3QK6A

Crystal structure of escherichia coli phnd
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
308
structure length
304
Chain Sequence
KALNFGIISTESQQNLKPQWTPFLQDMEKKLGVKVNAFFAPDYAGIIQGMRFNKVDIAWYGNLSAMEAVDRANGQVFAQTVAADGSPGYWSVLIVNKDSPINNLNDLLAKRKDLTFGNGDPNSTSGFLVPGYYVFAKNNISASDFKRTVNAGHETNALAVANKQVDVATNNTENLDKLKTSAPEKLKELKVIWKSPLIPGDPIVWRKNLSETTKDKIYDFFMNYGKTPEEKAVLERLGWAPFRASSDLQLVPIRQLALFKEMQSVKDNEQDKLAKTTAIQAQLDDLDRLNNALSAMSSVSKAVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PhnD, subunit of alkylphosphonate ABC transporter
publication title Structure of the Escherichia coli Phosphonate Binding Protein PhnD and Rationally Optimized Phosphonate Biosensors.
pubmed doi rcsb
source organism Escherichia coli uti89
molecule tags Transport protein
total genus 103
structure length 304
sequence length 308
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12974 Phosphonate-bd ABC transporter, phosphonate, periplasmic substrate-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.90 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3qk6A03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3qk6A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3qk6A02
1B40A 4R6HA 3KGCA 4NWCA 4GL8A 1R9LA 4BDMA 2XXYA 4JSDA 1VE4A 2NXOA 1SW1A 2ONKE 2ONRA 2DXRA 1PB7A 4GVOA 3EPEA 2XX8A 1NNFA 3RT6B 1B9JA 4X1BA 2VP1A 3H6TA 2IEEA 2YLNA 2H98A 4H0WA 3MQ9A 5BUUA 1URGA 4JDFA 4E0WA 3TUSA 2C5IT 5CC2A 4POWA 3H3GA 4QSCA 2XXPA 3G3KA 5ELVA 4YU0A 3N94A 1UTBB 4XKQA 1WDNA 5ICQA 2XXUA 3HV1A 4NWDA 3TTLA 1Q35A 4ECFA 4DE8A 4PE5B 4H5FA 4B6XA 1URSA 3IB1A 2CA5A 4G4PA 4KHZE 2WKYA 4QFLA 4EF2A 4KCDA 1MPDA 2FYIA 3K01A 5CMMA 5DVJA 2H5YA 1FQDA 3OOAA 3S9MC 3KN8A 2GHBA 2VD3A 3C35A 4QSDA 1MXXA 1II5A 5BWJA 2E1SA 5JTYB 2UVHA 4I1DA 2Z22A 1DTZA 1VFDA 4H67A 3H6UA 1H43A 1QULA 4ZECA 5FHMA 3K6WA 4FAJA 1J1NA 4FATA 3H06B 4LA9A 1B1HA 1Z7NE 4H1XA 3MZ9A 3WAEA 1JW1A 3MBPA 3TKDA 4OWDA 3PPRA 5DEXB 3N6TA 3IORA 3TTRA 3TTNA 1GV8A 4Z0IA 4ESXA 5H8QB 1FTJA 1PEBA 1JVYA 1WODA 4FEDA 4ZEBA 4G8HA 4Q5TA 5DVIA 3FIRA 2ZNSA 3M8UA 3THIA 5KZTA 2B3BA 1MQGA 2KWHA 3UA8A 2F7AA 5KDTA 2THIA 1JQFA 1US5A 3S4UA 3RNNA 3RY3A 1P1NA 2DE3A 3IK6B 4IGRA 2I3WA 2DXYA 4ZE8A 1N7XA 1ZKBA 5TU0A 3CSGA 2P2AA 1ZTYA 3LC8A 3V5AA 4G8NA 3CG1A 3SEXA 1B5JA 3VE1B 2Y7IA 3K0VA 4ZEKA 5I84A 1ZKEA 1RYOA 4RK2A 3BFUA 1DOTA 4DXBA 3OD7A 3M3LA 4NE4A 4GOTA 3IL1B 4WKMA 3OSRA 2R6GE 4THIA 3MWBA 4LQ2A 3LSFB 3SEVA 2QJEA 2HQ0A 3Q25A 1SW4A 2OZZA 3DLNA 1B3HA 2V3TA 2XXIA 1LVFA 2RCAA 1IJ6A 3FJGA 4N13A 3H4ZA 1NFTA 5A5XB 3T22A 5I56A 1MG1A 4DLDA 1B0LA 3MVWA 1SW5A 2X26A 2FNCA 1MQDA 1LAGE 1MY1A 5H8NB 3JV9A 3UIFA 3FV2A 3H6VA 3S2VA 1JNFA 2XD2A 4ZEFA 3OO9A 3MP8A 2Z23A 4F29A 5KCJA 1B5IA 5I56B 2Y7PA 3E4RA 3HPIA 2IA4A 4YZZA 3TODA 1N84A 1PB9A 4YB5A 3FJMA 5DYHA 2XTLA 4P11A 3FVKA 3RQTA 3KOTA 4IO4A 4YAHX 4NF8B 2I3VA 5KCJB 4QSEA 3ZKLA 2OJTA 1UTHA 2A5SA 2A5TB 3MZ1A 3QUJA 1AL3A 2H99A 4NF5A 2O68A 1AOVA 3S9NC 5AA4B 4TOZA 3PMWA 4IO5A 4GXAA 3MVZA 1Y3NA 2KLFA 4RPOA 2ZNUA 2C5KT 4OQOA 1B3LA 1LFIA 2F7CA 3O6IA 1QKBA 2O84X 5H8SA 5AA2D 3EHUA 2NOOA 1B1XA 2Q9TA 4U23A 3C4MA 4RPNA 1B52A 3ZKKA 1QSDA 4KPTA 4KQPA 1VR5A 1ELJA 5K2YA 4EQBA 1YPNA 2VOZA 4X1DA 1OIBA 5J1DA 4OFOA 4J2CA 4XKPA 4HW8A 1WVJA 4IB2A 5FTIA 1XVXA 3L6GA 1POTA 1Y20A 1RYXA 1IJ5A 3G3JA 3B6QA 1Z7ME 1MY2A 3ONMA 5CMKA 3U93A 4NF6A 3Q28A 4RK9A 2OCUA 1MPBA 3L6HA 3VDFA 3FV1A 1SD3A 2XX7A 4QFKA 3TAJA 1QJMA 3TTMA 2RC9A 2Y7RA 3SKPA 3CG3A 3K6UA 3SEYA 4GD5A 4POXA 2DVZA 3WAFA 1A7LA 1B3GA 3FXQA 4LATA 1I6QA 1BTJA 3N6UA 1XS5A 4M1VA 3A3UA 1SI0A 4U21A 3OSQA 4G77A 4DXCA 1IZ1A 5H8FA 2Y84A 2F35A 3MVYA 1I6BA 3KOSA 1M5CA 3M3FA 3VLUA 3O97A 5JEIA 4Q0CA 5AA3A 3UORA 2Z8FA 1MPCA 3RTFB 4AB5A 3BBRA 1OLAA 5TP9B 3B6TA 1B7UA 3ILTB 5L9OA 4NEDA 3C36A 3KJTA 4GFRA 2F6GA 1R9QA 4EUOA 4AB6A 4QHQA 2F7BA 1NL5A 2ABHA 1H76A 3T9VA 3B6WA 2GHAA 4U1ZA 1ZU0A 4ZE9A 3LBSA 1IITA 4QFOA 2DE4A 1FTKA 2DWIA 5F1QA 1GGGA 4YICA 3VLVA 4U1OA 1FTLA 1PB8A 1Y4TA 1YCJA 2XX9A 3C33A 1A8FA 4QFPA 4F3GA 3OXNA 3VXBA 3EHTA 1O64A 5I2NA 3H03A 1SBPA 2V93A 3SDFA 4F1VA 2I4BA 1DMBA 1N7WA 1KWHA 5EYFA 4JXIA 1MXWA 4OZ9A 3CVGA 1UTBA 1LAXA 2QS1A 3O6HA 3C32A 2V3QA 2OK2A 2RINA 5I57A 1LRZA 2O1LA 3QSLA 1MQIA 5I2NB 3MPKA 1MXYA 4F3SA 2NVUB 2DQVA 1B4HA 3FXDB 1AMFA 3K6VA 1XVYA 2E0SA 4R9FA 1B2HA 2O69A 4MLVA 4R6KA 5I57B 1ZJLA 1Y9UA 4X9TA 1LGBC 4F22A 3HHFA 5EHMA 3JYRA 4IO2A 5JTYA 3S9LC 1QUIA 3G3HA 3R6UA 4EDPA 2HAUA 2UVIA 3HO7A 1JW5A 3DELB 3QK6A 1D9YA 5LOMA 2QS4A 3HCQA 4YKKA 1XT8A 4IY6A 3O2AA 1TFDA 3D4CA 2PT1A 2X7QA 5I2KA 3SERA 3K6XA 3CSBA 3FJ7A 4XKRA 4AQ4A 2I0BA 2XXWA 5DEXA 2PVUA 3RTWB 2H25A 4LZ7A 5H8QA 3RUMA 5F7VA 3FXEB 1XC1A 4C1UA 1Z0PA 1MQHA 5I2KB 2D5WA 2UVGA 2I48A 2I49A 4OERA 4H65A 1A54A 2RC8A 1EZOA 4GXSB 2HEUA 4R6YA 3VVEA 2ZYOA 2Q2CA 4G68B 1MS7A 1CB6A 4GIZA 1MRPA 1FCKA 1SYIA 3IO4A 1CE2A 2DWAA 3W9VA 1NNTA 4IO6A 3DP4A 4RJZA 1XHYA 1Y3QA 2OWSA 3FVNA 3OELA 1USYE 4QRZA 1R1NA 3KEIA 4NF4A 2ZYKA 3KN7A 4GQOA 3I5OA 3IOTA 2REJA 1MY0A 4KFQA 4MF3A 4PFTA 1TFAA 1SI1A 2ZYMA 2HCAA 1LLSA 4NF4B 5L9SA 1NNPA 2XD3A 1OQHA 5CBRA 4DCXA 3AXFA 1MXZA 3GLBA 2UXAA 4JWYA 1Y3PA 3VVFA 1A8EA 4OFJA 1SW2A 1I69A 3OMBA 2X9WA 1XOCA 3CFZA 4IY5A 2B65A 1IIWA 1P99A 5CMBA 3T96B 5A5XA 1UIUA 2ANJA 1MH3A 1QUJA 3O9PA 4MFIA 4FECA 1QKAA 3PD9A 4BDLA 5ITOA 3K1MA 2IC6A 4OXVA 1IXGA 3G3GA 4EF1A 1BP5A 5DTBA 5H8NA 3OENA 2AIXA 3U92A 4GLIA 4UACA 4FEBA 5B70A 3O29A 4OETA 4R9GA 1SDXA 4P0IA 3FD3A 1S50A 2AL4A 4YB6A 3A09A 3FATA 2AYSA 4F3PA 4CQIA 2D3IA 4EQ7A 2VGQA 2K48A 3PU5A 4TQUQ 3GBBA 4Q8RA 3PD8A 2DVCA 3PPNA 1N0TA 1N76A 5CMCA 3ZSFA 4G2ZA 4NF8A 3LR1A 3TQLA 1LFHA 1NKXA 4E0XA 1MDQA 2HZLA 4F31B 2A5TA 2I0CA 4OEUA 1M5BA 4IO7A 5AA4A 1B58A 2OLBA 1Y1ZA 2QS2A 3K4UA 3OEKA 4OENA 1EH3A 1MY4A 5IAIA 3W15C 4PFWA 3F11A 4NMYA 1B3FA 4RXLA 4HS7A 4C0RA 4H8JA 2OWTA 3PPQA 3LUYA 2AL5A 4MLQA 2GH9A 4LVQA 3RLFE 5H8HB 5HPQA 3T66A 1B51A 4ZEIA 1ZLQA 2RKMA 3SETA 2DSFA 4F2QA 1EU8A 5ITPA 3FXUA 1P1OA 1OVTA 1M5FA 3IB2A 3Q29A 3TELA 4U4SA 4XXUA 3S9EA 2DYXA 3K1NA 3MPLA 3IAZA 3PUWE 3VXCA 4LONB 1A55A 5K2XA 5AA1A 1Q1KA 4U4XA 1POY1 1GR2A 1IXCA 1B7ZA 3VVDA 4ELRA 5FHOA 2D21A 1A99A 1BIYA 1LB8A 2CMOA 1ZIUA 3EQ1A 3MJNA 2ESNA 4H8IA 4M4GA 2Q2AA 3QYTA 3MUQA 3IX1A 3E9XA 2PT2A 3U1OA 3IJXB 3CR9A 3OO7A 2PX1A 3PPOA 3PUZE 4DIGA 1O63A 1ZMGA 3Q26A 3LSXA 4R73A 2G29A 4PFUA 5L9MA 4F2OA 5EHSA 1PC3A 4L17A 2ZXTA 3MZBA 1FTOA 3UK4A 3KZGA 3RN8A 5JK4A 2HXWA 1US4A 4KYDA 1P1WA 3PUYE 1MDP1 5TP9A 4ZS9A 3FVGA 3KBRA 5B7DA 1MM6A 3Q27A 2NWJA 1OQGA 4WEDA 4LP2B 4KR5A 1LCFA 1R6ZA 4ZZAA 1DPEA 2UYEA 3TQWA 3EN3A 1LAHE 1FQEA 1UIVA 2G93A 2F34A 1IXHA 3C9HA 4RY1A 1MXUA 4HCYA 5I58B 3P7IA 4KD5A 4H5GA 3VFJA 4ELOA 1MQJA 3U8QA 4G68C 1LAFE 1LSTA 2F97A 2Q88A 5AA2B 2PBWA 4YMBA 3FASA 3R7XA 3IJOB 3GZGA 1URDA 2PYYA 4BLAA 4JWXA 2XXHA 3FUZA 2YJPA 1ANFA 4JBZA 3VLWA 3PUVE 4FI5A 1NH7A 4I62A 1PBPA 1Y1MA 3PGFA 5HM4B 4YMAA 4BDQA 1FQFA 5IKBA 4OTEA 5L8DA 1OMPA 4DDDA 1TT1A 5CI5A 1IUDA 4LZ8A 4RNSA 4TLMB 3TYHA 3E13X 4R75A 4GWOA 4DCYA 4RYAA 1VSOA 1IEJA 2YPNA 1EZPA 5CRYA 1YTVA 4XKNA 1S9TA 4I9DA 2F78A 3SESA 1D4NA 3ZS6A 3KG2A 4R2BA 4PFYA 4R2FA 4BDOA 4KYEA 4YB7A 3PV0E 2I4CA 2OBGA 2Q89A 3CFLA 4ZEDA 4LQ5A 3HN0A 1TXFA 2ONSA 2QS3A 2ZYNA 1JEUA 2X7PA 4RA1A 3M3KA 4F1UA 2RCBA 4ZDMA 3HHGA 4F19A 3GXAA 5CM6A 1BKAA 4PP0A 2RF1A 1USYH 2F6PA 3K1PA 4XTCQ 3MP6A 4FE8A 4K3FA 2B3FA 3QXMA 3KJ7A 3RT8A 1N3XA 1IXIA 1B4ZA 1UQWA 5FTHA 4HCWA 4OMBA 3PUXE 3TCHA 1MM7A 1JEVA 2V3UA 4ONYA 2W7YA 2UYFA 3TFLA 4ZZEA 4G68A 2H9BA 3VV5A 4F1YA 2F36A 1HSEA 4FIMA 4KCCA 3T9XB 1SYHA 3CI8A 2P0SA 2DP8A 4WXJA 3CKDA 2HAVA 1QVSA 3IOWA 3FVOA 2V84A 5M2VA 1A40A 3USDA 5FHNA 2R71A 3E3KA 5ICTA 3C34A 4Q30B 3UN6A 1D9VA 3O28A 2FA7A 1N3WA 1OVBA 1DSNA 2XXTA 1HSJA 3I6VA 3B7DA 4PQJA 5TPAA 2DWHA 3TZAA 2QL3A 2XXQA 2QMWA 4G8MA 5DVFA 1FQCA 4OESA 2GFEA 3IOUA 2O7UA 3G7WA 3RGYA 2X9XA 5TPAB 2VHAA 1NMUA 3V8XB 4Z7EA 4HTGA 2IC9A 1B3EA 2O1MA 5I59A 4KI0E 3G3FA 1B32A 3CRBA 5KDTB 5ISUA 4JWOA 2R9JA 1AIVA 3MXZA 4IO3A 4TLLB 5AE4A 4F18A 1RKMA 3A3CA 1B5HA 2Y7WA 2VD2A 1LBCA 5I59B 1OLCA 3LSWA 1P1QA 2G0UA 3T93B 1QUKA 3ODBA 2QPQA 4WEPA 2HZKA 4R74A 3MVXA 3TEPA 1YAEA 4BDRA 2Z8EA 2H4IA 1H45A 4N6PA 3IO6A 4R72A 1B46A 4GL0A 1HSLA 1DTGA 3DP6A 3BKIB 4EYYR 1FQAA 4ISUA 1T0KA 3UP9A 4MH5A 2O51A 2MBGA 2P1SA 4EXLA 2DS9A 2QRYA 4U2RA 4GRKA 2F8DA 4U22A 3QIMA 1QW0A 3H7MA 4GF8A 1B6HA 1AH5A 3GBAA 1BLFA 2DOJA 3MC2A 2I58A 3CFXA 4LUBA 3K00A 1ZBMA 3G3IA 3ECRA 4XIGQ 4JB7A 1Y4CA 5H8HA 1FQBA 3TCGA 1H3DA 3JZJA 4ND9A 2C5JA 4EXKA 4O3BA 3OO6A 2XXRA 2ALUA 1NNKA 1LFGA 3QUFA 4F39A 3U94A 2KWIB 1PDAA 1MY3A 3PPPA 3U72A 2GRVA 3TPAA 2V25A 3TDJA 3O66A 2F5XA 3BFTA 3I3VA 2Q8JA 1P1UA 4OEVA 3TMGA 3KSJA 4O3CA 1GTKA 2QSXA 1LCTA 2XXXA 3L3PA 1UTHB 3LSLA 4JSOA 3KN3A 4NF5B 1H7CA 2I6EA 2REGA 1SVXB 3R26A 2BJJX 2Y7KA 1LB9A 1JW4A 3KSXA 1M5DA 4LZ5A 2XHDA 4KYSA 3W9WA 1H44A 3MAMA 4ELQA 1I6AA 3N5LA 3HSTA 1B7HA 4YKPA 1D3KA 4OFLA 3UGWA 4BDNA 3DP8A 4UA8A 4DXUA 5HBCA 3TCFA 4DNDA 1O7TA 2DE2A 1S7YA 3MP1A 3DM0A 4F3BA 3K02A 4IGTA 1TWYA 4H6DA 1MXVA 3EF7A 4DZ1A 3FZVA 4FJPA 3C31A 1GVCA 1ATGA 4QF9A 3K2DA 4C1TA 4FORA 3KFMA 4L0RA 4YKJA 3OO8A 1N04A 3EHSA 1LBBA 5CBSA 5I58A 3H6WA 4ESWA 3T9UA 1EZ9A 3IB0A 4NF6B 2QMXA 4PETA 3PMVA 5AA2A 1L5TA 3SEUA 2ZNTA 2ZMBA 2DWJA 2O7IA 1DPPA 2XXVA 1F9BA 4MBPA 2Z8DA 3D4GA 4OVJA 2O6AA 1NH8A 2PMSA 4I8CA 1B0HA 5DT6A 3V83A 3V89B 3TKLB 2LAOA 4NTLA 2UVJA 4OHNA 2HFBA 1SQYA 4QFNA 1VFEA 2RC7A 3MW0A 3ILUB 3FGSA 4X48A 4EQ9A 4O3AA 4P0GA 5H8FB 3N26A 1FW0A 1JVXA 1IQ7A 4N07A 1FTMA 4ELPA 3T9HB 3CIJA 1PBQA 3FXRA 3CVRA 1B05A 4OYVA 1JETA 3PMXA 2M8CA 1M5EA 3SEWA 4YKIA 3O6GA 2X9YA 3TTKA 3RPWA 2NUVA 3IR1A 3OEMA 1MH4A 3IOVA 2CZLA 3QAXA
chains in the Genus database with same CATH superfamily
4IL9A 1B40A 4R6HA 4HEAA 4DV7T 3KGCA 4NWCA 4GL8A 3PDYA 1R9LA 4BDMA 5LHHB 4P0BA 2XXYA 4PK4A 4JSDA 3BQKA 1DBZA 4DCYA 1VE4A 2NXOA 4HFIA 2XUEA 1SW1A 2FIXA 2ONKE 2ONRA 2DXRA 1PB7A 1MNDA 4GVOA 5ESYA 3EPEA 3E22E 5HAXA 5CGMA 4I50E 1YD8G 2E9XB 3RX6A 1NNFA 2XX8A 4OVRA 3RT6B 2XWVA 4CI1B 1B9JA 5A1LA 1DCUA 4GWUA 4H9QC 4JI0T 4X1BA 4MBQA 2VP1A 3H6TA 1ZV4X 2IEEA 2YLNA 3WAJA 3BK9A 2H98A 1INPA 4H0WA 4YSXA 2XWOA 3MQ9A 2V6YA 5BUUA 4YY3T 4TN7B 4GX4A 5L3CB 2CXFA 2VK9A 1URGA 4U7IA 4JDFA 5F24A 4E0WA 3AE3A 3TUSA 2C5IT 5CC2A 4POWA 4QXCB 3H3GA 4QSCA 2XXPA 3ZCJA 5HEOA 4EB6E 4B3MT 4ASKA 3G3KA 5ELVA 4YU0A 5FVLA 3N94A 4WBNE 1UTBB 1NI9A 4XKQA 4AIUA 3EHZA 2CEXA 1WDNA 2MPKA 3ETVA 5ICQA 3RC8A 2XXUA 4O2BE 3HV1A 4NWDA 2Q9QD 3TTLA 1Q35A 4ECFA 3MACA 5LBMA 3F2EA 3LDQB 3N9MA 4DE8A 4PE5B 5AQHB 4H5FA 2KQZA 3OKQA 4NG7A 5ET7A 4CXXA 4B6XA 1URSA 3IB1A 2CA5A 4G4PA 4KHZE 4E7ZA 2WKYA 4QFLA 2LM2A 4EF2A 1FBPA 2A72A 4KCDA 5DW8A 1BR4A 3ANWB 1MPDA 2FYIA 3NOHA 3E79A 2IIUA 3K01A 5CMMA 5DVJA 2H5YA 1FQDA 3OOAA 3S9MC 3KN8A 2GHBA 3AEGA 1XMQT 2VD3A 3C35A 2PBIA 4QSDA 4K0KT 1MXXA 1II5A 5BWJA 2E1SA 5JTYB 4JI8T 4QX8B 2UVHA 3FBPA 3FZMB 4I1DA 4CN1A 2Z22A 2V7IA 2ODUA 1DTZA 1VFDA 4H67A 1RDYA 4XF5A 2I59A 3H6UA 2WAUA 1H43A 1QULA 4ZECA 3EI0A 2DWGA 4IDNA 5FHMA 3K6WA 4FAJA 3RYIE 4X04A 1J1NA 4XBFB 1D0XA 3LJCA 4ERRA 4FATA 4DI3D 3H06B 2Y6XA 4LA9A 4N17A 1B1HA 2I0MA 4OVTA 4AS5A 1Z7NE 4H1XA 4FBPA 3SS1A 3MZ9A 3WAEA 1WYBA 4I43B 2WBBA 2XQ5A 3HKBE 1JW1A 3MBPA 3PU8A 2B4LA 3TKDA 1UURA 4OWDA 3QB5A 4IE6A 3ZPOA 3PPRA 5JDGA 5DEXB 4H9SE 3N6TA 3IORA 2JMKA 1OEDC 3TTRA 3VU7H 1FRPA 5LMUT 2ES0A 3TTNA 3NKZA 2QVRA 1GV8A 4Z0IA 4ESXA 5H8QB 1FTJA 1J1JA 4PC9A 2FJBA 1PEBA 2LSGA 1JVYA 1WR6A 2V7MA 1WODA 3CPZA 4FEDA 4DUZT 4JVDA 1SHZC 5DQWA 4ZEBA 4X1KE 3P8CD 4G8HA 5ADXL 4Q5TA 5DVIA 3FIRA 3N2OA 1HF8A 2ZNSA 2ZLYA 3M8UA 1JP4A 3ZT7A 3THIA 3AEDA 5KZTA 1L0VA 2B3BA 3UU4A 4ZI3D 1MQGA 2HXRA 2KWHA 2KT9A 5EQ8A 4DBRA 3UA8A 2F7AA 4HWFA 5KDTA 5JRCA 4TWFA 2THIA 5HEUA 1JQFA 4NHBA 4F8HA 1US5A 4TNVA 2N2NA 1I94T 2H3RA 3I1AA 3S4UA 2V7JA 5LMNT 1IBLT 2XAHB 3RNNA 2BKPA 4O7IA 1HX8A 1NEKA 3KINB 2VPOA 2BZBA 5LYJE 2ACXA 1SUMB 3RY3A 1P1NA 2VT5A 2DE3A 3IK6B 3CK6A 4IGRA 2I3WA 2DXYA 3UU5A 4ZE8A 4MAGA 5LNKA 1N7XA 1ZKBA 5IGAA 5TU0A 3CSGA 1LKXA 2P2AA 3T1YT 2XM2A 3AA1B 4YTNA 5AQKB 4O7MA 1ZTYA 3IFCA 2MKZA 1HX1B 2L5VA 3LC8A 3V5AA 4HWIB 4G8NA 1IMFA 1FPJA 3CG1A 3SEXA 3ZEFB 1X79A 1B5JA 3VE1B 4QX7B 1YQ4A 2VKHA 2Y7IA 3AA0B 3K0VA 4N8GA 4ZEKA 2FJDA 5I84A 1ZKEA 2K5BB 2UUCT 4CN6A 1RYOA 4RK2A 2F3DA 3NZQA 3BFUA 4HFVA 2X66A 1DOTA 4DXBA 3OD7A 3FHNA 4UVBB 4MJOA 3M3LA 4NAPA 2OLTA 4GOTA 4NE4A 4XFEA 3IL1B 1IBMT 2PFYA 1XDPA 5JDNA 2PTFA 2R6GE 3DP7A 3AXJA 3OSRA 4THIA 4WKMA 3JAFA 2WBDA 2WYPA 3MWBA 3KV6A 4LQ2A 3GN5A 3AA6B 2X0HA 1LBVA 3NRYA 3LSFB 3SEVA 2KNDA 4EIWA 4OVSA 3ZYMA 2P9BA 2QJEA 2NTXA 2HQ0A 3Q25A 4H9OC 1SW4A 2OZZA 3DLNA 1B3HA 2V3TA 2ZZVA 5LGUB 4IE5A 4P1EA 2XXIA 1LVFA 4LFCT 5LJMA 2HPJA 2NR4A 2RCAA 4DR4T 4NGUA 1IJ6A 1FBHA 3FJGA 1YKHB 4N13A 3B8BA 4UF0B 1NFTA 3H4ZA 3T22A 3K1SA 5A5XB 5I5PA 1MIWA 5ABFB 1MG1A 5C8YE 4DLDA 5I56A 1B0LA 3MVWA 5L4EA 1SW5A 1XWMA 2CZIA 2X26A 1NV0A 2FNCA 4UV8B 2PCRA 5FXWA 1MQDA 1LAGE 1MY1A 1LEVA 5H8NB 3PURA 2V6XA 3FZLB 3JV9A 1OEDA 2UXBT 3MYUA 4JVIA 4PDDA 3UIFA 3FV2A 2HPLA 3H6VA 3ZMVB 3ZMUB 5CFBA 1JNFA 2F3BA 2XD2A 4ZEFA 3S2VA 3OO9A 3MP8A 3ZMSB 2Z23A 3ZCIA 4F29A 5KCJA 1B5IA 5L3GB 5I56B 1D1BA 2NP9A 2Y7PA 2A9UA 3E4RA 3A7MA 2LOPA 3HPIA 4NQ8A 4JBWF 2IA4A 4YZZA 2CCQA 2XAQB 3O1HA 2Y8DA 4PE3A 1K9YA 2JQHA 4U31A 3TODA 5LDZA 4AQFC 1N84A 1PB9A 4YB5A 5IWAT 3FJMA 5DYHA 2XTLA 4P11A 3CX7B 3FVKA 3RQTA 3KOTA 2CMRA 4IO4A 4YAHX 2VWAA 4DV4T 4NF8B 2I3VA 4JI2T 5KCJB 2XSBA 4QSEA 4UV9B 3ZKLA 2OJTA 3CQCB 1UTHA 2A5SA 2A5TB 3MZ1A 3QUJA 1AL3A 4PBQA 2H99A 4NF5A 2O68A 4JV5T 1YYZA 2WQYA 1AOVA 3S9NC 5HEGA 3Q5WA 5AA4B 4PK6A 3FBLA 4TOZA 4DV1T 3PMWA 4IO5A 4DI4B 4ZI2D 4GXAA 3MVZA 5LG4A 3UQ4A 5EQAA 1Y3NA 3ZYKA 2KLFA 4RPOA 3T1BA 2ZNUA 2NW7A 2C5KT 2CHOA 4OQOA 3FXBA 3B13A 3VHLA 2M67A 3NWIA 1B3LA 1LFIA 4TV9E 1HS7A 2F7CA 4EAHA 3O6IA 3SFDA 1QKBA 2QA7A 2O84X 1VRBA 2BVMA 5H8SA 1YZ0A 5AA2D 3EHUA 4X8RA 5LCYA 2NOOA 1B1XA 4E7SA 2WDRA 2Q9TA 4P3LA 4YHHT 4U23A 3C4MA 1M7KA 4RPNA 3GA8A 3RPLB 1B52A 3ZKKA 1I6ZA 3EAMA 1QSDA 4KPTA 4KQPA 2CXDA 1VR5A 5AQFB 1ELJA 2C0SA 3IHRA 5K2YA 4EQBA 1VDWA 1YPNA 2E8IA 2JJ9A 4KHPT 2VOZA 4X1DA 2ACZA 3FZHB 3HL6A 1OIBA 4ISSA 5J1DA 4OFOA 2ZZXA 4J2CA 4XKPA 4HW8A 1WVJA 4XZCA 4IB2A 5FTIA 1XVXA 2HN2A 2OA5A 3IEEA 1BR0A 3RIUC 1POTA 1Y20A 3L6GA 2I6HA 1RYXA 4GBWA 1IJ5A 5JDLA 4HWHA 5AQGB 3G3JA 4N15A 4EV6A 2DHRA 3B6QA 1Z7ME 2NW9A 2SPCA 1MY2A 5L3DB 3BIHA 3B57A 3ONMA 2J62A 5CMKA 1J5WA 3U93A 5LTCA 4NF6A 4UELA 3Q28A 4RK9A 2OCUA 1MPBA 3L6HA 2VB6A 3T0JA 2XA5A 3RYDA 4U33A 3VDFA 2VKJA 2NWBA 3FV1A 1SD3A 2XX7A 2W62A 4QFKA 1QJMA 3TAJA 2RC9A 3TTMA 2RP4A 2Y7RA 3ZT5A 3B50A 3N9QA 2KZ7B 3CG3A 3K6UA 3SKPA 3JC6D 2UUBT 3SEYA 3ZJ2A 4LF6T 4NF0A 4GD5A 4OA4A 4POXA 2E9XD 2DVZA 3WAFA 4DVDA 1A7LA 1B3GA 3FXQA 4LATA 5FYMA 3EABA 3PUSA 1I6QA 1BTJA 3E78A 3KC1A 2WSSV 3N6UA 1XS5A 4IREA 4M1VA 1N36T 3A3UA 1SI0A 5ETWA 4U21A 2VQFT 2ZZWA 3OSQA 4G77A 1CUNA 4DXCA 4YJ2E 1NV7A 2VURA 1IZ1A 5H8FA 4EZ4A 4AQFA 2CM0A 1FPLA 2Y84A 2F35A 3MVYA 1YXIA 3RHWA 3ONXA 1I6BA 3KOSA 1M5CA 2XQ6A 4NX1A 1Y01A 5IZ3B 4C90A 3KC0A 3M3FA 3VLUA 4G2AA 4IE4A 3MSTA 3O97A 3J7Yq 1FEWA 5JEIA 2BBHA 5CA0E 4PFBA 4B3RT 1MMNA 4Q0CA 4AI6A 3P4WA 5AA3A 2LRLA 3UORA 2Z8FA 2BKNA 1MPCA 3RTFB 4AB5A 3BBRA 5J0ZA 3SFEA 1OLAA 5TP9B 2W0GA 3B6TA 4O4HE 1B7UA 3O4XE 3ILTB 5L9OA 1FPKA 2CXLA 4H9PC 2YK0A 4NEDA 3I9YA 3KBTA 3L09A 1KZ8A 3C36A 3KJTA 2LM9A 4GFRA 4PAIA 4DBQA 2F6GA 3W15B 1R9QA 4BA9A 3OTOT 5AQQB 3HI2A 2HPGA 4EUOA 3AAEB 4AB6A 4O4IE 4QHQA 3CHGA 2F7BA 1NL5A 2LJLA 2K24A 2ABHA 3MZKB 1H76A 3T9VA 4TNWA 3B6WA 2GHAA 5LG3A 4U1ZA 1ZU0A 5J2TE 4ZE9A 4DR5T 1VOMA 3J9X1 3LBSA 1IITA 4GX3A 4UXNB 4QFOA 2B1EA 2DE4A 1FTKA 5JDHA 2DWIA 4ZS3A 5F1QA 1GGGA 2DDKA 4YICA 3VLVA 4U1OA 5CJ5A 1FBDA 4A98A 1FTLA 1PB8A 2QGSA 3RYHE 1Y4TA 1YCJA 4HE2A 1MMDA 1KNRA 2W2UA 2XX9A 1FJ9A 3C33A 1A8FA 3AB3B 4QFPA 4F3GA 3OXNA 3VXBA 2DCFA 4HKAA 2R6GF 1O64A 3EHTA 5I2NA 1HNWT 2LHNA 4QH5A 3H03A 1SBPA 2V93A 1D9QA 2XAJB 3SDFA 4F1VA 2I4BA 5A5LA 1DMBA 1N7WA 1KWHA 2WYKA 4GWYA 1AJ3A 4KBMB 2GK9A 5EYFA 1MMAA 4JXIA 1MXWA 4OZ9A 3CVGA 2P3VA 1G0IA 1UTBA 5FXZA 4PFIA 1LAXA 3RIUA 2QS1A 2L8KA 3O6HA 3AEAA 5FNVE 2Y5LA 3C32A 4I3EA 2V3QA 2OK2A 2RINA 5I57A 1LRZA 2O1LA 5L3FB 2XPKA 2MTQA 2ZM6T 3UQ7A 1FPDA 3QSLA 4MIJA 1MQIA 4JI3T 5I2NB 4HN9A 3MPKA 2LSJA 1FBEA 2BKOA 2IMLA 1MXYA 2WY2A 4F3SA 2NVUB 2EHOB 3MK7C 2DQVA 1B4HA 3FXDB 1AMFA 5FXXA 3K6VA 1XVYA 4NUVA 2E0SA 4R9FA 3ANWA 1B2HA 2O69A 4MLVA 2L9QA 3AEFA 4R6KA 5LOVE 2CE7A 3IA3A 5L4HA 1U4QA 5I57B 3HFUA 1ZJLA 2XWIA 1Y9UA 2WEFA 4X9TA 3GWHA 1LGBC 4F22A 3HHFA 4O8MA 5EHMA 3JYRA 4IO2A 4IDZA 3A29A 2IAKA 5JTYA 3S9LC 1QUIA 5EYHA 4AKRB 3G3HA 3R6UA 4U2ZA 4EDPA 2H89A 2YINA 5EK2A 2HAUA 2UVIA 4PBHA 5T3JA 3MA9A 4DV3T 3HO7A 2FVZA 5H6QB 1JW5A 3DELB 3QK6A 5JREA 1D9YA 5LOMA 4HFEA 2QS4A 3FB2A 1NV6A 4GIWA 3HCQA 2H7VC 4YKKA 1KFYA 4WZXA 1IMCA 1XT8A 4IY6A 3O2AA 1OEDE 1TFDA 1HNXT 3D4CA 1OXZA 2PT1A 4NXMT 2X7QA 5I2KA 3SERA 4COFA 4YTMA 4QH1A 3K6XA 5FY0A 4PK5A 3CSBA 3FJ7A 4IT4A 4XKRA 3OJAA 4AQ4A 2QYWA 2I0BA 2XXWA 5DEXA 2PVUA 5HXCA 3RTWB 4YT0A 2H25A 5IYZE 4I55E 3SOLA 4LZ7A 3ZLIA 3CMLA 5H8QA 3RUMA 5F7VA 3FXEB 2JMHA 4WW0A 1XC1A 4C1UA 3UUXB 2VPNA 1Z0PA 1MQHA 5I2KB 3RYFE 1IAPA 1FPEA 2D5WA 2UVGA 2I48A 3QB5K 2I49A 4OERA 4H65A 1A54A 2RC8A 4DMWA 3FZKB 1EZOA 3ZC0A 5JDFA 4GXSB 3I0OA 2HEUA 5EYGA 2DNXA 4MHCA 4R6YA 2VKOA 3VVEA 3A8YC 4MMPA 2ZYOA 1YXRA 2Q2CA 2F4VT 4A56A 5LXTE 4G68B 2VKDA 4QH4A 1JNRA 1FIOA 3JAEA 1MS7A 3MJXA 4OYJA 1CB6A 4GIZA 3PUGA 1MRPA 1FCKA 1SYIA 3IO4A 3VR8A 1CE2A 2DWAA 1MMGA 5JTGA 4GBVA 4LFAT 2VASA 3W9VA 4O2AE 1NNTA 4IO6A 2OV9A 3RQUA 3DP4A 4RJZA 1XHYA 2IW5B 1Y3QA 4LFBT 2OWSA 3N2GE 2UU9T 4CXWA 3FVNA 3OELA 4PGNA 5HXRA 2LSKA 1USYE 3R84B 2LSYA 4QRZA 3ZJ1A 3TLVA 1UK5A 1KK7A 1R1NA 4JYAT 3KEIA 3AECA 2XHEB 4NF4A 2ZYKA 3KN7A 5HEJA 4GQOA 4IE0A 3I5OA 2AXDS 2YDSA 1MIVA 1SE7A 4ISTA 3IOTA 2REJA 1U5PA 1MY0A 4GOUA 4OANA 4NPPA 4KFQA 4MF3A 2CWOA 1LBXA 1UX5A 4GWSA 4PFTA 1TFAA 2HHHT 2D0TA 1SI1A 4U2YA 3BIGA 4ZZCA 1NUXA 1W09A 4PJMA 4JLEA 4P9KA 4CN4A 3DTOA 2ZYMA 1QUUA 4PAFA 2HCAA 2Q9QB 5EK4A 3I9WA 1FJGT 1LLSA 4Z8XA 4NF4B 5L9SA 3ETUA 3KV9A 3SZPA 3VRBA 1NNPA 3F57A 2XD3A 3O1IA 1OQHA 1E2AA 5CBRA 3P4PA 2K9AA 2XASB 3AE9A 4HE8A 3O9XA 4DCXA 3U78A 3AXFA 1MXZA 3GLBA 2UXAA 4JWYA 1Y3PA 3VVFA 1A8EA 1S35A 3UU3A 4OFJA 1SW2A 3EKIA 1I69A 3OMBA 4DR3T 3AA7B 2X9WA 1XOCA 3CFZA 2BG9B 4IY5A 2X51A 1LBWA 2B65A 5HXHA 1IIWA 1P99A 5CMBA 4UF0A 3T96B 5A5XA 1UIUA 2ANJA 1MH3A 1QUJA 5ABFA 3O9PA 4MFIA 3K8PC 4C91A 4FECA 1QKAA 3P4QA 3PD9A 5JDMA 4BDLA 4EQ9A 4H9RC 2XM1A 4YSZA 5ITOA 2V8SV 3LUZA 3K1MA 4H9NC 2IC6A 5HWXA 5HWYA 4ADZA 4OXVA 4N4UA 1IXGA 3G3GA 4Z90A 4EF1A 2BBJA 4IGUA 1BP5A 5DTBA 5H8NA 1D0YA 3OENA 1XDOA 4UEMA 2AIXA 3U92A 4GLIA 4UACA 4DR6T 4FEBA 4AQGA 2WX9A 5JR9B 3O29A 5B70A 4QXHB 4P09A 1NV5A 4OETA 3P4SA 4R9GA 4KX6A 1SDXA 4P0IA 3FD3A 1S50A 4PFPA 2AL4A 4YB6A 4ZHQE 3A09A 3FATA 2BS3A 4LF9T 2AYSA 4F3PA 4KMCA 4CQIA 2D3IA 4EQ7A 4AQYT 1NV4A 4WBOA 4EEBA 2VGQA 2NW8A 2K48A 4O4JE 3EUHA 2FBPA 3PU5A 4TQUQ 3GBBA 3AAAB 4Q8RA 3PD8A 2DVCA 3PPNA 1N0TA 4N6KA 5JQGE 1N76A 5FY7A 1G0HA 2MAWA 3NBXX 4CZZB 4EYUA 5CMCA 5JH7E 3BQIA 3ZSFA 3H3AA 4G2ZA 3BQLA 4NF8A 4DIDB 3LR1A 5CA1E 4GX6A 3TQLA 1KF6A 1NUYA 1LFHA 3LBXB 1NKXA 4E0XA 1MDQA 2HZLA 4F31B 2A5TA 2I0CA 4OEUA 2KMFA 2W61A 2Z6EA 1M5BA 4IO7A 4FJOA 4N78D 3RRWA 3IBPA 5AA4A 1ZEEA 3VKGA 1B58A 4TWHA 2OLBA 1Y1ZA 2QS2A 3K4UA 3OEKA 2V7LA 4AKLA 2V26A 4OENA 3RGLA 3AE2A 1EH3A 2XAGB 1MY4A 5IAIA 3W15C 4PFWA 3F11A 3ZSTA 4NMYA 2PFVA 3KV4A 1B3FA 1GQEA 4HS7A 4RXLA 1JNZA 4WNKA 2WB5A 4LN5A 4C0RA 1WFDA 4H8JA 2OWTA 3PPQA 3LUYA 3RKGA 2B76A 3RYCE 2AL5A 5C3JA 4JI6T 3ROJA 4JUYA 4HWCA 2V5CA 2BDEA 4MLQA 2GH9A 4LVQA 3RLFE 5H8HB 4I40A 4MEVA 5HPQA 2V5DA 3T66A 1B51A 4X48A 4YTPA 3M65A 3ZYLA 4ZEIA 3ZC1A 4ZEYA 3LK42 4TZ4C 1ZLQA 2FUPA 3RPLA 3IF8B 5AQOB 2RKMA 3HKDE 4N8YA 3SETA 2LT3A 4QWNB 2DSFA 4F2QA 1EU8A 5ITPA 3FXUA 2JRKA 1P1OA 5JVDE 5AQLB 4NN3A 1E7PA 1OVTA 1M5FA 3IB2A 4EOZB 4X5TA 2V4CA 3Q29A 3TELA 3OVUA 2UXDT 3FBZA 2CEAA 1D1CA 3L8RA 4U4SA 4XXUA 1HTJF 1IZNB 3KBUA 3S9EA 1UUSA 2DYXA 3K1NA 3PTYA 3MPLA 3IAZA 3A5XA 3PUWE 3VXCA 3K3QC 4LONB 1A55A 4IR8A 3AAIA 5K2XA 1WCRA 3N9PA 5AA1A 1Q1KA 4U4XA 4CI2B 1POY1 1GR2A 1IXCA 4DV5T 4IIJE 1HG2A 1YW0A 1B7ZA 3C4WA 3VVDA 4LMKA 4XEQA 4ELRA 3AE1A 2YEVC 5HXEA 4UR9A 4IHJE 5FHOA 2D21A 4ZI7E 1A99A 3VR9A 2EHOC 2J47A 1BIYA 1LB8A 2CMOA 1SPIA 3AE8A 4OFZA 2LSIA 1ZIUA 2RA1A 3G06A 3EQ1A 5CB4E 3MJNA 2ESNA 1B7TA 4H8IA 2JIWA 4ILAA 1BK4A 4M4GA 3Q2MA 5JDQA 2Q2AA 3QYTA 3MUQA 3IX1A 4NIQA 1EZ3A 3E9XA 2XQAA 2KLQA 3C4XA 3RH3A 2PT2A 3N9LA 3U1OA 1HFAA 1W0BA 3IJXB 3CR9A 4JVCA 2V1DB 3OO7A 2PX1A 4HE0A 3Q5XA 1XZYA 1T72A 3UU6A 2D9DA 2KR0A 4H63V 3KV5A 3PPOA 3PUZE 1FBGA 4DIGA 2DWKA 4QXDA 4KXPA 1O63A 4QKNA 4A5XA 1ZMGA 3Q26A 3AE6A 5H6RB 1EYKA 3LSXA 3OYXA 1ZHCA 4R73A 2G29A 4PFUA 4PW8A 5L9MA 4A97A 4F2OA 5EHSA 3KVAA 1PC3A 4L17A 5IZ3A 2ZXTA 3MZBA 3P4RA 1FTOA 1FPBA 5LGTB 3UK4A 3KZGA 3RN8A 5JK4A 3T1HT 1O3XA 2HXWA 2K3WA 3U3IA 1US4A 3Q9DA 4KYDA 1P1WA 3PUYE 3M3ZB 4I0UA 1MDP1 2EHOD 5AQVB 5TP9A 4ZS9A 3Q5DA 3FVGA 3KBRA 2XXKA 1QLBA 3UUMA 2FIEA 2CLYB 4PFOA 1RDZA 1XNRT 2J1DG 2D0UA 4PAGA 4MHFA 3AE5A 2BJIA 3UT5E 1MM6A 5B7DA 3Q27A 2NWJA 1CNQA 1OQGA 4WEDA 4LP2B 3PUAA 5EZYE 4TV8E 2XQ7A 4BAYB 1LCFA 4KR5A 1R6ZA 3CX8B 4ZZAA 4GYRA 4P0AA 1DPEA 2UYEA 2V7KA 3TQWA 3EN3A 1LAHE 1FQEA 1UIVA 2G93A 2F34A 1IXHA 1N34T 3C9HA 4RY1A 5KX5E 1MXUA 2MYSA 4DUYT 4HCYA 4EEDA 3GYYA 5I58B 3P7IA 4KD5A 4H5GA 5ET6A 3VFJA 4ELOA 3PJAJ 3UTKA 1FPIA 1MQJA 4JI7T 4IDOA 3UU8A 3U8QA 2A2FX 4G68C 1T7SA 5DABA 1LAFE 4JEUB 3MKDA 1LSTA 4N91A 2F97A 4MCOA 3CQXC 2Q88A 2H88A 5AA2B 3UFEA 2PBWA 4YMBA 2FJEA 1Z8UA 3FASA 3R7XA 3IJOB 1ZOYA 3OPCA 2XQ4A 2YU2A 3V5UA 3GZGA 4DV2T 2E5VA 1URDA 2PYYA 1M62A 4IDQA 4BLAA 4GKJT 5F5WA 4JWXA 4IE7A 2XXHA 3FUZA 4TX5A 2YJPA 1ANFA 1FBFA 4JBZA 2JPFA 3VLWA 3PUVE 4FI5A 5FXVA 1NH7A 4I62A 1PBPA 4AS4A 1Y1MA 2WCAA 3PGFA 2M6BA 1XNQT 2WP9A 4YMAA 5HM4B 2QVAA 2X9HA 1WRDA 2X67A 4BDQA 5AQTB 1FQFA 3ZN0B 5IKBA 4OTEA 5L8DA 3ESLA 3QNUA 1OMPA 4DDDA 5FP3A 1TT1A 5CI5A 1T8BA 1IUDA 4Q25A 2EHOA 5FL0A 2IHR1 5AQPB 2A3DA 4LZ8A 2P3NA 4RNSA 4TLMB 3TYHA 4ZOLE 2Q9QC 4B3ST 3JADA 1UX4A 3E13X 4GWOA 5BMVE 1ZP0A 2CBIA 4R75A 4RYAA 4LF4T 1VSOA 1IEJA 3HKCE 2B4MA 2YPNA 1EZPA 5CRYA 4H45A 1YTVA 1N33T 4DR7T 1SA0E 3UFGA 4XKNA 1S9TA 4I9DA 4N6DA 4P1NA 2F78A 4P47A 3SESA 3RI5A 1D4NA 4HTEA 3KG2A 3ZS6A 4R2BA 4PFYA 4R2FA 5KMGP 1NENA 2CRBA 4TUYE 2PJQA 3RF1A 4KYEA 4BDOA 5J1GA 4YB7A 2JQKA 3ISPA 2XQYA 4KUMB 4AKIA 2BG9C 2ODVA 3PV0E 1EYIA 2I4CA 2RPAA 3U65A 5EK3A 2OBGA 2Q89A 3CFLA 4ZEDA 2CHNA 4DR2T 2X0LB 1K9ZA 5IUXA 3EDUA 4LQ5A 3LG7A 1XI6A 3HN0A 1TXFA 2ONSA 2QS3A 2N1GA 2ZYNA 1JEUA 2W4XA 4PGPA 1DU2A 2X7PA 5ABHA 2PG8A 4HXVA 3K3OA 4RA1A 3M3KA 4GK5E 4F1UA 2RCBA 4ZDMA 3HHGA 2D2SA 4F19A 3GXAA 5CM6A 4GK0E 2CPTA 1BKAA 5JR9C 4PP0A 2V6YB 2RF1A 3UULA 3CIRA 2WWUA 1USYH 4JI4T 2F6PA 3K1PA 4XTCQ 3ZKRA 3MP6A 4FE8A 4G63A 2WDVA 4K3FA 4HFDA 2XJ7A 2B3FA 4X20E 3KJ7A 1IBKT 3QXMA 4PF6A 3RT8A 2FJAA 2HN1A 4K0UA 3AE4A 1WLXA 1N3XA 1IXIA 1OWAA 2YDQA 1B4ZA 1UQWA 4MFRA 5FTHA 4HCWA 3C64A 4OMBA 3PUXE 3TCHA 2OX3A 1MM7A 1LBYA 1JEVA 3NZPA 5I7IA 2QRXA 2V3UA 4X62T 4ONYA 4ILUA 3RLFF 2KXPB 4DMVA 2UYFA 2Y48B 2W7YA 3TFLA 4DO0A 2LHRA 4ZZEA 4G68A 2H9BA 4OVQA 5HEHA 2JQQA 4YXDA 3VV5A 2JQ9A 4F1YA 2WBLA 3ABVA 5E0OA 4F6RC 4DV0T 3K3NA 2HHMA 2F36A 4ZI3C 5ABGA 1HSEA 4FIMA 3H3MA 4KCCA 3T9XB 1SYHA 3CI8A 2DI4A 1FTAA 2P0SA 2VQET 4GKKT 3R6NA 2DP8A 1KNZA 3CKDA 3KDSE 2LLYA 2HAVA 4WXJA 4OVPA 1QVSA 4U7YA 5AQUB 3IOWA 3OBVE 3RIFA 3FVOA 2WS3A 2V84A 5M2VA 1KA1A 1A40A 1Y64B 3E0ZA 2YDRA 3USDA 2LE8A 3LK3B 3PUWF 1T98A 5FHNA 2R8TA 2R71A 3E3KA 5DQVA 5ICTA 1FPGA 1D1AA 3C34A 4Q30B 2XQ3A 4AKGA 3UN6A 4MNIA 1D9VA 2D5UA 2ZMAA 5DJQC 4UVCB 4AKHA 3O28A 5L3BB 2FA7A 1R8IA 4AXPA 3KFWX 1N3WA 1RDXA 1OVBA 1DSNA 2XXTA 2W67A 4OYKA 2MOZA 4OHFA 5C2TA 1HSJA 4GWZA 5LA6E 3I6VA 2Q9QA 3EVYA 3B7DA 4PQJA 5TPAA 2DWHA 4GWXA 3P50A 3TZAA 3LSVA 4YHJA 2QL3A 2XXQA 2QMWA 3X1DA 4G8MA 5DVFA 1FQCA 5LB7B 4OESA 1IMAA 3RPUA 3TLSA 4PAKA 5FKYA 3LK2B 2GFEA 1IMBA 3IOUA 4WYVA 2O7UA 3G7WA 4CI3B 3PUZF 1E1HB 3RGYA 4MALA 2UUAT 2BG9A 2X9XA 1YQ3A 2CBJA 5TPAB 4B3TT 4YJ3E 4I3YA 5M4YA 2VHAA 1NMUA 3V8XB 4Z7EA 4HTGA 2IC9A 4EXTA 1B3EA 2O1MA 5I59A 2WZHA 4KI0E 2J4GA 4L5GA 4ZZBA 3G3FA 3F31A 1B32A 1HR0T 1LBZA 3CRBA 5KDTB 5ISUA 5JRCB 4HE1A 3KVBA 4JWOA 4X66T 2GQ1A 4XAXB 4UVAB 3GMIA 2R9JA 4PFRA 2W63A 4GWWA 1D0ZA 3MXZA 1AIVA 5FMNA 4ILCA 4IO3A 2XY8B 3RRCA 2ZM0A 3JCFA 3PTRB 5L47A 4TLLB 5AE4A 4F18A 3PJAA 3ZN1B 2VL0A 1RKMA 3PUYF 2QVUA 3ZT6A 3CQGB 3A3CA 1B5HA 5JR9A 4DV6T 2Y7WA 2VD2A 1FJ6A 1LBCA 5I59B 5HYAA 1OLCA 3AVSA 4X65T 3LSWA 5ABEA 5TAOA 1P1QA 2G0UA 5LBQB 5LGNB 1HCIA 2WMNA 3T93B 1QUKA 3ODBA 1BR1A 2QPQA 2FHYA 4WEPA 2W00A 2HZKA 3RQWA 3C50A 4R74A 3MVXA 3TEPA 1YAEA 4BDRA 5LJNA 2Z8EA 2H4IA 2LEHA 4LMJA 2VVSA 1H45A 2LKGA 4N6PA 5HCJA 3IO6A 4R72A 1B46A 3ZMZB 4GL0A 4H63H 1HSLA 3LBXA 2UXCT 1XMOT 1DTGA 5L3EB 3DP6A 4O4LE 3BKIB 4EYYR 1FQAA 4ISUA 1X9BA 1T0KA 3UP9A 1W9RA 4ZXLA 1YKEB 2O51A 4MH5A 2MBGA 2P1SA 4EXLA 2DS9A 2BS4A 2QRYA 3AXJB 2CLYC 4LF5T 4U2RA 4GRKA 1Q9DA 3NVOA 4ILBA 2F8DA 4U22A 3E08A 3QIMA 3GN5B 3LV0A 1UCUA 2LOSA 1IMDA 1QW0A 3H7MA 5FBPA 4LF7T 2YU1A 3O1JA 3RKOA 4GF8A 1B6HA 1NUWA 3PUVF 1AH5A 4ZI2C 1FMVA 2HH7A 5ET5A 3GBAA 1BLFA 2DOJA 4V1Av 4P56A 3MC2A 2I58A 2M6IA 3CFXA 4LUBA 3K00A 1ZBMA 3G3IA 4PJLA 3B5MA 3ECRA 4XIGQ 1KNPA 4JB7A 1G73A 5AQMB 3QMFA 1Y4CA 2CWYA 5H8HA 1FQBA 1DK4A 4MNPA 5FY1A 3TCGA 3N9OA 1H3DA 2ZM2A 1MNEA 3JZJA 4ND9A 3AEBA 2C5JA 4IL4A 3TLUA 3CWZB 4EXKA 4O3BA 4P8BA 3OO6A 2XXRA 2ALUA 3LFMA 3WAKA 1LFGA 1NNKA 1CHUA 3QUFA 2WWVA 4F39A 3U94A 1OEDB 2KWIB 3OYZA 4YFSA 1AWBA 1PDAA 1W0AA 1MY3A 3PPPA 3HR0A 5F8PA 3PU3A 3N9NA 2LRKA 4KP3C 3U72A 2UXNB 2GRVA 3C98B 2JJKA 1QGXA 4NXNT 1WR0A 4PJNA 3TPAA 2V25A 5IM2A 4JI5T 2NTYA 3TDJA 3O66A 2F5XA 3PV0F 3BFTA 3I3VA 4X1IE 2BVLA 2IUBA 4HWDA 2XWKA 2Q8JA 3ZSSA 3AVRA 4LMLA 1P1UA 4OEVA 3ONLC 5AQRB 3TMGA 3KSJA 4O3CA 1GTKA 4IDPA 2QSXA 1LCTA 3ONJA 2XXXA 3L3PA 1UTHB 3LSLA 4JSOA 4BJNA 1HG5A 3KN3A 4NF5B 4I4TE 2DLRA 1H7CA 4OK0A 2I6EA 2REGA 1SVXB 3R26A 3AE7A 2VL8A 2BJJX 2WDQA 2Y7KA 1HNZT 1LB9A 1WYCA 4PDHA 3EDVA 1JW4A 2XAFB 3KSXA 1M5DA 4LZ5A 4PJJA 3JC6C 2XHDA 4KYSA 3TLTA 2CZHA 4GYSA 3W9WA 1H44A 5AQSB 3MAMA 4ELQA 1I6AA 3VRAA 2E9XC 3C4ZA 3N5LA 3HSTA 1B7HA 4YKPA 2YOEA 4HFCA 1D3KA 4OFLA 3VKHA 3UGWA 4BDNA 1VCTA 5KDMC 4KHZF 3DP8A 4UIGA 4H46A 4HFHA 4UA8A 4DXUA 4CXYA 2DL1A 3PE0A 2QFLA 4NUUA 3SWHA 3PUXF 3RC3A 5HBCA 4DNDA 3TCFA 1LVKA 1O7TA 2DE2A 1NAFA 2WMOA 1US7B 4Z91A 3QOFA 3SRZA 2Q8MA 1S7YA 5LHGB 5AQNB 3MP1A 5KXJA 2OWZA 4X1YE 3Q5EA 3DM0A 4F3BA 3H37A 4O8SA 3K02A 4IGTA 4OX9T 5HXSA 4EZHA 3DJBA 3RIAA 4EGWA 1TWYA 4H6DA 1MXVA 3EF7A 4DZ1A 3FZVA 2X0YA 1EYJA 2XQ8A 3HKEE 5BR8T 4FJPA 3C31A 2IDOB 1ATGA 1GVCA 1MIYA 1NV2A 4QF9A 2XQ9A 3K2DA 4C1TA 2CZKA 4FORA 4P1LA 3KFMA 4L0RA 5GONE 4DR1T 4ANJA 3I0QA 3V5SA 1BR2A 4YSYA 2ZM8A 1NV1A 4YKJA 5FL1A 3TLWA 3C51A 3QC9A 4L9IA 3OO8A 1FMWA 1N04A 3EHSA 1LBBA 1UGOA 1G8XA 5CBSA 2NOXA 3H6WA 5I58A 4ESWA 3T9UA 2WZIA 5IZZA 4JEHB 5AQIB 1EZ9A 3IB0A 4PTKA 1NUZA 1KEYA 3D0TA 2L3LA 4NF6B 2XZEA 3L39A 5L2LA 4BJMA 5EQ9A 2QMXA 4PETA 2PFZA 5ET8A 4YLHA 3PMVA 4PCDA 4QXBB 3CX6B 1NWMX 1L5TA 5AA2A 4HFBA 3SEUA 4MNCA 2W66A 2ZNTA 2ZMBA 2DWJA 2O7IA 1DPPA 2XXVA 1F9BA 5IHYA 3AEEA 1FBCA 2Z8DA 4MBPA 2FBWA 3D4GA 2XSAA 4O94A 4OVJA 2O6AA 2YKSA 1NH8A 2PMSA 4HGAA 2WM9A 4MLKA 4U3CA 4I8CA 2UXXB 1B0HA 2WU5A 3FZFB 1V9DA 1VCSA 5DT6A 2LKHA 5J16A 2BS2A 3V83A 3V89B 4G61A 2VVNA 4TWDA 3TKLB 3D1RA 2LAOA 5LP6E 4NTLA 2UVJA 4OHNA 2HFBA 1SQYA 4QFNA 3HA4A 4N81A 1VFEA 2RC7A 3MW0A 3ILUB 1NV3A 4PNIA 5I3SA 1J5ET 2E5LT 2YN6A 2WU2A 5J2UE 2AE9A 3PUQA 3FGSA 4O3AA 4P0GA 5H8FB 3ZMTB 5AQJB 4AISA 3N26A 1FW0A 1JVXA 1IMEA 1IQ7A 4N07A 1FTMA 4KI0F 4U72A 5LHIB 2X68A 4U74A 4ELPA 2H7OA 3UUNA 4PF8A 3T9HB 3CIJA 1PBQA 3FXRA 5F3JA 3CVRA 1N32T 2KSRA 2N9DA 4QHOA 5IZ1A 1B05A 4OYVA 1JETA 2Q74A 3PMXA 5FVKA 1FSAA 3KBZA 1KA0A 2M8CA 4ZS2A 3IFAA 3WI3A 1M5EA 3SEWA 2E2AA 4YKIA 4X64T 3O6GA 2X9YA 1S94A 2Y5KA 3RPWA 3TTKA 2BG9E 2NUVA 4MX6A 4LF8T 3IR1A 3OEMA 5HCMA 1MH4A 3IOVA 5AFUL 4JI1T 2KINB 4M1PA 2CEYA 4QBAA 4UABA 3NRXA 2E9XA 2QVVA 2CZLA 3N2KE 3QAXA 3UUBA 5EQ7A 3T8OA 1FPFA
chains in the Genus database with same CATH topology
1B40A 4R6HA 4HEAA 3KGCA 4NWCA 4GL8A 3PDYA 1R9LA 4BDMA 5LHHB 4P0BA 2XXYA 4PK4A 4JSDA 3BQKA 1VE4A 2NXOA 2XUEA 1SW1A 2ONKE 2ONRA 2DXRA 1PB7A 1MNDA 4GVOA 3EPEA 3E22E 5HAXA 4I50E 1YD8G 2E9XB 3RX6A 1NNFA 2XX8A 3RT6B 4CI1B 1B9JA 5A1LA 4H9QC 4X1BA 4MBQA 2VP1A 3H6TA 1ZV4X 2IEEA 2YLNA 3WAJA 3BK9A 2H98A 4H0WA 3MQ9A 5BUUA 4TN7B 5L3CB 2CXFA 2VK9A 1URGA 4JDFA 4E0WA 3TUSA 2C5IT 5CC2A 4POWA 4QXCB 3H3GA 4QSCA 2XXPA 3ZCJA 4EB6E 3G3KA 4ASKA 5ELVA 4YU0A 3N94A 4WBNE 1UTBB 4XKQA 1WDNA 3ETVA 5ICQA 3RC8A 2XXUA 4O2BE 3HV1A 4NWDA 2Q9QD 3TTLA 1Q35A 4ECFA 3MACA 5LBMA 3F2EA 3N9MA 4DE8A 4PE5B 4H5FA 3OKQA 4CXXA 4B6XA 1URSA 3IB1A 2CA5A 4G4PA 4KHZE 4E7ZA 2WKYA 4QFLA 4EF2A 2A72A 4KCDA 1BR4A 3ANWB 1MPDA 2FYIA 3K01A 5CMMA 5DVJA 2H5YA 1FQDA 3OOAA 3S9MC 3KN8A 2GHBA 2VD3A 3C35A 2PBIA 4QSDA 1MXXA 1II5A 5BWJA 2E1SA 5JTYB 2UVHA 4QX8B 4I1DA 2Z22A 2V7IA 2ODUA 1DTZA 1VFDA 4H67A 2I59A 3H6UA 2WAUA 1H43A 1QULA 4ZECA 2DWGA 5FHMA 3K6WA 4FAJA 3RYIE 1J1NA 4XBFB 1D0XA 3LJCA 4ERRA 4FATA 3H06B 2Y6XA 4LA9A 1B1HA 1Z7NE 4H1XA 3SS1A 3MZ9A 3WAEA 1WYBA 4I43B 3HKBE 1JW1A 3MBPA 3PU8A 3TKDA 4OWDA 4IE6A 3ZPOA 3PPRA 5JDGA 5DEXB 4H9SE 3N6TA 3IORA 2JMKA 3TTRA 3VU7H 2ES0A 3TTNA 1GV8A 4Z0IA 4ESXA 5H8QB 1FTJA 1PEBA 2LSGA 1JVYA 1WR6A 2V7MA 1WODA 3CPZA 4FEDA 1SHZC 5DQWA 4ZEBA 4X1KE 3P8CD 4G8HA 5ADXL 4Q5TA 5DVIA 3FIRA 3N2OA 1HF8A 2ZNSA 2ZLYA 3M8UA 3THIA 5KZTA 2B3BA 4ZI3D 1MQGA 2KWHA 2KT9A 4DBRA 3UA8A 2F7AA 5KDTA 5JRCA 2THIA 1JQFA 1US5A 2N2NA 2H3RA 3I1AA 3S4UA 2V7JA 2XAHB 3RNNA 1HX8A 3KINB 2BZBA 5LYJE 2ACXA 3RY3A 1P1NA 2DE3A 3IK6B 4IGRA 2I3WA 2DXYA 4ZE8A 5LNKA 1N7XA 1ZKBA 5TU0A 3CSGA 1LKXA 2P2AA 3AA1B 1ZTYA 3LC8A 3V5AA 4G8NA 3CG1A 3SEXA 3ZEFB 1X79A 1B5JA 3VE1B 4QX7B 2VKHA 2Y7IA 3AA0B 3K0VA 4ZEKA 5I84A 1ZKEA 2K5BB 1RYOA 4RK2A 3NZQA 3BFUA 4HFVA 2X66A 1DOTA 4DXBA 3OD7A 3FHNA 4UVBB 3M3LA 4NE4A 4GOTA 3IL1B 4WKMA 5JDNA 3OSRA 2R6GE 3DP7A 4THIA 3MWBA 3KV6A 4LQ2A 3GN5A 3AA6B 3NRYA 3LSFB 3SEVA 2KNDA 4EIWA 3ZYMA 2P9BA 2QJEA 2NTXA 2HQ0A 3Q25A 4H9OC 1SW4A 2OZZA 3DLNA 1B3HA 2V3TA 5LGUB 4IE5A 2XXIA 1LVFA 5LJMA 2HPJA 2RCAA 1IJ6A 3FJGA 1YKHB 4N13A 4UF0B 1NFTA 3H4ZA 3T22A 5A5XB 1MIWA 5I56A 1MG1A 5C8YE 4DLDA 1B0LA 3MVWA 1SW5A 2X26A 2FNCA 4UV8B 5FXWA 1MQDA 1LAGE 1MY1A 5H8NB 3PURA 3JV9A 3UIFA 3FV2A 2HPLA 3H6VA 3ZMVB 3ZMUB 4ZEFA 1JNFA 2XD2A 3S2VA 3OO9A 3MP8A 3ZMSB 2Z23A 3ZCIA 4F29A 5KCJA 1B5IA 5L3GB 5I56B 1D1BA 2NP9A 2Y7PA 3E4RA 2LOPA 3HPIA 2IA4A 4YZZA 2CCQA 2XAQB 3O1HA 2Y8DA 3TODA 4AQFC 1N84A 1PB9A 4YB5A 3FJMA 5DYHA 2XTLA 4P11A 3CX7B 3FVKA 3RQTA 3KOTA 2CMRA 4IO4A 4YAHX 2VWAA 4NF8B 2I3VA 5KCJB 4QSEA 4UV9B 3ZKLA 2OJTA 3CQCB 1UTHA 2A5SA 2A5TB 3MZ1A 3QUJA 1AL3A 2H99A 4NF5A 2O68A 1AOVA 3S9NC 3Q5WA 5AA4B 4PK6A 3FBLA 4TOZA 3PMWA 4IO5A 4ZI2D 4GXAA 3MVZA 5LG4A 1Y3NA 3ZYKA 2KLFA 4RPOA 2ZNUA 2NW7A 2C5KT 4OQOA 3B13A 3VHLA 2M67A 1B3LA 1LFIA 4TV9E 1HS7A 2F7CA 4EAHA 3O6IA 1QKBA 2QA7A 2O84X 1VRBA 2BVMA 5H8SA 5AA2D 3EHUA 5LCYA 2NOOA 1B1XA 4E7SA 2Q9TA 4U23A 3C4MA 4RPNA 3GA8A 1B52A 3ZKKA 1QSDA 4KPTA 4KQPA 2CXDA 1VR5A 1ELJA 2C0SA 3IHRA 5K2YA 4EQBA 1YPNA 2E8IA 2JJ9A 2VOZA 4X1DA 3HL6A 1OIBA 5J1DA 4ISSA 4OFOA 4J2CA 4XKPA 4HW8A 1WVJA 4XZCA 4IB2A 5FTIA 1XVXA 3IEEA 2OA5A 1BR0A 3L6GA 1POTA 1Y20A 1RYXA 1IJ5A 5JDLA 3G3JA 2DHRA 3B6QA 1Z7ME 2NW9A 2SPCA 1MY2A 5L3DB 3B57A 3ONMA 5CMKA 3U93A 4NF6A 4UELA 3Q28A 4RK9A 2OCUA 1MPBA 3L6HA 2VB6A 3VDFA 2VKJA 2NWBA 3FV1A 1SD3A 2XX7A 2W62A 4QFKA 1QJMA 3TAJA 2RC9A 3TTMA 2RP4A 2Y7RA 3SKPA 3N9QA 2KZ7B 3CG3A 3K6UA 3JC6D 3SEYA 3ZJ2A 4GD5A 4POXA 2E9XD 2DVZA 3WAFA 4DVDA 1A7LA 1B3GA 3FXQA 4LATA 5FYMA 3PUSA 1I6QA 1BTJA 2WSSV 3N6UA 1XS5A 4M1VA 3A3UA 1SI0A 5ETWA 4U21A 3OSQA 4G77A 1CUNA 4DXCA 4YJ2E 1IZ1A 5H8FA 4EZ4A 4AQFA 2CM0A 2Y84A 2F35A 3MVYA 3ONXA 1I6BA 3KOSA 1M5CA 4C90A 3M3FA 3VLUA 4G2AA 4IE4A 3O97A 3J7Yq 1FEWA 5JEIA 5CA0E 1MMNA 4Q0CA 4AI6A 5AA3A 3UORA 2Z8FA 1MPCA 3RTFB 4AB5A 3BBRA 1OLAA 5TP9B 2W0GA 3B6TA 4O4HE 1B7UA 3O4XE 3ILTB 5L9OA 2CXLA 4H9PC 2YK0A 4NEDA 3I9YA 3KBTA 3L09A 3C36A 3KJTA 2LM9A 4GFRA 4DBQA 2F6GA 3W15B 1R9QA 4BA9A 3HI2A 4EUOA 3AAEB 4AB6A 4O4IE 4QHQA 2F7BA 1NL5A 2LJLA 2K24A 2ABHA 3MZKB 1H76A 3T9VA 3B6WA 2GHAA 4U1ZA 1ZU0A 5J2TE 4ZE9A 1VOMA 3J9X1 3LBSA 1IITA 4UXNB 4QFOA 2B1EA 2DE4A 1FTKA 5JDHA 2DWIA 4ZS3A 5F1QA 1GGGA 4YICA 3VLVA 4U1OA 1FTLA 1PB8A 2QGSA 3RYHE 1Y4TA 1YCJA 1MMDA 2XX9A 3C33A 1A8FA 3AB3B 4QFPA 4F3GA 3OXNA 3VXBA 2DCFA 4HKAA 3EHTA 1O64A 5I2NA 2LHNA 3H03A 1SBPA 2V93A 2XAJB 3SDFA 4F1VA 2I4BA 1DMBA 1N7WA 1KWHA 1AJ3A 4KBMB 2GK9A 5EYFA 1MMAA 4JXIA 1MXWA 4OZ9A 3CVGA 1UTBA 5FXZA 1LAXA 2QS1A 2L8KA 3O6HA 5FNVE 3C32A 2V3QA 2OK2A 2RINA 5I57A 1LRZA 2O1LA 5L3FB 2MTQA 3QSLA 1MQIA 5I2NB 4HN9A 3MPKA 2LSJA 1MXYA 4F3SA 2NVUB 2EHOB 3MK7C 2DQVA 1B4HA 3FXDB 1AMFA 5FXXA 3K6VA 1XVYA 4NUVA 2E0SA 4R9FA 3ANWA 1B2HA 2O69A 4MLVA 2L9QA 4R6KA 5LOVE 2CE7A 1U4QA 5I57B 1ZJLA 1Y9UA 4X9TA 3GWHA 1LGBC 4F22A 3HHFA 5EHMA 3JYRA 4IO2A 4IDZA 2IAKA 5JTYA 3S9LC 1QUIA 4AKRB 3G3HA 3R6UA 4EDPA 2YINA 5EK2A 2HAUA 2UVIA 3MA9A 3HO7A 5H6QB 1JW5A 3DELB 3QK6A 5JREA 1D9YA 5LOMA 2QS4A 3FB2A 4GIWA 3HCQA 2H7VC 4YKKA 1XT8A 4IY6A 3O2AA 1TFDA 3D4CA 1OXZA 2PT1A 2X7QA 5I2KA 3SERA 3K6XA 5FY0A 4PK5A 3CSBA 3FJ7A 4XKRA 3OJAA 4AQ4A 2I0BA 2XXWA 5DEXA 2PVUA 5HXCA 3RTWB 2H25A 5IYZE 4I55E 3SOLA 4LZ7A 3ZLIA 3CMLA 5H8QA 3RUMA 5F7VA 3FXEB 2JMHA 4WW0A 1XC1A 4C1UA 3UUXB 1Z0PA 1MQHA 5I2KB 3RYFE 1IAPA 2D5WA 2UVGA 2I48A 2I49A 4OERA 4H65A 1A54A 2RC8A 4DMWA 1EZOA 3ZC0A 5JDFA 4GXSB 3I0OA 2HEUA 2DNXA 4MHCA 4R6YA 2VKOA 3VVEA 2ZYOA 2Q2CA 4A56A 5LXTE 4G68B 2VKDA 1FIOA 1MS7A 3MJXA 4OYJA 1CB6A 4GIZA 3PUGA 1MRPA 1FCKA 1SYIA 3IO4A 1CE2A 2DWAA 1MMGA 2VASA 3W9VA 4O2AE 1NNTA 4IO6A 3DP4A 4RJZA 1XHYA 2IW5B 1Y3QA 2OWSA 3N2GE 4CXWA 3FVNA 3OELA 5HXRA 2LSKA 1USYE 3R84B 2LSYA 4QRZA 3ZJ1A 1KK7A 1R1NA 3KEIA 2XHEB 4NF4A 2ZYKA 3KN7A 4GQOA 4IE0A 3I5OA 1MIVA 4ISTA 3IOTA 2REJA 1U5PA 1MY0A 4GOUA 4KFQA 4MF3A 2CWOA 1UX5A 4PFTA 1TFAA 2D0TA 1SI1A 4PJMA 4JLEA 3DTOA 2ZYMA 1QUUA 2HCAA 2Q9QB 5EK4A 3I9WA 1LLSA 4Z8XA 4NF4B 5L9SA 3ETUA 3KV9A 1NNPA 3F57A 2XD3A 3O1IA 1OQHA 5CBRA 2K9AA 2XASB 4HE8A 3O9XA 4DCXA 3U78A 3AXFA 1MXZA 3GLBA 2UXAA 4JWYA 1Y3PA 3VVFA 1A8EA 1S35A 4OFJA 1SW2A 1I69A 3OMBA 3AA7B 2X9WA 1XOCA 3CFZA 4IY5A 2X51A 2B65A 5HXHA 1IIWA 1P99A 5CMBA 4UF0A 3T96B 5A5XA 1UIUA 2ANJA 1MH3A 1QUJA 3O9PA 4MFIA 3K8PC 4C91A 4FECA 1QKAA 3PD9A 5JDMA 4BDLA 4H9RC 5ITOA 3K1MA 4H9NC 2IC6A 5HWXA 5HWYA 4ADZA 4OXVA 1IXGA 3G3GA 4EF1A 1BP5A 4IGUA 5DTBA 5H8NA 1D0YA 3OENA 4UEMA 2AIXA 3U92A 4GLIA 4UACA 4FEBA 4AQGA 5B70A 5JR9B 3O29A 4QXHB 4P09A 4OETA 4R9GA 1SDXA 4P0IA 3FD3A 1S50A 4PFPA 2AL4A 4YB6A 4ZHQE 3A09A 3FATA 2AYSA 4F3PA 4KMCA 4CQIA 2D3IA 4EQ7A 4WBOA 2VGQA 2NW8A 2K48A 4O4JE 3EUHA 3PU5A 4TQUQ 3GBBA 3AAAB 4Q8RA 3PD8A 2DVCA 3PPNA 1N0TA 5JQGE 1N76A 5FY7A 3NBXX 4CZZB 4EYUA 5CMCA 5JH7E 3BQIA 3ZSFA 3H3AA 4G2ZA 3BQLA 4NF8A 3LR1A 5CA1E 3TQLA 1LFHA 3LBXB 1NKXA 4E0XA 1MDQA 2HZLA 4F31B 2A5TA 2I0CA 4OEUA 2KMFA 2W61A 2Z6EA 1M5BA 4IO7A 4FJOA 4N78D 3RRWA 3IBPA 5AA4A 1ZEEA 3VKGA 1B58A 2OLBA 1Y1ZA 2QS2A 3K4UA 3OEKA 2V7LA 4AKLA 2V26A 4OENA 1EH3A 2XAGB 1MY4A 5IAIA 3W15C 4PFWA 3F11A 4NMYA 2PFVA 3KV4A 1B3FA 4HS7A 4RXLA 4WNKA 4C0RA 4H8JA 2OWTA 3PPQA 3LUYA 3RYCE 2AL5A 4JUYA 2BDEA 4MLQA 2GH9A 4LVQA 3RLFE 5H8HB 5HPQA 3T66A 1B51A 3M65A 3ZYLA 4ZEIA 3ZC1A 3LK42 4TZ4C 1ZLQA 3IF8B 2RKMA 3HKDE 3SETA 2LT3A 4QWNB 2DSFA 4F2QA 1EU8A 5ITPA 3FXUA 2JRKA 1P1OA 5JVDE 1OVTA 1M5FA 3IB2A 4EOZB 3Q29A 3TELA 3FBZA 2CEAA 1D1CA 4U4SA 4XXUA 1HTJF 1IZNB 3KBUA 3S9EA 2DYXA 3K1NA 3MPLA 3IAZA 3A5XA 3PUWE 3VXCA 3K3QC 4LONB 1A55A 3AAIA 5K2XA 3N9PA 5AA1A 1Q1KA 4U4XA 4CI2B 1POY1 1GR2A 1IXCA 4IIJE 1HG2A 1YW0A 1B7ZA 3C4WA 3VVDA 4ELRA 2YEVC 5HXEA 5FHOA 4IHJE 2D21A 4ZI7E 1A99A 2EHOC 1BIYA 1LB8A 2CMOA 4OFZA 2LSIA 1ZIUA 2RA1A 3EQ1A 5CB4E 3MJNA 2ESNA 1B7TA 4H8IA 4M4GA 3Q2MA 5JDQA 2Q2AA 3QYTA 3MUQA 3IX1A 1EZ3A 3E9XA 2KLQA 3C4XA 3RH3A 2PT2A 3N9LA 3U1OA 1HFAA 3IJXB 3CR9A 2V1DB 3OO7A 2PX1A 3Q5XA 4H63V 3KV5A 3PPOA 3PUZE 4DIGA 2DWKA 1O63A 4QKNA 1ZMGA 3Q26A 5H6RB 3LSXA 3OYXA 1ZHCA 4R73A 2G29A 4PFUA 4PW8A 5L9MA 4F2OA 5EHSA 3KVAA 1PC3A 4L17A 2ZXTA 3MZBA 1FTOA 5LGTB 3UK4A 3KZGA 3RN8A 5JK4A 1O3XA 2HXWA 3U3IA 1US4A 3Q9DA 4KYDA 1P1WA 3PUYE 1MDP1 2EHOD 5TP9A 4ZS9A 3FVGA 3KBRA 3UUMA 2CLYB 4PFOA 2J1DG 2D0UA 4PAGA 3UT5E 1MM6A 5B7DA 3Q27A 2NWJA 1OQGA 4WEDA 4LP2B 3PUAA 5EZYE 4TV8E 4KR5A 4BAYB 1LCFA 1R6ZA 3CX8B 4ZZAA 4GYRA 4P0AA 1DPEA 2UYEA 2V7KA 3TQWA 3EN3A 1LAHE 1FQEA 1UIVA 2G93A 2F34A 1IXHA 3C9HA 4RY1A 5KX5E 1MXUA 2MYSA 4HCYA 5I58B 3P7IA 4KD5A 4H5GA 3VFJA 4ELOA 3UTKA 1MQJA 3U8QA 2A2FX 4G68C 5DABA 1LAFE 4JEUB 3MKDA 1LSTA 2F97A 3CQXC 2Q88A 5AA2B 3UFEA 2PBWA 4YMBA 3FASA 3R7XA 3IJOB 2YU2A 3V5UA 3GZGA 1URDA 2PYYA 4BLAA 4JWXA 4IE7A 2XXHA 3FUZA 4TX5A 2YJPA 1ANFA 4JBZA 2JPFA 3VLWA 3PUVE 4FI5A 5FXVA 1NH7A 4I62A 1PBPA 1Y1MA 3PGFA 5HM4B 4YMAA 2X9HA 1WRDA 2X67A 4BDQA 1FQFA 3ZN0B 5IKBA 4OTEA 5L8DA 3ESLA 1OMPA 4DDDA 5FP3A 1TT1A 5CI5A 1IUDA 2EHOA 2A3DA 4LZ8A 4RNSA 4TLMB 3TYHA 4ZOLE 2Q9QC 3E13X 4R75A 1UX4A 4GWOA 4DCYA 5BMVE 4RYAA 1VSOA 1IEJA 3HKCE 2YPNA 1EZPA 5CRYA 1YTVA 1SA0E 4XKNA 1S9TA 4I9DA 2F78A 3SESA 1D4NA 4HTEA 3KG2A 3ZS6A 4R2BA 4PFYA 4R2FA 5KMGP 4TUYE 4BDOA 2PJQA 4KYEA 5J1GA 4YB7A 2XQYA 4KUMB 4AKIA 2ODVA 3PV0E 2I4CA 5EK3A 2OBGA 2Q89A 3CFLA 4ZEDA 2X0LB 3EDUA 4LQ5A 3LG7A 3HN0A 1TXFA 2ONSA 2QS3A 2N1GA 2ZYNA 1JEUA 2X7PA 2PG8A 3K3OA 4RA1A 3M3KA 4GK5E 4F1UA 2RCBA 4ZDMA 3HHGA 2D2SA 4F19A 3GXAA 5CM6A 4GK0E 1BKAA 5JR9C 4PP0A 2RF1A 3UULA 2WWUA 1USYH 2F6PA 3K1PA 4XTCQ 3MP6A 4FE8A 4G63A 4K3FA 2B3FA 4X20E 3KJ7A 3QXMA 3RT8A 4K0UA 1WLXA 1N3XA 1IXIA 1OWAA 1B4ZA 1UQWA 4MFRA 5FTHA 4HCWA 3C64A 4OMBA 3PUXE 3TCHA 1MM7A 1JEVA 3NZPA 2V3UA 4ONYA 4ILUA 4DMVA 2KXPB 2W7YA 2UYFA 2Y48B 3TFLA 4DO0A 2LHRA 4ZZEA 4G68A 2H9BA 2JQQA 3VV5A 4F1YA 2WBLA 4F6RC 5E0OA 3K3NA 2F36A 4ZI3C 1HSEA 4FIMA 4KCCA 3T9XB 1SYHA 3CI8A 2DI4A 2P0SA 3R6NA 2DP8A 1KNZA 3CKDA 2HAVA 3KDSE 4WXJA 1QVSA 3IOWA 3OBVE 3FVOA 2V84A 5M2VA 1A40A 1Y64B 3E0ZA 3USDA 2LE8A 3LK3B 1T98A 5FHNA 2R71A 3E3KA 5DQVA 5ICTA 3C34A 1D1AA 4Q30B 4AKGA 3UN6A 1D9VA 2D5UA 2ZMAA 5DJQC 4UVCB 4AKHA 3O28A 5L3BB 2FA7A 4AXPA 3KFWX 1N3WA 1OVBA 1DSNA 2XXTA 4OYKA 2MOZA 4OHFA 1HSJA 5LA6E 3I6VA 2Q9QA 3EVYA 3B7DA 4PQJA 5TPAA 2DWHA 3TZAA 4YHJA 2QL3A 2XXQA 2QMWA 4G8MA 5DVFA 1FQCA 4OESA 3RPUA 3LK2B 2GFEA 3IOUA 2O7UA 3G7WA 4CI3B 1E1HB 3RGYA 4MALA 2X9XA 5TPAB 4YJ3E 5M4YA 2VHAA 1NMUA 3V8XB 4Z7EA 4HTGA 2IC9A 4EXTA 1B3EA 2O1MA 5I59A 4KI0E 4L5GA 3G3FA 3F31A 1B32A 3CRBA 5KDTB 5ISUA 5JRCB 3KVBA 4JWOA 4XAXB 4UVAB 3GMIA 2R9JA 2W63A 1AIVA 1D0ZA 3MXZA 5FMNA 4IO3A 3PTRB 3RRCA 2ZM0A 4TLLB 5AE4A 4F18A 3ZN1B 1RKMA 3CQGB 3A3CA 1B5HA 5JR9A 2Y7WA 2VD2A 1LBCA 5I59B 5HYAA 1OLCA 3AVSA 3LSWA 5TAOA 1P1QA 2G0UA 5LBQB 5LGNB 1HCIA 2WMNA 3T93B 1QUKA 3ODBA 1BR1A 2QPQA 4WEPA 2W00A 2HZKA 3C50A 4R74A 3MVXA 3TEPA 1YAEA 4BDRA 5LJNA 2Z8EA 2H4IA 2LEHA 1H45A 4N6PA 3IO6A 4R72A 1B46A 3ZMZB 4GL0A 4H63H 1HSLA 3LBXA 1DTGA 5L3EB 3DP6A 4O4LE 3BKIB 4EYYR 1FQAA 4ISUA 1T0KA 3UP9A 1YKEB 2O51A 4MH5A 2MBGA 2P1SA 4EXLA 2DS9A 2QRYA 2CLYC 4U2RA 4GRKA 2F8DA 4U22A 3E08A 3QIMA 3GN5B 1UCUA 2LOSA 1QW0A 3H7MA 2YU1A 3O1JA 3RKOA 4GF8A 1B6HA 1AH5A 4ZI2C 1FMVA 2HH7A 3GBAA 1BLFA 2DOJA 4V1Av 3MC2A 2I58A 3CFXA 4LUBA 3K00A 1ZBMA 3G3IA 4PJLA 3ECRA 4XIGQ 4JB7A 1G73A 1Y4CA 2CWYA 5H8HA 1FQBA 5FY1A 3TCGA 3N9OA 1H3DA 2ZM2A 1MNEA 3JZJA 4ND9A 2C5JA 3CWZB 4EXKA 4O3BA 3OO6A 2XXRA 2ALUA 3LFMA 3WAKA 1LFGA 1NNKA 3QUFA 4F39A 3U94A 2KWIB 3OYZA 4YFSA 1PDAA 1MY3A 3PPPA 3HR0A 5F8PA 3PU3A 3N9NA 4KP3C 3U72A 2UXNB 2GRVA 3C98B 4PJNA 3TPAA 2V25A 2NTYA 3TDJA 3O66A 2F5XA 3BFTA 3I3VA 4X1IE 2BVLA 2Q8JA 3AVRA 1P1UA 4OEVA 3TMGA 3KSJA 4O3CA 1GTKA 2QSXA 1LCTA 2XXXA 3L3PA 1UTHB 3LSLA 4JSOA 4BJNA 1HG5A 3KN3A 4NF5B 4I4TE 2DLRA 1H7CA 4OK0A 2I6EA 2REGA 1SVXB 3R26A 2VL8A 2BJJX 2Y7KA 1LB9A 1WYCA 3EDVA 1JW4A 2XAFB 3KSXA 1M5DA 4LZ5A 4PJJA 3JC6C 2XHDA 4KYSA 3W9WA 4GYSA 1H44A 3MAMA 4ELQA 1I6AA 2E9XC 3C4ZA 3N5LA 3HSTA 1B7HA 4YKPA 1D3KA 4OFLA 3VKHA 3UGWA 4BDNA 5KDMC 3DP8A 4UIGA 4UA8A 4DXUA 4CXYA 3PE0A 4NUUA 3SWHA 5HBCA 3RC3A 3TCFA 4DNDA 1LVKA 1O7TA 2DE2A 1NAFA 2WMOA 1US7B 3SRZA 1S7YA 5LHGB 3MP1A 4X1YE 3DM0A 4F3BA 3H37A 4O8SA 3K02A 4IGTA 5HXSA 4EZHA 3DJBA 1TWYA 4H6DA 1MXVA 3EF7A 4DZ1A 3FZVA 3HKEE 4FJPA 3C31A 1GVCA 1ATGA 1MIYA 4QF9A 3K2DA 4C1TA 4FORA 3KFMA 4L0RA 5GONE 4ANJA 3I0QA 3V5SA 1BR2A 2ZM8A 4YKJA 3C51A 3QC9A 4L9IA 3OO8A 1FMWA 1N04A 3EHSA 1LBBA 1G8XA 5CBSA 2NOXA 3H6WA 5I58A 4ESWA 3T9UA 4JEHB 1EZ9A 3IB0A 3D0TA 2L3LA 4NF6B 5L2LA 4BJMA 2QMXA 4PETA 4YLHA 3PMVA 4QXBB 3CX6B 1NWMX 1L5TA 5AA2A 3SEUA 2ZNTA 2ZMBA 2DWJA 2O7IA 1DPPA 2XXVA 1F9BA 5IHYA 2Z8DA 4MBPA 3D4GA 4OVJA 2O6AA 1NH8A 2PMSA 4HGAA 2WM9A 4MLKA 4I8CA 2UXXB 1B0HA 1V9DA 5DT6A 3V83A 3V89B 3TKLB 2LAOA 5LP6E 4NTLA 2UVJA 4OHNA 2HFBA 1SQYA 4QFNA 3HA4A 1VFEA 2RC7A 3MW0A 3ILUB 4PNIA 3FGSA 4X48A 4EQ9A 5J2UE 3PUQA 4O3AA 4P0GA 5H8FB 3ZMTB 3N26A 1FW0A 1JVXA 1IQ7A 4N07A 1FTMA 4U72A 5LHIB 2X68A 4U74A 4ELPA 2H7OA 3UUNA 3T9HB 3CIJA 1PBQA 3FXRA 5F3JA 3CVRA 2N9DA 4QHOA 1B05A 4OYVA 1JETA 3PMXA 2M8CA 4ZS2A 3WI3A 1M5EA 3SEWA 4YKIA 3O6GA 2X9YA 1S94A 3TTKA 3RPWA 2NUVA 3IR1A 3OEMA 1MH4A 3IOVA 5AFUL 2KINB 4M1PA 3NRXA 2E9XA 2CZLA 3N2KE 3QAXA 3T8OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B40 A;  4R6H A;  3KGC A;  4NWC A;  4GL8 A;  1R9L A;  4BDM A;  2XXY A;  4JSD A;  1VE4 A;  2NXO A;  1SW1 A;  2ONK E;  2ONR A;  2DXR A;  1PB7 A;  4GVO A;  3EPE A;  2XX8 A;  1NNF A;  3RT6 B;  1B9J A;  4X1B A;  2VP1 A;  3H6T A;  2IEE A;  2YLN A;  2H98 A;  4H0W A;  3MQ9 A;  5BUU A;  1URG A;  4JDF A;  4E0W A;  3TUS A;  2C5I T;  5CC2 A;  4POW A;  3H3G A;  4QSC A;  2XXP A;  3G3K A;  5ELV A;  4YU0 A;  3N94 A;  1UTB B;  4XKQ A;  1WDN A;  5ICQ A;  2XXU A;  3HV1 A;  4NWD A;  3TTL A;  1Q35 A;  4ECF A;  4DE8 A;  4PE5 B;  4H5F A;  4B6X A;  1URS A;  3IB1 A;  2CA5 A;  4G4P A;  4KHZ E;  2WKY A;  4QFL A;  4EF2 A;  4KCD A;  1MPD A;  2FYI A;  3K01 A;  5CMM A;  5DVJ A;  2H5Y A;  1FQD A;  3OOA A;  3S9M C;  3KN8 A;  2GHB A;  2VD3 A;  3C35 A;  4QSD A;  1MXX A;  1II5 A;  5BWJ A;  2E1S A;  5JTY B;  2UVH A;  4I1D A;  2Z22 A;  1DTZ A;  1VFD A;  4H67 A;  3H6U A;  1H43 A;  1QUL A;  4ZEC A;  5FHM A;  3K6W A;  4FAJ A;  1J1N A;  4FAT A;  3H06 B;  4LA9 A;  1B1H A;  1Z7N E;  4H1X A;  3MZ9 A;  3WAE A;  1JW1 A;  3MBP A;  3TKD A;  4OWD A;  3PPR A;  5DEX B;  3N6T A;  3IOR A;  3TTR A;  3TTN A;  1GV8 A;  4Z0I A;  4ESX A;  5H8Q B;  1FTJ A;  1PEB A;  1JVY A;  1WOD A;  4FED A;  4ZEB A;  4G8H A;  4Q5T A;  5DVI A;  3FIR A;  2ZNS A;  3M8U A;  3THI A;  5KZT A;  2B3B A;  1MQG A;  2KWH A;  3UA8 A;  2F7A A;  5KDT A;  2THI A;  1JQF A;  1US5 A;  3S4U A;  3RNN A;  3RY3 A;  1P1N A;  2DE3 A;  3IK6 B;  4IGR A;  2I3W A;  2DXY A;  4ZE8 A;  1N7X A;  1ZKB A;  5TU0 A;  3CSG A;  2P2A A;  1ZTY A;  3LC8 A;  3V5A A;  4G8N A;  3CG1 A;  3SEX A;  1B5J A;  3VE1 B;  2Y7I A;  3K0V A;  4ZEK A;  5I84 A;  1ZKE A;  1RYO A;  4RK2 A;  3BFU A;  1DOT A;  4DXB A;  3OD7 A;  3M3L A;  4NE4 A;  4GOT A;  3IL1 B;  4WKM A;  3OSR A;  2R6G E;  4THI A;  3MWB A;  4LQ2 A;  3LSF B;  3SEV A;  2QJE A;  2HQ0 A;  3Q25 A;  1SW4 A;  2OZZ A;  3DLN A;  1B3H A;  2V3T A;  2XXI A;  1LVF A;  2RCA A;  1IJ6 A;  3FJG A;  4N13 A;  3H4Z A;  1NFT A;  5A5X B;  3T22 A;  5I56 A;  1MG1 A;  4DLD A;  1B0L A;  3MVW A;  1SW5 A;  2X26 A;  2FNC A;  1MQD A;  1LAG E;  1MY1 A;  5H8N B;  3JV9 A;  3UIF A;  3FV2 A;  3H6V A;  3S2V A;  1JNF A;  2XD2 A;  4ZEF A;  3OO9 A;  3MP8 A;  2Z23 A;  4F29 A;  5KCJ A;  1B5I A;  5I56 B;  2Y7P A;  3E4R A;  3HPI A;  2IA4 A;  4YZZ A;  3TOD A;  1N84 A;  1PB9 A;  4YB5 A;  3FJM A;  5DYH A;  2XTL A;  4P11 A;  3FVK A;  3RQT A;  3KOT A;  4IO4 A;  4YAH X;  4NF8 B;  2I3V A;  5KCJ B;  4QSE A;  3ZKL A;  2OJT A;  1UTH A;  2A5S A;  2A5T B;  3MZ1 A;  3QUJ A;  1AL3 A;  2H99 A;  4NF5 A;  2O68 A;  1AOV A;  3S9N C;  5AA4 B;  4TOZ A;  3PMW A;  4IO5 A;  4GXA A;  3MVZ A;  1Y3N A;  2KLF A;  4RPO A;  2ZNU A;  2C5K T;  4OQO A;  1B3L A;  1LFI A;  2F7C A;  3O6I A;  1QKB A;  2O84 X;  5H8S A;  5AA2 D;  3EHU A;  2NOO A;  1B1X A;  2Q9T A;  4U23 A;  3C4M A;  4RPN A;  1B52 A;  3ZKK A;  1QSD A;  4KPT A;  4KQP A;  1VR5 A;  1ELJ A;  5K2Y A;  4EQB A;  1YPN A;  2VOZ A;  4X1D A;  1OIB A;  5J1D A;  4OFO A;  4J2C A;  4XKP A;  4HW8 A;  1WVJ A;  4IB2 A;  5FTI A;  1XVX A;  3L6G A;  1POT A;  1Y20 A;  1RYX A;  1IJ5 A;  3G3J A;  3B6Q A;  1Z7M E;  1MY2 A;  3ONM A;  5CMK A;  3U93 A;  4NF6 A;  3Q28 A;  4RK9 A;  2OCU A;  1MPB A;  3L6H A;  3VDF A;  3FV1 A;  1SD3 A;  2XX7 A;  4QFK A;  3TAJ A;  1QJM A;  3TTM A;  2RC9 A;  2Y7R A;  3SKP A;  3CG3 A;  3K6U A;  3SEY A;  4GD5 A;  4POX A;  2DVZ A;  3WAF A;  1A7L A;  1B3G A;  3FXQ A;  4LAT A;  1I6Q A;  1BTJ A;  3N6U A;  1XS5 A;  4M1V A;  3A3U A;  1SI0 A;  4U21 A;  3OSQ A;  4G77 A;  4DXC A;  1IZ1 A;  5H8F A;  2Y84 A;  2F35 A;  3MVY A;  1I6B A;  3KOS A;  1M5C A;  3M3F A;  3VLU A;  3O97 A;  5JEI A;  4Q0C A;  5AA3 A;  3UOR A;  2Z8F A;  1MPC A;  3RTF B;  4AB5 A;  3BBR A;  1OLA A;  5TP9 B;  3B6T A;  1B7U A;  3ILT B;  5L9O A;  4NED A;  3C36 A;  3KJT A;  4GFR A;  2F6G A;  1R9Q A;  4EUO A;  4AB6 A;  4QHQ A;  2F7B A;  1NL5 A;  2ABH A;  1H76 A;  3T9V A;  3B6W A;  2GHA A;  4U1Z A;  1ZU0 A;  4ZE9 A;  3LBS A;  1IIT A;  4QFO A;  2DE4 A;  1FTK A;  2DWI A;  5F1Q A;  1GGG A;  4YIC A;  3VLV A;  4U1O A;  1FTL A;  1PB8 A;  1Y4T A;  1YCJ A;  2XX9 A;  3C33 A;  1A8F A;  4QFP A;  4F3G A;  3OXN A;  3VXB A;  3EHT A;  1O64 A;  5I2N A;  3H03 A;  1SBP A;  2V93 A;  3SDF A;  4F1V A;  2I4B A;  1DMB A;  1N7W A;  1KWH A;  5EYF A;  4JXI A;  1MXW A;  4OZ9 A;  3CVG A;  1UTB A;  1LAX A;  2QS1 A;  3O6H A;  3C32 A;  2V3Q A;  2OK2 A;  2RIN A;  5I57 A;  1LRZ A;  2O1L A;  3QSL A;  1MQI A;  5I2N B;  3MPK A;  1MXY A;  4F3S A;  2NVU B;  2DQV A;  1B4H A;  3FXD B;  1AMF A;  3K6V A;  1XVY A;  2E0S A;  4R9F A;  1B2H A;  2O69 A;  4MLV A;  4R6K A;  5I57 B;  1ZJL A;  1Y9U A;  4X9T A;  1LGB C;  4F22 A;  3HHF A;  5EHM A;  3JYR A;  4IO2 A;  5JTY A;  3S9L C;  1QUI A;  3G3H A;  3R6U A;  4EDP A;  2HAU A;  2UVI A;  3HO7 A;  1JW5 A;  3DEL B;  3QK6 A;  1D9Y A;  5LOM A;  2QS4 A;  3HCQ A;  4YKK A;  1XT8 A;  4IY6 A;  3O2A A;  1TFD A;  3D4C A;  2PT1 A;  2X7Q A;  5I2K A;  3SER A;  3K6X A;  3CSB A;  3FJ7 A;  4XKR A;  4AQ4 A;  2I0B A;  2XXW A;  5DEX A;  2PVU A;  3RTW B;  2H25 A;  4LZ7 A;  5H8Q A;  3RUM A;  5F7V A;  3FXE B;  1XC1 A;  4C1U A;  1Z0P A;  1MQH A;  5I2K B;  2D5W A;  2UVG A;  2I48 A;  2I49 A;  4OER A;  4H65 A;  1A54 A;  2RC8 A;  1EZO A;  4GXS B;  2HEU A;  4R6Y A;  3VVE A;  2ZYO A;  2Q2C A;  4G68 B;  1MS7 A;  1CB6 A;  4GIZ A;  1MRP A;  1FCK A;  1SYI A;  3IO4 A;  1CE2 A;  2DWA A;  3W9V A;  1NNT A;  4IO6 A;  3DP4 A;  4RJZ A;  1XHY A;  1Y3Q A;  2OWS A;  3FVN A;  3OEL A;  1USY E;  4QRZ A;  1R1N A;  3KEI A;  4NF4 A;  2ZYK A;  3KN7 A;  4GQO A;  3I5O A;  3IOT A;  2REJ A;  1MY0 A;  4KFQ A;  4MF3 A;  4PFT A;  1TFA A;  1SI1 A;  2ZYM A;  2HCA A;  1LLS A;  4NF4 B;  5L9S A;  1NNP A;  2XD3 A;  1OQH A;  5CBR A;  4DCX A;  3AXF A;  1MXZ A;  3GLB A;  2UXA A;  4JWY A;  1Y3P A;  3VVF A;  1A8E A;  4OFJ A;  1SW2 A;  1I69 A;  3OMB A;  2X9W A;  1XOC A;  3CFZ A;  4IY5 A;  2B65 A;  1IIW A;  1P99 A;  5CMB A;  3T96 B;  5A5X A;  1UIU A;  2ANJ A;  1MH3 A;  1QUJ A;  3O9P A;  4MFI A;  4FEC A;  1QKA A;  3PD9 A;  4BDL A;  5ITO A;  3K1M A;  2IC6 A;  4OXV A;  1IXG A;  3G3G A;  4EF1 A;  1BP5 A;  5DTB A;  5H8N A;  3OEN A;  2AIX A;  3U92 A;  4GLI A;