3QK6A

Crystal structure of escherichia coli phnd
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
308
structure length
304
Chain Sequence
b'KALNFGIISTESQQNLKPQWTPFLQDMEKKLGVKVNAFFAPDYAGIIQGMRFNKVDIAWYGNLSAMEAVDRANGQVFAQTVAADGSPGYWSVLIVNKDSPINNLNDLLAKRKDLTFGNGDPNSTSGFLVPGYYVFAKNNISASDFKRTVNAGHETNALAVANKQVDVATNNTENLDKLKTSAPEKLKELKVIWKSPLIPGDPIVWRKNLSETTKDKIYDFFMNYGKTPEEKAVLERLGWAPFRASSDLQLVPIRQLALFKEMQSVKDNEQDKLAKTTAIQAQLDDLDRLNNALSAMSSVSKAVQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Escherichia coli Phosphonate Binding Protein PhnD and Rationally Optimized Phosphonate Biosensors.
pubmed doi rcsb
molecule keywords PhnD, subunit of alkylphosphonate ABC transporter
source organism Escherichia coli uti89
molecule tags Transport protein
total genus 103
structure length 304
sequence length 308
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12974 Phosphonate-bd ABC transporter, phosphonate, periplasmic substrate-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.90 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3qk6A03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3qk6A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3qk6A02
3MZ1A 5K2XA 3CSBA 2GFEA 4KCDA 4XKRA 3FXRA 4ELPA 1M5CA 4LUBA 1D3KA 3IB1A 1B1HA 1IIWA 3TQWA 4BDOA 3G3JA 3B6QA 3R26A 2QRYA 5I2KB 3TCFA 3N5LA 5L9OA 2NOOA 1IXCA 3MXZA 4YKPA 2G0UA 2BJJX 5CBRA 1JEVA 2RC7A 4ND9A 5I56A 2DOJA 3KN3A 1NL5A 4DIGA 2Z8FA 3LUYA 1I6QA 5DT6A 4GXSB 2H99A 2ZYNA 2Z22A 3T9HB 4DE8A 1LRZA 4OWDA 2Y7PA 1AMFA 3RT8A 3U1OA 1A99A 2H4IA 3HN0A 4OEUA 4THIA 3L6GA 3TEPA 1B1XA 3O9PA 3T66A 2ZMBA 5B7DA 1LB9A 2Y7RA 2ZYOA 5TU0A 4R2FA 2P0SA 1ZU0A 3M3FA 2X26A 3TZAA 4OMBA 3SEWA 2F97A 4F1VA 2NUVA 4GFRA 3PD9A 2XX9A 5DYHA 1XT8A 1J1NA 4R9GA 1XS5A 4LQ2A 4ZEFA 1N76A 1SI0A 4Q8RA 3VVEA 5EHMA 2UYFA 1Y4TA 4KI0E 4CQIA 1B4ZA 2H98A 1CE2A 2OWSA 4Z7EA 3RTFB 3V83A 1EZOA 2ALUA 1SI1A 1UQWA 2D5WA 2DQVA 1AOVA 1MY3A 4XIGQ 3QUFA 1SW2A 3PUYE 4Q30B 3K6WA 3I6VA 4H8JA 3R7XA 1MPCA 2XXTA 4YB7A 4P0GA 1P1OA 2ZYKA 4NF5A 5J1DA 4AB5A 4RPNA 1FQDA 3C33A 4EQBA 3EPEA 1ZKBA 1QUJA 3UORA 3VVDA 4J2CA 4MH5A 2D3IA 2C5IT 5A5XB 1MH4A 2F36A 1B3FA 4BLAA 1II5A 2I49A 3U93A 1PDAA 4DCYA 3UGWA 3TKLB 3GBBA 5H8HA 1SBPA 1KWHA 3H4ZA 4OZ9A 3CFLA 3DP4A 1FQAA 1FW0A 2X9YA 1LCFA 3VXBA 1B0HA 4L0RA 1S7YA 1RYOA 2AYSA 1JETA 4U4XA 1A40A 1Z0PA 1PEBA 2REGA 3THIA 1B4HA 3V89B 1OVTA 1IEJA 1MS7A 3H6TA 2Q9TA 4FAJA 3IK6B 3OELA 1NNKA 5ICQA 4LATA 4LZ7A 1QKBA 5AA2A 3B6TA 1OLAA 1YTVA 5H8QA 1LSTA 2V93A 4G8MA 1LBBA 1URDA 5L8DA 4JXIA 4ZZAA 2XXXA 1SW5A 1MM7A 2B65A 2XD3A 4R73A 5TPAA 3M8UA 1YPNA 1DTZA 1P1NA 3PPRA 1IXIA 3PUZE 3FVOA 2DE3A 4PFWA 2ESNA 2RC9A 3VLUA 3QYTA 1MXZA 3SERA 2ABHA 2F7CA 2OZZA 5CC2A 4I62A 5JEIA 1M5DA 3HO7A 2FYIA 4AQ4A 4GVOA 1ZIUA 4FI5A 3T9UA 4HCWA 3P7IA 1JQFA 1JVXA 3S9LC 1PB8A 1VFEA 4IO2A 2E1SA 3K1PA 3G3GA 1Y4CA 2HXWA 3ZKLA 1B5IA 3RLFE 2YPNA 1QJMA 1HSEA 4ELOA 1XVYA 4F18A 1ZKEA 4JSOA 2NWJA 2O1LA 3MP8A 3EQ1A 2HAUA 5I57A 4N6PA 3EHTA 4O3CA 4KPTA 1NH8A 4Q5TA 5CM6A 2C5JA 4YMBA 3MW0A 4MFIA 1NKXA 1B9JA 4IB2A 1DSNA 2M8CA 3ZS6A 4OFJA 1MM6A 1D4NA 2Q88A 4XXUA 4E0XA 3GZGA 2HAVA 4GIZA 1JVYA 3N26A 4DNDA 4PP0A 3LSLA 4ZEKA 3SESA 3MPKA 1IJ5A 1JW4A 3LSFB 4PE5B 4I8CA 4LZ5A 3FASA 3C4MA 3CR9A 2PX1A 3KN7A 4X48A 4QFOA 1I69A 3IL1B 2VGQA 4R2BA 3KG2A 4F1UA 1MXYA 2AL4A 4OERA 3O6GA 5AA4A 5I56B 4RY1A 4IO4A 3SEVA 2CMOA 2QJEA 1XHYA 5AA3A 5DVFA 1DPEA 3AXFA 4OENA 2I4BA 4LA9A 3V8XB 3OO8A 1OLCA 2XXUA 3OSRA 5I58A 1O7TA 1UTHA 4X1BA 3OD7A 3DLNA 3FV2A 3TTMA 4YKIA 2RF1A 1Y3NA 2DWHA 4UACA 4RYAA 3OENA 2A5TB 3ILTB 3B7DA 3TUSA 4ZZEA 1B05A 3ODBA 2IC6A 1B3HA 2Q89A 4YKJA 3LSXA 4AB6A 2R71A 4U2RA 1S9TA 4YMAA 4YAHX 3G7WA 1MXXA 4BDRA 1MH3A 4EQ9A 3TMGA 1JW1A 3N6UA 1B51A 2P2AA 4IY5A 1S50A 5I59B 4F3GA 3IO4A 4C1UA 1LFGA 3O6IA 1R1NA 3PU5A 2Y7WA 2I0CA 4GD5A 4GQOA 2XX7A 2KLFA 1YAEA 3C35A 1POY1 1B3GA 2ZXTA 3GXAA 5FTHA 5M2VA 3RNNA 3UIFA 2RINA 3QK6A 3JZJA 5ITPA 1ZBMA 3MUQA 4MLVA 4OHNA 4QF9A 1OQGA 4KYDA 3MVWA 2KWIB 4NF8B 3KEIA 3E13X 3H06B 3CG3A 2ZYMA 3K6UA 2UVIA 1HSJA 3IOVA 3SEXA 1A8FA 3CFZA 3PPOA 2Y7IA 2F5XA 4GLIA 3FVKA 1CB6A 4GL0A 2I48A 3O6HA 1B58A 1P99A 2DXRA 2O6AA 1IQ7A 3H7MA 4U23A 1IZ1A 4NF4A 4H8IA 4YB5A 2NXOA 3L3PA 3BKIB 1FQFA 2R9JA 3IJXB 4DLDA 4TLLB 1GTKA 1JNFA 3Q29A 4F3SA 3U8QA 3C9HA 1EH3A 1USYE 2HFBA 4C1TA 1PB9A 5JTYB 3SEYA 4OFLA 1TT1A 3D4GA 4FJPA 2CZLA 4H65A 1QVSA 3FXDB 3OXNA 4ELQA 4JDFA 4FEBA 4H5GA 1R9LA 3TTKA 1Y3QA 4N13A 3K1NA 2I58A 1FCKA 1FTMA 4F22A 3PUWE 2V84A 4NEDA 3ECRA 4JWYA 3O97A 2RCBA 1B2HA 1YCJA 4RK2A 1QW0A 5H8FA 3MPLA 1Y1MA 3FIRA 1N0TA 2O69A 1B7HA 2UYEA 1XOCA 5HPQA 1XC1A 3OEMA 2H5YA 5DVJA 1B6HA 4WEDA 2F7BA 1N3WA 4FE8A 2LAOA 2PMSA 4H1XA 4LP2B 4P0IA 1Y20A 3H03A 3PPQA 4F39A 1P1UA 5H8NB 3K01A 4OFOA 4XKNA 3TKDA 4JWXA 4G68A 4GL8A 1LAGE 4H0WA 3Q28A 3IR1A 4FIMA 4QFPA 1FTOA 1MG1A 2WKYA 1UTBA 3IO6A 3MP6A 3T9VA 2XTLA 1NMUA 4Z0IA 1DPPA 3EHUA 5CBSA 4ZE8A 3KJ7A 2O84X 1NH7A 3RY3A 4RNSA 2QMXA 4QHQA 2Q2CA 2DSFA 3UA8A 1MY2A 3FV1A 2Y84A 1H76A 3FJ7A 3RT6B 5I2NA 4QSEA 5L9MA 1A8EA 2QSXA 5KCJB 1EZPA 4IO3A 2PVUA 4H5FA 3K6VA 5ICTA 2OJTA 2X7PA 2XXQA 3ONMA 3Q27A 5I2KA 3UP9A 4NF6B 3K02A 2XD2A 1VE4A 1B40A 2DWJA 3CIJA 4ZDMA 1ATGA 3RUMA 3QXMA 3B6WA 1ZJLA 4LONB 3TYHA 4P11A 4HW8A 3R6UA 1F9BA 2VD2A 3PMVA 3TTRA 3ZKKA 5KDTB 4EF2A 4X9TA 3BFTA 1UTHB 2OBGA 1MDP1 1NFTA 4I1DA 5ELVA 4R6KA 2DXYA 1BLFA 2XXYA 3PD8A 5ITOA 4U21A 3H6WA 2F78A 2IA4A 3EN3A 4XKQA 2ANJA 1D9VA 3KGCA 1Z7NE 2DE4A 5BUUA 4KCCA 2OLBA 3RPWA 2K48A 4ELRA 1I6BA 4YZZA 4F2QA 2RCAA 3CRBA 3RN8A 3OSQA 4F3PA 4G4PA 3IB0A 2GHAA 4OYVA 2XXRA 3H6UA 4ONYA 3IOUA 4DXBA 1LVFA 1JEUA 2ONSA 3RGYA 3TAJA 2IC9A 2UVGA 1TFAA 1ZMGA 2QS4A 1MY4A 1TXFA 5TP9B 3JYRA 1URSA 4MF3A 4NWCA 3A3CA 4R74A 2UVJA 4TQUQ 3U72A 4BDMA 1IXGA 4OETA 3ZSFA 4HS7A 3TQLA 2MBGA 1M5BA 3O66A 4ISUA 4TOZA 3KZGA 1GGGA 1QUIA 3W9WA 4G8NA 3QSLA 1N84A 2PT2A 1AL3A 3M3KA 1BTJA 3OOAA 1R9QA 2Q2AA 4KFQA 3C34A 4QRZA 4EQ7A 1LGBC 2V3UA 3EF7A 3U94A 3L6HA 4NTLA 4B6XA 1BP5A 1OQHA 1OMPA 3SETA 1A54A 1N3XA 4JB7A 3MZBA 5A5XA 3N6TA 5CMCA 4QSCA 3HHFA 1QKAA 1MY1A 1L5TA 4NF4B 3N94A 4EXLA 3K6XA 3PGFA 1LAFE 4U1OA 2QL3A 1NNFA 3VXCA 3HPIA 4Q0CA 1UIVA 3DP6A 2I3VA 4OQOA 4YB6A 3O29A 2IEEA 1PB7A 3T93B 4DCXA 5B70A 4PFUA 5FHMA 4RA1A 4YICA 2V3QA 3GLBA 1MQDA 4GF8A 2P1SA 1B32A 4GXAA 3ILUB 2H9BA 1A55A 1H45A 1SVXB 2FA7A 2ONRA 3H3GA 4M4GA 2QS3A 5AE4A 1PBQA 1QUKA 3HHGA 3TPAA 5F1QA 1H44A 1MXWA 4QFLA 5DEXA 3U92A 2KWHA 3IORA 2F8DA 5CMMA 2F6GA 5HM4B 3OO6A 3TCGA 2NVUB 2UXAA 1GV8A 2OK2A 3F11A 2HQ0A 2O7UA 3CVGA 4YKKA 1I6AA 2DWAA 4EF1A 1N7WA 4QSDA 1P1WA 4RPOA 4G68C 3IJOB 4F3BA 3SEUA 3TCHA 3VV5A 3VLWA 2Q8JA 3SKPA 2HEUA 1NNTA 4XTCQ 4DZ1A 3FXUA 5DVIA 3KSJA 2O1MA 4U22A 3IAZA 2QS1A 1MQIA 3FVNA 2OCUA 2UVHA 3TELA 2PYYA 4NF5B 1US5A 3IX1A 4IGRA 4ESWA 4JBZA 2PT1A 5JK4A 2W7YA 3MQ9A 2DVCA 2OWTA 4FORA 4N07A 2REJA 3G3FA 1MDQA 3RQTA 3OO9A 5I2NB 3E4RA 2XXPA 5CRYA 3G3HA 1O63A 4RK9A 1D9YA 3FVGA 5BWJA 2GHBA 5H8HB 4NMYA 1USYH 2FNCA 3DM0A 1T0KA 1B3LA 3K4UA 3BFUA 2QPQA 2V25A 2DVZA 2H25A 3CKDA 1MRPA 4ZEBA 3CVRA 3BBRA 2HZLA 4FECA 3MVXA 4KYSA 4F2OA 5AA2B 2RKMA 3TFLA 4BDLA 5H8QB 2R6GE 3PMXA 1MPDA 3CFXA 1NNPA 3G3IA 1H3DA 3VE1B 4ESXA 3MP1A 4IO7A 5TPAB 2XXIA 2O51A 5DTBA 4PFTA 1EZ9A 4PQJA 3G3KA 2A5TA 1PC3A 4KHZE 1WDNA 3MVZA 4IO6A 3LC8A 4DDDA 3S4UA 3WAFA 1N04A 3S2VA 4KYEA 3JV9A 2YJPA 3EHSA 3D4CA 2I4CA 4K3FA 1Y9UA 2I3WA 5I59A 1H43A 1IXHA 1N7XA 3K2DA 2Y7KA 1SD3A 4JSDA 4H67A 2AIXA 1AH5A 5L9SA 1Y1ZA 5K2YA 3A3UA 5CMBA 1O64A 1VR5A 1Z7ME 2F34A 3S9NC 2XX8A 1MQHA 1B46A 4WEPA 3LR1A 5I57B 1FTKA 3LBSA 1A7LA 3E9XA 2THIA 3MAMA 3IB2A 4X1DA 2GH9A 2G93A 4F31B 3KFMA 5IKBA 4NF8A 3FD3A 2VD3A 2X9WA 1LCTA 3C32A 4OXVA 4POXA 1LB8A 3QIMA 3FJGA 1P1QA 1XVXA 1BIYA 2F7AA 3PUXE 4WKMA 5EYFA 2B3FA 4R72A 3USDA 4NWDA 2B3BA 3QUJA 4EYYR 5I84A 3KSXA 2I0BA 3MZ9A 4UA8A 2HZKA 3PUVE 3UK4A 4F19A 4ZS9A 3RTWB 5FHNA 1M5EA 3W15C 2VOZA 2F35A 5HBCA 3PV0E 4IO5A 1TWYA 2PBWA 4HTGA 1MPBA 3PMWA 1SDXA 3VLVA 3CG1A 1MQJA 2QS2A 3UN6A 1RKMA 3MWBA 1JW5A 4DXCA 1MQGA 5AA4B 4IGTA 2XXVA 1H7CA 5JTYA 3CSGA 2I6EA 3HCQA 4ZEDA 3MBPA 1SW1A 5I58B 1EU8A 1LBCA 4JWOA 1B3EA 4EDPA 4YU0A 2RC8A 1M5FA 2DP8A 2O68A 1VSOA 4BDNA 1HSLA 3FUZA 4MBPA 2Z8DA 2ZNUA 3O28A 1FQCA 3E3KA 1ZTYA 5ISUA 5AA1A 3KOSA 1US4A 5KZTA 3OEKA 1LAHE 4U4SA 4R6YA 4GOTA 5DEXB 1PBPA 1DTGA 2XXWA 3QAXA 1SW4A 4MLQA 1R6ZA 4GWOA 2A5SA 2HCAA 3C36A 1FQBA 1WODA 4GRKA 1Q1KA 4OEVA 3KBRA 4E0WA 1B7ZA 3Q25A 3T96B 1IITA 1QULA 3FXQA 1MY0A 5H8NA 3FJMA 1LLSA 3H6VA 2XXHA 5CI5A 4XKPA 4G2ZA 2XHDA 2Z8EA 1ZLQA 1Q35A 1GR2A 1SYIA 3GBAA 3IOWA 2AL5A 4FEDA 4NE4A 4EXKA 4OESA 4LZ8A 2DYXA 2DE2A 3CI8A 4LQ5A 5H8SA 4TLMB 4QFKA 1IUDA 2YLNA 3TTLA 2X7QA 4WXJA 1FTLA 3FZVA 3VFJA 2G29A 4F29A 4R75A 4OVJA 3M3LA 4F1YA 4L17A 5KCJA 3W9VA 1LAXA 5CMKA 2DWIA 3DP8A 1VFDA 1QSDA 1TFDA 4O3BA 4HCYA 2E0SA 4QFNA 1RYXA 2F6PA 3FGSA 1UIUA 4ZE9A 3T22A 4LVQA 3KOTA 3TTNA 1MXUA 3WAEA 1B5HA 1MXVA 1FQEA 2VP1A 3K1MA 3I5OA 4NF6A 4H6DA 1AIVA 4O3AA 4POWA 1BKAA 3KJTA 2Z23A 2VHAA 3KN8A 1B5JA 3C31A 3S9MC 3S9EA 2V3TA 3PPPA 3MJNA 3A09A 3I3VA 4ECFA 1OIBA 5FHOA 3HSTA 5EHSA 2ONKE 3SDFA 3TDJA 3HV1A 5KDTA 3Q26A 2X9XA 1GVCA 1DOTA 3FXEB 1FTJA 5LOMA 4G77A 1B0LA 3DELB 3MC2A 4PFYA 3K00A 2C5KT 1DMBA 5H8FB 3OMBA 1B52A 3V5AA 4OTEA 3PPNA 4RXLA 5IAIA 4R9FA 2CA5A 1B7UA 1ELJA 3VDFA 4EUOA 4U1ZA 1WVJA 1URGA 2O7IA 1LFIA 3IOTA 1ANFA 1SYHA 5F7VA 4G8HA 3TODA 1IJ6A 4KD5A 1POTA 3MVYA 4G68B 2ZNTA 2GRVA 2QMWA 4PETA 5AA2D 4ZECA 4KQPA 5TP9A 4BDQA 4M1VA 3FATA 2D21A 4IY6A 4DXUA 1UTBB 4R6HA 1Y3PA 4FATA 3VVFA 2ZNSA 4KR5A 4I9DA 4RJZA 1OVBA 3K0VA 5FTIA 3O2AA 3T9XB 4ZEIA 2DS9A 4C0RA 3LSWA 1SQYA 3OO7A 1LFHA
chains in the Genus database with same CATH superfamily
3MZ1A 5K2XA 1SA0E 5HEUA 3CSBA 4EYUA 4UVCB 2GFEA 3ONLC 3RYHE 4KCDA 2WBBA 4XKRA 4DV4T 3FXRA 4ELPA 4HE2A 1RDZA 1K9ZA 2WU2A 1M5CA 4XBFB 4LUBA 1D3KA 3IB1A 5HXHA 5FXWA 1B1HA 1IIWA 2XAFB 4TN7B 4P9KA 1FPKA 3TQWA 4BDOA 3UFGA 2IAKA 2V26A 3B6QA 3G3JA 2BS4A 4MHCA 5F5WA 3J9X1 2RPAA 3TLSA 5FKYA 3R26A 1IMCA 2QRYA 4NPPA 3ZCIA 3KBZA 5I2KB 4O2BE 3SRZA 4O8SA 2X0LB 3TCFA 5F24A 3N5LA 5L3EB 3AECA 2QRXA 5HCMA 2XQ8A 2QGSA 3N9QA 5EK3A 4MAGA 5L9OA 4PCDA 2NOOA 3UT5E 1J1JA 2LKGA 3MXZA 4HKAA 1IXCA 1IBKT 4OVQA 4YKPA 2G0UA 2BJJX 5CBRA 1YD8G 1JEVA 2RC7A 2BG9E 4ND9A 1D0ZA 5JDNA 5LGNB 2DOJA 3KN3A 1NL5A 5I56A 3ANWA 3A29A 4DIGA 2Z8FA 3LUYA 2XAHB 4GWZA 3LK2B 1I6QA 5DT6A 4GXSB 5AQHB 3PUWF 1XMQT 2H99A 3ESLA 1S94A 2ZYNA 3PTRB 2Z22A 2LJLA 2I0MA 2WDQA 4YHHT 2LHRA 1RDYA 3T9HB 4GWYA 4PF8A 3RYIE 5FMNA 3OKQA 2VL8A 4DE8A 1LRZA 4OWDA 4QXCB 4A56A 4PGNA 2Y7PA 3ZKRA 1AMFA 3BIHA 3EDVA 5LGTB 3RT8A 3U1OA 3B50A 4GX4A 4GYSA 3ZSSA 1A99A 5C3JA 3ZMVB 2H4IA 3HN0A 4QXDA 1T72A 4OEUA 4THIA 3L6GA 4U7YA 3ZN1B 3TEPA 1B1XA 1KEYA 3O9PA 3ONJA 4L5GA 5ADXL 2JQHA 1K9YA 2ZMBA 3T66A 5B7DA 1Z8UA 1D9QA 2EHOD 1LB9A 2Y7RA 2ZYOA 5TU0A 2BG9C 4R2FA 2P0SA 1OEDB 3VRAA 1ZU0A 3M3FA 2X26A 3TZAA 4OMBA 3SEWA 3E0ZA 2F97A 3AE8A 3DP7A 2BG9B 4KMCA 1M62A 4F1VA 3M65A 3HA4A 2NUVA 1ZV4X 2L5VA 4LMJA 3PD9A 2CHOA 4GFRA 2XX9A 4UR9A 5DYHA 4CXXA 4MHFA 1XT8A 1SPIA 1J1NA 4R9GA 2CBIA 2X68A 4G61A 1XS5A 4LQ2A 2LSIA 4MEVA 2NW8A 4N78D 4ZEFA 1N76A 1SI0A 4Q8RA 4C90A 3VVEA 3H37A 5EHMA 2VVSA 2UYFA 1Y4TA 1IAPA 4N8YA 1CHUA 4TV9E 3AB3B 4KI0E 4TWHA 5T3JA 4ZI7E 4CQIA 2XQAA 2WWUA 4ILBA 1MMGA 4MFRA 1B4ZA 2H98A 1NV0A 4DVDA 4IT4A 1CE2A 2OWSA 4Z7EA 3RTFB 3ZJ1A 3V83A 3UQ4A 2ALUA 1EZOA 3ZYMA 1SI1A 1UQWA 2FJEA 2D5WA 4C91A 1FPFA 3U65A 5EK2A 2DQVA 1N32T 1AOVA 1MY3A 1HR0T 3RIUA 4XIGQ 4NGUA 3OYXA 2W0GA 2H7OA 2YOEA 3QUFA 1SW2A 3PUYE 4Q30B 4WW0A 3QB5A 3K6WA 3I6VA 4H8JA 1LBXA 5GONE 1LBVA 5EYHA 3PU8A 5L2LA 3R7XA 5ET8A 1MPCA 5JDLA 3T8OA 2XXTA 3A8YC 5LMNT 4DR3T 4YB7A 3UU8A 4P0GA 1P1OA 2ZYKA 3LDQB 4NF5A 4XZCA 3T0JA 5J1DA 4AB5A 1FPJA 4X1YE 4OA4A 4RPNA 1N34T 1SE7A 2WWVA 1FQDA 3C33A 1WR6A 5I5PA 3AE4A 4EQBA 2OLTA 2CCQA 3EPEA 5CJ5A 1ZKBA 4X65T 1QUJA 4OVRA 1HNWT 3UORA 3VVDA 4HFEA 4J2CA 4JVCA 2P3VA 5HXEA 4X8RA 4MH5A 2D3IA 3P4RA 2WYKA 2C5IT 3RX6A 5A5XB 3NZPA 1MH4A 2F36A 2YINA 4Z8XA 1B3FA 4AQFA 4BLAA 1II5A 2PBIA 4JI4T 2I49A 3U93A 1V9DA 1PDAA 4PF6A 4DCYA 1FBFA 3UGWA 2ZZVA 2QVVA 3TKLB 2WZHA 3GBBA 2FBWA 5KXJA 4ILCA 3CIRA 2VB6A 2WZIA 5AQUB 4A5XA 1SBPA 1KWHA 5H8HA 5FP3A 3CQCB 5FVLA 3H4ZA 4UF0B 3CFLA 4OZ9A 3DP4A 1FQAA 1FW0A 2X9YA 1LCFA 5FVKA 3W15B 3VXBA 5JH7E 1B0HA 4L0RA 1RYOA 1S7YA 2AYSA 3ZEFB 1JETA 2WQYA 4HWDA 4U4XA 1A40A 2L3LA 1Z0PA 3N9LA 1PEBA 2REGA 3THIA 1B4HA 3V89B 3AE1A 2ZM6T 5DQVA 1OVTA 3ABVA 1U4QA 3HKEE 3I1AA 1IEJA 2VKHA 1UX5A 1MS7A 3H6TA 3E78A 1G0HA 5IGAA 2Q9TA 4FJOA 4OVSA 4FAJA 3GN5A 3PUZF 3IK6B 3OELA 4ILAA 4OYKA 3O9XA 1NNKA 5ICQA 3ZT7A 4LATA 2XY8B 4LZ7A 1NWMX 3RYDA 1QKBA 5AA2A 3B6TA 1YKHB 2LLYA 1OLAA 1JP4A 3NWIA 1YTVA 5H8QA 4JI0T 1LSTA 2Q9QA 4HEAA 4MBQA 2CZKA 3AE5A 2JQKA 2V93A 4G8MA 1LBBA 1URDA 2PTFA 3C64A 2IHR1 5FY1A 5L8DA 4JXIA 1NUYA 4ZZAA 4E7SA 2XXXA 4ZI2C 3RC8A 1SW5A 4NXMT 1MM7A 3OBVE 5IZ3B 2B65A 2XD3A 4R73A 3KC1A 4NX1A 1D0YA 5TPAA 3M8UA 1YPNA 1DTZA 1P1NA 4GIWA 3PPRA 1IXIA 2I6HA 3PUZE 2ZM8A 5FXVA 3FVOA 2B1EA 5J2UE 1SUMB 3Q9DA 2WMNA 2DE3A 5L47A 2WMOA 4PFWA 2DCFA 2ESNA 2NW7A 2RC9A 3VLUA 2C0SA 4HXVA 3QYTA 5KX5E 1MXZA 3SERA 2ABHA 2VK9A 4IHJE 2F7CA 2OZZA 4LF6T 5CC2A 4I62A 4GK0E 4DI3D 5JEIA 2YDSA 1FJ6A 3B8BA 1M5DA 3HO7A 2FYIA 4QKNA 4PDDA 5HEGA 4B3MT 4N8GA 4MALA 4AQ4A 4GVOA 4PAFA 2NTYA 1ZIUA 5AQOB 4FI5A 3T9UA 2CXFA 4HCWA 3P7IA 1LBYA 4X04A 1JQFA 4QX7B 1JVXA 4P1LA 5JDGA 5FL0A 3IHRA 3S9LC 1PB8A 1VFEA 2QVAA 4IO2A 2E1SA 3K1PA 3G3GA 2FIEA 1Y4CA 3OYZA 2HXWA 3ZKLA 2BKPA 3ZMTB 4N6KA 3ZYLA 1B5IA 3G06A 2LOSA 4CI1B 2E9XD 1UCUA 2LRKA 3RLFE 3BQKA 5CA0E 2V7LA 5JREA 3HR0A 3PUQA 2YPNA 1QJMA 1HSEA 4ELOA 1XVYA 2GQ1A 4F18A 2XQ4A 3QC9A 2CEXA 1ZKEA 2PFZA 4JSOA 2NWJA 1XDPA 2O1LA 3MP8A 4JI8T 5LGUB 3EQ1A 2HAUA 5I57A 4LF5T 5L3FB 3A5XA 3ZMSB 2OWZA 2YDRA 4N6PA 3EHTA 4IDNA 4O3CA 4P3LA 4LMKA 4KPTA 1NH8A 3RYCE 4Q5TA 3EUHA 5CM6A 2C5JA 4YMBA 2VURA 3MW0A 4MFIA 4LF7T 4NIQA 1NKXA 3T1BA 2CHNA 1B9JA 4IB2A 2LSKA 1DSNA 1EYKA 2M8CA 3ZS6A 3AEFA 3UU5A 4AI6A 4OFJA 2EHOA 1MM6A 3CX8B 1D4NA 2WX9A 1IMEA 2KZ7B 2H89A 2Q88A 4P47A 4DR6T 3KBUA 3LSVA 4XXUA 2WY2A 4E0XA 4PJLA 3GZGA 1FJ9A 2HAVA 5JDHA 4GIZA 3Q5XA 4F6RC 1JVYA 4PK5A 3N26A 2JPFA 4DNDA 3N2GE 5FNVE 4LFCT 4PP0A 3LSLA 4ZEKA 3SESA 3MPKA 4JLEA 1IJ5A 2Y8DA 1JW4A 5LB7B 4AISA 3LSFB 4I8CA 4PE5B 4XF5A 4LZ5A 3JCFA 5HXRA 4F8HA 4DV1T 3FASA 3C4MA 2VQFT 2W2UA 3CR9A 3GYYA 2D2SA 2PX1A 3N2KE 3RC3A 4NAPA 3O1JA 1D1AA 4GYRA 3KN7A 5EYGA 4QFOA 4X48A 1I69A 3IL1B 2XM1A 2XAGB 2VGQA 4R2BA 3A7MA 4GWWA 3KG2A 4F1UA 1MXYA 2K9AA 2YKSA 2AL4A 4OERA 4DUYT 3O6GA 5AA4A 5I56B 4RY1A 3ANWB 3PU3A 1FPLA 4IE4A 4IO4A 4HTEA 3SEVA 4OX9T 3BK9A 4HFDA 2UXDT 2CMOA 2QJEA 1XHYA 5J16A 5AA3A 5DVFA 1DPEA 3AXFA 2FJBA 5JDMA 4NF0A 2ES0A 2I4BA 4OENA 4BJMA 4LA9A 3V8XB 1FMWA 3OO8A 1OLCA 2XXUA 4GWXA 3OSRA 5I58A 4AQYT 1O7TA 1UTHA 2UUBT 1NV3A 3OD7A 3TLTA 4X1BA 3DLNA 3AEBA 3FV2A 3TTMA 4DMVA 4YKIA 1KF6A 2RF1A 1Y3NA 4DR2T 2DWHA 4MIJA 4N6DA 5IYZE 4UACA 4O4IE 4UVBB 2WDVA 4AKIA 4ZOLE 2N9DA 4HFVA 3VKGA 4RYAA 2J4GA 3OENA 1EYJA 2A5TB 3ILTB 3B7DA 3TUSA 1LBZA 4ZZEA 1B05A 3ZJ2A 3ODBA 3OVUA 2IC6A 1B3HA 2RP4A 3FBZA 5FXXA 2Q89A 4YKJA 4PBQA 3LSXA 4AB6A 2R71A 4U2RA 2X67A 1S9TA 3IFAA 4YAHX 4YMAA 4QX8B 3G7WA 3RRWA 3JAEA 1MXXA 5HCJA 4BDRA 1MH3A 4EQ9A 5ABFB 4PC9A 3TMGA 1JW1A 3HI2A 4GX3A 3N6UA 2VASA 1B51A 2P2AA 4IY5A 1S50A 2IMLA 3AEGA 5I59B 4F3GA 3IO4A 4C1UA 1LFGA 1UGOA 3O6IA 4EV6A 2N2NA 3MSTA 1R1NA 3PU5A 1IBLT 2Y7WA 2I0CA 4GD5A 4GQOA 2XX7A 2KLFA 3LG7A 3M3ZB 1YAEA 2Q74A 4PK4A 3C35A 1HG5A 1POY1 1VCTA 1B3GA 1XZYA 2ZXTA 5AQJB 3GXAA 3PJAJ 5DABA 4EB6E 3RIUC 3IEEA 5FTHA 5M2VA 4HWIB 2FUPA 3RNNA 5DQWA 3AE9A 3UIFA 2E2AA 5JRCA 5LTCA 3AEAA 2RINA 3QK6A 4O4HE 3JZJA 3DJBA 1N33T 3RPLA 5ITPA 1ZBMA 5AFUL 3MUQA 4MLVA 4OHNA 3N2OA 1HNXT 1NV5A 2CEYA 4QF9A 1OQGA 4KYDA 3N9NA 5EZYE 3T1HT 3MVWA 1LEVA 2PJQA 4DMWA 2LSGA 2KWIB 4NF8B 2VKOA 3SZPA 3KEIA 2FJDA 3E13X 3H06B 3CG3A 3HL6A 3JC6D 2ZYMA 4FBPA 4IE5A 3CPZA 4DV7T 3ZC1A 3K6UA 1FBEA 2UVIA 2MPKA 1HSJA 3IFCA 4ZZBA 3IOVA 3SEXA 3MKDA 2CEAA 3L8RA 2P3NA 1A8FA 4K0KT 1WFDA 3LBXA 3CFZA 3PPOA 2Y7IA 2F5XA 4GLIA 3UUNA 4AQFC 3FVKA 1CB6A 4GL0A 2B76A 5AQFB 4LF8T 2I48A 3O6HA 1B58A 2XHEB 3UUBA 4I4TE 4TWDA 2ODVA 5TAOA 3ZN0B 1P99A 2DXRA 1YZ0A 3RI5A 2O6AA 1IQ7A 1J5WA 3H7MA 4U23A 1IZ1A 4NF4A 4H8IA 1LVKA 4YB5A 1QUUA 2Y48B 2NXOA 2KMFA 3L3PA 3BKIB 1E7PA 1FQFA 4O8MA 2XUEA 2R9JA 4UABA 3IJXB 3AAEB 4DLDA 5J1GA 3FBLA 4AIUA 5LMUT 2LKHA 4TLLB 1GTKA 4B3TT 1JNFA 3Q29A 4F3SA 3U8QA 2MKZA 3NBXX 3C9HA 1EH3A 1NENA 1INPA 1T7SA 1USYE 3KV6A 3KBTA 2HFBA 4C1TA 1BR2A 1PB9A 1IMAA 5JTYB 3AAAB 5L3CB 3SEYA 4OFLA 2E9XA 2VQET 1YW0A 1TT1A 2LRLA 2Q9QC 1NUXA 3FZHB 4OYJA 2A9UA 1FMVA 3CHGA 3D4GA 2N1GA 3FXBA 2MOZA 4YSYA 4FJPA 4ILUA 2CZLA 4PAIA 4H65A 2KNDA 1MIVA 3FXDB 1HX1B 4HWHA 1QVSA 3OXNA 4B3RT 5AQTB 4PAKA 4ELQA 4JDFA 4FEBA 3BQIA 4H5GA 4NG7A 1J5ET 1R9LA 3TTKA 3H3MA 2V7MA 4P8BA 1Y3QA 4N13A 5HXCA 2Y5KA 3LK3B 2IIUA 3K1SA 1FTAA 3K1NA 4PFBA 4PAGA 2I58A 2PG8A 1FCKA 2Y5LA 5CGMA 5KDMC 1FTMA 5LCYA 4F22A 3PUWE 4LMLA 4NHBA 2V84A 4NEDA 2NOXA 4QH5A 3ECRA 2WCAA 4JWYA 1NEKA 3O97A 2RCBA 1B2HA 1YCJA 3LUZA 4RK2A 1QW0A 5H8FA 3MPLA 1Y1MA 3FIRA 1N0TA 2O69A 2DL1A 2V6YA 1B7HA 2UYEA 1XOCA 5HPQA 1XC1A 4JI7T 3OEMA 3K3NA 2H5YA 3HKDE 1LBWA 5DVJA 4HWFA 2AE9A 4DR5T 1B6HA 1RDXA 4WEDA 4Q25A 2VKDA 4H9QC 1N3WA 2F7BA 4FE8A 2W67A 2LAOA 3RPUA 2W63A 2PMSA 4H1XA 4LP2B 3HFUA 3ZT5A 2NTXA 4P0IA 4IDZA 1Y20A 4KXPA 3UUMA 3H03A 4OFZA 2XQ3A 3PPQA 1VRBA 4F39A 3X1DA 2M6BA 1P1UA 5H8NB 5EK4A 4I3EA 3K01A 4LN5A 1YQ3A 4OFOA 4XKNA 2HN2A 4KP3C 5F8PA 3TKDA 2ACXA 2V7KA 4U72A 4JEUB 4JWXA 4G68A 3ETUA 4GL8A 1LAGE 4H0WA 3Q28A 5IZ1A 3IR1A 4FIMA 4QFPA 4QBAA 5CA1E 1FTOA 4WZXA 5ET5A 1MG1A 5EQ8A 4P56A 2WBDA 3P4QA 4P09A 4MX6A 2WKYA 4EEBA 1UTBA 3IO6A 3MP6A 3T9VA 3PUXF 2KSRA 4DV3T 1MIYA 2XTLA 1NMUA 4IDOA 4Z0IA 1DPPA 3EHUA 5CBSA 1FIOA 1IMBA 1AWBA 4ZE8A 3KJ7A 2O84X 1NH7A 4MMPA 3RY3A 4RNSA 3ZYKA 4X1KE 2WB5A 5LBQB 3E22E 5LJMA 1FJGT 2QMXA 4QHQA 4YJ3E 2Q2CA 2DSFA 3UA8A 1MY2A 2EHOC 3B13A 1NAFA 3FV1A 2Y84A 4PFIA 1H76A 3UULA 3FJ7A 4MNIA 3L39A 3PUSA 5AQKB 5DW8A 3RT6B 5I2NA 4QSEA 5L9MA 5BR8T 1A8EA 2KR0A 2QSXA 1WCRA 3ZPOA 5KCJB 2CWOA 4IO3A 1EZPA 2A2FX 2PVUA 3UUXB 4H5FA 5EQ7A 4HFIA 1OXZA 1N36T 2WP9A 3IF8B 3AEEA 3K6VA 5ICTA 3KDSE 3RF1A 3U78A 2OJTA 2X7PA 2XXQA 2XWOA 3ONMA 3Q27A 5LG4A 3FHNA 4MCOA 2VPOA 4IR8A 1NI9A 2OX3A 5I2KA 3UP9A 3LFMA 1Y64B 4NF6B 2Y6XA 3P4SA 3K02A 1G8XA 1XDOA 2H7VC 4IL4A 2XD2A 1VE4A 1B40A 2D0UA 3KVBA 3CMLA 1HNZT 2DWJA 2JMHA 3CIJA 4ZDMA 5FYMA 3N9PA 1MMNA 1HTJF 1ATGA 4JYAT 2X66A 3RUMA 1MNDA 3QXMA 4U2YA 4CN1A 1ZJLA 3B6WA 4LONB 3D1RA 3TYHA 3AA7B 4IDPA 4P11A 4HW8A 5CB4E 1MNEA 3R6UA 1F9BA 2VD2A 2FJAA 2W4XA 3HKBE 3PMVA 3TTRA 3ZKKA 4KUMB 5KDTB 4EF2A 4X9TA 3BFTA 2HPGA 5C8YE 1WRDA 2XQ5A 3RIFA 4IE6A 1UTHB 2OBGA 3AAIA 2MYSA 1MDP1 1NFTA 4I1DA 5ELVA 4R6KA 2DXYA 1BLFA 2R8TA 2XXYA 3PD8A 3I0QA 4NUUA 3QB5K 2DWKA 1YXRA 5ITOA 4AKGA 4U21A 3H6WA 2GK9A 4HE0A 2F78A 2IA4A 2BBJA 1Q9DA 3EN3A 4XKQA 5L3BB 2ANJA 1D9VA 5LYJE 3KGCA 3ZCJA 1OEDA 1Z7NE 4EAHA 2DE4A 5BUUA 3QNUA 4KCCA 2OLBA 4IL9A 3RPWA 4MJOA 3LK42 4YJ2E 2K48A 4ELRA 1I6BA 4YZZA 4F2QA 4N4UA 2RCAA 1BK4A 3CRBA 2UUAT 3RN8A 4I3YA 3OSQA 4F3PA 5A5LA 4G4PA 3IB0A 4PNIA 2GHAA 4OYVA 4ZS2A 1T8BA 5FXZA 5JR9C 2XXRA 2XJ7A 3H6UA 4YY3T 4ONYA 2M67A 3KFWX 5LHGB 4PJJA 3IOUA 1LVFA 4DXBA 1JEUA 2ONSA 2J62A 3RGYA 3TAJA 5ETWA 2IC9A 3V5SA 2UVGA 5LHHB 3Q5WA 1HX8A 2L8KA 4ISTA 2AXDS 1VOMA 1TFAA 2XQ6A 1ZMGA 2X9HA 2PFYA 2CXLA 4DR7T 2QS4A 1MY4A 4DV0T 1TXFA 5TP9B 4XAXB 3JYRA 4O2AE 1URSA 4MF3A 2JJ9A 4NWCA 3A3CA 4R74A 2ODUA 4ZI3C 2UVJA 4QH1A 4TQUQ 3CWZB 4E7ZA 3U72A 4BDMA 3MYUA 1WR0A 1IXGA 5HEOA 2FIXA 2LT3A 2CE7A 4EZ4A 4TWFA 4OETA 3ZSFA 5DJQC 4PDHA 2P9BA 4JI1T 4PFPA 4HS7A 3TQLA 2BS3A 2MBGA 1M5BA 3O66A 4ISUA 3KZGA 4TOZA 1GGGA 2XQ9A 3F57A 1QUIA 4XEQA 3SS1A 3W9WA 4G8NA 3QSLA 5KMGP 3SWHA 1N84A 2PT2A 1AL3A 4G63A 5AQRB 4DBQA 5FBPA 1R8IA 3UQ7A 3M3KA 1E2AA 5LDZA 3C4WA 4O94A 1BTJA 3OOAA 5AQLB 1R9QA 2Q2AA 4KFQA 4LFAT 4YTMA 4IIJE 1FPBA 3C34A 4QRZA 3FBPA 4UXNB 3BIGA 4EQ7A 1LGBC 2V3UA 5ET6A 3EF7A 3U94A 3L6HA 2KT9A 3BQLA 4NTLA 2WU5A 4H9OC 2UXCT 4B6XA 2WSSV 1BP5A 1I94T 1OQHA 1OMPA 3SETA 1MMDA 1A54A 1N3XA 4JB7A 3AE3A 3OPCA 3MZBA 5A5XA 1HFAA 3N6TA 4IE7A 1KA0A 5CMCA 4QSCA 1CUNA 3VU7H 4LFBT 5L4EA 1KNRA 3HHFA 1QKAA 4UVAB 4Z91A 3SFDA 1MY1A 1L5TA 4PJNA 4EGWA 4NF4B 3TLWA 2WAUA 3N94A 3NRXA 4EXLA 3K6XA 2Q8MA 2A72A 2J1DG 5J0ZA 4YXDA 3PGFA 4EOZB 2X0HA 1LAFE 3LJCA 3EABA 4UF0A 4U1OA 4M1PA 2QL3A 3PUAA 3P50A 3C50A 1NNFA 3VXCA 3KV4A 3HPIA 4Q0CA 1UIVA 2JQQA 3DP6A 3RH3A 5LA6E 3H3AA 5ESYA 2IW5B 2E9XC 4O4LE 5LNKA 2I3VA 1YQ4A 4OQOA 4YB6A 1NUWA 4CZZB 3O29A 1FBPA 2IEEA 1PB7A 1I6ZA 2H88A 3T93B 4DCXA 2XWIA 3MZKB 5AQPB 1QGXA 5B70A 1YYZA 2YN6A 4NXNT 4ADZA 4P0BA 4PFUA 2W61A 5FHMA 2WS3A 4EIWA 4RA1A 4ZEYA 4YICA 2V5DA 2V3QA 3CQXC 4L9IA 3GLBA 1MQDA 4GF8A 1IZNB 3VRBA 4HFHA 2F3DA 2P1SA 4PK6A 2XWVA 1B32A 2V1DB 4HWCA 4GWSA 4GXAA 3ILUB 4OVPA 2H9BA 4GBVA 3UU3A 1A55A 2WYPA 1H45A 1SVXB 5IZ3A 2FA7A 2ONRA 3H3GA 4M4GA 2QS3A 2KXPB 3PJAA 4ISSA 1BR0A 3P4WA 5AE4A 3SFEA 3C4XA 5F3JA 1PBQA 3MA9A 5J2TE 4X62T 4I0UA 4QHOA 1QUKA 3HHGA 3TPAA 2WEFA 5F1QA 1DBZA 2DLRA 5AQQB 1H44A 3EAMA 1MXWA 4QFLA 5DEXA 2CLYC 3Q2MA 3U92A 2LM9A 2KWHA 2ZM0A 3IORA 2B4LA 2F8DA 5IUXA 3OO7A 5CMMA 3AEDA 2F6GA 2I59A 2V6YB 1W9RA 5HM4B 3OO6A 3TCGA 3ZMZB 2NVUB 2UXAA 1GV8A 1NV2A 2RA1A 2OK2A 4ERRA 3F11A 5JR9A 2HQ0A 2O7UA 4EXTA 5HEJA 3CVGA 4YKKA 1I6AA 2DWAA 4EF1A 3D0TA 3C51A 1N7WA 4PFOA 4UIGA 4QSDA 1P1WA 4RPOA 2HPLA 2V7JA 4G68C 3IJOB 4DBRA 4F3BA 4JVDA 3SEUA 3TCHA 4KHPT 3VV5A 4AQGA 3ISPA 2Q8JA 3VLWA 3SKPA 2HEUA 3RHWA 4JV5T 2CBJA 4MNPA 1US7B 1NNTA 4XTCQ 4DZ1A 3LV0A 3FXUA 5HXSA 5DVIA 3K3OA 3KSJA 1W09A 2O1MA 4U22A 3IAZA 2IDOB 2QS1A 4ANJA 3KINB 1MQIA 3FVNA 4X64T 2NWBA 4PGPA 3AVSA 1XMOT 2OCUA 4CN4A 2UVHA 3TELA 4U33A 2PYYA 3N9OA 4NF5B 1VCSA 1US5A 2ACZA 3IX1A 2JQ9A 3Q5DA 2YU1A 4IGRA 1FBCA 4ESWA 4WYVA 4GX6A 3CX6B 4JBZA 1FBDA 2PT1A 2DWGA 3OTOT 4YHJA 4N81A 1EZ3A 5JK4A 2W7YA 4P1NA 3MQ9A 2DVCA 2OWTA 4FORA 4TV8E 4N07A 2REJA 3G3FA 2CMRA 3WAJA 1MDQA 1JNRA 1BR1A 4CI2B 3RQTA 3OO9A 5I2NB 2W66A 3E4RA 2XXPA 5CRYA 3G3HA 1O63A 4RK9A 1KNPA 2CRBA 1D9YA 2VT5A 2NW9A 3FVGA 5BWJA 4QH4A 2GHBA 2R6GF 5AQSB 2UXBT 5H8HB 4NMYA 1USYH 2FNCA 3ZSTA 5L3GB 3AE7A 3DM0A 3GA8A 1T0KA 1UUSA 1SHZC 3L09A 1B3LA 4KBMB 2LSJA 5IM2A 3K4UA 2WM9A 3BFUA 2QPQA 5AQNB 2V25A 4UV8B 2DVZA 2H25A 5I3SA 3CKDA 4WBNE 4NN3A 2MAWA 1WYCA 2K5BB 3PTYA 3AA1B 3JADA 4YSZA 1MRPA 4ZEBA 3CVRA 3GN5B 1FBHA 1OEDE 1JNZA 2LM2A 3BBRA 2HZLA 4FECA 3MVXA 4KYSA 2BVMA 4F2OA 4WNKA 3EHZA 5AA2B 2RKMA 3TFLA 5LBMA 4BDLA 5H8QB 5AQGB 2R6GE 3PMXA 4KHZF 1MPDA 2Q9QB 1FPDA 2HHMA 3CFXA 2WDRA 1UX4A 5ABHA 3QMFA 2XA5A 2OV9A 1NNPA 3G3IA 1H3DA 3VE1B 3AA0B 4TX5A 3RYFE 2CZHA 4ESXA 3AE6A 4DV5T 2CXDA 3MP1A 3NKZA 3NZQA 4TNVA 4IO7A 5TPAB 5AQMB 3JC6C 4NQ8A 4A97A 1HF8A 2XXIA 1IMFA 2O51A 2V5CA 5DTBA 4PFTA 4I50E 4O4JE 3AXJA 3KVAA 3WAKA 3FZKB 4N91A 2SPCA 1EZ9A 4PQJA 2L9QA 2DHRA 5AQVB 3G3KA 2X0YA 2A5TA 1PC3A 1KA1A 4KHZE 1EYIA 5FY7A 1WDNA 2LHNA 3R6NA 1OEDC 3MVZA 3GWHA 4IO6A 4OHFA 2HXRA 1DU2A 3OJAA 1NV4A 1VDWA 2V4CA 4KI0F 4UV9B 4X20E 2V6XA 3LC8A 4QXBB 4DDDA 3F31A 2JJKA 3S4UA 2LSYA 4DUZT 3RQWA 3WAFA 1L0VA 1N04A 2XSBA 2CWYA 3I9WA 4H45A 3S2VA 2HPJA 2CPTA 4A98A 4KYEA 3JV9A 4PJMA 2KINB 5ABFA 4CXYA 2YJPA 1D1CA 3EHSA 4CI3B 3D4CA 2I4CA 4K3FA 1Y9UA 2I3WA 5I59A 4WBOA 4IDQA 2D5UA 1H43A 1NV7A 1IXHA 1N7XA 3K2DA 1HCIA 4DI4B 3PUYF 2Y7KA 5H6RB 1SD3A 2VVNA 5LXTE 1KZ8A 4JSDA 4H67A 2AIXA 5IHYA 1AH5A 5L9SA 1Y1ZA 5K2YA 3A3UA 5CMBA 1O64A 4XFEA 2E5LT 3J7Yq 2VL0A 1ZHCA 1VR5A 1Z7ME 2XAQB 2F34A 3S9NC 4AKHA 2HH7A 2XX8A 1MQHA 1FRPA 1B46A 1MIWA 5BMVE 4CN6A 3LR1A 4WEPA 4V1Av 5I57B 1FTKA 4OANA 3LBSA 1A7LA 3E9XA 1G0IA 2THIA 3K3QC 4YTNA 3MAMA 3IB2A 5LG3A 4X1DA 3FZMB 2GH9A 4YSXA 2G93A 4F31B 3O1IA 3KFMA 5IKBA 1KK7A 3O1HA 4ZI2D 4X1IE 4DV2T 4NF8A 1KFYA 3FD3A 2VD3A 3PUVF 2QVUA 4HE8A 4N15A 2X9WA 1LCTA 2YEVC 3C32A 4OXVA 4JI2T 4POXA 5A1LA 1LB8A 3QIMA 3PV0F 3FJGA 1WLXA 1P1QA 1XVXA 2EHOB 1BIYA 2F7AA 3KC0A 4DV6T 3PUXE 5JQGE 3TLVA 4WKMA 5EYFA 1O3XA 2VWAA 3IA3A 4LF4T 2CM0A 4K0UA 4OK0A 2BS2A 2B3FA 5ABGA 4R72A 4TZ4C 2E5VA 4OVTA 2F4VT 3USDA 2M6IA 2DDKA 3AE2A 4NWDA 3MJXA 3MACA 2B3BA 5HEHA 3QUJA 2BKNA 4EYYR 5I84A 5ABEA 3KSXA 2CZIA 2F3BA 2I0BA 2MTQA 5M4YA 1CNQA 3MZ9A 4LF9T 4UA8A 2HZKA 2BBHA 5HWYA 3PUVE 3UK4A 4F19A 4ZS9A 3RTWB 2BDEA 5FHNA 1M5EA 4ZXLA 2VOZA 3W15C 2J47A 2F35A 5HBCA 3PV0E 2XM2A 5HWXA 4U74A 4IO5A 1HG2A 1ZEEA 2LE8A 1TWYA 2PBWA 4BJNA 4HTGA 1MPBA 3PMWA 1SDXA 4BAYB 3VLVA 3CG1A 4KX6A 1MQJA 2QS2A 3UN6A 4JUYA 1RKMA 3MWBA 4H63V 1JW5A 2JMKA 1MQGA 2XSAA 4GWUA 4JVIA 4DXCA 5AA4B 5FY0A 4IGTA 3EI0A 4HFBA 2XXVA 4JEHB 3RIAA 1H7CA 5JTYA 3NOHA 2OA5A 3HKCE 4ZZCA 3CSGA 4H46A 5FL1A 2I6EA 3HCQA 3FZFB 4ZEDA 1G73A 5IZZA 3MBPA 4ZI3D 1SW1A 5I58B 1EU8A 1LBCA 4JWOA 1B3EA 2XWKA 4CXWA 4GOUA 4YU0A 4EDPA 2RC8A 1M5FA 2DP8A 4EZHA 2O68A 4DR1T 2K24A 3CK6A 4EEDA 3V5UA 1VSOA 4BDNA 1ZP0A 2QFLA 1HSLA 2W62A 1Y01A 3FUZA 4UEMA 2XQ7A 3ZLIA 4MBPA 2XAJB 2Z8DA 3CX7B 2ZNUA 4U2ZA 2BVLA 4TNWA 4X5TA 1FPGA 3O28A 3IBPA 4JI3T 4Z90A 3PUGA 1FQCA 3E3KA 1ZTYA 4YTPA 5ISUA 4U7IA 2B4MA 5AA1A 3KOSA 1US4A 5KZTA 4JI5T 3OEKA 1LAHE 4U4SA 3EVYA 2BZBA 3FZLB 4R6YA 4GOTA 5ET7A 2A3DA 2BG9A 5I7IA 3C4ZA 1FEWA 5JVDE 4GKKT 5DEXB 1PBPA 1DTGA 2XXWA 3QAXA 3RQUA 2D0TA 1SW4A 4MLQA 4P1EA 1R6ZA 4GWOA 1BR4A 1E1HB 4IGUA 2A5SA 2HCAA 4AKRB 4H9NC 3C36A 3RLFF 1XWMA 2PCRA 1FQBA 3ZC0A 4JI6T 1WODA 4GRKA 3UU6A 1Q1KA 2V8SV 4OEVA 3KBRA 5JR9B 1FPEA 1FSAA 4BA9A 4E0WA 4YFSA 4TUYE 1U5PA 3E79A 1B7ZA 3Q25A 3T96B 2QA7A 4GK5E 3ONXA 5LHIB 1UK5A 2XQYA 1IITA 3WI3A 1NV6A 1QULA 3FXQA 2KQZA 1MY0A 5H8NA 5CFBA 3N9MA 4H9SE 1LKXA 1X9BA 3FJMA 1LLSA 3H6VA 2XXHA 2KLQA 1DCUA 3RKOA 1X79A 5CI5A 4XKPA 4B3ST 5JRCB 4G2ZA 4H9RC 3RPLB 4AS5A 3EKIA 2XHDA 1YKEB 2DI4A 2Z8EA 1ZLQA 4PTKA 2V7IA 2YU2A 5L4HA 4AKLA 1Q35A 2D9DA 1GR2A 1SYIA 3GBAA 2AL5A 3IOWA 4ZHQE 4FEDA 2HN1A 5JDFA 4NE4A 4EXKA 4G2AA 4OESA 4LZ8A 2X51A 2DYXA 2DE2A 4I43B 3CI8A 1M7KA 4DO0A 4MLKA 5JTGA 4LQ5A 5H8SA 1WYBA 3MK7C 4X66T 1D0XA 4TLMB 3P4PA 4I55E 4QFKA 3EDUA 1IUDA 2YK0A 2Z6EA 2YLNA 3I9YA 3TTLA 5HAXA 3LBXB 2X7QA 4WXJA 4AS4A 3VR8A 1IMDA 4H9PC 5HYAA 1W0BA 1FTLA 3FZVA 3VFJA 3FB2A 2G29A 3VR9A 4F29A 2H3RA 1DK4A 1FPIA 4JBWF 4R75A 3C98B 1B7TA 3M3LA 4OVJA 4F1YA 1UURA 4L17A 3ETVA 5KCJA 3W9VA 1LAXA 5CMKA 2DWIA 3DP8A 1XI6A 4U31A 1VFDA 4MNCA 2XPKA 1QSDA 4HFCA 4AXPA 1TFDA 4O3BA 4UELA 3UTKA 4HCYA 2E0SA 4QFNA 1RYXA 2F6PA 3FGSA 5E0OA 1UIUA 3KV9A 4COFA 4DR4T 1FBGA 4DIDB 5C2TA 4ZE9A 3NVOA 3T22A 4LVQA 3GMIA 3KOTA 3TTNA 3KV5A 1MXUA 3WAEA 3AVRA 1B5HA 2WBLA 4IREA 4QXHB 1MXVA 1FQEA 3TLUA 1XNQT 2VP1A 3K1MA 3I5OA 5IWAT 2DNXA 4NF6A 4P0AA 4O7MA 4H6DA 2VKJA 2W00A 1AIVA 2E9XB 4IE0A 3CQGB 1BKAA 1MMAA 3KJTA 1D1BA 4O3AA 2Z23A 3RRCA 2VHAA 4POWA 2XZEA 3KN8A 1B5JA 3C31A 3S9MC 3S9EA 4QWNB 4N17A 4PW8A 2V3TA 1QLBA 3PPPA 1NUZA 4HE1A 3R84B 3MJNA 3A09A 1OWAA 2HHHT 3I3VA 4ECFA 1OIBA 2XXKA 4PFRA 2UXNB 1XNRT 3RKGA 4I40A 5FHOA 3HSTA 5EHSA 1KNZA 2ONKE 3SDFA 3TDJA 3HV1A 5KDTA 4PE3A 1S35A 3VKHA 3E08A 5H6QB 3Q26A 3B57A 2X9XA 3UU4A 2FHYA 1GVCA 1DOTA 2QYWA 5LJNA 1GQEA 5LOVE 3FXEB 1FTJA 5LOMA 3PURA 2LOPA 2BKOA 3P8CD 3O4XE 3RGLA 3T1YT 1B0LA 4G77A 3AXJB 3DELB 4YT0A 3MC2A 1ZOYA 4PFYA 2ZLYA 3QOFA 3K00A 2C5KT 3UFEA 1DMBA 2JIWA 5H8FB 3OMBA 1B52A 2NR4A 4ZS3A 2CLYB 3V5AA 4O7IA 4OTEA 3AA6B 3PPNA 2UUCT 4RXLA 5IAIA 5LP6E 1T98A 1YXIA 4R9FA 2IUBA 2CA5A 3K8PC 1B7UA 2ZM2A 1ELJA 2FVZA 5EQAA 2XASB 5JDQA 3VDFA 4EUOA 4U1ZA 1NV1A 1WVJA 1URGA 2VPNA 3DTOA 2O7IA 3ROJA 1LFIA 3IOTA 1ANFA 2FBPA 3PDYA 1SYHA 5F7VA 2YDQA 4G8HA 2ZZWA 1AJ3A 3TODA 2PFVA 3NRYA 1IJ6A 2LEHA 1POTA 4KD5A 1IBMT 4U3CA 4HGAA 3MVYA 4G68B 2NP9A 2GRVA 2ZNTA 4GBWA 1W0AA 4GKJT 2QMWA 4PETA 4H63H 3VHLA 3B5MA 5AA2D 4ZECA 4KQPA 3F2EA 5TP9A 2K3WA 1HS7A 5AQIB 4M1VA 4BDQA 3FATA 2D21A 4HN9A 4IY6A 2Q9QD 1UTBB 2QVRA 3JAFA 4DXUA 4PBHA 4R6HA 1Y3PA 4YLHA 2UU9T 4FATA 2ZMAA 3I0OA 3VVFA 3PE0A 4ASKA 3Q5EA 2ZNSA 4KR5A 4I9DA 3U3IA 2E8IA 4RJZA 1OVBA 3K0VA 5FTIA 3O2AA 2UXXB 2BJIA 5EQ9A 4ZEIA 4NUVA 3T9XB 2DS9A 2ZZXA 5L3DB 3ZMUB 4C0RA 2JRKA 3LSWA 1SQYA 3SOLA 3ZT6A 1LFHA
chains in the Genus database with same CATH topology
3MZ1A 5K2XA 1SA0E 3CSBA 4EYUA 4UVCB 2GFEA 3RYHE 4KCDA 4XKRA 3FXRA 4ELPA 1M5CA 4XBFB 4LUBA 1D3KA 3IB1A 5HXHA 5FXWA 1B1HA 1IIWA 2XAFB 4TN7B 3TQWA 4BDOA 2IAKA 2V26A 3B6QA 3G3JA 3J9X1 4MHCA 3R26A 2QRYA 3ZCIA 5I2KB 4O2BE 3SRZA 4O8SA 2X0LB 3TCFA 3N5LA 5L3EB 2QGSA 3N9QA 5EK3A 5L9OA 2NOOA 3UT5E 1IXCA 3MXZA 4HKAA 4YKPA 2G0UA 2BJJX 5CBRA 1YD8G 1JEVA 2RC7A 4ND9A 1D0ZA 5JDNA 5LGNB 2DOJA 3KN3A 1NL5A 5I56A 3ANWA 4DIGA 2Z8FA 3LUYA 2XAHB 3LK2B 1I6QA 5DT6A 4GXSB 2H99A 3ESLA 1S94A 2ZYNA 3PTRB 2Z22A 2LJLA 2LHRA 3T9HB 3RYIE 5FMNA 3OKQA 2VL8A 4DE8A 1LRZA 4OWDA 4QXCB 4A56A 2Y7PA 1AMFA 3EDVA 5LGTB 3RT8A 3U1OA 4GYSA 1A99A 3ZMVB 2H4IA 3HN0A 4OEUA 4THIA 3L6GA 3ZN1B 3TEPA 1B1XA 3O9PA 4L5GA 5ADXL 3T66A 2ZMBA 5B7DA 2EHOD 1LB9A 2Y7RA 2ZYOA 5TU0A 4R2FA 2P0SA 1ZU0A 3M3FA 2X26A 3TZAA 4OMBA 3SEWA 3E0ZA 2F97A 3DP7A 4KMCA 4F1VA 3M65A 3HA4A 2NUVA 1ZV4X 3PD9A 4GFRA 2XX9A 5DYHA 4CXXA 1XT8A 1J1NA 4R9GA 2X68A 1XS5A 4LQ2A 2LSIA 2NW8A 4N78D 4ZEFA 1N76A 1SI0A 4Q8RA 4C90A 3VVEA 3H37A 5EHMA 2UYFA 1Y4TA 1IAPA 4TV9E 3AB3B 4KI0E 4ZI7E 4CQIA 2WWUA 1MMGA 4MFRA 1B4ZA 2H98A 4DVDA 1CE2A 2OWSA 4Z7EA 3RTFB 3ZJ1A 3V83A 1EZOA 2ALUA 3ZYMA 1SI1A 1UQWA 2D5WA 4C91A 5EK2A 2DQVA 1AOVA 1MY3A 4XIGQ 3OYXA 2W0GA 2H7OA 3QUFA 1SW2A 3PUYE 4Q30B 4WW0A 3K6WA 3I6VA 4H8JA 5GONE 3PU8A 5L2LA 3R7XA 1MPCA 5JDLA 3T8OA 2XXTA 4YB7A 4P0GA 1P1OA 2ZYKA 4NF5A 4XZCA 5J1DA 4AB5A 4X1YE 4RPNA 1FQDA 3C33A 1WR6A 4EQBA 2CCQA 3EPEA 1ZKBA 1QUJA 3UORA 3VVDA 4J2CA 5HXEA 4MH5A 2D3IA 2C5IT 3RX6A 5A5XB 3NZPA 1MH4A 2F36A 2YINA 4Z8XA 1B3FA 4AQFA 4BLAA 1II5A 2PBIA 2I49A 3U93A 1V9DA 1PDAA 4DCYA 3UGWA 3TKLB 3GBBA 2VB6A 5H8HA 1SBPA 1KWHA 5FP3A 3CQCB 3H4ZA 4UF0B 3CFLA 4OZ9A 3DP4A 1FQAA 1FW0A 2X9YA 1LCFA 3W15B 3VXBA 5JH7E 1B0HA 4L0RA 1RYOA 2AYSA 1S7YA 3ZEFB 1JETA 4U4XA 1A40A 2L3LA 1Z0PA 3N9LA 1PEBA 2REGA 3THIA 1B4HA 3V89B 5DQVA 1OVTA 1U4QA 3HKEE 3I1AA 1IEJA 2VKHA 1UX5A 1MS7A 3H6TA 2Q9TA 4FJOA 4FAJA 3GN5A 3IK6B 3OELA 4OYKA 3O9XA 1NNKA 5ICQA 4LATA 4LZ7A 1NWMX 1QKBA 5AA2A 3B6TA 1YKHB 1OLAA 1YTVA 5H8QA 1LSTA 2Q9QA 4HEAA 4MBQA 2V93A 4G8MA 1LBBA 1URDA 3C64A 5FY1A 5L8DA 4JXIA 4ZZAA 4E7SA 2XXXA 4ZI2C 3RC8A 1SW5A 1MM7A 3OBVE 2B65A 2XD3A 4R73A 1D0YA 5TPAA 3M8UA 1YPNA 1DTZA 1P1NA 4GIWA 3PPRA 1IXIA 3PUZE 2ZM8A 5FXVA 3FVOA 2B1EA 5J2UE 3Q9DA 2WMNA 2DE3A 2WMOA 4PFWA 2DCFA 2ESNA 2NW7A 2RC9A 3VLUA 2C0SA 3QYTA 5KX5E 1MXZA 3SERA 2ABHA 2VK9A 4IHJE 2F7CA 2OZZA 5CC2A 4I62A 4GK0E 5JEIA 1M5DA 3HO7A 2FYIA 4QKNA 4AQ4A 4MALA 4GVOA 2NTYA 1ZIUA 4FI5A 3T9UA 2CXFA 4HCWA 3P7IA 1JQFA 4QX7B 1JVXA 5JDGA 3IHRA 3S9LC 1PB8A 1VFEA 4IO2A 2E1SA 3K1PA 3G3GA 1Y4CA 3OYZA 2HXWA 3ZKLA 3ZMTB 3ZYLA 1B5IA 2LOSA 4CI1B 2E9XD 1UCUA 3RLFE 3BQKA 5CA0E 2V7LA 5JREA 3HR0A 3PUQA 2YPNA 1QJMA 1HSEA 4ELOA 1XVYA 4F18A 3QC9A 1ZKEA 4JSOA 2NWJA 2O1LA 3MP8A 5LGUB 3EQ1A 2HAUA 5I57A 5L3FB 3A5XA 3ZMSB 4N6PA 3EHTA 4O3CA 4KPTA 1NH8A 3RYCE 4Q5TA 3EUHA 5CM6A 2C5JA 4YMBA 3MW0A 4MFIA 1NKXA 1B9JA 4IB2A 2LSKA 1DSNA 2M8CA 3ZS6A 4AI6A 4OFJA 2EHOA 1MM6A 3CX8B 1D4NA 2KZ7B 2Q88A 3KBUA 4XXUA 4E0XA 4PJLA 3GZGA 2HAVA 5JDHA 4GIZA 3Q5XA 4F6RC 1JVYA 4PK5A 3N26A 2JPFA 4DNDA 3N2GE 5FNVE 4PP0A 3LSLA 4ZEKA 3SESA 3MPKA 4JLEA 1IJ5A 2Y8DA 1JW4A 3LSFB 4PE5B 4I8CA 4LZ5A 5HXRA 3FASA 3C4MA 3CR9A 2D2SA 2PX1A 3N2KE 3RC3A 3O1JA 1D1AA 4GYRA 3KN7A 4QFOA 4X48A 1I69A 3IL1B 2XAGB 2VGQA 4R2BA 3KG2A 4F1UA 1MXYA 2K9AA 2AL4A 4OERA 3O6GA 5AA4A 5I56B 4RY1A 3ANWB 3PU3A 4IO4A 4IE4A 4HTEA 3SEVA 3BK9A 2CMOA 2QJEA 1XHYA 5AA3A 5DVFA 1DPEA 3AXFA 5JDMA 2ES0A 2I4BA 4OENA 4BJMA 4LA9A 3V8XB 1FMWA 3OO8A 1OLCA 2XXUA 3OSRA 5I58A 1O7TA 1UTHA 4X1BA 3OD7A 3DLNA 3FV2A 3TTMA 4DMVA 4YKIA 2RF1A 1Y3NA 2DWHA 5IYZE 4UACA 4O4IE 4UVBB 4AKIA 4ZOLE 2N9DA 4HFVA 3VKGA 4RYAA 3OENA 2A5TB 3ILTB 3B7DA 3TUSA 4ZZEA 1B05A 3ZJ2A 3ODBA 2IC6A 1B3HA 2RP4A 3FBZA 5FXXA 2Q89A 4YKJA 3LSXA 4AB6A 2R71A 4U2RA 2X67A 1S9TA 4YMAA 4YAHX 4QX8B 3G7WA 3RRWA 1MXXA 4BDRA 1MH3A 4EQ9A 3TMGA 1JW1A 3HI2A 3N6UA 2VASA 1B51A 2P2AA 4IY5A 1S50A 5I59B 4F3GA 3IO4A 4C1UA 1LFGA 3O6IA 2N2NA 1R1NA 3PU5A 2Y7WA 2I0CA 4GD5A 4GQOA 2XX7A 2KLFA 3LG7A 1YAEA 4PK4A 3C35A 1HG5A 1POY1 1B3GA 2ZXTA 3GXAA 5DABA 4EB6E 3IEEA 5FTHA 5M2VA 3RNNA 5DQWA 3UIFA 5JRCA 2RINA 3QK6A 4O4HE 3JZJA 3DJBA 5ITPA 1ZBMA 5AFUL 3MUQA 4MLVA 4OHNA 3N2OA 4QF9A 1OQGA 4KYDA 3N9NA 5EZYE 3MVWA 2PJQA 4DMWA 2LSGA 2KWIB 4NF8B 2VKOA 3KEIA 3E13X 3H06B 3CG3A 3HL6A 3JC6D 2ZYMA 4IE5A 3CPZA 3ZC1A 3K6UA 2UVIA 1HSJA 3IOVA 3SEXA 3MKDA 2CEAA 1A8FA 3LBXA 3CFZA 3PPOA 2Y7IA 2F5XA 4GLIA 3UUNA 4AQFC 3FVKA 1CB6A 4GL0A 2I48A 3O6HA 1B58A 2XHEB 4I4TE 2ODVA 5TAOA 3ZN0B 1P99A 2DXRA 2O6AA 1IQ7A 3H7MA 4U23A 1IZ1A 4NF4A 4H8IA 1LVKA 4YB5A 1QUUA 2Y48B 2NXOA 2KMFA 3L3PA 3BKIB 1FQFA 2XUEA 2R9JA 3IJXB 3AAEB 4DLDA 5J1GA 3FBLA 4TLLB 1GTKA 1JNFA 3Q29A 4F3SA 3U8QA 3NBXX 3C9HA 1EH3A 1USYE 3KV6A 3KBTA 2HFBA 4C1TA 1BR2A 1PB9A 5JTYB 3AAAB 5L3CB 3SEYA 4OFLA 2E9XA 1YW0A 1TT1A 2Q9QC 4OYJA 1FMVA 3D4GA 2N1GA 2MOZA 4FJPA 4ILUA 2CZLA 4H65A 2KNDA 1MIVA 3FXDB 1QVSA 3OXNA 4ELQA 4JDFA 4FEBA 3BQIA 4H5GA 1R9LA 3TTKA 2V7MA 1Y3QA 4N13A 5HXCA 3LK3B 3K1NA 4PAGA 2I58A 2PG8A 1FCKA 5KDMC 1FTMA 5LCYA 4F22A 3PUWE 2V84A 4NEDA 2NOXA 3ECRA 4JWYA 3O97A 2RCBA 1B2HA 1YCJA 4RK2A 1QW0A 5H8FA 3MPLA 1Y1MA 3FIRA 1N0TA 2O69A 1B7HA 2UYEA 1XOCA 5HPQA 1XC1A 3OEMA 3K3NA 2H5YA 3HKDE 5DVJA 1B6HA 4WEDA 2VKDA 4H9QC 1N3WA 2F7BA 4FE8A 2LAOA 3RPUA 2W63A 2PMSA 4H1XA 4LP2B 2NTXA 4P0IA 4IDZA 1Y20A 3UUMA 3H03A 4OFZA 3PPQA 1VRBA 4F39A 1P1UA 5H8NB 5EK4A 3K01A 4OFOA 4XKNA 4KP3C 5F8PA 3TKDA 2ACXA 2V7KA 4U72A 4JEUB 4JWXA 4G68A 3ETUA 4GL8A 1LAGE 4H0WA 3Q28A 3IR1A 4FIMA 4QFPA 5CA1E 1FTOA 1MG1A 4P09A 2WKYA 1UTBA 3IO6A 3MP6A 3T9VA 1MIYA 2XTLA 1NMUA 4Z0IA 1DPPA 3EHUA 5CBSA 1FIOA 4ZE8A 3KJ7A 2O84X 1NH7A 3RY3A 4RNSA 3ZYKA 4X1KE 5LBQB 3E22E 5LJMA 2QMXA 4QHQA 4YJ3E 2Q2CA 2DSFA 3UA8A 1MY2A 2EHOC 3B13A 1NAFA 3FV1A 2Y84A 1H76A 3UULA 3FJ7A 3PUSA 3RT6B 5I2NA 4QSEA 5L9MA 1A8EA 2QSXA 5KCJB 3ZPOA 1EZPA 2CWOA 4IO3A 2A2FX 2PVUA 3UUXB 4H5FA 1OXZA 3IF8B 3K6VA 5ICTA 3KDSE 3U78A 2OJTA 2X7PA 2XXQA 3ONMA 3Q27A 5LG4A 3FHNA 5I2KA 3UP9A 3LFMA 1Y64B 4NF6B 2Y6XA 3K02A 1G8XA 2H7VC 2XD2A 1VE4A 1B40A 2D0UA 3KVBA 3CMLA 2DWJA 2JMHA 3CIJA 4ZDMA 5FYMA 3N9PA 1MMNA 1HTJF 1ATGA 2X66A 3RUMA 1MNDA 3QXMA 3B6WA 1ZJLA 4LONB 3TYHA 3AA7B 4P11A 4HW8A 5CB4E 1MNEA 3R6UA 1F9BA 2VD2A 3PMVA 3HKBE 3TTRA 3ZKKA 4KUMB 5KDTB 4EF2A 4X9TA 3BFTA 5C8YE 1WRDA 4IE6A 1UTHB 2OBGA 3AAIA 2MYSA 1MDP1 1NFTA 4I1DA 5ELVA 4R6KA 2DXYA 1BLFA 2XXYA 3PD8A 3I0QA 4NUUA 2DWKA 5ITOA 4AKGA 4U21A 3H6WA 2GK9A 2F78A 2IA4A 3EN3A 4XKQA 5L3BB 2ANJA 1D9VA 5LYJE 3KGCA 3ZCJA 1Z7NE 4EAHA 2DE4A 5BUUA 4KCCA 2OLBA 3RPWA 3LK42 4YJ2E 2K48A 4ELRA 1I6BA 4YZZA 4F2QA 2RCAA 3CRBA 3RN8A 3OSQA 4F3PA 4G4PA 3IB0A 4PNIA 2GHAA 4OYVA 4ZS2A 5FXZA 5JR9C 2XXRA 3H6UA 4ONYA 2M67A 3KFWX 4PJJA 5LHGB 3IOUA 1LVFA 4DXBA 1JEUA 2ONSA 3RGYA 3TAJA 5ETWA 2IC9A 3V5SA 2UVGA 5LHHB 3Q5WA 1HX8A 2L8KA 4ISTA 1VOMA 1TFAA 1ZMGA 2X9HA 2CXLA 2QS4A 1MY4A 1TXFA 5TP9B 4XAXB 3JYRA 4O2AE 1URSA 4MF3A 2JJ9A 4NWCA 3A3CA 4R74A 2ODUA 4ZI3C 2UVJA 4TQUQ 3CWZB 4E7ZA 3U72A 4BDMA 1IXGA 2LT3A 2CE7A 4EZ4A 4OETA 3ZSFA 5DJQC 2P9BA 4PFPA 4HS7A 3TQLA 2MBGA 1M5BA 3O66A 4ISUA 4TOZA 3KZGA 1GGGA 3F57A 1QUIA 3SS1A 3W9WA 4G8NA 3QSLA 5KMGP 3SWHA 1N84A 2PT2A 1AL3A 4G63A 4DBQA 3M3KA 3C4WA 1BTJA 3OOAA 1R9QA 2Q2AA 4KFQA 4IIJE 3C34A 4QRZA 4UXNB 4EQ7A 1LGBC 2V3UA 3EF7A 3U94A 3L6HA 2KT9A 3BQLA 4NTLA 4H9OC 4B6XA 2WSSV 1BP5A 1OQHA 1OMPA 3SETA 1MMDA 1A54A 1N3XA 4JB7A 3MZBA 5A5XA 1HFAA 3N6TA 4IE7A 5CMCA 4QSCA 1CUNA 3VU7H 3HHFA 1QKAA 4UVAB 1MY1A 1L5TA 4PJNA 4NF4B 2WAUA 3N94A 3NRXA 4EXLA 3K6XA 2A72A 2J1DG 3PGFA 4EOZB 1LAFE 3LJCA 4UF0A 4U1OA 4M1PA 2QL3A 3PUAA 3C50A 1NNFA 3VXCA 3KV4A 3HPIA 4Q0CA 1UIVA 2JQQA 3DP6A 3RH3A 5LA6E 3H3AA 2IW5B 2E9XC 4O4LE 5LNKA 2I3VA 4OQOA 4YB6A 4CZZB 3O29A 2IEEA 1PB7A 3T93B 4DCXA 3MZKB 5B70A 4ADZA 4P0BA 4PFUA 2W61A 5FHMA 4EIWA 4RA1A 4YICA 2V3QA 3CQXC 4L9IA 3GLBA 1MQDA 4GF8A 1IZNB 2P1SA 4PK6A 1B32A 2V1DB 4GXAA 3ILUB 2H9BA 1A55A 1H45A 1SVXB 2FA7A 2ONRA 3H3GA 4M4GA 2QS3A 2KXPB 4ISSA 1BR0A 5AE4A 3C4XA 5F3JA 1PBQA 3MA9A 5J2TE 4QHOA 1QUKA 3HHGA 3TPAA 5F1QA 2DLRA 1H44A 1MXWA 4QFLA 5DEXA 2CLYC 3Q2MA 3U92A 2LM9A 2KWHA 2ZM0A 3IORA 2F8DA 3OO7A 5CMMA 2F6GA 2I59A 5HM4B 3OO6A 3TCGA 3ZMZB 2NVUB 2UXAA 1GV8A 2RA1A 2OK2A 4ERRA 3F11A 5JR9A 2HQ0A 2O7UA 4EXTA 3CVGA 4YKKA 1I6AA 2DWAA 4EF1A 3D0TA 3C51A 1N7WA 4PFOA 4UIGA 4QSDA 1P1WA 4RPOA 2HPLA 2V7JA 4G68C 3IJOB 4DBRA 4F3BA 3SEUA 3TCHA 3VV5A 4AQGA 3VLWA 2Q8JA 3SKPA 2HEUA 1US7B 1NNTA 4XTCQ 4DZ1A 3FXUA 5HXSA 5DVIA 3K3OA 3KSJA 2O1MA 4U22A 3IAZA 2QS1A 4ANJA 3KINB 1MQIA 3FVNA 2NWBA 3AVSA 2OCUA 2UVHA 3TELA 2PYYA 3N9OA 4NF5B 1US5A 3IX1A 2YU1A 4IGRA 4ESWA 3CX6B 4JBZA 2PT1A 2DWGA 4YHJA 1EZ3A 5JK4A 2W7YA 3MQ9A 2DVCA 2OWTA 4FORA 4TV8E 4N07A 2REJA 3G3FA 2CMRA 3WAJA 1MDQA 4CI2B 1BR1A 3RQTA 3OO9A 5I2NB 3E4RA 2XXPA 5CRYA 3G3HA 1O63A 4RK9A 1D9YA 2NW9A 3FVGA 5BWJA 2GHBA 5H8HB 4NMYA 1USYH 2FNCA 5L3GB 3DM0A 3GA8A 1T0KA 1SHZC 3L09A 1B3LA 4KBMB 2LSJA 3K4UA 2WM9A 3BFUA 2QPQA 2V25A 4UV8B 2DVZA 2H25A 3CKDA 4WBNE 1WYCA 2K5BB 3AA1B 1MRPA 4ZEBA 3CVRA 3GN5B 3BBRA 2HZLA 4FECA 3MVXA 4KYSA 2BVMA 4F2OA 4WNKA 5AA2B 2RKMA 3TFLA 5LBMA 4BDLA 5H8QB 2R6GE 3PMXA 1MPDA 2Q9QB 3CFXA 1UX4A 1NNPA 3G3IA 1H3DA 3VE1B 3AA0B 4TX5A 3RYFE 4ESXA 2CXDA 3MP1A 3NZQA 4IO7A 5TPAB 3JC6C 1HF8A 2XXIA 2O51A 5DTBA 4PFTA 4I50E 4O4JE 3KVAA 3WAKA 2SPCA 1EZ9A 4PQJA 2L9QA 2DHRA 3G3KA 2A5TA 1PC3A 4KHZE 1WDNA 5FY7A 2LHNA 3R6NA 3MVZA 3GWHA 4IO6A 4OHFA 3OJAA 4UV9B 4X20E 3LC8A 4QXBB 4DDDA 3F31A 3S4UA 2LSYA 3WAFA 1N04A 2CWYA 3I9WA 3S2VA 2HPJA 4KYEA 3JV9A 4PJMA 2KINB 4CXYA 2YJPA 1D1CA 3EHSA 4CI3B 3D4CA 2I4CA 4K3FA 1Y9UA 2I3WA 5I59A 4WBOA 2D5UA 1H43A 1IXHA 1N7XA 3K2DA 2Y7KA 5H6RB 1SD3A 5LXTE 4JSDA 4H67A 2AIXA 5IHYA 1AH5A 5L9SA 1Y1ZA 5K2YA 3A3UA 5CMBA 1O64A 3J7Yq 1VR5A 1ZHCA 1Z7ME 2XAQB 2F34A 3S9NC 4AKHA 2HH7A 2XX8A 1MQHA 1B46A 1MIWA 5BMVE 3LR1A 4WEPA 4V1Av 5I57B 1FTKA 3LBSA 1A7LA 3E9XA 2THIA 3K3QC 3MAMA 3IB2A 4X1DA 2GH9A 2G93A 4F31B 3O1IA 3KFMA 5IKBA 1KK7A 3O1HA 4ZI2D 4X1IE 4NF8A 3FD3A 2VD3A 4HE8A 2X9WA 1LCTA 2YEVC 3C32A 4OXVA 4POXA 5A1LA 1LB8A 3QIMA 3FJGA 1WLXA 1P1QA 1XVXA 2EHOB 1BIYA 2F7AA 3PUXE 4WKMA 5JQGE 5EYFA 1O3XA 2VWAA 2CM0A 4K0UA 4OK0A 2B3FA 4R72A 4TZ4C 3USDA 4NWDA 3MJXA 3MACA 2B3BA 3QUJA 4EYYR 5I84A 3KSXA 2I0BA 2MTQA 5M4YA 3MZ9A 4UA8A 2HZKA 3PUVE 5HWYA 3UK4A 4F19A 4ZS9A 3RTWB 2BDEA 5FHNA 1M5EA 3W15C 2VOZA 2F35A 5HBCA 3PV0E 5HWXA 4U74A 4IO5A 1HG2A 1ZEEA 2LE8A 1TWYA 2PBWA 4BJNA 4HTGA 1MPBA 3PMWA 1SDXA 4BAYB 3VLVA 3CG1A 1MQJA 2QS2A 3UN6A 4JUYA 1RKMA 3MWBA 4H63V 1JW5A 2JMKA 1MQGA 4DXCA 5AA4B 5FY0A 4IGTA 2XXVA 4JEHB 1H7CA 5JTYA 2OA5A 3HKCE 3CSGA 2I6EA 3HCQA 4ZEDA 1G73A 3MBPA 4ZI3D 1SW1A 5I58B 1EU8A 1LBCA 4JWOA 1B3EA 4CXWA 4GOUA 4YU0A 4EDPA 2RC8A 1M5FA 2DP8A 4EZHA 2O68A 2K24A 3V5UA 1VSOA 4BDNA 1HSLA 2W62A 3FUZA 4UEMA 3ZLIA 4MBPA 2XAJB 2Z8DA 3CX7B 2ZNUA 2BVLA 3O28A 3IBPA 3PUGA 1FQCA 3E3KA 1ZTYA 5ISUA 5AA1A 3KOSA 1US4A 5KZTA 3OEKA 1LAHE 4U4SA 3EVYA 2BZBA 4R6YA 4GOTA 2A3DA 3C4ZA 1FEWA 5JVDE 5DEXB 1PBPA 1DTGA 2XXWA 3QAXA 2D0TA 1SW4A 4MLQA 1R6ZA 4GWOA 1BR4A 1E1HB 4IGUA 2A5SA 2HCAA 4AKRB 4H9NC 3C36A 1FQBA 3ZC0A 1WODA 4GRKA 1Q1KA 4OEVA 3KBRA 5JR9B 4BA9A 4E0WA 4YFSA 4TUYE 1U5PA 1B7ZA 3Q25A 3T96B 2QA7A 4GK5E 3ONXA 5LHIB 2XQYA 1IITA 3WI3A 1QULA 3FXQA 1MY0A 5H8NA 3N9MA 4H9SE 1LKXA 3FJMA 1LLSA 3H6VA 2XXHA 2KLQA 3RKOA 1X79A 5CI5A 4XKPA 4G2ZA 5JRCB 4H9RC 2XHDA 1YKEB 2DI4A 2Z8EA 1ZLQA 2YU2A 2V7IA 4AKLA 1Q35A 1GR2A 1SYIA 3GBAA 3IOWA 2AL5A 4FEDA 4ZHQE 5JDFA 4NE4A 4EXKA 4G2AA 4OESA 4LZ8A 2X51A 2DYXA 2DE2A 4I43B 3CI8A 4DO0A 4MLKA 4LQ5A 5H8SA 1WYBA 3MK7C 1D0XA 4TLMB 4I55E 4QFKA 3EDUA 1IUDA 2YK0A 2Z6EA 2YLNA 3I9YA 3TTLA 5HAXA 3LBXB 2X7QA 4WXJA 4H9PC 5HYAA 1FTLA 3FZVA 3VFJA 3FB2A 2G29A 4F29A 2H3RA 4R75A 3C98B 1B7TA 3M3LA 4OVJA 4F1YA 4L17A 3ETVA 5KCJA 3W9VA 1LAXA 5CMKA 2DWIA 3DP8A 1VFDA 1QSDA 4AXPA 1TFDA 4O3BA 4UELA 3UTKA 4HCYA 2E0SA 4QFNA 1RYXA 2F6PA 3FGSA 5E0OA 1UIUA 3KV9A 4ZE9A 3T22A 4LVQA 3GMIA 3KOTA 3TTNA 3KV5A 1MXUA 3WAEA 3AVRA 1B5HA 2WBLA 4QXHB 1MXVA 1FQEA 2VP1A 3K1MA 3I5OA 2DNXA 4NF6A 4P0AA 4H6DA 2VKJA 2W00A 1AIVA 2E9XB 4IE0A 1BKAA 3CQGB 1MMAA 3KJTA 1D1BA 4O3AA 2Z23A 3RRCA 2VHAA 4POWA 3KN8A 1B5JA 3C31A 3S9MC 3S9EA 4QWNB 4PW8A 2V3TA 3PPPA 3R84B 3MJNA 3A09A 1OWAA 3I3VA 4ECFA 1OIBA 2UXNB 5FHOA 3HSTA 5EHSA 1KNZA 2ONKE 3SDFA 3TDJA 3HV1A 5KDTA 1S35A 3VKHA 3E08A 5H6QB 3Q26A 3B57A 2X9XA 1GVCA 1DOTA 5LJNA 5LOVE 3FXEB 1FTJA 5LOMA 3PURA 2LOPA 4G77A 3P8CD 3O4XE 1B0LA 3DELB 3MC2A 4PFYA 2ZLYA 3K00A 2C5KT 3UFEA 1DMBA 5H8FB 3OMBA 1B52A 4ZS3A 2CLYB 3V5AA 4OTEA 3AA6B 3PPNA 4RXLA 5IAIA 5LP6E 1T98A 4R9FA 2CA5A 3K8PC 1B7UA 2ZM2A 1ELJA 2XASB 5JDQA 3VDFA 4EUOA 4U1ZA 1WVJA 1URGA 3DTOA 2O7IA 1LFIA 3IOTA 1ANFA 3PDYA 1SYHA 5F7VA 4G8HA 1AJ3A 3TODA 2PFVA 3NRYA 1IJ6A 2LEHA 1POTA 4KD5A 4HGAA 3MVYA 4G68B 2NP9A 2GRVA 2ZNTA 2QMWA 4PETA 4H63H 3VHLA 5AA2D 4ZECA 4KQPA 3F2EA 5TP9A 4BDQA 1HS7A 4M1VA 3FATA 2D21A 4HN9A 4IY6A 2Q9QD 1UTBB 4DXUA 4R6HA 1Y3PA 4YLHA 4FATA 2ZMAA 3I0OA 3VVFA 3PE0A 4ASKA 2ZNSA 4KR5A 4I9DA 3U3IA 2E8IA 4RJZA 1OVBA 3K0VA 5FTIA 3O2AA 2UXXB 4ZEIA 4NUVA 3T9XB 2DS9A 5L3DB 3ZMUB 4C0RA 2JRKA 3LSWA 1SQYA 3SOLA 1HCIA 1LFHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MZ1 A;  5K2X A;  3CSB A;  2GFE A;  4KCD A;  4XKR A;  3FXR A;  4ELP A;  1M5C A;  4LUB A;  1D3K A;  3IB1 A;  1B1H A;  1IIW A;  3TQW A;  4BDO A;  3G3J A;  3B6Q A;  3R26 A;  2QRY A;  5I2K B;  3TCF A;  3N5L A;  5L9O A;  2NOO A;  1IXC A;  3MXZ A;  4YKP A;  2G0U A;  2BJJ X;  5CBR A;  1JEV A;  2RC7 A;  4ND9 A;  5I56 A;  2DOJ A;  3KN3 A;  1NL5 A;  4DIG A;  2Z8F A;  3LUY A;  1I6Q A;  5DT6 A;  4GXS B;  2H99 A;  2ZYN A;  2Z22 A;  3T9H B;  4DE8 A;  1LRZ A;  4OWD A;  2Y7P A;  1AMF A;  3RT8 A;  3U1O A;  1A99 A;  2H4I A;  3HN0 A;  4OEU A;  4THI A;  3L6G A;  3TEP A;  1B1X A;  3O9P A;  3T66 A;  2ZMB A;  5B7D A;  1LB9 A;  2Y7R A;  2ZYO A;  5TU0 A;  4R2F A;  2P0S A;  1ZU0 A;  3M3F A;  2X26 A;  3TZA A;  4OMB A;  3SEW A;  2F97 A;  4F1V A;  2NUV A;  4GFR A;  3PD9 A;  2XX9 A;  5DYH A;  1XT8 A;  1J1N A;  4R9G A;  1XS5 A;  4LQ2 A;  4ZEF A;  1N76 A;  1SI0 A;  4Q8R A;  3VVE A;  5EHM A;  2UYF A;  1Y4T A;  4KI0 E;  4CQI A;  1B4Z A;  2H98 A;  1CE2 A;  2OWS A;  4Z7E A;  3RTF B;  3V83 A;  1EZO A;  2ALU A;  1SI1 A;  1UQW A;  2D5W A;  2DQV A;  1AOV A;  1MY3 A;  4XIG Q;  3QUF A;  1SW2 A;  3PUY E;  4Q30 B;  3K6W A;  3I6V A;  4H8J A;  3R7X A;  1MPC A;  2XXT A;  4YB7 A;  4P0G A;  1P1O A;  2ZYK A;  4NF5 A;  5J1D A;  4AB5 A;  4RPN A;  1FQD A;  3C33 A;  4EQB A;  3EPE A;  1ZKB A;  1QUJ A;  3UOR A;  3VVD A;  4J2C A;  4MH5 A;  2D3I A;  2C5I T;  5A5X B;  1MH4 A;  2F36 A;  1B3F A;  4BLA A;  1II5 A;  2I49 A;  3U93 A;  1PDA A;  4DCY A;  3UGW A;  3TKL B;  3GBB A;  5H8H A;  1SBP A;  1KWH A;  3H4Z A;  4OZ9 A;  3CFL A;  3DP4 A;  1FQA A;  1FW0 A;  2X9Y A;  1LCF A;  3VXB A;  1B0H A;  4L0R A;  1S7Y A;  1RYO A;  2AYS A;  1JET A;  4U4X A;  1A40 A;  1Z0P A;  1PEB A;  2REG A;  3THI A;  1B4H A;  3V89 B;  1OVT A;  1IEJ A;  1MS7 A;  3H6T A;  2Q9T A;  4FAJ A;  3IK6 B;  3OEL A;  1NNK A;  5ICQ A;  4LAT A;  4LZ7 A;  1QKB A;  5AA2 A;  3B6T A;  1OLA A;  1YTV A;  5H8Q A;  1LST A;  2V93 A;  4G8M A;  1LBB A;  1URD A;  5L8D A;  4JXI A;  4ZZA A;  2XXX A;  1SW5 A;  1MM7 A;  2B65 A;  2XD3 A;  4R73 A;  5TPA A;  3M8U A;  1YPN A;  1DTZ A;  1P1N A;  3PPR A;  1IXI A;  3PUZ E;  3FVO A;  2DE3 A;  4PFW A;  2ESN A;  2RC9 A;  3VLU A;  3QYT A;  1MXZ A;  3SER A;  2ABH A;  2F7C A;  2OZZ A;  5CC2 A;  4I62 A;  5JEI A;  1M5D A;  3HO7 A;  2FYI A;  4AQ4 A;  4GVO A;  1ZIU A;  4FI5 A;  3T9U A;  4HCW A;  3P7I A;  1JQF A;  1JVX A;  3S9L C;  1PB8 A;  1VFE A;  4IO2 A;  2E1S A;  3K1P A;  3G3G A;  1Y4C A;  2HXW A;  3ZKL A;  1B5I A;  3RLF E;  2YPN A;  1QJM A;  1HSE A;  4ELO A;  1XVY A;  4F18 A;  1ZKE A;  4JSO A;  2NWJ A;  2O1L A;  3MP8 A;  3EQ1 A;  2HAU A;  5I57 A;  4N6P A;  3EHT A;  4O3C A;  4KPT A;  1NH8 A;  4Q5T A;  5CM6 A;  2C5J A;  4YMB A;  3MW0 A;  4MFI A;  1NKX A;  1B9J A;  4IB2 A;  1DSN A;  2M8C A;  3ZS6 A;  4OFJ A;  1MM6 A;  1D4N A;  2Q88 A;  4XXU A;  4E0X A;  3GZG A;  2HAV A;  4GIZ A;  1JVY A;  3N26 A;  4DND A;  4PP0 A;  3LSL A;  4ZEK A;  3SES A;  3MPK A;  1IJ5 A;  1JW4 A;  3LSF B;  4PE5 B;  4I8C A;  4LZ5 A;  3FAS A;  3C4M A;  3CR9 A;  2PX1 A;  3KN7 A;  4X48 A;  4QFO A;  1I69 A;  3IL1 B;  2VGQ A;  4R2B A;  3KG2 A;  4F1U A;  1MXY A;  2AL4 A;  4OER A;  3O6G A;  5AA4 A;  5I56 B;  4RY1 A;  4IO4 A;  3SEV A;  2CMO A;  2QJE A;  1XHY A;  5AA3 A;  5DVF A;  1DPE A;  3AXF A;  4OEN A;  2I4B A;  4LA9 A;  3V8X B;  3OO8 A;  1OLC A;  2XXU A;  3OSR A;  5I58 A;  1O7T A;  1UTH A;  4X1B A;  3OD7 A;  3DLN A;  3FV2 A;  3TTM A;  4YKI A;  2RF1 A;  1Y3N A;  2DWH A;  4UAC A;  4RYA A;  3OEN A;  2A5T B;  3ILT B;  3B7D A;  3TUS A;  4ZZE A;  1B05 A;  3ODB A;  2IC6 A;  1B3H A;  2Q89 A;  4YKJ A;  3LSX A;  4AB6 A;  2R71 A;  4U2R A;  1S9T A;  4YMA A;  4YAH X;  3G7W A;  1MXX A;  4BDR A;  1MH3 A;  4EQ9 A;  3TMG A;  1JW1 A;  3N6U A;  1B51 A;  2P2A A;  4IY5 A;  1S50 A;  5I59 B;  4F3G A;  3IO4 A;  4C1U A;  1LFG A;  3O6I A;  1R1N A;  3PU5 A;  2Y7W A;  2I0C A;  4GD5 A;  4GQO A;  2XX7 A;  2KLF A;  1YAE A;  3C35 A;  1POY 1;  1B3G A;  2ZXT A;  3GXA A;  5FTH A;  5M2V A;  3RNN A;  3UIF A;  2RIN A;  3QK6 A;  3JZJ A;  5ITP A;  1ZBM A;  3MUQ A;  4MLV A;  4OHN A;  4QF9 A;  1OQG A;  4KYD A;  3MVW A;  2KWI B;  4NF8 B;  3KEI A;  3E13 X;  3H06 B;  3CG3 A;  2ZYM A;  3K6U A;  2UVI A;  1HSJ A;  3IOV A;  3SEX A;  1A8F A;  3CFZ A;  3PPO A;  2Y7I A;  2F5X A;  4GLI A;  3FVK A;  1CB6 A;  4GL0 A;  2I48 A;  3O6H A;  1B58 A;  1P99 A;  2DXR A;  2O6A A;  1IQ7 A;  3H7M A;  4U23 A;  1IZ1 A;  4NF4 A;  4H8I A;  4YB5 A;  2NXO A;  3L3P A;  3BKI B;  1FQF A;  2R9J A;  3IJX B;  4DLD A;  4TLL B;  1GTK A;  1JNF A;  3Q29 A;  4F3S A;  3U8Q A;  3C9H A;  1EH3 A;  1USY E;  2HFB A;  4C1T A;  1PB9 A;  5JTY B;  3SEY A;  4OFL A;  1TT1 A;  3D4G A;  4FJP A;  2CZL A;  4H65 A;  1QVS A;  3FXD B;  3OXN A;  4ELQ A;  4JDF A;  4FEB A;  4H5G A;  1R9L A;  3TTK A;  1Y3Q A;  4N13 A;  3K1N A;  2I58 A;  1FCK A;  1FTM A;  4F22 A;  3PUW E;  2V84 A;  4NED A;  3ECR A;  4JWY A;  3O97 A;  2RCB A;  1B2H A;  1YCJ A;  4RK2 A;  1QW0 A;  5H8F A;  3MPL A;  1Y1M A;  3FIR A;  1N0T A;  2O69 A;  1B7H A;  2UYE A;  1XOC A;  5HPQ A;  1XC1 A;  3OEM A;  2H5Y A;  5DVJ A;  1B6H A;  4WED A;  2F7B A;  1N3W A;  4FE8 A;  2LAO A;  2PMS A;  4H1X A;  4LP2 B;  4P0I A;  1Y20 A;  3H03 A;  3PPQ A;  4F39 A;  1P1U A;  5H8N B;  3K01 A;  4OFO A;  4XKN A;  3TKD A;  4JWX A;  4G68 A;  4GL8 A;  1LAG E;  4H0W A;  3Q28 A;  3IR1 A;  4FIM A;  4QFP A;  1FTO A;  1MG1 A;  2WKY A;  1UTB A;  3IO6 A;  3MP6 A;  3T9V A;  2XTL A;  1NMU A;  4Z0I A;  1DPP A;  3EHU A;  5CBS A;  4ZE8 A;  3KJ7 A;  2O84 X;  1NH7 A;  3RY3 A;  4RNS A;  2QMX A;  4QHQ A;  2Q2C A;  2DSF A;  3UA8 A;  1MY2 A;  3FV1 A;  2Y84 A;  1H76 A;  3FJ7 A;  3RT6 B;  5I2N A;  4QSE A;  5L9M A;  1A8E A;  2QSX A;  5KCJ B;  1EZP A;  4IO3 A;  2PVU A;  4H5F A;  3K6V A;  5ICT A;  2OJT A;  2X7P A;  2XXQ A;  3ONM A;  3Q27 A;  5I2K A;  3UP9 A;  4NF6 B;  3K02 A;  2XD2 A;  1VE4 A;  1B40 A;  2DWJ A;  3CIJ A;  4ZDM A;  1ATG A;  3RUM A;  3QXM A;  3B6W A;  1ZJL A;  4LON B;  3TYH A;  4P11 A;  4HW8 A;  3R6U A;  1F9B A;  2VD2 A;  3PMV A;  3TTR A;  3ZKK A;  5KDT B;  4EF2 A;  4X9T A;  3BFT A;  1UTH B;  2OBG A;  1MDP 1;  1NFT A;