3QK6A

Crystal structure of escherichia coli phnd
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
308
structure length
304
Chain Sequence
KALNFGIISTESQQNLKPQWTPFLQDMEKKLGVKVNAFFAPDYAGIIQGMRFNKVDIAWYGNLSAMEAVDRANGQVFAQTVAADGSPGYWSVLIVNKDSPINNLNDLLAKRKDLTFGNGDPNSTSGFLVPGYYVFAKNNISASDFKRTVNAGHETNALAVANKQVDVATNNTENLDKLKTSAPEKLKELKVIWKSPLIPGDPIVWRKNLSETTKDKIYDFFMNYGKTPEEKAVLERLGWAPFRASSDLQLVPIRQLALFKEMQSVKDNEQDKLAKTTAIQAQLDDLDRLNNALSAMSSVSKAVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PhnD, subunit of alkylphosphonate ABC transporter
publication title Structure of the Escherichia coli Phosphonate Binding Protein PhnD and Rationally Optimized Phosphonate Biosensors.
pubmed doi rcsb
source organism Escherichia coli uti89
molecule tags Transport protein
total genus 103
structure length 304
sequence length 308
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12974 Phosphonate-bd ABC transporter, phosphonate, periplasmic substrate-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.90 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3qk6A03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3qk6A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3qk6A02
4N13A 1A8EA 3DP4A 5F7VA 4ZEDA 1PB9A 4LATA 3V5AA 2F6GA 2G0UA 1R1NA 5CMMA 4ZECA 3TYHA 1JQFA 1AH5A 3RN8A 2ONKE 4EXKA 2V3TA 4MLQA 2FYIA 5CMBA 1SD3A 1R6ZA 2NXOA 4EUOA 3MP6A 3FXUA 4JWOA 4YB7A 4IO4A 3IOWA 4U1ZA 3N26A 2F35A 3K4UA 1R9QA 4U21A 3QK6A 2NOOA 1ZMGA 4IB2A 3CIJA 1NH7A 1DTGA 2C5KT 1QJMA 1OMPA 1B4ZA 1GVCA 5CI5A 2Q2AA 1FTOA 2QJEA 4BDLA 1B7UA 3K6VA 3MBPA 2H25A 2QL3A 3KGCA 3M8UA 3HHFA 1FQEA 5JTYB 1NH8A 1B58A 4QFOA 1AL3A 2DOJA 2DWHA 1GV8A 3TFLA 2DVCA 3ZKLA 3RNNA 3RTWB 4BDOA 1CE2A 4BLAA 1EH3A 3OXNA 5KCJB 3D4CA 3Q29A 4G8HA 3KOTA 3FATA 3LBSA 1Z7ME 4U23A 1XVYA 1RYOA 2XXYA 3SEUA 3IO4A 3B6QA 4U4XA 1VFDA 1FW0A 2XTLA 1ZTYA 4XIGQ 1OLAA 4R74A 1B5HA 2HCAA 1MXVA 1M5CA 2Z8FA 2UYEA 4TOZA 1JETA 5EHMA 4ISUA 1LFGA 3FVKA 4AB5A 1UTHB 4PFUA 2RCAA 4F22A 1FQCA 1DPPA 1AMFA 4OYVA 2KLFA 4YKJA 2DP8A 2X9XA 1VSOA 2D21A 4JDFA 5CC2A 3VXCA 5DT6A 2RF1A 3K02A 5AA2A 3PPPA 1B5JA 1S7YA 3MVWA 3FXEB 3PD8A 4H8IA 2Y84A 3G3GA 5EHSA 5H8NB 3IB1A 2DE3A 1GGGA 3CG3A 3H4ZA 3C36A 4ELRA 2QS2A 3FIRA 4DCYA 1QKAA 5J1DA 5KZTA 3H7MA 5H8HA 1SDXA 4H0WA 2I3VA 5AA4B 1ATGA 1ZLQA 5A5XB 2OLBA 3N94A 3TCFA 5AA1A 1BLFA 1XC1A 2H99A 3TQWA 4F3GA 2CA5A 3U72A 2B3BA 5H8QB 2XXHA 4OFJA 4IGTA 3S9NC 4DE8A 1O63A 1ANFA 3QIMA 4CQIA 1MG1A 2H98A 1SW5A 2X26A 3TTLA 2A5SA 2Z8DA 3SEWA 1B3EA 4EF1A 1EZ9A 4FE8A 1EZOA 4PP0A 1NNFA 4DZ1A 5I2NA 3ZKKA 1URSA 3VFJA 2BJJX 3T9VA 2XXRA 4MLVA 2ALUA 2H5YA 1TT1A 4G68A 4IY6A 1TFAA 3MVYA 4XKRA 3Q27A 3A09A 3LUYA 1Y4TA 1IEJA 2OBGA 2NVUB 3P7IA 4R6HA 4I62A 4NF8B 4PFTA 4NF6B 4Q5TA 4H5GA 5I57B 2Z22A 1B3LA 3VLUA 4NE4A 3SETA 1B3GA 2AYSA 3FVOA 3IJOB 2F5XA 4YB6A 2G29A 4P0GA 1MH3A 3S9MC 3E3KA 3IX1A 3SKPA 5DEXA 2H9BA 4GIZA 3B7DA 3DP8A 5I58A 5ISUA 1PB7A 1IZ1A 3KJ7A 4XXUA 5ITPA 1YCJA 1O64A 3KN3A 2OZZA 2GHAA 3PMWA 4HCYA 4GD5A 1O7TA 1Y3PA 3PGFA 4YKIA 4FECA 4FJPA 1H43A 4H6DA 3O6HA 3QAXA 3LSWA 1N84A 2Y7RA 3S9EA 3UIFA 3HPIA 2RINA 3TPAA 1MH4A 4KCCA 4ND9A 4OEUA 1POY1 4K3FA 1PBPA 4ZEKA 3SESA 5I56A 4UA8A 4OQOA 1P1UA 5L8DA 2GRVA 3UORA 4O3BA 2DYXA 1EU8A 3ECRA 3T93B 1URGA 3K6UA 1VE4A 1EZPA 1QVSA 3IOTA 1M5FA 1B05A 2Q9TA 1LFIA 5JK4A 5H8SA 1N76A 4BDRA 3K0VA 4GL8A 4JBZA 4ECFA 1PC3A 4N6PA 2R71A 3K2DA 4O3CA 1LGBC 3PPOA 3RY3A 1MM7A 2CZLA 2D5WA 1CB6A 1MY3A 3HCQA 4R6YA 4YMBA 2PYYA 3OO9A 1M5DA 5I2KA 2F78A 2XXTA 1IJ5A 2HQ0A 3FUZA 3H6WA 5LOMA 3MWBA 5DTBA 1A99A 2UVHA 3L3PA 4F2OA 2FA7A 2W7YA 1S9TA 4RJZA 3OEKA 2I0BA 4C1UA 2XXUA 4BDNA 4HTGA 2XXIA 1ZIUA 4QF9A 4HCWA 2HFBA 4RPNA 3SDFA 1D9VA 4POWA 1MXZA 3DP6A 3V89B 4NF5A 4ELOA 2QS3A 3VLVA 5EYFA 3BKIB 4U4SA 3L6GA 2UVIA 3TCHA 3O9PA 1B7HA 3E13X 2DSFA 4P0IA 3KSXA 2HZKA 3QUJA 2B65A 2ZXTA 1M5EA 1S50A 3E4RA 1PBQA 3KFMA 4Q0CA 1P1QA 2I4CA 3MVXA 4YU0A 1OVBA 2R9JA 2AIXA 3KN8A 1TWYA 1FQBA 5TP9A 2I6EA 3PPQA 4JSOA 4N07A 3EQ1A 4OZ9A 1ZKBA 3R6UA 2OWSA 4RPOA 3LSXA 3B6WA 4ELQA 3G3KA 1I6BA 4HW8A 1US4A 1ELJA 4RNSA 3PUZE 1SYHA 4GFRA 3PUXE 4JWYA 3CKDA 1AIVA 3K01A 4ZEBA 3FXRA 4H1XA 4EQ9A 4GRKA 1XT8A 3GBBA 4YKPA 4H8JA 4XKPA 4KFQA 3TCGA 3IJXB 2OK2A 3ILTB 1B0LA 4ZEIA 1FCKA 3M3LA 4R73A 2O68A 5ITOA 4LZ7A 3MQ9A 5DVFA 3ODBA 1JNFA 5AA2B 4X48A 3E9XA 2Z23A 3RUMA 3K1MA 4OETA 2PT1A 4NF4A 4EQ7A 2XXPA 3AXFA 2XXVA 4G68C 1NL5A 1LCTA 3KBRA 2DVZA 4QFNA 1P1WA 4U1OA 2IC9A 2I4BA 4OTEA 4F1YA 5H8HB 5L9SA 4OEVA 1OVTA 4DNDA 4WKMA 2ABHA 2ZNSA 3MW0A 1VFEA 1ZJLA 4EQBA 3ZS6A 1MY4A 1PB8A 3I3VA 4BDMA 3USDA 3ZSFA 3HV1A 1B9JA 5HM4B 1A55A 1IXIA 2Q8JA 1SYIA 3CVRA 3CSGA 4Q30B 2V84A 3VVDA 1B7ZA 1H44A 1BIYA 3N5LA 4FAJA 2Q89A 1B3HA 1BTJA 4R72A 1NNKA 1N04A 4YAHX 2DWAA 2A5TA 2F34A 4RK2A 5IAIA 4JSDA 4ZE8A 4OERA 1A8FA 1SW2A 3K6XA 2XX8A 1UIVA 5I2NB 5K2XA 3M3FA 1DMBA 3VVEA 1B52A 2OWTA 2Y7IA 3RLFE 2PT2A 2Q2CA 3TKLB 3H6TA 4G68B 3W15C 1URDA 2YJPA 4YZZA 2X9WA 5KDTA 4M4GA 1ZKEA 5CMCA 4AB6A 4R9GA 3DELB 5H8FA 2VP1A 1YPNA 3WAFA 4FORA 4QRZA 4FEBA 1FTKA 4M1VA 5DVJA 4R2BA 1JVYA 2F7CA 3FVGA 2O84X 2RCBA 3DM0A 1WVJA 1LVFA 3PPRA 4GVOA 3MVZA 5HPQA 1R9LA 2IC6A 1B5IA 3C32A 1QSDA 2DE4A 5I58B 1PDAA 3V83A 1NFTA 3T22A 1F9BA 3ILUB 3FXQA 2O1LA 2OJTA 1JW5A 1XHYA 3FV2A 2ZMBA 3CFLA 1MS7A 4GOTA 1LFHA 3MZBA 3C35A 4F3BA 2YPNA 1HSJA 2FNCA 1TFDA 3H6VA 5AA2D 3K00A 1DPEA 1P1OA 4TQUQ 3QUFA 1OIBA 1JVXA 3H06B 4GLIA 3TTKA 1M5BA 2P1SA 3O6GA 1B1XA 3H6UA 3OO6A 4I8CA 2X7PA 1UQWA 2DS9A 3QSLA 2RC8A 4C0RA 4KYDA 4DXCA 5B70A 4MF3A 1BP5A 3PD9A 3FVNA 4QHQA 3TTMA 1P99A 4TLLB 2O6AA 1MDQA 2V3QA 4RXLA 3O2AA 2PMSA 1JW1A 3PUYE 3IK6B 4LZ8A 1KWHA 3U8QA 3EN3A 1PEBA 1B3FA 1RYXA 4H5FA 3PMXA 3W9WA 5TU0A 3KEIA 4QSCA 3UP9A 4OENA 3FJGA 4L0RA 1USYH 1H7CA 3MJNA 3B6TA 1SI0A 4KI0E 1MQJA 1MPDA 3JYRA 2PBWA 4NWCA 3EHSA 1FTLA 1IXGA 3QXMA 3CI8A 5I2KB 1VR5A 2DE2A 4DDDA 3G3IA 3PPNA 4KHZE 2ZYMA 4F3SA 3IOVA 2XX9A 3UN6A 4J2CA 4F31B 2REGA 1Y3NA 1MY1A 2IEEA 2XHDA 3OMBA 3BBRA 4XTCQ 2E0SA 3ONMA 3HO7A 1MRPA 4EF2A 1LB8A 1LRZA 1NMUA 4NMYA 3KOSA 2ZNUA 5I59A 1LB9A 3H03A 3U1OA 1Z7NE 3PUWE 1Y1ZA 1NNTA 4LQ5A 4POXA 1MQIA 2VOZA 5CM6A 3RGYA 4NF5B 1Y1MA 3O29A 1B51A 4PETA 3FJMA 4IGRA 4L17A 3MUQA 4GWOA 5TPAA 4PE5B 2GFEA 2QPQA 2XXWA 4GXSB 4F39A 4AQ4A 2C5IT 4F29A 1N7WA 1B40A 2QSXA 4F18A 1LCFA 4IO6A 4GF8A 3O28A 2O51A 1MM6A 1MXXA 1MQDA 4LQ2A 5TP9B 3DLNA 2D3IA 1QULA 3TODA 4U22A 3MC2A 2H4IA 3G3HA 1QKBA 3UA8A 5K2YA 3OEMA 1QW0A 3TUSA 3IORA 4FIMA 3T9XB 3VXBA 2HAVA 3TTRA 4LP2B 3Q26A 1UTBA 3BFTA 4KPTA 1D9YA 2C5JA 3THIA 1LBCA 2ONSA 3VLWA 5HBCA 1IXHA 2AL5A 3H3GA 4OESA 3FJ7A 3LSFB 4E0XA 5IKBA 4IO2A 2ZYKA 2F8DA 4NF4B 5CMKA 1FQDA 3BFUA 4RA1A 2Z8EA 4NEDA 4R6KA 1XS5A 1Q35A 3LC8A 4WEDA 4DIGA 1Y9UA 3KN7A 1B32A 2XD2A 4X9TA 5M2VA 3TZAA 3FASA 4DXUA 4ZEFA 3G3JA 5I84A 2V93A 1SW4A 4XKNA 3OSRA 1NNPA 3JV9A 4XKQA 3I6VA 2QS1A 3A3UA 3U94A 1USYE 2VD2A 1FTJA 3TQLA 4H67A 3PU5A 3FD3A 2X7QA 4KR5A 3OOAA 2X9YA 4O3AA 2REJA 3HN0A 1WDNA 3R26A 2ZYNA 3S4UA 1OQHA 1L5TA 1IXCA 4IO3A 4EDPA 4ZS9A 2V3UA 4LZ5A 3UGWA 3HHGA 3CG1A 2A5TB 1N3XA 4R9FA 3GXAA 4ESXA 4P11A 3VE1B 3QYTA 4R2FA 3L6HA 5CRYA 1UIUA 3MAMA 2P2AA 2E1SA 1IJ6A 3FZVA 2THIA 1FQAA 2VD3A 5DVIA 1N0TA 1B6HA 3VDFA 4LA9A 4ESWA 1HSEA 2XXQA 2I48A 2O7IA 2LAOA 1Y3QA 3TMGA 1NKXA 2DQVA 5KDTB 3K6WA 3SERA 5CBSA 3Q28A 1T0KA 3RT8A 4IY5A 4X1BA 5H8FB 3G3FA 4WEPA 1TXFA 3MZ9A 1N7XA 4GXAA 1P1NA 1GTKA 2XXXA 4OFLA 4Q8RA 5BWJA 1H3DA 3U93A 4IO5A 2ANJA 1LAXA 3FV1A 1I6AA 2DXYA 2F7BA 5JEIA 2V25A 2RC9A 2ZNTA 2MBGA 3EF7A 4THIA 4PFYA 3F11A 2I3WA 3TTNA 1LAFE 3TELA 4MBPA 5FTIA 2KWIB 1OQGA 1MPBA 1B2HA 1MDP1 4KYEA 3CRBA 5BUUA 4R75A 3FGSA 3FXDB 4WXJA 3N6UA 1SQYA 3GLBA 3I5OA 4X1DA 4G77A 1LLSA 4GQOA 5L9MA 4G2ZA 4F2QA 3KZGA 4OXVA 2F36A 5JTYA 3T96B 3K1NA 3K1PA 1IUDA 3N6TA 1MPCA 1LAGE 3EHTA 4ZE9A 2IA4A 1JEUA 4YICA 4KD5A 3VVFA 3C9HA 4OFOA 1MQGA 2DWIA 3GZGA 3KSJA 3GBAA 4JWXA 1H45A 5AE4A 3MP1A 4FATA 1SVXB 5KCJA 4F3PA 1MQHA 2QMXA 4B6XA 4OMBA 4LONB 3OSQA 2I49A 4ZDMA 2RKMA 1II5A 3MPLA 1B1HA 5DEXB 2XD3A 3OO8A 1MXYA 3IAZA 2DXRA 3TEPA 1B46A 1SW1A 1US5A 3RT6B 1POTA 3KJTA 4NWDA 1IIWA 2P0SA 3CFXA 4U2RA 1B4HA 3OO7A 3R7XA 1QUJA 3D4GA 2HZLA 3V8XB 1B0HA 5I59B 3JZJA 3IR1A 1LBBA 4G4PA 3SEVA 4OWDA 1IITA 3UK4A 4ELPA 2I0CA 2CMOA 4I1DA 3SEXA 1XOCA 1I6QA 2F97A 5ICTA 1UTHA 4IO7A 1MY0A 2KWHA 5I56B 4KQPA 2Y7WA 4Z0IA 4NTLA 5TPAB 4ZZAA 2WKYA 4RY1A 1MXUA 1YTVA 5FHOA 2F6PA 2PX1A 3S9LC 1AOVA 3MZ1A 4QFKA 3T9HB 3C33A 3EPEA 3RPWA 2VGQA 2O69A 4H65A 2NWJA 3CVGA 4LVQA 2YLNA 2PVUA 3IL1B 5H8NA 2HXWA 3CR9A 4F1UA 2HEUA 3RTFB 3KG2A 4G8NA 3A3CA 5FHMA 2QRYA 1D4NA 4DLDA 2O1MA 3T9UA 3MXZA 1YAEA 5AA4A 1A54A 1XVXA 1UTBB 2OCUA 5FTHA 1A7LA 2Q88A 2O7UA 3MPKA 5A5XA 4EXLA 1ZU0A 2GHBA 1BKAA 5B7DA 1OLCA 4LUBA 2RC7A 5AA3A 4DXBA 1GR2A 1FTMA 1A40A 5H8QA 4RYAA 4RK9A 1MXWA 4JXIA 1J1NA 1DTZA 1Y4CA 3O6IA 1ZBMA 2M8CA 4BDQA 2Y7KA 4OHNA 4HS7A 2F7AA 2I58A 3O97A 5F1QA 1LSTA 4TLMB 4QSDA 1SBPA 2DWJA 3LR1A 1Q1KA 4ONYA 1I69A 1SI1A 1MY2A 2AL4A 3C4MA 5L9OA 2Y7PA 2UYFA 3OENA 1LAHE 3IB0A 3RQTA 4DCXA 3U92A 1DOTA 1Z0PA 5DYHA 4I9DA 3TAJA 1HSLA 3G7WA 2ESNA 5CBRA 4F19A 1N3WA 4NF8A 2G93A 4FEDA 4NF6A 5I57A 4UACA 3HSTA 3W9VA 4FI5A 3IOUA 3IO6A 4QSEA 3CSBA 5FHNA 2NUVA 1Y20A 3TDJA 3OD7A 3C31A 4Z7EA 2XX7A 4YMAA 3T66A 3LSLA 1QUIA 2HAUA 4MFIA 1DSNA 4MH5A 5ICQA 3TKDA 1WODA 2B3FA 1IQ7A 2R6GE 2ZYOA 4JB7A 1JEVA 4GL0A 3O66A 2UVJA 3M3KA 4EYYR 4PQJA 3Q25A 1FQFA 4OVJA 3MP8A 4C1TA 3SEYA 2UVGA 3S2VA 1D3KA 1H76A 3EHUA 4ZZEA 4F1VA 2QS4A 4KCDA 3OELA 4KYSA 4QFPA 2VHAA 2GH9A 2UXAA 4PFWA 4G8MA 3PUVE 3C34A 3VV5A 2ONRA 3WAEA 2K48A 1QUKA 4YKKA 1JW4A 3PMVA 1RKMA 4QFLA 5ELVA 4YB5A 3IB2A 3CFZA 3PV0E 2QMWA 4E0WA
chains in the Genus database with same CATH superfamily
4N13A 1A8EA 1G0HA 2JPFA 3DP4A 5F7VA 5I3SA 1FPFA 4ZEDA 1HG5A 1PB9A 2K5BB 1XDPA 4LATA 3V5AA 3HR0A 3N9OA 2F6GA 5L4HA 3J9X1 4O4JE 1US7B 4E7SA 3CQGB 2G0UA 1R1NA 5CMMA 4ZECA 1MMNA 3TYHA 1JQFA 2ZLYA 4I4TE 4MX6A 3ANWA 3SOLA 4FBPA 4KX6A 4IIJE 1AH5A 2ZMAA 2Q9QC 3RN8A 2ONKE 4EXKA 2V3TA 1T7SA 4MLQA 2FYIA 5CMBA 4YSZA 1SD3A 3NBXX 4HE8A 1R6ZA 2NXOA 4EUOA 2DL1A 3MP6A 3FXUA 4JWOA 4YB7A 4GK5E 4IO4A 4IE0A 1EYJA 3IOWA 5F24A 1HNXT 4MEVA 4U1ZA 5FXXA 3N26A 2F35A 5ABGA 2EHOA 5L2LA 3K4UA 4DV3T 2VKOA 3JAFA 4CXWA 1R9QA 4U21A 1NUWA 3QK6A 4X04A 2NOOA 1ZMGA 4HE0A 1IMDA 5ETWA 3OJAA 5CGMA 3U78A 4IB2A 3CIJA 1NH7A 2N9DA 3OBVE 1DTGA 2BG9C 3K3QC 2RPAA 1FPLA 2C5KT 4H45A 1QJMA 1OMPA 4MJOA 4QX7B 1KA1A 4F8HA 1B4ZA 1GVCA 5CI5A 2WSSV 2Q2AA 1FTOA 5AQFB 2QJEA 2E5VA 3ZCJA 4XZCA 1B7UA 4BDLA 2CE7A 4MAGA 5JQGE 3K6VA 3MBPA 4YHJA 2H25A 2QL3A 3KGCA 3M8UA 3N9QA 3HHFA 2XQ4A 1FQEA 5JTYB 4QH4A 3ONJA 2WYKA 3E79A 3FBLA 3AE4A 5C2TA 4H9SE 1B58A 1NH8A 4ZS2A 4QFOA 3KINB 4TZ4C 4TV9E 5JR9C 1AL3A 5J2UE 4HFIA 2DOJA 1YYZA 3IBPA 2VVSA 2CM0A 3AE5A 4GWYA 2QYWA 2RA1A 5ABFB 2DWHA 1GV8A 1MIVA 5EQ7A 1KA0A 3TFLA 4AXPA 2DVCA 2WM9A 3ZKLA 5CJ5A 2KQZA 3I0OA 4UEMA 5JRCB 3RNNA 3RTWB 4BDOA 1CE2A 3CX7B 4PC9A 4BLAA 4EEDA 1EH3A 4I0UA 5HEGA 3OXNA 5KCJB 3JC6C 2KLQA 5FL1A 2YK0A 3D4CA 1Y64B 3FXBA 3Q29A 4G8HA 4BAYB 4HE2A 3SZPA 3EDVA 3ZJ1A 4DUZT 5I5PA 3KOTA 3FATA 5AFUL 3N9MA 3LBSA 2Q9QB 1Z7ME 3RYFE 4U23A 1XVYA 2V26A 3UU4A 2XPKA 1RYOA 4NF0A 1XI6A 2WMNA 4NXNT 2XXYA 3SEUA 4NQ8A 3LDQB 4DR1T 3IO4A 3B6QA 3QNUA 4U4XA 1VFDA 1KNPA 1FW0A 1NEKA 4GX3A 2XTLA 4COFA 3VRBA 1ZTYA 4XIGQ 3QB5K 3MYUA 4N15A 1OLAA 4QHOA 4R74A 2BG9B 1B5HA 3ZYKA 2HCAA 4JV5T 1MXVA 3KBZA 4HFDA 1M5CA 2Z8FA 2W66A 1M7KA 2C0SA 2UYEA 4TOZA 1JETA 4JI2T 2X0YA 3NVOA 5EHMA 5FY1A 4ISUA 1LFGA 1MMDA 3EDUA 3FVKA 4PAIA 2DI4A 4AB5A 1UTHB 4PFUA 2RCAA 4F22A 1FQCA 1DPPA 1GQEA 1AMFA 4OYVA 3V5UA 4DIDB 2KLFA 4IE4A 5LYJE 3UU6A 2UXXB 2V7JA 1FBGA 4YKJA 2DP8A 2X9XA 1VSOA 5LMUT 5JR9B 2D21A 1KNRA 3RIUA 4JDFA 5CC2A 4H9RC 5FMNA 1FBHA 3VXCA 5DT6A 1NWMX 3NRXA 2RF1A 4UXNB 4DV5T 1X9BA 5J2TE 3K02A 5AA2A 3PPPA 1B5JA 1S7YA 3MVWA 4QXCB 3FXEB 2DCFA 3PD8A 2H3RA 2PFZA 4H8IA 1HNWT 3ZMTB 2Y84A 3G3GA 5EHSA 5H8NB 3IB1A 5KMGP 2DE3A 1GGGA 3CG3A 3H4ZA 2LLYA 2E5LT 2Q8MA 3C36A 5L3BB 1JNZA 1E1HB 4ELRA 4OVRA 2QS2A 3FIRA 3CQXC 5IYZE 2LKHA 3ZMSB 4YSYA 4ILCA 2K3WA 3ISPA 4N8GA 4DCYA 2UXNB 4U33A 1QKAA 4N6KA 3O1IA 2FIEA 1V9DA 4HWIB 4OX9T 4PFIA 5J1DA 4G2AA 5KZTA 3H7MA 5A1LA 4X64T 1I6ZA 5H8HA 2CLYC 1SDXA 4GYSA 1ZP0A 2L3LA 4H0WA 4JVDA 3D1RA 2I3VA 5AA4B 1ATGA 2XAFB 1QLBA 1ZLQA 5LDZA 4LF8T 3OTOT 1X79A 2X67A 4XBFB 5A5XB 3QOFA 4ZI3D 2Y5KA 1HX1B 2OLBA 2VKDA 1QGXA 3N94A 3TCFA 5AA1A 1BLFA 3HA4A 1XC1A 2H99A 2NP9A 3TQWA 4UF0B 2P3NA 4F3GA 4ZZBA 2A2FX 3CQCB 5FNVE 1D9QA 2CA5A 3A7MA 3AEAA 3U72A 2B3BA 5H8QB 2XXHA 4OFJA 4IGTA 3MZKB 4IR8A 3S9NC 3T1YT 1ZHCA 4DE8A 1O63A 4HKAA 1ANFA 3QIMA 5ET7A 4CQIA 1MG1A 2H98A 1DCUA 3O1HA 1SW5A 5AQKB 2X26A 4TWHA 3TTLA 2A5SA 2Z8DA 1FPIA 3SEWA 2B4LA 3ZLIA 2XA5A 2BJIA 1B3EA 1VDWA 3AVRA 4KUMB 3UQ7A 3BQIA 4YTNA 1FTAA 5L3CB 2IUBA 4A5XA 3CPZA 2A72A 4EF1A 4H9OC 1EZ9A 1NV1A 4FE8A 3AA0B 1EZOA 3NZPA 4OK0A 1ZEEA 4PP0A 4AKGA 5EK4A 1NNFA 5LB7B 5E0OA 4DZ1A 5I2NA 3ZKKA 3RYDA 4IDZA 1URSA 3VFJA 4PFOA 3UU5A 3OVUA 3FZHB 2BJJX 3ZJ2A 2PCRA 4YJ3E 3T9VA 2XXRA 4MLVA 4MLKA 2ALUA 3FZLB 2H5YA 3TLVA 4WZXA 1TT1A 4G68A 4IY6A 5HXEA 3PV0F 1TFAA 3MVYA 1OWAA 3P4PA 2V5DA 3OPCA 3AVSA 5FVKA 2Q9QD 3P50A 4XKRA 3MK7C 3Q27A 3VRAA 3A09A 3LUYA 5JVDE 1Y4TA 2FIXA 2RP4A 5HCJA 1IEJA 4UELA 2OBGA 2NVUB 2W67A 3P7IA 2WDVA 4O94A 4PTKA 3AAEB 4I62A 4NF8B 4PFTA 4DR5T 4R6HA 1UX5A 5ADXL 4PF8A 4NF6B 4Q5TA 4H5GA 5I57B 2CLYB 1RDXA 2WDQA 2Z22A 2E9XA 4PNIA 2PG8A 1B3LA 2LJLA 4HN9A 3VLUA 4NE4A 3SETA 1B3GA 2AYSA 3FVOA 3V5SA 3UFEA 2CXLA 3IJOB 2F5XA 4YB6A 2G29A 4JI0T 4ANJA 4I50E 3AE7A 1YQ3A 2EHOC 4P0GA 1MH3A 3ZMVB 3S9MC 3E3KA 3IX1A 3SKPA 3PUZF 5DEXA 3UUMA 2H9BA 2CZHA 3RKGA 4GIZA 3B7DA 3DP8A 5I58A 5ISUA 1PB7A 3GA8A 1IZ1A 1SE7A 3KJ7A 1E2AA 3RPLB 4I43B 4XXUA 3L39A 5HXHA 4PGPA 5DQWA 5ITPA 4M1PA 1YCJA 5IZ3B 2CWYA 3UFGA 1O64A 3KN3A 4YHHT 3JCFA 3ZSSA 2Y48B 3ZYLA 2N1GA 1S94A 4DV7T 5JTGA 3KFWX 2OZZA 5LMNT 2V5CA 3LK2B 1U4QA 2GHAA 3PMWA 4HCYA 1KNZA 3L8RA 5AQIB 4ISSA 4BA9A 4TX5A 4GD5A 1O7TA 4YT0A 3LSVA 1Y3PA 3RX6A 5AQJB 3PGFA 5HXRA 3CIRA 4YKIA 1WR6A 4P09A 4TNVA 4FECA 4GKJT 1H43A 4FJPA 4H6DA 3O6HA 3LSWA 3QAXA 1N84A 2Y7RA 3S9EA 3E22E 3JC6D 3P4RA 3UIFA 5FP3A 3HPIA 5DW8A 4HXVA 4WW0A 2RINA 3TPAA 4NUVA 1LBWA 1MH4A 4KCCA 4ND9A 1D1AA 2YEVC 5LGTB 5BR8T 1NUZA 4OEUA 1POY1 4K3FA 5DJQC 4NG7A 1PBPA 4ZEKA 3SESA 4GX4A 5I56A 4QH5A 4UA8A 4OQOA 1P1UA 5FXVA 5L8DA 4OHFA 2GRVA 4EAHA 2X0HA 3EKIA 4TV8E 4O3BA 2DYXA 3UORA 4DR3T 4DV0T 4JLEA 2W61A 1EU8A 1LBYA 2LE8A 3ECRA 4P1EA 3T93B 1URGA 3PTRB 3ANWB 3K6UA 1VE4A 1EZPA 1QVSA 3FZKB 3IOTA 4N81A 1M5FA 1OEDE 4AQFA 2X68A 3WI3A 1B05A 2LSGA 2Q9TA 1LFIA 3PU8A 2XQ9A 2ODVA 1AWBA 5JK4A 5H8SA 4PAFA 4ILAA 1N36T 1N76A 3CX6B 4BDRA 1UX4A 3K0VA 4GL8A 1S35A 3B13A 3LK3B 4JBZA 4ECFA 2EHOB 1PC3A 4N6PA 2R71A 3N9PA 3K2DA 3C4XA 2ZM2A 2DWGA 2LHNA 4O3CA 1LGBC 3PPOA 3RY3A 1MM7A 3N2KE 2CZLA 5LCYA 5FYMA 4OANA 5H6RB 5A5LA 2D5WA 1CB6A 3TLSA 1MY3A 3HCQA 1ZOYA 3CMLA 2BKOA 4R6YA 4YMBA 2VL8A 2PYYA 2NOXA 4X1YE 1FBDA 3OO9A 4GIWA 1M5DA 5I2KA 3E78A 5IZZA 1W9RA 4U2YA 2F78A 3HL6A 2XXTA 1IJ5A 3ZEFB 2D2SA 2HQ0A 3FUZA 5LP6E 3H6WA 4JEHB 5LOMA 3MWBA 5DTBA 1A99A 2UVHA 1NUXA 3M65A 4JI3T 3L3PA 3H3MA 4F2OA 4B3MT 4TWFA 2KR0A 2JQ9A 2FA7A 2W7YA 1HX8A 2FBPA 5T3JA 1S9TA 4RJZA 4MNPA 4O4LE 4LF5T 2LOPA 3RIUC 3OEKA 4DUYT 2I0BA 4C1UA 4AI6A 1MMGA 4PJJA 2V1DB 3RLFF 2XXUA 4H9NC 4BDNA 2CPTA 3RH3A 4YFSA 4HTGA 2XXIA 2CEXA 1ZIUA 4QF9A 4HCWA 2JMKA 2WAUA 3RGLA 1NUYA 4O7MA 4IDPA 2HFBA 4RPNA 2NW7A 3SDFA 1FPBA 3HI2A 1D9VA 4POWA 1MXZA 3DP6A 4P9KA 3V89B 4IREA 4NF5A 4ELOA 5KXJA 4TNWA 2QS3A 3VLVA 4KBMB 5LBQB 3PJAJ 5EYFA 3BKIB 2J62A 2XQ7A 4U4SA 3L6GA 2UVIA 3TCHA 3JAEA 3O9PA 1B7HA 3E13X 4PBHA 1CUNA 2IAKA 2DSFA 4P0IA 3KSXA 2HZKA 3QUJA 4H9PC 2L8KA 2A3DA 2B65A 2ZXTA 5HYAA 2IIUA 1M5EA 4GYRA 1S50A 2K24A 2ZM8A 3CHGA 3WAJA 2B1EA 3E4RA 1PBQA 3KFMA 4Q0CA 1P1QA 4CXXA 2I4CA 3MVXA 4YU0A 1OVBA 2R9JA 5LOVE 3TLTA 2AIXA 2YU2A 1BR4A 4NUUA 4ZXLA 1TWYA 3KN8A 4PFRA 1FQBA 2XUEA 4KMCA 5TP9A 2I6EA 3PPQA 4DR6T 4JSOA 4N07A 3EQ1A 4OZ9A 2HPLA 1ZKBA 3R6UA 5F5WA 2OWSA 4RPOA 3LSXA 3QB5A 2YDRA 3B6WA 2VURA 3QMFA 4ELQA 3G3KA 4DI3D 1I6BA 4HW8A 4IDOA 4O4IE 1US4A 1ELJA 4UVAB 4RNSA 3PUZE 1SYHA 4GFRA 1L0VA 3PUXE 4JWYA 3CKDA 1K9YA 1AIVA 3ZT7A 1WLXA 2VK9A 3K01A 4ZEBA 3FXRA 4H1XA 4EQ9A 2V7IA 4GRKA 3K3NA 1XT8A 3GBBA 3OYXA 4LN5A 4HFHA 4YKPA 3F2EA 1JNRA 3UUNA 4H8JA 1HCIA 2LOSA 3O1JA 2PFYA 3C50A 4XKPA 4KFQA 1J1JA 3TCGA 3IJXB 4LFAT 4EZ4A 4QBAA 2OK2A 2GK9A 3ILTB 1B0LA 5LGNB 1LEVA 3IFAA 4QXDA 3LBXA 4ZEIA 1FCKA 2CMRA 4K0UA 3M3LA 5JDQA 1FRPA 5FVLA 4R73A 2FHYA 2O68A 2JQQA 5AQMB 5ITOA 1N34T 2X9HA 4LZ7A 1MNEA 3MQ9A 1G73A 2LSJA 5DVFA 4N78D 4N8YA 3ODBA 1JNFA 2I6HA 4XAXB 5AA2B 4X48A 3E9XA 2E8IA 2Z23A 3RUMA 4CN1A 3K1MA 4OETA 2PT1A 4NF4A 1FJ6A 4PK6A 4EQ7A 5JH7E 3IF8B 4PAGA 4JI8T 2XXPA 4XFEA 2F4VT 5LHGB 3NWIA 3UUXB 3AXFA 2XXVA 4G68C 1NL5A 5ABHA 1LCTA 3KBRA 3E08A 2PBIA 3DP7A 2DVZA 3AXJA 4QFNA 5FXZA 1P1WA 4U1OA 4GWXA 2IC9A 2I4BA 2M67A 3I9WA 3BQKA 4OTEA 4F1YA 5I7IA 4MALA 4DR4T 2W00A 1Z8UA 5H8HB 3DTOA 3SWHA 5L9SA 2EHOD 3PUSA 4OEVA 2E2AA 2E9XC 1OVTA 4DNDA 1YZ0A 4WKMA 2ACXA 2MOZA 2BVMA 3R6NA 5EYGA 2D0TA 4BJNA 2OLTA 3PUGA 2DDKA 2ABHA 2ZNSA 3MW0A 1VFEA 1ZJLA 4EQBA 5ET8A 4WBNE 1MY4A 3ZS6A 3HFUA 2KNDA 1PB8A 2P3VA 3I3VA 2BS3A 3RI5A 4BDMA 3USDA 5AQNB 2DLRA 3ZSFA 1WR0A 1IBMT 1IMCA 3HV1A 2J1DG 1B9JA 5HM4B 2LSKA 1A55A 1IXIA 2VPOA 4P3LA 1YW0A 1SYIA 2Q8JA 2NW8A 3CVRA 3CSGA 2LM9A 4Q30B 5IGAA 4KHZF 4I3YA 5IWAT 3H37A 2V84A 3VVDA 1B7ZA 4P56A 4GX6A 1H44A 3G06A 1BIYA 3N5LA 4FAJA 2Q89A 1B3HA 1BTJA 4R72A 3EABA 1NNKA 5GONE 2WU2A 3FB2A 4X8RA 1B7TA 1N04A 5KDMC 4YAHX 2DWAA 2MYSA 2A5TA 2F34A 2NTXA 4O7IA 4RK2A 5IAIA 1XNRT 3KC0A 2VKJA 2BG9E 4JSDA 2PJQA 1LBZA 1I94T 3MJXA 3RRWA 4X62T 4ZE8A 3PUWF 4OERA 1A8FA 1SW2A 3K6XA 5FL0A 1UIVA 2XX8A 5K2XA 3ONLC 1W0BA 3M3FA 5I2NB 2WWVA 3RRCA 2XAHB 1DMBA 3VVEA 5CB4E 1B52A 3GN5A 2OWTA 2WZHA 2ODUA 3ESLA 2Y7IA 3RLFE 4G63A 2YINA 3EI0A 2PT2A 5AQRB 2Q2CA 4DV6T 3TKLB 3H6TA 4G68B 3VR9A 4PJLA 3W15C 3ZCIA 3RC3A 4JI4T 1FJ9A 1URDA 2JQHA 1LKXA 2YJPA 4YZZA 2X9WA 5KDTA 2H7OA 3AE6A 4H46A 4N6DA 4M4GA 1ZKEA 5CMCA 4AB6A 2XQ6A 1BR2A 5EK2A 4R9GA 4K0KT 2BBJA 3DELB 2LRKA 4OVSA 5H8FA 5HWYA 2VP1A 1DK4A 5ABFA 1YPNA 2X0LB 3WAFA 4AS4A 4JI7T 4FORA 4JYAT 2KSRA 4FEBA 4QRZA 1FTKA 3RHWA 4M1VA 2J4GA 5DVJA 3PUQA 4WBOA 4OFZA 2E9XB 4R2BA 4KP3C 4MHCA 1JVYA 3DJBA 3T8OA 2V7MA 5JRCA 2F7CA 3FVGA 4JI1T 2O84X 1HFAA 1IBLT 4AQFC 2RCBA 5FY7A 1BR1A 4JVCA 3DM0A 1WVJA 3RQWA 2XQAA 5L4EA 3AA6B 1LVFA 4ZEYA 1XNQT 3ETUA 3PPRA 4LF7T 2QVAA 4X1KE 1RDYA 4P0BA 5CFBA 4GVOA 3ZMZB 3MVZA 4P1LA 5HPQA 2K9AA 1RDZA 3ZMUB 3ZYMA 2YN6A 2HN1A 4DV4T 2NR4A 4DMVA 5C8YE 1R9LA 2IC6A 3Q5WA 1B5IA 1IMBA 1LBXA 3C32A 1QSDA 2DE4A 4I40A 5I58B 5IZ1A 1PDAA 3SFEA 3V83A 5LNKA 5J16A 1NFTA 3T22A 1F9BA 3ILUB 3P8CD 2XWVA 3KVBA 3FXQA 2O1LA 3LG7A 2OJTA 1YKHB 1JW5A 1XHYA 3FV2A 1MNDA 5LXTE 2CZIA 3RYIE 3LK42 2ZMBA 3CFLA 3AEBA 1MS7A 4GOTA 1LFHA 3MZBA 1M62A 3C35A 2D9DA 1K9ZA 4F3BA 2YPNA 5KX5E 4WYVA 1HSJA 5HEJA 2FNCA 5LG4A 1TFDA 3H6VA 5AA2D 3K00A 1NV7A 1OXZA 2BDEA 1DPEA 1P1OA 4TQUQ 4JI6T 3QUFA 1OIBA 4V1Av 3VU7H 1JVXA 1SPIA 3H06B 5LHIB 4GLIA 3TTKA 3GMIA 3AE2A 1M5BA 5F8PA 5LHHB 2P1SA 3O6GA 1B1XA 3H6UA 4WNKA 3OO6A 3AEDA 2ZZVA 4I8CA 2X7PA 3N9LA 3W15B 3E0ZA 1UQWA 2DS9A 4NX1A 3QSLA 2RC8A 4C0RA 4KYDA 4DXCA 5B70A 3LUZA 4F6RC 1BK4A 4MF3A 1BP5A 3PD9A 3FVNA 4QHQA 4UV9B 2XZEA 4FJOA 4MNCA 3TTMA 4EOZB 1P99A 3PJAA 4TLLB 4U72A 3RPUA 1J5ET 2L5VA 1D0XA 4EZHA 2O6AA 1MDQA 2V3QA 3ONXA 1NV3A 4RXLA 1BR0A 5AQUB 4CN4A 3O2AA 5TAOA 1VCSA 3X1DA 1JW1A 2PMSA 3PUYE 2BBHA 4UVCB 3IK6B 4LZ8A 1KWHA 3U8QA 3EN3A 1PEBA 2UUCT 1UGOA 1FBPA 4DBRA 4GOUA 4CXYA 1B3FA 1RYXA 4H5FA 3PMXA 3W9WA 5TU0A 3AE1A 2XWIA 3KEIA 4QSCA 5LG3A 1FPDA 3UP9A 2XSBA 4OENA 3Q2MA 3FJGA 4U74A 4HTEA 3ZC0A 3KC1A 2D0UA 4L0RA 3ABVA 1USYH 1H7CA 2UU9T 3B6TA 3MJNA 2QVRA 3J7Yq 1IMFA 4ZHQE 2V6YA 1SI0A 4YY3T 4KI0E 3PE0A 1MQJA 1MPDA 4PCDA 2WBDA 3JYRA 2AE9A 2LSYA 2PBWA 4NWCA 3EHSA 2MPKA 2YOEA 4LFBT 1FTLA 3PUXF 5AQLB 1IXGA 3QXMA 1FMWA 3CI8A 5I2KB 2CHNA 1T72A 1VR5A 3SRZA 4TUYE 2DE2A 1IMEA 4DDDA 3G3IA 4DVDA 4B3TT 3PPNA 3KV4A 2ZYMA 4KHZE 4F3SA 3IOVA 2XX9A 2VWAA 4L9IA 3UN6A 4J2CA 4F31B 3MA9A 2REGA 1FPKA 1Y3NA 1MY1A 2IEEA 1UCUA 2XHDA 3OMBA 4PBQA 3BBRA 4XTCQ 3RIAA 2E0SA 3ONMA 3HO7A 1MRPA 4EF2A 5JDLA 1LB8A 1LRZA 1NMUA 1T98A 4NMYA 1YXRA 1SUMB 3KOSA 2ZNUA 3GYYA 5I59A 1LB9A 3H03A 3U1OA 1Z7NE 3PUWE 1Y1ZA 2Y5LA 2ES0A 4EEBA 1NNTA 2W4XA 4LQ5A 3K8PC 2HH7A 3P4QA 3FZMB 4POXA 1MQIA 3PURA 3MSTA 4IDQA 4O2BE 2VOZA 5CM6A 3RGYA 4PK4A 2FJBA 4NF5B 1Y1MA 3O29A 1B51A 4PETA 3IEEA 4IL9A 3FJMA 4IGRA 2WEFA 4L17A 3MUQA 4GWOA 4N4UA 1MMAA 5TPAA 4PE5B 2E9XD 5EZYE 2XAQB 2B4MA 2GFEA 2UXCT 2QPQA 5L47A 2XXWA 2B76A 2UXBT 4GXSB 2JJ9A 4F39A 4O8MA 3N9NA 4AQ4A 2C5IT 4F29A 4QXBB 1N7WA 2KXPB 1B40A 1IAPA 2QSXA 3HKCE 4F18A 3F31A 4LF9T 4HWHA 1LCFA 4IO6A 3I1AA 5EK3A 2WBLA 2ZM0A 3LJCA 2KINB 4GF8A 3O28A 2N2NA 3GWHA 2O51A 1MM6A 1MXXA 1MQDA 4Z91A 4LQ2A 4OVPA 5FBPA 2FJAA 1KF6A 4A98A 5TP9B 3DLNA 2D3IA 1QULA 3FBZA 2XXKA 3TODA 4U22A 3MC2A 2H4IA 3G3HA 2A9UA 1QKBA 5HXSA 4UIGA 3UA8A 4G61A 2NW9A 1IZNB 5K2YA 2LHRA 2L9QA 4DI4B 3OEMA 4PAKA 1FPJA 2CXFA 1QW0A 3TUSA 3IORA 4FIMA 3P4SA 4AQYT 3IFCA 3T9XB 3C64A 2GQ1A 3O9XA 4O8SA 2CRBA 4MIJA 3VXBA 3O4XE 4X5TA 2HAVA 3RC8A 3IHRA 2NWBA 2F3DA 4C91A 3TTRA 4AQGA 3D0TA 4LP2B 2V4CA 3NRYA 4QWNB 3Q26A 4YSXA 2HPJA 2CBJA 1UTBA 3B57A 5LJNA 4X1IE 3BFTA 4KPTA 1E7PA 4IE7A 4ADZA 2X66A 3LBXB 4EIWA 1D9YA 2ZZXA 2VB6A 3AA7B 2C5JA 3THIA 5FKYA 1LBCA 2CEAA 2ONSA 1FMVA 3Q9DA 4N17A 5AQOB 3VLWA 2IDOB 4P47A 5HBCA 2Q74A 1IXHA 2AL5A 3H3GA 2AXDS 4OESA 3RKOA 3FJ7A 3NZQA 3LSFB 4E0XA 2WDRA 4LMLA 5IKBA 2XWKA 4IO2A 2M6IA 2ZYKA 2F8DA 4KHPT 4MCOA 1EZ3A 4NF4B 5CMKA 4MFRA 2CXDA 4PJNA 1FQDA 3BFUA 4RA1A 3CWZB 2WMOA 3AAAB 4GWUA 2Z8EA 2QVVA 2BS2A 5ESYA 1DBZA 4NEDA 4R6KA 4JUYA 1XS5A 3R84B 2LEHA 2ACZA 1Q35A 2XQ3A 2XAJB 2HXRA 3LC8A 4WEDA 4DIGA 2M6BA 2HPGA 1Y9UA 3KN7A 4QXHB 5FY0A 1B32A 1D1CA 5EYHA 2XD2A 4X9TA 5M2VA 4UV8B 3TZAA 2UXDT 5HAXA 3FASA 4IE6A 4DXUA 4DR2T 4ZEFA 1NV2A 5AQGB 1NENA 3G3JA 1N32T 1Q9DA 3RYCE 2XWOA 1OEDA 2V93A 5I84A 1SW4A 4XKNA 4GWZA 3OSRA 5EQAA 1HR0T 1NNPA 3JV9A 2LSIA 4XKQA 2OV9A 5AQQB 3UQ4A 2MKZA 3I6VA 2QS1A 2JRKA 5HWXA 4DV1T 5C3JA 3A3UA 3U94A 2IHR1 1G0IA 1USYE 2VD2A 1FTJA 3TQLA 2XM1A 4H67A 3PU5A 3FD3A 2X7QA 4KR5A 4XEQA 2HHHT 5HEUA 3OOAA 4O4HE 5FXWA 5IUXA 2X9YA 4O3AA 4NXMT 2REJA 4U7YA 4AKRB 4LMKA 3HN0A 3JADA 1WDNA 3R26A 2ZYNA 3BK9A 4LFCT 3S4UA 4HFVA 1SA0E 1NV0A 1XZYA 1OQHA 1L5TA 1IXCA 4P8BA 4IO3A 4ZI2C 4EDPA 4JVIA 1NAFA 4ZS9A 5ET6A 2V3UA 3KDSE 5AQSB 4LZ5A 3UGWA 3HHGA 3C4ZA 3CG1A 1CHUA 2QFLA 2A5TB 1N3XA 4R9FA 2WWUA 4JEUB 4NIQA 2OA5A 3GXAA 4ESXA 4P11A 3VE1B 3QYTA 4R2FA 4YLHA 3L6HA 1FEWA 5L3GB 5CRYA 1UIUA 5CA0E 3H3AA 4X20E 4XF5A 3MAMA 2P2AA 5LBMA 2E1SA 3ZT6A 4DBQA 1IJ6A 3KV6A 3FZVA 4GBVA 2THIA 3GN5B 1FQAA 2VD3A 3HKBE 2WS3A 1WRDA 5DVIA 4GWWA 3KBUA 1N0TA 1B6HA 3VDFA 4LA9A 2V6XA 2H7VC 4PGNA 1CNQA 4HFCA 4ESWA 1HSEA 4PFPA 2XXQA 3PTYA 2I48A 5J1GA 2O7IA 4EXTA 2LAOA 4HFEA 1Y3QA 3TMGA 1NKXA 2DQVA 5KDTB 4NPPA 4ILBA 3K6WA 3SERA 4TWDA 3NKZA 5CBSA 3Q28A 1QUUA 2R8TA 1T0KA 3B5MA 1G8XA 3RT8A 4ISTA 4IY5A 2CEYA 5IM2A 4B3ST 4X1BA 5H8FB 4C90A 3KV9A 1INPA 3G3FA 2Z6EA 4WEPA 2V8SV 1TXFA 3MZ9A 1N7XA 4YTPA 2VKHA 3PDYA 4GXAA 2CWOA 2I59A 3PUYF 1P1NA 1D0YA 5ABEA 1GTKA 2XXXA 4OFLA 4CI1B 4Q8RA 4HWFA 4HEAA 5BWJA 1H3DA 3U93A 5JDGA 2VL0A 1HNZT 1MIYA 1ZV4X 5JDFA 4NAPA 4IO5A 2ANJA 4OA4A 3QC9A 1WYBA 2XHEB 5DABA 4B3RT 1LAXA 2FVZA 3FV1A 1I6AA 3HKDE 4O2AE 2DXYA 4EYUA 2CZKA 2F7BA 4P0AA 4IE5A 5JEIA 4KI0F 4U2ZA 2V25A 2RC9A 2UUAT 5AQPB 1AJ3A 2ZNTA 2QVUA 2P9BA 1FPGA 2WYPA 2MBGA 3EF7A 5IHYA 1HG2A 4THIA 1YQ4A 2I0MA 2XQYA 2VT5A 3C98B 4DR7T 2DHRA 3EHZA 5JREA 4PFYA 2IMLA 4JBWF 5EQ8A 2DNXA 3F11A 2I3WA 3TTNA 5JDMA 1LAFE 4MBPA 3TELA 5FTIA 2KWIB 3F57A 2WZIA 1MPBA 1OQGA 4NHBA 2H88A 5DQVA 1FSAA 1B2HA 1MDP1 4KYEA 2BVLA 1MIWA 2WBBA 3CRBA 3UU3A 3ZKRA 1LBVA 2JIWA 2F3BA 5BUUA 3C51A 4R75A 3FGSA 5JDHA 5HEHA 3FXDB 4WXJA 4UABA 3N6UA 4HWDA 1SQYA 2YDQA 3GLBA 3I5OA 4X1DA 4H63H 3VKHA 4G77A 4A56A 4GBWA 1LLSA 4GQOA 2BKNA 1KFYA 4JI5T 3T1HT 2YDSA 5L9MA 4G2ZA 1HTJF 4ZI7E 3AEEA 5LA6E 3AB3B 3K3OA 3P4WA 4F2QA 4L5GA 3KZGA 4OXVA 4OVTA 5HEOA 2F36A 1YKEB 5M4YA 5JTYA 3T96B 3AAIA 1FIOA 3K1NA 3K1PA 2NTYA 1FPEA 3T0JA 4GK0E 1IMAA 1IUDA 2W0GA 4IT4A 3BIHA 3N6TA 1MPCA 1LAGE 2KZ7B 4PK5A 3EHTA 2W63A 2FBWA 3FZFB 4ASKA 4ZE9A 3ZPOA 2IA4A 3IA3A 1JEUA 1FBEA 4YICA 3AA1B 4KD5A 2H89A 3VVFA 3FHNA 3PUAA 1JP4A 3C9HA 4ZOLE 4BJMA 4OFOA 1MQGA 2DWIA 3GZGA 3KSJA 3AECA 3GBAA 4JWXA 1H45A 5AQHB 5AE4A 3MP1A 4FATA 2LRLA 3OYZA 3CX8B 1SVXB 5KCJA 4F3PA 4HGAA 3U3IA 1MQHA 2QMXA 3FBPA 4B6XA 4OMBA 2LT3A 3Q5DA 4LONB 3OSQA 2X51A 2V6YB 3BIGA 2I49A 4ZDMA 2RKMA 1II5A 3MPLA 5ET5A 1B1HA 5DEXB 2Q9QA 2XD3A 3OO8A 1UUSA 1MXYA 5LJMA 3IAZA 5LTCA 2UUBT 2Y8DA 1IBKT 2DXRA 2Y6XA 3TEPA 1B46A 1SW1A 1US5A 4Q25A 4MHFA 2ZZWA 4X65T 4I3EA 2BZBA 1D1BA 3RT6B 4U31A 1POTA 3B50A 3KJTA 4NWDA 4GKKT 1IIWA 4E7ZA 2P0SA 3CFXA 4U2RA 1B4HA 4AS5A 2WB5A 5L3DB 1J5WA 3ZN1B 3OO7A 2WQYA 4HE1A 5HXCA 3R7XA 4CI3B 1QUJA 4P1NA 5EQ9A 3D4GA 2XJ7A 2MAWA 2HZLA 2BG9A 4HWCA 2R6GF 3V8XB 1B0HA 5I59B 2LKGA 3JZJA 3IR1A 1LBBA 4UR9A 4G4PA 1EYIA 3SEVA 2SPCA 4OWDA 5H6QB 3WAKA 1IITA 3UK4A 4ELPA 4MBQA 2I0CA 1FBFA 5JDNA 2CMOA 4I1DA 2YKSA 4LF6T 3SEXA 1XOCA 1I6QA 2BS4A 2F97A 5ICTA 1UTHA 4IO7A 3I0QA 4AIUA 1MY0A 2KWHA 5I56B 3VR8A 3TLUA 1T8BA 3AEFA 1W09A 4KQPA 2Y7WA 4Z0IA 4NTLA 5TPAB 3L09A 4ZZAA 2WKYA 5JR9A 4RY1A 1MXUA 1YTVA 5FHOA 2XASB 1N33T 2F6PA 4EV6A 2PX1A 3S9LC 3OKQA 1NV5A 1AOVA 3PUVF 4PFBA 1YXIA 4PDHA 3MZ1A 4DV2T 4QFKA 4IDNA 4TN7B 3T9HB 3C33A 3EPEA 3VHLA 3RPWA 2VGQA 2O69A 2WU5A 2MTQA 4DMWA 4H65A 1OEDC 3EVYA 3A5XA 2NWJA 3N2OA 3KV5A 2WX9A 3ZT5A 3CVGA 3NOHA 2VPNA 4CI2B 4LVQA 2YLNA 2PVUA 2D5UA 2KMFA 1DU2A 3IL1B 3A8YC 5H8NA 2HXWA 1XWMA 3B8BA 4OVQA 3CR9A 4F1UA 2HEUA 3RTFB 5AQVB 4CN6A 3KG2A 3BQLA 4G8NA 4ZI2D 3A3CA 5FHMA 2QRYA 1D4NA 4DLDA 4LMJA 4AKLA 2QGSA 2OWZA 1XDOA 3UULA 1W0AA 4AKIA 3AE9A 5F3JA 2O1MA 3T9UA 3MXZA 1KEYA 4ZZCA 4PE3A 4NGUA 1YAEA 5AA4A 1A54A 1FBCA 2WY2A 1XVXA 1UTBB 2XQ5A 2OCUA 5FTHA 1A7LA 2Q88A 2O7UA 3MPKA 5A5XA 2FJDA 4YTMA 1NV4A 4EXLA 1ZU0A 4YJ2E 2GHBA 1BKAA 2XAGB 2W62A 2JMHA 4HFBA 2V7KA 2FUPA 2ZM6T 5B7DA 2LM2A 2XSAA 2IW5B 1OLCA 4UF0A 4LUBA 4LF4T 5BMVE 2CBIA 2RC7A 5AA3A 3AE3A 4DXBA 1GR2A 1FTMA 1A40A 1LVKA 4MMPA 5H8QA 4PJMA 4Z8XA 4RK9A 4RYAA 4PDDA 1MXWA 4JXIA 1VRBA 4X66T 1J1NA 1DTZA 1UURA 2DWKA 3HKEE 1KK7A 1Y4CA 3O6IA 3VKGA 4UVBB 1ZBMA 2J47A 2M8CA 4BDQA 2YU1A 3SFDA 3MKDA 2Y7KA 4U7IA 4OHNA 4HS7A 2F7AA 2I58A 4NN3A 1KZ8A 3O97A 3T1BA 1HF8A 5F1QA 1LSTA 3UT5E 4TLMB 3M3ZB 4ZS3A 2CHOA 2XQ8A 4QSDA 5AQTB 1SBPA 1NV6A 1OEDB 4ILUA 4A97A 4KXPA 2DWJA 3C4WA 1Q1KA 3LR1A 4ONYA 3ETVA 2VQFT 3CK6A 1I69A 1SI1A 3EUHA 4PW8A 1MY2A 2AL4A 3C4MA 5L9OA 2Y7PA 2UYFA 3EAMA 1XMQT 3OENA 5L3FB 1LAHE 3IB0A 3K1SA 2VASA 1HS7A 3RQTA 4DCXA 1WYCA 3U92A 1DOTA 4OYKA 3RYHE 3LFMA 1Z0PA 5DYHA 4Z90A 4I9DA 3TAJA 1HSLA 3G7WA 2WP9A 5HCMA 3ZC1A 2ESNA 5CBRA 4F19A 3AE8A 1EYKA 2PFVA 1N3WA 4NF8A 4EB6E 4EGWA 2FJEA 1UK5A 2G93A 4FEDA 4NF6A 5I57A 1YD8G 2KT9A 3I9YA 4UACA 3HSTA 3W9VA 3Q5XA 4FI5A 3IOUA 1U5PA 3IO6A 2V7LA 2WCAA 4QSEA 2XY8B 3CSBA 5FHNA 1O3XA 3RQUA 2W2UA 1NI9A 2NUVA 4QH1A 3UUBA 2BKPA 1Y20A 4OYJA 3A29A 3TDJA 3RIFA 3OD7A 3C31A 4Z7EA 1XMOT 3KVAA 2XX7A 2VVNA 4YMAA 3T66A 4IL4A 1WCRA 3ZSTA 3LSLA 4N91A 1QUIA 4MNIA 2HAUA 3RF1A 5CA1E 4MFIA 1DSNA 4MH5A 5ICQA 3TKDA 1FJGT 1WODA 3AEGA 2B3FA 5LGUB 1IQ7A 2R6GE 2ZYOA 2OX3A 4JB7A 1JEVA 4ZI3C 3U65A 4IHJE 4QX8B 2HHMA 1WFDA 4GL0A 3RPLA 2JJKA 3O66A 2UVJA 3M3KA 4EYYR 3ROJA 4PQJA 3MACA 3Q25A 1FQFA 2QRXA 4U3CA 4OVJA 3MP8A 5IZ3A 4C1TA 1VOMA 4H63V 3SEYA 4AISA 2UVGA 3S2VA 2JQKA 3PU3A 1D3KA 1H76A 4DO0A 3EHUA 4ZZEA 3TLWA 4F1VA 2QS4A 2XM2A 4H9QC 3LV0A 2PTFA 3Q5EA 5L3EB 4GWSA 4AKHA 3OELA 4KCDA 1R8IA 4KYSA 4QFPA 3AXJB 2VHAA 3UTKA 2GH9A 1VCTA 4QKNA 2UXAA 4I55E 3ZN0B 1D0ZA 4PFWA 4CZZB 2CCQA 2HN2A 4G8MA 4PF6A 3PUVE 3C34A 3VV5A 3UU8A 2ONRA 1SHZC 3WAEA 2K48A 1QUKA 4YKKA 2QA7A 1JW4A 3PMVA 4IGUA 1RKMA 1Y01A 4QFLA 5ELVA 4YB5A 3KBTA 5J0ZA 3IB2A 4YXDA 3SS1A 3CFZA 3N2GE 3PV0E 2QMWA 4E0WA 4ERRA 2VQET
chains in the Genus database with same CATH topology
4N13A 1A8EA 2JPFA 3DP4A 5F7VA 4ZEDA 1HG5A 1PB9A 2K5BB 4LATA 3V5AA 3HR0A 3N9OA 2F6GA 3J9X1 4O4JE 1US7B 4E7SA 3CQGB 2G0UA 1R1NA 5CMMA 4ZECA 1MMNA 3TYHA 1JQFA 2ZLYA 4I4TE 3ANWA 3SOLA 4IIJE 1AH5A 2ZMAA 2Q9QC 3RN8A 2ONKE 4EXKA 2V3TA 4MLQA 2FYIA 5CMBA 1SD3A 3NBXX 4HE8A 1R6ZA 2NXOA 4EUOA 3MP6A 3FXUA 4JWOA 4YB7A 4GK5E 4IO4A 4IE0A 3IOWA 4U1ZA 5FXXA 3N26A 2F35A 2EHOA 5L2LA 3K4UA 2VKOA 4CXWA 1R9QA 4U21A 3QK6A 2NOOA 1ZMGA 5ETWA 3OJAA 3U78A 4IB2A 3CIJA 1NH7A 2N9DA 3OBVE 1DTGA 3K3QC 2C5KT 1QJMA 1OMPA 4QX7B 1B4ZA 1GVCA 5CI5A 2WSSV 2Q2AA 1FTOA 2QJEA 3ZCJA 4XZCA 1B7UA 4BDLA 2CE7A 5JQGE 3K6VA 3MBPA 4YHJA 2H25A 2QL3A 3KGCA 3M8UA 3N9QA 3HHFA 1FQEA 5JTYB 3FBLA 1NH8A 4H9SE 1B58A 4ZS2A 4QFOA 3KINB 4TZ4C 4TV9E 5JR9C 1AL3A 5J2UE 2DOJA 3IBPA 2CM0A 2RA1A 2DWHA 1GV8A 1MIVA 3TFLA 4AXPA 2DVCA 2WM9A 3ZKLA 3I0OA 4UEMA 5JRCB 3RNNA 3RTWB 4BDOA 1CE2A 3CX7B 4BLAA 1EH3A 3OXNA 5KCJB 3JC6C 2KLQA 2YK0A 3D4CA 1Y64B 3Q29A 4G8HA 4BAYB 3EDVA 3ZJ1A 3KOTA 3FATA 5AFUL 3N9MA 3LBSA 2Q9QB 1Z7ME 3RYFE 4U23A 1XVYA 2V26A 1RYOA 2WMNA 2XXYA 3SEUA 3IO4A 3B6QA 4U4XA 1VFDA 1FW0A 2XTLA 1ZTYA 4XIGQ 1OLAA 4QHOA 4R74A 1B5HA 3ZYKA 2HCAA 1MXVA 1M5CA 2Z8FA 2C0SA 2UYEA 4TOZA 1JETA 5EHMA 5FY1A 4ISUA 1LFGA 1MMDA 3EDUA 3FVKA 2DI4A 4AB5A 1UTHB 4PFUA 2RCAA 4F22A 1FQCA 1DPPA 1AMFA 4OYVA 3V5UA 2KLFA 4IE4A 5LYJE 2UXXB 2V7JA 4YKJA 2DP8A 2X9XA 1VSOA 5JR9B 2D21A 4JDFA 5CC2A 4H9RC 5FMNA 3VXCA 5DT6A 1NWMX 3NRXA 2RF1A 4UXNB 3K02A 5J2TE 5AA2A 3PPPA 1B5JA 1S7YA 3MVWA 4QXCB 3FXEB 2DCFA 3PD8A 2H3RA 4H8IA 3ZMTB 2Y84A 3G3GA 5EHSA 5H8NB 3IB1A 5KMGP 2DE3A 1GGGA 3CG3A 3H4ZA 3C36A 5L3BB 1E1HB 4ELRA 2QS2A 3FIRA 3CQXC 5IYZE 3ZMSB 4DCYA 2UXNB 1QKAA 3O1IA 1V9DA 5J1DA 5KZTA 4G2AA 3H7MA 5A1LA 5H8HA 2CLYC 1SDXA 4GYSA 2L3LA 4H0WA 2I3VA 5AA4B 1ATGA 2XAFB 1ZLQA 1X79A 2X67A 4XBFB 5A5XB 4ZI3D 2OLBA 2VKDA 3N94A 3TCFA 5AA1A 1BLFA 3HA4A 1XC1A 2H99A 2NP9A 3TQWA 4UF0B 4F3GA 2A2FX 3CQCB 5FNVE 2CA5A 3U72A 2B3BA 5H8QB 2XXHA 4OFJA 4IGTA 3MZKB 3S9NC 1ZHCA 4DE8A 1O63A 4HKAA 1ANFA 3QIMA 4CQIA 1MG1A 2H98A 3O1HA 1SW5A 2X26A 3TTLA 2A5SA 2Z8DA 3SEWA 3ZLIA 1B3EA 3AVRA 4KUMB 3BQIA 5L3CB 3CPZA 2A72A 4EF1A 4H9OC 1EZ9A 4FE8A 3AA0B 1EZOA 3NZPA 4OK0A 1ZEEA 4PP0A 4AKGA 5EK4A 1NNFA 5E0OA 4DZ1A 5I2NA 3ZKKA 4IDZA 1URSA 3VFJA 4PFOA 2BJJX 3ZJ2A 4YJ3E 3T9VA 2XXRA 4MLVA 4MLKA 2ALUA 2H5YA 1TT1A 4G68A 4IY6A 5HXEA 1TFAA 3MVYA 1OWAA 3AVSA 2Q9QD 4XKRA 3MK7C 3Q27A 3A09A 3LUYA 5JVDE 1Y4TA 2RP4A 1IEJA 2OBGA 4UELA 2NVUB 3P7IA 3AAEB 4I62A 4NF8B 4PFTA 4R6HA 1UX5A 5ADXL 4NF6B 4Q5TA 4H5GA 5I57B 2CLYB 2Z22A 2E9XA 4PNIA 2PG8A 1B3LA 2LJLA 4HN9A 3VLUA 4NE4A 3SETA 1B3GA 2AYSA 3FVOA 3V5SA 3UFEA 2CXLA 3IJOB 2F5XA 4YB6A 2G29A 4ANJA 4I50E 2EHOC 4P0GA 1MH3A 3ZMVB 3S9MC 3E3KA 3IX1A 3SKPA 5DEXA 3UUMA 2H9BA 4GIZA 3B7DA 3DP8A 5I58A 5ISUA 1PB7A 3GA8A 1IZ1A 3KJ7A 4I43B 4XXUA 5HXHA 5DQWA 5ITPA 4M1PA 1YCJA 2CWYA 1O64A 3KN3A 2Y48B 3ZYLA 2N1GA 1S94A 3KFWX 2OZZA 3LK2B 1U4QA 2GHAA 3PMWA 4HCYA 1KNZA 4ISSA 4BA9A 4TX5A 4GD5A 1O7TA 1Y3PA 3RX6A 3PGFA 5HXRA 4YKIA 1WR6A 4P09A 4FECA 4FJPA 1H43A 4H6DA 3O6HA 3LSWA 3QAXA 1N84A 2Y7RA 3S9EA 3E22E 3JC6D 3UIFA 5FP3A 3HPIA 4WW0A 2RINA 3TPAA 4NUVA 1MH4A 4KCCA 4ND9A 1D1AA 2YEVC 5LGTB 4OEUA 1POY1 4K3FA 5DJQC 1PBPA 4ZEKA 3SESA 5I56A 4UA8A 4OQOA 1P1UA 5FXVA 5L8DA 4OHFA 2GRVA 4EAHA 3UORA 4TV8E 4O3BA 2DYXA 4JLEA 2W61A 1EU8A 2LE8A 3ECRA 3T93B 1URGA 3PTRB 3ANWB 3K6UA 1VE4A 1EZPA 1QVSA 3IOTA 1M5FA 4AQFA 2X68A 3WI3A 1B05A 2LSGA 2Q9TA 1LFIA 3PU8A 2ODVA 5JK4A 5H8SA 1N76A 3CX6B 4BDRA 1UX4A 3K0VA 4GL8A 1S35A 3B13A 3LK3B 4JBZA 4ECFA 2EHOB 1PC3A 4N6PA 2R71A 3N9PA 3K2DA 3C4XA 2ZM2A 2DWGA 2LHNA 4O3CA 1LGBC 3PPOA 3RY3A 1MM7A 3N2KE 2CZLA 5LCYA 5FYMA 5H6RB 2D5WA 1CB6A 1MY3A 3HCQA 3CMLA 4R6YA 4YMBA 2VL8A 2PYYA 2NOXA 4X1YE 3OO9A 4GIWA 1M5DA 5I2KA 2F78A 3HL6A 2XXTA 1IJ5A 3ZEFB 2D2SA 2HQ0A 3FUZA 5LP6E 3H6WA 4JEHB 5LOMA 3MWBA 5DTBA 1A99A 2UVHA 3M65A 3L3PA 4F2OA 2FA7A 2W7YA 1HX8A 1S9TA 4RJZA 4O4LE 3OEKA 2LOPA 2I0BA 4C1UA 4AI6A 1MMGA 4PJJA 2V1DB 2XXUA 4H9NC 4BDNA 3RH3A 4YFSA 4HTGA 2XXIA 1ZIUA 4QF9A 4HCWA 2JMKA 2WAUA 2HFBA 4RPNA 2NW7A 3SDFA 3HI2A 1D9VA 4POWA 1MXZA 3DP6A 3V89B 4NF5A 4ELOA 2QS3A 3VLVA 4KBMB 5LBQB 5EYFA 3BKIB 4U4SA 3L6GA 2UVIA 3TCHA 3O9PA 1B7HA 3E13X 1CUNA 2IAKA 2DSFA 4P0IA 3KSXA 2HZKA 3QUJA 4H9PC 2L8KA 2A3DA 2B65A 2ZXTA 5HYAA 1M5EA 4GYRA 1S50A 2K24A 2ZM8A 3WAJA 2B1EA 3E4RA 1PBQA 3KFMA 4Q0CA 1P1QA 4CXXA 2I4CA 3MVXA 4YU0A 1OVBA 2R9JA 5LOVE 2AIXA 2YU2A 1BR4A 4NUUA 1TWYA 3KN8A 1FQBA 2XUEA 4KMCA 5TP9A 2I6EA 3PPQA 4JSOA 4N07A 3EQ1A 4OZ9A 2HPLA 1ZKBA 3R6UA 2OWSA 4RPOA 3LSXA 3B6WA 4ELQA 3G3KA 1I6BA 4HW8A 4O4IE 1US4A 1ELJA 4UVAB 4RNSA 3PUZE 1SYHA 4GFRA 3PUXE 4JWYA 3CKDA 1AIVA 1WLXA 2VK9A 3K01A 4ZEBA 3FXRA 4H1XA 4EQ9A 2V7IA 4GRKA 3K3NA 1XT8A 3GBBA 3OYXA 4YKPA 3F2EA 3UUNA 4H8JA 1HCIA 2LOSA 3O1JA 4XKPA 3C50A 4KFQA 3TCGA 3IJXB 4EZ4A 2OK2A 2GK9A 3ILTB 1B0LA 5LGNB 4ZEIA 3LBXA 1FCKA 2CMRA 4K0UA 3M3LA 5JDQA 4R73A 2O68A 2JQQA 5ITOA 2X9HA 4LZ7A 1MNEA 3MQ9A 1G73A 2LSJA 5DVFA 4N78D 3ODBA 1JNFA 4XAXB 5AA2B 4X48A 3E9XA 2E8IA 2Z23A 3RUMA 3K1MA 4OETA 2PT1A 4NF4A 4PK6A 4EQ7A 5JH7E 3IF8B 4PAGA 2XXPA 5LHGB 3AXFA 3UUXB 2XXVA 4G68C 1NL5A 1LCTA 3KBRA 3E08A 2PBIA 3DP7A 2DVZA 4QFNA 5FXZA 1P1WA 4U1OA 2IC9A 2I4BA 2M67A 3I9WA 3BQKA 4OTEA 4F1YA 4MALA 2W00A 5H8HB 3DTOA 3SWHA 5L9SA 2EHOD 3PUSA 4OEVA 1OVTA 2E9XC 4DNDA 4WKMA 2ACXA 2MOZA 2BVMA 3R6NA 2D0TA 4BJNA 3PUGA 2ABHA 2ZNSA 3MW0A 1VFEA 1ZJLA 4EQBA 4WBNE 1MY4A 3ZS6A 2KNDA 1PB8A 3I3VA 4BDMA 3USDA 2DLRA 3ZSFA 3HV1A 2J1DG 1B9JA 5HM4B 2LSKA 1A55A 1IXIA 1YW0A 1SYIA 2Q8JA 2NW8A 3CVRA 3CSGA 2LM9A 4Q30B 3H37A 2V84A 3VVDA 1B7ZA 1H44A 1BIYA 3N5LA 4FAJA 2Q89A 1B3HA 1BTJA 4R72A 1NNKA 5GONE 3FB2A 1B7TA 1N04A 5KDMC 4YAHX 2DWAA 2MYSA 2A5TA 2F34A 2NTXA 4RK2A 5IAIA 2VKJA 4JSDA 2PJQA 3MJXA 3RRWA 4ZE8A 4OERA 1A8FA 1SW2A 3K6XA 2XX8A 1UIVA 5I2NB 5K2XA 3M3FA 3RRCA 2XAHB 1DMBA 3VVEA 5CB4E 1B52A 3GN5A 2OWTA 2ODUA 3ESLA 2Y7IA 3RLFE 4G63A 2YINA 2PT2A 2Q2CA 3TKLB 3H6TA 4G68B 4PJLA 3W15C 3ZCIA 3RC3A 1URDA 1LKXA 2YJPA 4YZZA 2X9WA 5KDTA 2H7OA 4M4GA 1ZKEA 5CMCA 4AB6A 1BR2A 5EK2A 4R9GA 3DELB 5H8FA 5HWYA 2VP1A 1YPNA 2X0LB 3WAFA 4FORA 4QRZA 4FEBA 1FTKA 4M1VA 5DVJA 3PUQA 4WBOA 4OFZA 2E9XB 4R2BA 1JVYA 4KP3C 4MHCA 3DJBA 3T8OA 2V7MA 5JRCA 2F7CA 3FVGA 2O84X 1HFAA 2RCBA 4AQFC 5FY7A 1BR1A 3DM0A 1WVJA 3AA6B 1LVFA 3ETUA 3PPRA 4X1KE 4P0BA 4GVOA 3ZMZB 3MVZA 5HPQA 2K9AA 3ZMUB 3ZYMA 4DMVA 5C8YE 1R9LA 2IC6A 3Q5WA 1B5IA 3C32A 1QSDA 2DE4A 5I58B 1PDAA 3V83A 5LNKA 1NFTA 3T22A 1F9BA 3ILUB 3P8CD 3KVBA 3FXQA 2O1LA 3LG7A 2OJTA 1YKHB 1JW5A 1XHYA 3FV2A 1MNDA 5LXTE 3RYIE 3LK42 2ZMBA 3CFLA 1MS7A 4GOTA 1LFHA 3MZBA 3C35A 4F3BA 2YPNA 5KX5E 1HSJA 2FNCA 5LG4A 1TFDA 3H6VA 5AA2D 3K00A 1OXZA 2BDEA 1DPEA 1P1OA 4TQUQ 3QUFA 1OIBA 4V1Av 3VU7H 1JVXA 3H06B 4GLIA 5LHIB 3TTKA 3GMIA 1M5BA 5F8PA 5LHHB 2P1SA 3O6GA 1B1XA 3H6UA 4WNKA 3OO6A 4I8CA 2X7PA 3N9LA 3W15B 3E0ZA 1UQWA 2DS9A 3QSLA 2RC8A 4C0RA 4KYDA 4DXCA 5B70A 4F6RC 4MF3A 1BP5A 3PD9A 3FVNA 4QHQA 4UV9B 4FJOA 3TTMA 4EOZB 1P99A 4TLLB 4U72A 3RPUA 1D0XA 4EZHA 2O6AA 1MDQA 2V3QA 3ONXA 4RXLA 1BR0A 3O2AA 5TAOA 2PMSA 1JW1A 3PUYE 4UVCB 3IK6B 4LZ8A 1KWHA 3U8QA 3EN3A 1PEBA 4DBRA 4GOUA 4CXYA 1B3FA 1RYXA 4H5FA 3PMXA 3W9WA 5TU0A 3KEIA 4QSCA 3UP9A 4OENA 3Q2MA 3FJGA 4U74A 4HTEA 3ZC0A 2D0UA 4L0RA 1USYH 1H7CA 3MJNA 3B6TA 3J7Yq 4ZHQE 1SI0A 4KI0E 3PE0A 1MQJA 1MPDA 3JYRA 2LSYA 2PBWA 4NWCA 3EHSA 1FTLA 1IXGA 3QXMA 1FMWA 3CI8A 5I2KB 1VR5A 3SRZA 4TUYE 2DE2A 4DDDA 3G3IA 4DVDA 3PPNA 3KV4A 2ZYMA 4KHZE 4F3SA 3IOVA 2XX9A 2VWAA 4L9IA 3UN6A 4J2CA 4F31B 3MA9A 2REGA 1Y3NA 1MY1A 2IEEA 1UCUA 2XHDA 3OMBA 3BBRA 4XTCQ 2E0SA 3ONMA 3HO7A 1MRPA 4EF2A 5JDLA 1LB8A 1LRZA 1NMUA 1T98A 4NMYA 3KOSA 2ZNUA 5I59A 1LB9A 3H03A 3U1OA 1Z7NE 3PUWE 1Y1ZA 2ES0A 1NNTA 4LQ5A 3K8PC 2HH7A 4POXA 1MQIA 3PURA 4O2BE 2VOZA 5CM6A 3RGYA 4PK4A 4NF5B 1Y1MA 3O29A 1B51A 4PETA 3IEEA 3FJMA 4IGRA 4L17A 3MUQA 4GWOA 1MMAA 5TPAA 4PE5B 2E9XD 5EZYE 2XAQB 2GFEA 2QPQA 2XXWA 4GXSB 2JJ9A 4F39A 3N9NA 4AQ4A 2C5IT 4F29A 4QXBB 1N7WA 2KXPB 1B40A 1IAPA 2QSXA 3HKCE 4F18A 3F31A 1LCFA 4IO6A 3I1AA 5EK3A 2WBLA 2ZM0A 3LJCA 2KINB 4GF8A 3O28A 2N2NA 3GWHA 2O51A 1MM6A 1MXXA 1MQDA 4LQ2A 5TP9B 3DLNA 2D3IA 1QULA 3FBZA 3TODA 4U22A 3MC2A 2H4IA 3G3HA 1QKBA 5HXSA 4UIGA 3UA8A 2NW9A 1IZNB 5K2YA 2LHRA 2L9QA 3OEMA 2CXFA 1QW0A 3TUSA 3IORA 4FIMA 3T9XB 3C64A 3O9XA 4O8SA 3VXBA 3O4XE 2HAVA 3RC8A 3IHRA 2NWBA 4C91A 3TTRA 4AQGA 3D0TA 4LP2B 3NRYA 4QWNB 3Q26A 2HPJA 1UTBA 3B57A 5LJNA 4X1IE 3BFTA 4KPTA 4IE7A 4ADZA 2X66A 3LBXB 4EIWA 1D9YA 2VB6A 3AA7B 2C5JA 3THIA 1LBCA 2CEAA 2ONSA 1FMVA 3Q9DA 3VLWA 5HBCA 1IXHA 2AL5A 3H3GA 4OESA 3RKOA 3FJ7A 3NZQA 3LSFB 4E0XA 5IKBA 4IO2A 2ZYKA 2F8DA 1EZ3A 4NF4B 5CMKA 4MFRA 2CXDA 4PJNA 1FQDA 3BFUA 4RA1A 3CWZB 2WMOA 3AAAB 2Z8EA 4NEDA 4R6KA 4JUYA 1XS5A 3R84B 2LEHA 1Q35A 2XAJB 3LC8A 4WEDA 4DIGA 1Y9UA 3KN7A 4QXHB 5FY0A 1B32A 1D1CA 2XD2A 4X9TA 5M2VA 4UV8B 3TZAA 5HAXA 3FASA 4IE6A 4DXUA 4ZEFA 3G3JA 3RYCE 5I84A 2V93A 1SW4A 4XKNA 3OSRA 1NNPA 3JV9A 2LSIA 4XKQA 3I6VA 2QS1A 2JRKA 5HWXA 3A3UA 3U94A 1USYE 2VD2A 1FTJA 3TQLA 4H67A 3PU5A 3FD3A 2X7QA 4KR5A 3OOAA 4O4HE 5FXWA 2X9YA 4O3AA 2REJA 4AKRB 3HN0A 1WDNA 3R26A 2ZYNA 3BK9A 3S4UA 4HFVA 1SA0E 1OQHA 1L5TA 1IXCA 4IO3A 4ZI2C 4EDPA 1NAFA 4ZS9A 2V3UA 3KDSE 4LZ5A 3UGWA 3HHGA 3C4ZA 3CG1A 2A5TB 1N3XA 4R9FA 2WWUA 4JEUB 2OA5A 3GXAA 4ESXA 4P11A 3VE1B 3QYTA 4R2FA 4YLHA 3L6HA 1FEWA 5L3GB 5CRYA 1UIUA 5CA0E 3H3AA 4X20E 3MAMA 2P2AA 5LBMA 2E1SA 4DBQA 1IJ6A 3KV6A 3FZVA 2THIA 3GN5B 1FQAA 2VD3A 3HKBE 1WRDA 5DVIA 3KBUA 1N0TA 1B6HA 3VDFA 4LA9A 2H7VC 4ESWA 1HSEA 4PFPA 2XXQA 2I48A 5J1GA 2O7IA 4EXTA 2LAOA 1Y3QA 3TMGA 1NKXA 2DQVA 5KDTB 3K6WA 3SERA 5CBSA 3Q28A 1QUUA 1T0KA 3RT8A 1G8XA 4ISTA 4IY5A 4X1BA 5H8FB 4C90A 3KV9A 3G3FA 2Z6EA 4WEPA 1TXFA 3MZ9A 1N7XA 4GXAA 2VKHA 3PDYA 2CWOA 2I59A 1P1NA 1D0YA 1GTKA 2XXXA 4OFLA 4CI1B 4Q8RA 4HEAA 5BWJA 1H3DA 3U93A 5JDGA 1MIYA 1ZV4X 5JDFA 4IO5A 2ANJA 3QC9A 1WYBA 2XHEB 5DABA 1LAXA 3FV1A 1I6AA 3HKDE 4O2AE 2DXYA 4EYUA 2F7BA 4P0AA 4IE5A 5JEIA 2V25A 2RC9A 1AJ3A 2ZNTA 2P9BA 2MBGA 3EF7A 5IHYA 1HG2A 4THIA 2XQYA 3C98B 2DHRA 5JREA 4PFYA 2DNXA 3F11A 2I3WA 3TTNA 5JDMA 1LAFE 4MBPA 3TELA 5FTIA 2KWIB 3F57A 1OQGA 1MPBA 5DQVA 1B2HA 1MDP1 4KYEA 2BVLA 1MIWA 3CRBA 5BUUA 3C51A 4R75A 3FGSA 5JDHA 3FXDB 4WXJA 3N6UA 1SQYA 3GLBA 3I5OA 4X1DA 4H63H 3VKHA 4G77A 4A56A 1LLSA 4GQOA 5L9MA 4G2ZA 1HTJF 4ZI7E 5LA6E 3AB3B 3K3OA 4F2QA 4L5GA 3KZGA 4OXVA 2F36A 1YKEB 5M4YA 5JTYA 3T96B 3AAIA 1FIOA 3K1NA 3K1PA 2NTYA 4GK0E 1IUDA 2W0GA 3N6TA 1MPCA 1LAGE 2KZ7B 4PK5A 3EHTA 2W63A 4ASKA 4ZE9A 3ZPOA 2IA4A 1JEUA 4YICA 3AA1B 4KD5A 3VVFA 3FHNA 3PUAA 3C9HA 4ZOLE 4BJMA 4OFOA 1MQGA 2DWIA 3GZGA 3KSJA 3GBAA 4JWXA 1H45A 5AE4A 3MP1A 4FATA 3OYZA 3CX8B 1SVXB 5KCJA 4F3PA 4HGAA 3U3IA 1MQHA 2QMXA 4B6XA 4OMBA 2LT3A 4LONB 3OSQA 2X51A 2I49A 4ZDMA 2RKMA 1II5A 3MPLA 1B1HA 5DEXB 2Q9QA 2XD3A 3OO8A 1MXYA 5LJMA 3IAZA 2Y8DA 2DXRA 2Y6XA 3TEPA 1B46A 1SW1A 1US5A 2BZBA 1D1BA 3RT6B 1POTA 3KJTA 4NWDA 1IIWA 4E7ZA 2P0SA 3CFXA 4U2RA 1B4HA 5L3DB 3ZN1B 3OO7A 5HXCA 3R7XA 4CI3B 1QUJA 3D4GA 2HZLA 3V8XB 1B0HA 5I59B 3JZJA 3IR1A 1LBBA 4G4PA 3SEVA 2SPCA 4OWDA 5H6QB 3WAKA 1IITA 3UK4A 4ELPA 4MBQA 2I0CA 5JDNA 2CMOA 4I1DA 3SEXA 1XOCA 1I6QA 2F97A 5ICTA 1UTHA 4IO7A 3I0QA 1MY0A 2KWHA 5I56B 4KQPA 2Y7WA 4Z0IA 4NTLA 5TPAB 3L09A 4ZZAA 2WKYA 5JR9A 4RY1A 1MXUA 1YTVA 5FHOA 2XASB 2F6PA 2PX1A 3S9LC 3OKQA 1AOVA 3MZ1A 4QFKA 4TN7B 3T9HB 3C33A 3EPEA 3VHLA 3RPWA 2VGQA 2O69A 2MTQA 4DMWA 4H65A 3EVYA 3A5XA 2NWJA 3N2OA 3KV5A 3CVGA 4LVQA 4CI2B 2YLNA 2PVUA 2D5UA 2KMFA 3IL1B 5H8NA 2HXWA 3CR9A 4F1UA 2HEUA 3RTFB 3KG2A 3BQLA 4G8NA 4ZI2D 3A3CA 5FHMA 2QRYA 1D4NA 4DLDA 4AKLA 2QGSA 4AKIA 3UULA 2O1MA 5F3JA 3T9UA 3MXZA 1YAEA 5AA4A 1A54A 1XVXA 1UTBB 2OCUA 5FTHA 1A7LA 2Q88A 2O7UA 3MPKA 5A5XA 4EXLA 1ZU0A 4YJ2E 2GHBA 1BKAA 2XAGB 2W62A 2JMHA 2V7KA 5B7DA 2IW5B 1OLCA 4UF0A 4LUBA 5BMVE 2RC7A 5AA3A 4DXBA 1GR2A 1FTMA 1A40A 1LVKA 5H8QA 4PJMA 4Z8XA 4RK9A 4RYAA 1MXWA 4JXIA 1VRBA 1J1NA 1DTZA 2DWKA 3HKEE 1KK7A 1Y4CA 3O6IA 3VKGA 4UVBB 1ZBMA 2M8CA 4BDQA 2YU1A 3MKDA 2Y7KA 4OHNA 4HS7A 2F7AA 2I58A 3O97A 1HF8A 5F1QA 1LSTA 3UT5E 4TLMB 4ZS3A 4QSDA 1SBPA 4ILUA 2DWJA 3C4WA 1Q1KA 3LR1A 4ONYA 3ETVA 1I69A 1SI1A 3EUHA 4PW8A 1MY2A 2AL4A 3C4MA 5L9OA 2Y7PA 2UYFA 3OENA 5L3FB 1LAHE 3IB0A 2VASA 1HS7A 3RQTA 4DCXA 1WYCA 3U92A 1DOTA 4OYKA 3RYHE 3LFMA 1Z0PA 5DYHA 4I9DA 3TAJA 1HSLA 3G7WA 3ZC1A 2ESNA 5CBRA 4F19A 2PFVA 1N3WA 4NF8A 4EB6E 2G93A 4FEDA 4NF6A 5I57A 1YD8G 2KT9A 3I9YA 4UACA 3HSTA 3W9VA 3Q5XA 4FI5A 3IOUA 1U5PA 3IO6A 2V7LA 4QSEA 3CSBA 5FHNA 1O3XA 2NUVA 1Y20A 4OYJA 3TDJA 3OD7A 3C31A 4Z7EA 3KVAA 2XX7A 4YMAA 3T66A 3LSLA 1QUIA 2HAUA 5CA1E 4MFIA 1DSNA 4MH5A 5ICQA 3TKDA 1WODA 2B3FA 5LGUB 1IQ7A 2R6GE 2ZYOA 4JB7A 1JEVA 4ZI3C 4IHJE 4QX8B 4GL0A 3O66A 2UVJA 3M3KA 4EYYR 4PQJA 3MACA 3Q25A 1FQFA 4OVJA 3MP8A 4C1TA 1VOMA 4H63V 3SEYA 2UVGA 3S2VA 3PU3A 1D3KA 1H76A 4DO0A 3EHUA 4ZZEA 4F1VA 2QS4A 4H9QC 5L3EB 4AKHA 3OELA 4KCDA 4KYSA 4QFPA 2VHAA 3UTKA 2GH9A 4QKNA 2UXAA 4I55E 3ZN0B 1D0ZA 4PFWA 4CZZB 2CCQA 4G8MA 3PUVE 3C34A 3VV5A 2ONRA 1SHZC 3WAEA 2K48A 1QUKA 4YKKA 2QA7A 1JW4A 3PMVA 4IGUA 1RKMA 4QFLA 5ELVA 4YB5A 3KBTA 3IB2A 3CFZA 3SS1A 3N2GE 3PV0E 2QMWA 4E0WA 4ERRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N13 A;  1A8E A;  3DP4 A;  5F7V A;  4ZED A;  1PB9 A;  4LAT A;  3V5A A;  2F6G A;  2G0U A;  1R1N A;  5CMM A;  4ZEC A;  3TYH A;  1JQF A;  1AH5 A;  3RN8 A;  2ONK E;  4EXK A;  2V3T A;  4MLQ A;  2FYI A;  5CMB A;  1SD3 A;  1R6Z A;  2NXO A;  4EUO A;  3MP6 A;  3FXU A;  4JWO A;  4YB7 A;  4IO4 A;  3IOW A;  4U1Z A;  3N26 A;  2F35 A;  3K4U A;  1R9Q A;  4U21 A;  3QK6 A;  2NOO A;  1ZMG A;  4IB2 A;  3CIJ A;  1NH7 A;  1DTG A;  2C5K T;  1QJM A;  1OMP A;  1B4Z A;  1GVC A;  5CI5 A;  2Q2A A;  1FTO A;  2QJE A;  4BDL A;  1B7U A;  3K6V A;  3MBP A;  2H25 A;  2QL3 A;  3KGC A;  3M8U A;  3HHF A;  1FQE A;  5JTY B;  1NH8 A;  1B58 A;  4QFO A;  1AL3 A;  2DOJ A;  2DWH A;  1GV8 A;  3TFL A;  2DVC A;  3ZKL A;  3RNN A;  3RTW B;  4BDO A;  1CE2 A;  4BLA A;  1EH3 A;  3OXN A;  5KCJ B;  3D4C A;  3Q29 A;  4G8H A;  3KOT A;  3FAT A;  3LBS A;  1Z7M E;  4U23 A;  1XVY A;  1RYO A;  2XXY A;  3SEU A;  3IO4 A;  3B6Q A;  4U4X A;  1VFD A;  1FW0 A;  2XTL A;  1ZTY A;  4XIG Q;  1OLA A;  4R74 A;  1B5H A;  2HCA A;  1MXV A;  1M5C A;  2Z8F A;  2UYE A;  4TOZ A;  1JET A;  5EHM A;  4ISU A;  1LFG A;  3FVK A;  4AB5 A;  1UTH B;  4PFU A;  2RCA A;  4F22 A;  1FQC A;  1DPP A;  1AMF A;  4OYV A;  2KLF A;  4YKJ A;  2DP8 A;  2X9X A;  1VSO A;  2D21 A;  4JDF A;  5CC2 A;  3VXC A;  5DT6 A;  2RF1 A;  3K02 A;  5AA2 A;  3PPP A;  1B5J A;  1S7Y A;  3MVW A;  3FXE B;  3PD8 A;  4H8I A;  2Y84 A;  3G3G A;  5EHS A;  5H8N B;  3IB1 A;  2DE3 A;  1GGG A;  3CG3 A;  3H4Z A;  3C36 A;  4ELR A;  2QS2 A;  3FIR A;  4DCY A;  1QKA A;  5J1D A;  5KZT A;  3H7M A;  5H8H A;  1SDX A;  4H0W A;  2I3V A;  5AA4 B;  1ATG A;  1ZLQ A;  5A5X B;  2OLB A;  3N94 A;  3TCF A;  5AA1 A;  1BLF A;  1XC1 A;  2H99 A;  3TQW A;  4F3G A;  2CA5 A;  3U72 A;  2B3B A;  5H8Q B;  2XXH A;  4OFJ A;  4IGT A;  3S9N C;  4DE8 A;  1O63 A;  1ANF A;  3QIM A;  4CQI A;  1MG1 A;  2H98 A;  1SW5 A;  2X26 A;  3TTL A;  2A5S A;  2Z8D A;  3SEW A;  1B3E A;  4EF1 A;  1EZ9 A;  4FE8 A;  1EZO A;  4PP0 A;  1NNF A;  4DZ1 A;  5I2N A;  3ZKK A;  1URS A;  3VFJ A;  2BJJ X;  3T9V A;  2XXR A;  4MLV A;  2ALU A;  2H5Y A;  1TT1 A;  4G68 A;  4IY6 A;  1TFA A;  3MVY A;  4XKR A;  3Q27 A;  3A09 A;  3LUY A;  1Y4T A;  1IEJ A;  2OBG A;  2NVU B;  3P7I A;  4R6H A;  4I62 A;  4NF8 B;  4PFT A;  4NF6 B;  4Q5T A;  4H5G A;  5I57 B;  2Z22 A;  1B3L A;  3VLU A;  4NE4 A;  3SET A;  1B3G A;  2AYS A;  3FVO A;  3IJO B;  2F5X A;  4YB6 A;  2G29 A;  4P0G A;  1MH3 A;  3S9M C;  3E3K A;  3IX1 A;  3SKP A;  5DEX A;  2H9B A;  4GIZ A;  3B7D A;  3DP8 A;  5I58 A;  5ISU A;  1PB7 A;  1IZ1 A;  3KJ7 A;  4XXU A;  5ITP A;  1YCJ A;  1O64 A;  3KN3 A;  2OZZ A;  2GHA A;  3PMW A;  4HCY A;  4GD5 A;  1O7T A;  1Y3P A;  3PGF A;  4YKI A;  4FEC A;  4FJP A;  1H43 A;  4H6D A;  3O6H A;  3QAX A;  3LSW A;  1N84 A;  2Y7R A;  3S9E A;  3UIF A;  3HPI A;  2RIN A;  3TPA A;  1MH4 A;  4KCC A;  4ND9 A;  4OEU A;  1POY 1;  4K3F A;  1PBP A;  4ZEK A;  3SES A;  5I56 A;  4UA8 A;  4OQO A;  1P1U A;  5L8D A;  2GRV A;  3UOR A;  4O3B A;  2DYX A;  1EU8 A;  3ECR A;  3T93 B;  1URG A;  3K6U A;  1VE4 A;  1EZP A;  1QVS A;  3IOT A;  1M5F A;  1B05 A;  2Q9T A;  1LFI A;  5JK4 A;  5H8S A;  1N76 A;  4BDR A;  3K0V A;  4GL8 A;  4JBZ A;  4ECF A;  1PC3 A;  4N6P A;  2R71 A;  3K2D A;  4O3C A;  1LGB C;  3PPO A;  3RY3 A;  1MM7 A;  2CZL A;  2D5W A;  1CB6 A;  1MY3 A;  3HCQ A;  4R6Y A;  4YMB A;  2PYY A;  3OO9 A;  1M5D A;  5I2K A;  2F78 A;  2XXT A;  1IJ5 A;  2HQ0 A;  3FUZ A;  3H6W A;  5LOM A;  3MWB A;  5DTB A;  1A99 A;  2UVH A;  3L3P A;  4F2O A;  2FA7 A;  2W7Y A;  1S9T A;  4RJZ A;  3OEK A;  2I0B A;  4C1U A;  2XXU A;  4BDN A;  4HTG A;  2XXI A;  1ZIU A;  4QF9 A;  4HCW A;  2HFB A;  4RPN A;  3SDF A;  1D9V A;  4POW A;  1MXZ A;  3DP6 A;  3V89 B;  4NF5 A;  4ELO A;  2QS3 A;  3VLV A;  5EYF A;  3BKI B;  4U4S A;  3L6G A;  2UVI A;  3TCH A;  3O9P A;  1B7H A;  3E13 X;  2DSF A;  4P0I A;  3KSX A;  2HZK A;  3QUJ A;  2B65 A;  2ZXT A;  1M5E A;  1S50 A;  3E4R A;  1PBQ A;  3KFM A;  4Q0C A;  1P1Q A;  2I4C A;  3MVX A;  4YU0 A;  1OVB A;  2R9J A;  2AIX A;  3KN8 A;  1TWY A;  1FQB A;  5TP9 A;  2I6E A;  3PPQ A;  4JSO A;  4N07 A;  3EQ1 A;  4OZ9 A;  1ZKB A;  3R6U A;  2OWS A;  4RPO A;  3LSX A;  3B6W A;  4ELQ A;  3G3K A;  1I6B A;  4HW8 A;  1US4 A;  1ELJ A;  4RNS A;  3PUZ E;  1SYH A;  4GFR A;  3PUX E;  4JWY A;  3CKD A;  1AIV A;  3K01 A;  4ZEB A;  3FXR A;  4H1X A;  4EQ9 A;  4GRK A;  1XT8 A;  3GBB A;  4YKP A;  4H8J A;  4XKP A;  4KFQ A;  3TCG A;  3IJX B;  2OK2 A;  3ILT B;  1B0L A;  4ZEI A;  1FCK A;  3M3L A;  4R73 A;  2O68 A;  5ITO A;  4LZ7 A;  3MQ9 A;  5DVF A;  3ODB A;  1JNF A;  5AA2 B;  4X48 A;  3E9X A;  2Z23 A;  3RUM A;  3K1M A;  4OET A;  2PT1 A;  4NF4 A;  4EQ7 A;  2XXP A;  3AXF A;  2XXV A;  4G68 C;  1NL5 A;  1LCT A;  3KBR A;  2DVZ A;  4QFN A;  1P1W A;  4U1O A;  2IC9 A;  2I4B A;  4OTE A;  4F1Y A;  5H8H B;  5L9S A;  4OEV A;  1OVT A;  4DND A;  4WKM A;  2ABH A;  2ZNS A;  3MW0 A;  1VFE A;  1ZJL A;  4EQB A;  3ZS6 A;  1MY4 A;  1PB8 A;  3I3V A;  4BDM A;  3USD A;  3ZSF A;  3HV1 A;  1B9J A;  5HM4 B;  1A55 A;  1IXI A;  2Q8J A;  1SYI A;  3CVR A;  3CSG A;  4Q30 B;  2V84 A;  3VVD A;  1B7Z A;  1H44 A;  1BIY A;  3N5L A;  4FAJ A;  2Q89 A;  1B3H A;  1BTJ A;  4R72 A;  1NNK A;  1N04 A;  4YAH X;  2DWA A;  2A5T A;  2F34 A;  4RK2 A;  5IAI A;  4JSD A;  4ZE8 A;  4OER A;  1A8F A;  1SW2 A;  3K6X A;  2XX8 A;  1UIV A;  5I2N B;  5K2X A;  3M3F A;  1DMB A;  3VVE A;  1B52 A;  2OWT A;  2Y7I A;  3RLF E;  2PT2 A;  2Q2C A;  3TKL B;  3H6T A;  4G68 B;  3W15 C;  1URD A;  2YJP A;  4YZZ A;  2X9W A;  5KDT A;  4M4G A;  1ZKE A;  5CMC A;  4AB6 A;  4R9G A;  3DEL B;  5H8F A;  2VP1 A;  1YPN A;  3WAF A;  4FOR A;  4QRZ A;  4FEB A;  1FTK A;  4M1V A;  5DVJ A;  4R2B A;  1JVY A;  2F7C A;  3FVG A;  2O84 X;  2RCB A;  3DM0 A;  1WVJ A;  1LVF A;  3PPR A;  4GVO A;  3MVZ A;  5HPQ A;  1R9L A;  2IC6 A;  1B5I A;  3C32 A;  1QSD A;  2DE4 A;  5I58 B;  1PDA A;  3V83 A;  1NFT A;  3T22 A;  1F9B A;  3ILU B;  3FXQ A;  2O1L A;  2OJT A;  1JW5 A;  1XHY A;  3FV2 A;  2ZMB A;  3CFL A;  1MS7 A;  4GOT A;  1LFH A;  3MZB A;  3C35 A;  4F3B A;  2YPN A;  1HSJ A;  2FNC A;  1TFD A;  3H6V A;  5AA2 D;  3K00 A;  1DPE A;  1P1O A;  4TQU Q;