3QK6A

Crystal structure of escherichia coli phnd
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
308
structure length
304
Chain Sequence
KALNFGIISTESQQNLKPQWTPFLQDMEKKLGVKVNAFFAPDYAGIIQGMRFNKVDIAWYGNLSAMEAVDRANGQVFAQTVAADGSPGYWSVLIVNKDSPINNLNDLLAKRKDLTFGNGDPNSTSGFLVPGYYVFAKNNISASDFKRTVNAGHETNALAVANKQVDVATNNTENLDKLKTSAPEKLKELKVIWKSPLIPGDPIVWRKNLSETTKDKIYDFFMNYGKTPEEKAVLERLGWAPFRASSDLQLVPIRQLALFKEMQSVKDNEQDKLAKTTAIQAQLDDLDRLNNALSAMSSVSKAVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Escherichia coli Phosphonate Binding Protein PhnD and Rationally Optimized Phosphonate Biosensors.
pubmed doi rcsb
source organism Escherichia coli uti89
molecule tags Transport protein
molecule keywords PhnD, subunit of alkylphosphonate ABC transporter
total genus 103
structure length 304
sequence length 308
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12974 Phosphonate-bd ABC transporter, phosphonate, periplasmic substrate-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.90 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3qk6A03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3qk6A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3qk6A02
1Z0PA 2GH9A 1A55A 2UVGA 3PU5A 4FEBA 1JVXA 2I49A 2UYEA 1N0TA 4K3FA 4MBPA 4R75A 1JW1A 2VOZA 5FHMA 5AA1A 3TCGA 1VE4A 1M5FA 1MY1A 1WVJA 4R6HA 3MWBA 1QUKA 2F97A 3C34A 4OESA 1IXGA 3UIFA 3IL1B 4RPOA 4WXJA 1IXCA 2VGQA 4G8NA 3I6VA 2NWJA 1B6HA 3KEIA 1PBQA 2UXAA 1TWYA 1VSOA 2X7QA 3QSLA 4PFYA 3G3JA 5L8DA 2OLBA 4Q8RA 4DXCA 5IKBA 3IX1A 3PPPA 3PUVE 2ONSA 1Q35A 1S50A 3RTWB 1MM6A 1CE2A 1USYH 3UORA 1LB9A 1FQBA 4Z0IA 2Q2CA 2DXRA 2ZYMA 4ELPA 1D9YA 1JW5A 1OQHA 3A3CA 1Z7ME 3O6IA 4EDPA 3PMVA 1P99A 3M3KA 4XTCQ 5I2NA 4NF5B 2THIA 4JXIA 4YMAA 4F3PA 1MQIA 4FJPA 2KWHA 1O7TA 2ZYOA 4GIZA 1MXYA 3OO8A 3IR1A 4H6DA 4TQUQ 4EF2A 1FTMA 2IC9A 3O2AA 3S4UA 1LAGE 3K1MA 1LVFA 1LBBA 3KFMA 3OO9A 3H6UA 1Y9UA 1FTKA 1Y4CA 3KJ7A 3N26A 4QHQA 5TPAB 3S2VA 3SEXA 2VD3A 2CA5A 1P1NA 5CC2A 3K02A 1GR2A 2R6GE 3L6GA 4XKQA 1UQWA 3CR9A 4BDQA 3Q28A 4RK2A 2O69A 1MXXA 1FCKA 4QFOA 5DEXB 1FTOA 1IITA 4AQ4A 2IEEA 2DSFA 2M8CA 4TLMB 1MY3A 2RC9A 3T9VA 2F78A 3E9XA 3FXEB 4IB2A 1Y3QA 2Z22A 4OENA 2RCAA 2KLFA 3CG1A 2O6AA 3C4MA 1B7HA 2AIXA 2NXOA 3U92A 2C5IT 3CI8A 1NMUA 3GBBA 3PPOA 2PBWA 4JWYA 2HZLA 3OSQA 3O9PA 1B0HA 3RLFE 3VXCA 1ZIUA 4QFNA 2AL4A 3WAFA 3FUZA 5ISUA 3C35A 4YKPA 3MVYA 1Y1MA 2ESNA 1OMPA 5H8FB 1B05A 4OEVA 3D4CA 2HQ0A 4M4GA 3IK6B 3S9LC 1PB7A 4YKJA 5CMBA 3USDA 4ELOA 4P0GA 5TU0A 2GRVA 4N13A 2H5YA 3MP6A 3VLWA 1EU8A 4F31B 1N3WA 1P1WA 1N7WA 2F36A 4OVJA 1MQHA 1B7ZA 1POTA 3K1NA 5H8NA 4MF3A 4PP0A 1XHYA 1MG1A 3CIJA 2NVUB 3SEWA 1A7LA 3FXUA 1T0KA 1Y4TA 5DYHA 1AMFA 3PV0E 3HV1A 3EPEA 3TZAA 1UIVA 2OCUA 5AA2A 3U1OA 2Q88A 3VVEA 4ZE9A 3N94A 3DLNA 4Q0CA 1LCFA 1ZKBA 3RNNA 5H8FA 4G68B 4JWOA 2VHAA 1I6AA 3MZ1A 4OQOA 3VLUA 3G3HA 1JETA 5CM6A 5EHMA 1D4NA 3T9XB 4FAJA 2QS2A 1O64A 2XX9A 3HN0A 3PGFA 1B4ZA 1HSJA 4RXLA 3IJXB 3CVRA 1SDXA 2XD2A 3RQTA 3SEVA 3V5AA 2BJJX 4IO2A 1M5EA 1WDNA 2UVJA 3BKIB 1FQDA 3LUYA 4FIMA 4G8HA 4RJZA 3FJMA 4ZE8A 2O1MA 2F7BA 2I4CA 4KHZE 1UTHB 4F1VA 2ZNSA 4U4SA 3DP4A 3SETA 5DEXA 2F34A 4ZS9A 4KYEA 1OLCA 1XVXA 4XXUA 4E0WA 1B0LA 2I0CA 3MAMA 4NF5A 4LA9A 4OFOA 5B7DA 4J2CA 2D5WA 2Y7WA 1FQEA 3FATA 1B58A 3H3GA 5I58A 3FVGA 1URSA 4HCYA 4HTGA 4LUBA 1LCTA 4OMBA 4ONYA 2Y7IA 3LC8A 3TCFA 1QULA 1SW1A 4ELQA 1II5A 2DQVA 3TYHA 1AOVA 4H0WA 4R6YA 3VVDA 4N07A 1B9JA 5AA4A 1HSEA 2DP8A 5KCJA 1H43A 3IOVA 3O6GA 1R9QA 2DVCA 3HPIA 3LBSA 4ZZAA 3IOTA 3FZVA 3RY3A 1UIUA 2X26A 1Y3PA 4FI5A 1ATGA 2G0UA 4M1VA 2O1LA 1H44A 2P2AA 5I2KA 3H4ZA 2XD3A 3VDFA 5B70A 4OETA 3T9UA 4C0RA 2RCBA 1MPDA 2ALUA 1J1NA 4G4PA 4QFKA 1CB6A 2DXYA 3FD3A 4F1UA 5HPQA 3OO6A 3R6UA 1NH7A 2Q9TA 5CI5A 5IAIA 2DVZA 1IQ7A 5BWJA 4R2BA 1SBPA 2P1SA 3MBPA 4POWA 5HBCA 1OQGA 3K00A 4IO5A 3VLVA 4EUOA 3VV5A 4BDMA 4U1OA 2X7PA 1B46A 2GFEA 4EQBA 2YLNA 1LAHE 2V84A 4OWDA 4WEDA 1USYE 3H7MA 5H8SA 4ELRA 3D4GA 4H67A 2WKYA 1DTZA 2F6PA 2RINA 3B7DA 3KN7A 1NNKA 4MFIA 3TQLA 1AIVA 1S9TA 5I57B 4NF6B 4G68C 1SI0A 3FV2A 2I6EA 2DE2A 3TDJA 4AB5A 3FXRA 2XXTA 3M8UA 3PMXA 4THIA 3FGSA 1RYOA 1MY2A 5K2YA 4G68A 3IB0A 4EF1A 3CSGA 4X9TA 1KWHA 4CQIA 1LAXA 2X9XA 1N76A 1WODA 4YB5A 4ZECA 1MS7A 1I6BA 2UVHA 5CMMA 1IXHA 1TXFA 3ILTB 2F8DA 3IB2A 2F35A 1P1UA 4QF9A 4WEPA 1QW0A 2ZXTA 3OSRA 3KZGA 3FVOA 5DVIA 4C1UA 3FXQA 4F18A 5ICTA 1B5HA 1SW2A 4C1TA 1QSDA 5I59B 1GVCA 4U2RA 2OJTA 1FTJA 1MH3A 3O6HA 1MPCA 2DOJA 1VFDA 2H9BA 2VP1A 1BTJA 3Q25A 1LFIA 3N5LA 1NNTA 2FNCA 2REGA 3PPNA 4NF8B 1B3FA 3P7IA 1DTGA 2V3TA 3KN8A 4I62A 2O7IA 3CFLA 4LATA 1MM7A 4OYVA 4QSCA 1NH8A 5EHSA 3QUFA 3K0VA 5KCJB 2ZMBA 4OFLA 3S9EA 3H03A 4IO6A 3ONMA 4I1DA 3UP9A 1MXWA 1N7XA 4BDNA 4NF4B 1I69A 1M5DA 4G8MA 2XX8A 3TCHA 2RF1A 1B1XA 1IXIA 1URDA 2KWIB 1MXVA 4F1YA 1QKAA 4BDOA 2DWIA 4F29A 3M3LA 3HHGA 3IO4A 2F5XA 4HS7A 1GGGA 1MY0A 1VFEA 2CZLA 5H8QA 5JEIA 4ZEBA 3RT6B 1UTBA 2W7YA 3LSFB 2HZKA 4OXVA 3MJNA 3OEMA 4DIGA 2P0SA 3M3FA 3H6WA 2F6GA 4PQJA 4XKRA 5AA2D 1N3XA 3G3KA 3OD7A 1NL5A 4LP2B 4YU0A 2Y7KA 2HAVA 2HAUA 3IORA 4FORA 5H8HA 2XHDA 4PFWA 3ZSFA 4Q30B 4EXKA 3T93B 3S9NC 3IJOB 4MH5A 2DE4A 5KDTB 2I58A 4XKNA 2PT2A 4AB6A 2GHAA 1MY4A 3K6VA 4X1DA 1JQFA 1SI1A 4LONB 4OZ9A 5I56A 3MVZA 2A5TB 3MPLA 5LOMA 3LR1A 4X1BA 2B65A 3S9MC 3CRBA 4LQ2A 1YTVA 5FTHA 2PYYA 3VE1B 5FHOA 3MP8A 1H76A 4IY5A 1SVXB 3JZJA 3V83A 4H8IA 2G29A 4RY1A 4OEUA 1MH4A 3AXFA 2AYSA 4IO3A 3OENA 3TTNA 4F19A 5I56B 4JB7A 2YJPA 2C5KT 2ZYKA 3TAJA 2I4BA 4GVOA 3BBRA 5I58B 1LGBC 3JYRA 2Q89A 1US4A 5KDTA 1R9LA 3U94A 3CFZA 3ECRA 5H8HB 3RPWA 3ZS6A 2O68A 4MLVA 2VD2A 3E3KA 2XX7A 3V89B 4FECA 1D3KA 3MZBA 4XIGQ 1JVYA 1R6ZA 4NWDA 2ONRA 3RT8A 5DT6A 3CVGA 3JV9A 3OXNA 1A8EA 3SERA 4EQ7A 1BKAA 5AA3A 1SYHA 3FXDB 2QS3A 1UTBB 2XXRA 3Q26A 4G2ZA 4WKMA 3B6TA 1MQGA 1DPEA 4GF8A 1B5JA 4YB6A 3HHFA 4QFPA 2E1SA 5M2VA 1JW4A 1ZJLA 3W15C 4ESWA 2PMSA 4N6PA 4ZEKA 1NNPA 4ECFA 1OIBA 1EZOA 3GZGA 4BDLA 3G7WA 3MXZA 4QSEA 1GV8A 4ZEDA 5A5XA 1LAFE 1I6QA 2D21A 4I8CA 1BLFA 2QS1A 1B3LA 4DE8A 4MLQA 3TQWA 1Y20A 3PUZE 2X9YA 1EH3A 3T66A 2PT1A 4OERA 5CMCA 3KGCA 3K6UA 4P0IA 3T96B 3CG3A 4F39A 1SD3A 1ANFA 4GLIA 3TTLA 2B3FA 3CFXA 4U4XA 4DCXA 1LSTA 2DS9A 2V25A 2XXWA 1QJMA 2AL5A 3C9HA 3FV1A 4H5FA 4U23A 2DYXA 2OWSA 3C32A 2R9JA 4YICA 4JWXA 2UVIA 4E0XA 1LFGA 3K1PA 5CMKA 4R72A 4NF8A 5HM4B 1QUJA 4JSOA 3OMBA 3Q27A 4JSDA 4QRZA 4R73A 4YB7A 3UN6A 1YAEA 4GWOA 4H1XA 2YPNA 4GD5A 4NEDA 3CSBA 1IUDA 1MDQA 3ILUB 1Q1KA 5F7VA 3GXAA 3TELA 2ZNUA 4IGTA 3KJTA 4R9FA 4H5GA 1BIYA 2GHBA 2RC7A 3Q29A 2OBGA 5BUUA 2IC6A 3QIMA 4IY6A 1FW0A 5L9OA 5FHNA 5TP9B 1H3DA 4IGRA 4KCDA 3K6XA 5I57A 1FQFA 1MXUA 5CRYA 2DE3A 3TODA 1MQDA 3L6HA 3HSTA 1N84A 3C33A 1MXZA 3K6WA 4F2QA 2XXYA 3TTMA 2O84X 2XTLA 1JEUA 4L0RA 5ITOA 4DLDA 1AH5A 4O3CA 5AE4A 1PB9A 2HEUA 1P1OA 4KYDA 1TT1A 5A5XB 4LZ8A 4YZZA 2MBGA 2XXIA 3OO7A 1B2HA 3LSWA 2ONKE 4YAHX 3ZKLA 4DCYA 4DZ1A 1XVYA 1OVBA 1FQCA 1XT8A 2ABHA 1SW5A 3FIRA 1PEBA 4U1ZA 5J1DA 1R1NA 4DNDA 1D9VA 3G3IA 4KPTA 4KQPA 3EHSA 2FYIA 5TPAA 4F3GA 4PETA 3PUXE 2XXVA 3G3GA 3SEYA 3IB1A 4F22A 5JTYA 3BFTA 1DSNA 2Y84A 3TTKA 4JDFA 1SYIA 1NKXA 3LSLA 3QXMA 4KYSA 1ZTYA 2ZNTA 3I3VA 3EHUA 3IOUA 4ND9A 5F1QA 4EXLA 1SQYA 3MZ9A 4KCCA 2OZZA 1B3HA 4YKKA 2V3UA 4R74A 3C36A 3VVFA 1QVSA 1IJ5A 3FVKA 4RNSA 3SKPA 5CBSA 5EYFA 3TUSA 1DMBA 1PC3A 1QUIA 1SW4A 2PVUA 4GOTA 1Z7NE 3O29A 5I2KB 1FTLA 1HSLA 2QJEA 1XOCA 5DVJA 4ZEFA 1ZBMA 4OTEA 3MC2A 3W9VA 5KZTA 4B6XA 1P1QA 3PMWA 4EQ9A 2Q8JA 5JTYB 3N6TA 2Q2AA 4GQOA 3QUJA 1B7UA 1MRPA 1URGA 3GBAA 3RUMA 4U21A 4ZEIA 1F9BA 1MPBA 4F2OA 2H25A 1BP5A 4IO4A 2NOOA 4JBZA 4P11A 3G3FA 4EYYR 3E13X 2I48A 2R71A 1IIWA 4KR5A 4R9GA 2XXHA 1OVTA 4NWCA 4HW8A 3ZKKA 2G93A 4Q5TA 2QMWA 4GXSB 4DXBA 1Y1ZA 1US5A 5FTIA 1TFDA 4GXAA 4R6KA 4ZDMA 1JEVA 1QKBA 5L9SA 5L9MA 4RPNA 4ESXA 4QFLA 3TPAA 2I3WA 1RYXA 1NFTA 1ZU0A 3MPKA 3FJGA 3DP6A 1B40A 3A3UA 4NE4A 3LSXA 3OELA 4BLAA 4PFUA 4Z7EA 1A40A 3MW0A 4XKPA 2OK2A 3KG2A 3FVNA 1YPNA 4IO7A 4TOZA 3SESA 1B51A 3THIA 4BDRA 3R26A 3KOTA 1IEJA 4RK9A 3DELB 3KSXA 4HCWA 2FA7A 4H65A 3IOWA 3CKDA 2I3VA 3O66A 1N04A 1B1HA 3MP1A 3PUWE 4LZ5A 3RGYA 1S7YA 2F7AA 1TFAA 4NF4A 1L5TA 2HFBA 4NMYA 3KOSA 2QSXA 4DDDA 4F3BA 1EZPA 1JNFA 3K4UA 3F11A 2QRYA 3O97A 3KBRA 2A5TA 1LFHA 5ICQA 5AA2B 2Z23A 3C31A 3BFUA 3RN8A 2ZYNA 3T9HB 4FEDA 3B6QA 1LB8A 1UTHA 2RKMA 2H4IA 3EQ1A 3IAZA 2UYFA 1XS5A 2DWAA 4I9DA 2F7CA 2IA4A 2XXUA 4KD5A 3V8XB 4YKIA 5H8QB 3QK6A 3FASA 1ZKEA 3O28A 3MVWA 5JK4A 3B6WA 1Y3NA 2HCAA 2O51A 3EN3A 1XC1A 1LRZA 3H06B 4ISUA 2A5SA 4PE5B 4U22A 3TEPA 1PB8A 4LVQA 1O63A 1RKMA 2QMXA 1B3EA 2RC8A 3VXBA 5I84A 2XXXA 1NNFA 2I0BA 4GFRA 1POY1 1GTKA 1LBCA 2DWJA 2XXPA 2Y7PA 4PFTA 3DM0A 3GLBA 4H8JA 2V93A 3PPQA 2Z8DA 1YCJA 3MUQA 1VR5A 1PBPA 1M5BA 4GL0A 5TP9A 4KFQA 2H98A 1A99A 3KN3A 3OOAA 4DXUA 2REJA 1B4HA 2V3QA 2H99A 1EZ9A 3PUYE 2Z8FA 3U93A 5H8NB 5I59A 3UGWA 5DTBA 1A54A 3UK4A 4UA8A 3T22A 4GRKA 5ITPA 1B3GA 1FQAA 3OEKA 4G77A 4UACA 1MQJA 4FE8A 4KI0E 1M5CA 4TLLB 3WAEA 1MDP1 1ZLQA 2PX1A 2XXQA 4R2FA 3R7XA 4RA1A 2O7UA 3SEUA 3MVXA 2X9WA 2QS4A 3A09A 3QYTA 3N6UA 1OLAA 1DPPA 1IJ6A 3I5OA 2B3BA 2LAOA 1B32A 3K01A 3L3PA 2ANJA 3H6VA 3KSJA 4L17A 3PD8A 2Y7RA 3TTRA 2D3IA 4NTLA 1DOTA 1H45A 2QPQA 4RYAA 3RTFB 2Z8EA 3TMGA 3E4RA 4YMBA 5CBRA 4GL8A 5DVFA 2E0SA 3HO7A 3HCQA 2DWHA 1IZ1A 1H7CA 2NUVA 4LQ5A 3SDFA 5I2NB 1LLSA 1B52A 4O3AA 4OHNA 2K48A 2OWTA 3PPRA 2HXWA 4O3BA 1AL3A 4X48A 4ZZEA 3IO6A 5K2XA 4OFJA 4QSDA 2C5JA 3TKDA 3W9WA 3QAXA 3H6TA 1PDAA 3K2DA 3TFLA 4FATA 5AA4B 3FJ7A 1A8FA 3EF7A 3DP8A 4POXA 4NF6A 3TKLB 3U72A 1ELJA 3ODBA 1B5IA 3MQ9A 1ZMGA 3PD9A 4LZ7A 5ELVA 3U8QA 2CMOA 4F3SA 3UA8A 3VFJA 2QL3A 3EHTA
chains in the Genus database with same CATH superfamily
4HE8A 1Z0PA 3Q2MA 3ZN0B 4DV4T 1UGOA 2HHMA 5AA1A 3CHGA 3BK9A 1HG5A 4OHFA 2F97A 2PTFA 1IXGA 3UIFA 1IXCA 2NWJA 1B6HA 1IZNB 1VSOA 4X64T 2X7QA 2XXKA 1Z8UA 4DXCA 1Q35A 4YSYA 4ELPA 2CCQA 4Z0IA 2Q2CA 4UABA 5AFUL 1D0XA 3A3CA 3P4PA 1Z7ME 4EDPA 3M3KA 3LG7A 1VOMA 4XTCQ 3ZYMA 4NF5B 4DV6T 3UTKA 1MQIA 2CZKA 3VU7H 1O7TA 4TQUQ 3OKQA 2IC9A 1NUYA 3S4UA 1LAGE 1Y9UA 1FTKA 3SEXA 4NHBA 4EIWA 3L6GA 3CR9A 4L5GA 5KDMC 4OX9T 1YKEB 4QFOA 2DSFA 2N1GA 4TLMB 1LBYA 3T9VA 3C51A 3GMIA 5AQUB 3NZQA 3CG1A 2AIXA 2NXOA 2UU9T 5HEHA 2C5IT 4U2YA 2PBWA 1KZ8A 5LBQB 2Y5KA 3P4RA 1ZIUA 2WAUA 3FUZA 1L0VA 4HE2A 1Y1MA 2ESNA 5AQRB 2HQ0A 2ZM2A 5F3JA 2WMNA 4P0GA 1FPEA 2GRVA 4N13A 1T98A 1N3WA 3N9PA 4MF3A 4PP0A 4MLKA 4K0KT 3SEWA 2YINA 3JCFA 1T0KA 3FXUA 3ZMVB 4LF9T 3PV0F 2NTYA 3N9NA 3PV0E 2OCUA 2Q9QC 2GK9A 2UXNB 3RNNA 1ZKBA 4O8SA 4JWOA 4OQOA 3PUVF 1V9DA 3T1YT 1D4NA 3VR8A 3T9XB 2NOXA 4UEMA 3HN0A 4P3LA 3PGFA 4QBAA 4HWCA 4IO2A 3BKIB 1FQDA 4G8HA 3S9MC 2ODVA 1UTHB 3RQUA 5BMVE 2ZNSA 4F1VA 2L8KA 3RIFA 5LG4A 5DEXA 4U33A 3PURA 1OLCA 1OEDA 4DV7T 5DW8A 1HNZT 3ABVA 3MAMA 2BG9C 5ET5A 2ZZXA 4J2CA 3FATA 1FQEA 4PTKA 4A56A 3UT5E 3FVGA 5DQWA 4HTGA 4ONYA 3LC8A 3TCFA 1QULA 1SW1A 1AOVA 1II5A 1S35A 4H0WA 4JI6T 3VVDA 4N07A 4B3ST 3QC9A 2DP8A 1H43A 3IOVA 3RY3A 3FZVA 1IBMT 1Y3PA 2G0UA 3AAAB 1H44A 3H4ZA 3UQ7A 4M1PA 4PDDA 4DBQA 2YEVC 1CB6A 2DXYA 5CI5A 1NH7A 2DVZA 5BWJA 4DMVA 1SBPA 2M67A 5HBCA 4KP3C 3VV5A 4EQBA 2YLNA 1LAHE 4O94A 1IMEA 5CA1E 4H67A 1FBGA 3X1DA 2MTQA 1DTZA 1KNPA 1FBHA 1M62A 5I57B 1XMOT 4G68C 2I6EA 4BA9A 1ZV4X 1XNRT 4JEUB 1NV2A 2V7LA 4O8MA 4TWFA 1HFAA 3AEBA 3JC6D 3LJCA 1KWHA 1LAXA 2X9XA 1D1AA 3O4XE 5LHGB 1WODA 4XF5A 2XAHB 1R8IA 5CMMA 3IB2A 3UK4A 4HKAA 4DV0T 3KZGA 3OSRA 5ICTA 3FXQA 1B5HA 1QSDA 1GVCA 4U2RA 3AVSA 3L8RA 1MH3A 2FJBA 2DOJA 1VFDA 2H9BA 4YKJA 2KZ7B 2LOSA 2WDRA 4QFLA 1DTGA 3AA1B 2V3TA 3KN8A 5EHSA 2O7IA 3CFLA 3VR9A 3H03A 3ONMA 4I1DA 3OPCA 4BDNA 3AECA 4YFSA 1B1XA 3K3NA 2JMHA 2UXXB 3HI2A 4F29A 3EAMA 5DJQC 2CZLA 3WI3A 4UF0B 3HKDE 1VFEA 4ZEBA 1OWAA 3RT6B 4OANA 2XAGB 3LSFB 3N2OA 4UVAB 3M3FA 3H6WA 2Q74A 4G61A 2FHYA 3RPLA 2XY8B 4PFWA 3OYZA 3T93B 4MH5A 2DE4A 4FJOA 2I58A 4MMPA 4AB6A 4X1DA 1JQFA 1SI1A 3HR0A 4LONB 4OZ9A 5LOMA 3MPLA 2B65A 4LQ2A 3AAEB 3ANWA 1H76A 2V6YA 4ZZCA 4OA4A 2SPCA 2G29A 3AA0B 3E08A 3E22E 4F19A 3NVOA 3E0ZA 5I56B 2YJPA 3D1RA 4COFA 2Q89A 1US4A 4HE0A 3PE0A 2V5CA 5H8HB 3B5MA 2XX7A 4GWUA 3PUXF 2P9BA 1JVYA 2W62A 2ONRA 3RT8A 3CVGA 5I5PA 4DR5T 3PUQA 2WP9A 3FXDB 4YHJA 4WKMA 3AE3A 2UUCT 3LK42 4A97A 1N36T 4ZI2D 2KT9A 1EZOA 4U7IA 3GZGA 4BDLA 2ODUA 3MXZA 4ZEDA 2HN1A 2D21A 4I8CA 3A5XA 1CNQA 3TQWA 4HE1A 1EH3A 2JQ9A 5CMCA 5HCJA 3AEFA 3H37A 4F39A 1ANFA 4GLIA 1EYIA 2B3FA 3A29A 3CFXA 3TTLA 3F57A 5IZZA 3LUZA 4YICA 1EYKA 4JWXA 2K5BB 3FZLB 2IHR1 2V7IA 1JNZA 5HM4B 3K8PC 4JSOA 2RA1A 4H9NC 4IDNA 4U31A 4JSDA 4QRZA 3PUGA 4GWOA 4PAFA 4GD5A 3KINB 5LBMA 1Q1KA 2VWAA 3UUBA 3AA6B 4GX4A 3IFAA 4IGTA 3TELA 4EOZB 1OXZA 2RC7A 3Q29A 2C0SA 3CIRA 2IC6A 2OBGA 5BUUA 3UU6A 3UQ4A 4QKNA 1KNRA 1FQFA 4DUYT 1NUXA 2DHRA 2DE3A 5CRYA 2LM2A 3U65A 3AE1A 3EHZA 4O3CA 5AQSB 5A5XB 4LZ8A 3LSWA 4F22A 3R84B 2ABHA 1QGXA 3FIRA 1PEBA 4KPTA 4KQPA 3TLVA 5TPAA 4F3GA 3EHSA 3CK6A 3FXBA 2XWIA 5JRCA 3PUXE 5FL0A 5FP3A 3G3GA 3SEYA 1X79A 2XPKA 2X67A 4ZEYA 1NKXA 1WFDA 5F1QA 5FY0A 4KCCA 5FXZA 1YW0A 4YKKA 2Q9QB 3Q5WA 5EYFA 1YKHB 4DV2T 5L47A 2PVUA 1Z7NE 3TMGA 4ZEFA 5KZTA 2W4XA 4G63A 3PMWA 3OVUA 2ZZWA 3QUJA 4PK6A 1URGA 3RUMA 2UXDT 4N4UA 2HPLA 4JBZA 4H9PC 1LBVA 5IZ3A 2V7KA 4PJMA 3ROJA 3NWIA 3ZT7A 1UCUA 2XQ8A 3LK3B 2PG8A 2QMWA 4ZS2A 1TFDA 4GXAA 4R6KA 1KEYA 2XQ7A 1G0HA 4RPNA 3TPAA 1D0ZA 3RYFE 1MMNA 2BZBA 2JQHA 5FXVA 2LHNA 1A40A 4XKPA 2OK2A 3KG2A 4IO7A 4LFBT 2GQ1A 1IEJA 5EQ8A 4X1IE 1HNWT 3FBZA 4HFIA 2WYPA 3O66A 3LV0A 1B1HA 3RGYA 4NF4A 4U7YA 4N91A 2HPJA 1EZPA 4F3BA 2V8SV 3KBRA 1MIVA 2A5TA 2XAFB 4IL4A 3ZT5A 2E9XA 1VRBA 2ZYNA 1LB8A 2RKMA 4TN7B 2H4IA 4AQFC 1INPA 3OYXA 2DWAA 4I9DA 2KMFA 5EYGA 3RI5A 2F7CA 2IA4A 2WBDA 2XXUA 3KDSE 4OVPA 4PFBA 1K9YA 5F24A 5C8YE 3O28A 3VKHA 3TEPA 2A72A 2XJ7A 2F3DA 4LVQA 5L3EB 3Q5XA 3TLWA 2E2AA 3ZT6A 1KK7A 1FBPA 3A7MA 1YYZA 1FPGA 2XXPA 4CI1B 3PPQA 3KV6A 5HXEA 4GL0A 1PBPA 2ACXA 2CZIA 4N6DA 3P50A 1A99A 3OOAA 4Z90A 3IF8B 3C4ZA 2V3QA 1MMDA 3U93A 5H8NB 1A54A 1YQ4A 4DUZT 1FQAA 1NUZA 3OEKA 4G77A 5IM2A 3WAEA 4TLLB 3MK7C 2QVVA 2AE9A 4WYVA 2BKPA 2ZM8A 5CFBA 1IJ6A 4U22A 2LAOA 3H6VA 2M6BA 3PD8A 2Y7RA 3TTRA 2V6XA 2D3IA 3L09A 2QPQA 5CBRA 2MKZA 1NAFA 3MJXA 2DWHA 2CM0A 4CN6A 2NUVA 4LQ5A 5IWAT 4CXYA 4O3AA 5AQFB 2OWTA 1MNDA 1FBDA 3IO6A 2C5JA 3TKDA 2LSKA 5IYZE 4PNIA 2K9AA 5L3CB 3RC8A 1B5IA 4LZ7A 2A9UA 3U8QA 1LEVA 1OEDC 1T7SA 5EK4A 2H7OA 3EHTA 1GQEA 4AKHA 1A55A 2UVGA 1JVXA 5AQPB 3FZMB 5FHMA 4A98A 4JVCA 1MY1A 1WVJA 3MWBA 4YSZA 3CX6B 5IUXA 4G8NA 2DDKA 3ZC1A 2VURA 1PBQA 1TWYA 3QSLA 4PFYA 4Q8RA 4H9OC 4H9QC 1U4QA 3B50A 4PJLA 2X0LB 3PUVE 3UORA 1USYH 2BBHA 4U3CA 1FQBA 3PTYA 2ZYMA 1MMAA 1D9YA 3QMFA 2LSGA 3B13A 5I2NA 4P0BA 4YMAA 5JDQA 1AJ3A 4FJPA 4GIZA 3IR1A 4H6DA 3AXJA 1FTMA 4UVCB 4IGUA 4LFCT 1LBBA 3UUNA 5TPAB 3KJ7A 2VD3A 2CA5A 4WBOA 5BR8T 3EDVA 3K02A 5LGNB 4V1Av 4JVIA 3Q28A 1MXXA 3HKEE 4PBQA 4HWDA 4I43B 1IITA 4XAXB 1OEDE 2IEEA 1YZ0A 4ADZA 4IB2A 1Y3QA 4PFRA 4WBNE 2RCAA 2KLFA 1YXRA 2X68A 2O6AA 2FJEA 3PPOA 4JWYA 2BKNA 3VXCA 3RLFE 1HCIA 3WAFA 2OV9A 1RDXA 5ISUA 3C35A 4YKPA 3F2EA 3BIGA 3MVYA 1FPLA 5H8FB 1B05A 4DI4B 4M4GA 1ZP0A 3S9LC 1PB7A 4ELOA 2XAQB 4JI2T 5TU0A 1N32T 1NV6A 2H5YA 4PAGA 1N7WA 2V7MA 3CPZA 2NVUB 3CIJA 1CHUA 4P47A 4X1YE 4AKGA 3PJAJ 1UIVA 4IIJE 4UIGA 5C2TA 1BR0A 2PCRA 3TZAA 5AA2A 3VVEA 4HXVA 3N94A 3DLNA 5H8FA 3VLUA 1JETA 1HX8A 5EHMA 3RYDA 4MNCA 1O64A 1B4ZA 1HSJA 4TZ4C 4EB6E 2RPAA 4MNIA 1M5EA 5J2UE 5LGUB 3FJMA 2O1MA 4KHZE 2PFYA 2OA5A 3PTRB 4U4SA 2XM2A 3QB5K 3ZCJA 3RHWA 4ZI3D 3PUAA 4XXUA 4E0WA 4HFVA 4YHHT 1B0LA 4PW8A 4O4LE 2I0CA 4LA9A 4NF5A 2Y7WA 1WR6A 3H3GA 4HCYA 4OMBA 2XSBA 3KBZA 3K3QC 4ELQA 2W0GA 2Y48B 2XAJB 2W2UA 1B9JA 1HSEA 5JREA 4JV5T 4O2AE 3O6GA 4HFBA 2X26A 5LP6E 1US7B 1M7KA 2XSAA 5AQMB 2P2AA 2IAKA 2XASB 4NXMT 5I2KA 5B70A 2RCBA 1J1NA 3FD3A 2IIUA 4F1UA 4N17A 3R6UA 1MNEA 4DO0A 1E2AA 4JI8T 5L3FB 1IQ7A 4R2BA 2P1SA 2E5LT 3LDQB 4IO5A 4EUOA 4PK4A 4U1OA 2V84A 5JR9A 4JI3T 4ELRA 3D4GA 2Y5LA 3ONXA 2WKYA 2F6PA 2RINA 1AIVA 5LMUT 1NI9A 1S9TA 3UU4A 2CXFA 3AEGA 3M8UA 2XXTA 3PMXA 1FMVA 3HFUA 4DBRA 1RYOA 2DWKA 2LSJA 2VL8A 2X9HA 4G68A 3IB0A 5K2YA 3TLTA 4LF8T 4I50E 4ZECA 1MS7A 1I6BA 4BDRA 1IXHA 1TXFA 1IMFA 2F35A 1QW0A 3KV4A 2ZXTA 4F18A 3N2KE 4P56A 4C1TA 5I59B 2ZMAA 3T8OA 4PGNA 3O6HA 4NWDA 3RTWB 1IMBA 1BTJA 3Q25A 3N5LA 1NNTA 4NF8B 1B3FA 3P7IA 4OYVA 4I62A 5JDLA 4F6RC 2D0TA 3QUFA 3AE8A 1N7XA 4NF4B 2W63A 1M5DA 5JDNA 2RF1A 3ZMTB 1IXIA 1URDA 1QKAA 4BDOA 1FBFA 4DR1T 5HYAA 5LYJE 4HS7A 5H8QA 5M4YA 2HPGA 2NW8A 2W7YA 2HZKA 4DIGA 3UFGA 2P0SA 4PQJA 4XKRA 3T1HT 3AE6A 4X65T 3ZYLA 4Z8XA 2WYKA 2Y7KA 4GK5E 5H8HA 4EXKA 4FORA 3ZSFA 3ZMSB 5KDTB 2I59A 4XKNA 2UXCT 3K6VA 1IMCA 5JDMA 3MVZA 2A5TB 5I56A 2VB6A 1YTVA 5FTHA 2MPKA 1SVXB 5A5LA 4LF6T 4NPPA 4LF7T 4OEUA 2AYSA 4IO3A 3TTNA 2C5KT 2I4BA 4GVOA 3BBRA 5CJ5A 1FBCA 5KDTA 3ECRA 3LSVA 4QX8B 1OEDB 2VD2A 5FBPA 3E3KA 1D3KA 3MZBA 4XIGQ 4N8GA 1R6ZA 4EQ7A 4AIUA 5AA3A 2OX3A 4YB6A 1B5JA 3HHFA 4ESWA 5LCYA 4HFHA 3FBLA 2Q9QD 4IDQA 4EEBA 4N81A 3HA4A 3G7WA 4QSEA 5ABFB 2K3WA 1I6QA 2WEFA 1BLFA 2QS1A 1SA0E 5H6RB 5LHHB 4ZI7E 3PUZE 4EYUA 4OERA 4QXHB 2P3VA 3KGCA 3K6UA 1SD3A 5AQQB 4U74A 2LOPA 2UVIA 4NGUA 5EQAA 5CMKA 4P9KA 2LRLA 2NR4A 1HF8A 4O2BE 4DVDA 3OMBA 4R73A 5GONE 4NEDA 1FPJA 1VCTA 1MDQA 5F7VA 1VDWA 4R9FA 2KR0A 3AE2A 3QIMA 4YTMA 4A5XA 1FW0A 5L9OA 4KCDA 3K6XA 5I57A 1MXUA 2JPFA 1MQDA 3K6WA 4UVBB 2KNDA 2LSYA 2XXYA 2O84X 2XTLA 1JEUA 5ITOA 2Z6EA 4KYDA 1NV0A 4YZZA 4NN3A 2MBGA 4YAHX 3FZKB 3I1AA 1XT8A 1FPBA 4CN4A 5LB7B 4EAHA 3G3IA 1D9VA 2FYIA 2LRKA 2YOEA 2A3DA 5FVKA 2EHOD 3VRBA 4JDFA 2L3LA 3LSLA 3QXMA 4KYSA 3V5SA 1ZTYA 3I3VA 4ND9A 1MIWA 2V3UA 5T3JA 4PFIA 3SKPA 3FVKA 1DMBA 4JI0T 1QUIA 4TX5A 4LFAT 1FTLA 2QJEA 1XOCA 2LJLA 5L2LA 3AE4A 2Q2AA 4GQOA 2W67A 2XQ4A 3GBAA 1BP5A 3G3FA 5AQLB 2R71A 1IIWA 3QB5A 1IBLT 4NWCA 3FB2A 3ZKKA 2G93A 1NV1A 5LG3A 3GA8A 4ZDMA 1JEVA 1QKBA 4ESXA 2I3WA 1RYXA 1NFTA 1ZU0A 3MPKA 1KF6A 1B40A 4BJNA 4NE4A 3LSXA 5AQTB 3OELA 2PBIA 3MW0A 2FBPA 4MBQA 3VRAA 4E7SA 1YPNA 4TOZA 4UV8B 5I7IA 3KOTA 2VK9A 3RRWA 5EK2A 3C50A 4KHZF 4MX6A 3IOWA 3CKDA 4LZ5A 1S7YA 2F7AA 5JDHA 5HXRA 1L5TA 3KOSA 3K4UA 3F11A 2QRYA 3H3MA 5KX5E 3OTOT 5ICQA 4H46A 3ZJ2A 5L3GB 4ZI3C 2CPTA 3C31A 4GBWA 3R6NA 3SFEA 3FZHB 2XHEB 2HCAA 2JRKA 1XC1A 4ISUA 2A5SA 3AA7B 4I3YA 2RC8A 2XXXA 1NNFA 4AQGA 2FUPA 2Y7PA 4HWHA 3DM0A 4H8JA 2YN6A 1YCJA 1VR5A 3MACA 3RYIE 4DXUA 4JYAT 1HG2A 4IREA 1EZ9A 4X20E 4DV5T 3KBTA 4KX6A 4GRKA 3AXJB 5FNVE 2PX1A 2WBLA 1UURA 2WY2A 3BIHA 5LJNA 2O7UA 3SEUA 3MVXA 1HR0T 3A09A 1FRPA 3K01A 3ZJ1A 4L17A 3L3PA 2ANJA 2CEAA 1DOTA 1H45A 3RTFB 4RYAA 5JEIA 3E4RA 3KFWX 4GX6A 3KVAA 5DABA 1H7CA 3SDFA 4GOUA 3ONLC 5F5WA 2XZEA 2HXWA 2B4LA 4QSDA 5K2XA 3W9WA 4C91A 1PDAA 1A8FA 3U78A 3TKLB 3ODBA 3P8CD 5ELVA 3RIUC 3UA8A 2P3NA 2LE8A 4MFRA 3KBUA 3PU5A 4R75A 4LN5A 4MBPA 2IMLA 3TCGA 1VE4A 1M5FA 3KV5A 4OESA 3C34A 2WWUA 4AQFA 4WXJA 4YLHA 5JVDE 3I6VA 3KEIA 5L3BB 5L8DA 3G3JA 2OLBA 5IKBA 3IX1A 3PPPA 2ONSA 1CE2A 1ZEEA 4GKKT 2J62A 4IE0A 1JW5A 2DNXA 3CWZB 3NOHA 2CWOA 4PF6A 5AQIB 4YTNA 2X0YA 2THIA 4F3PA 3Q5DA 1MXYA 2YU2A 4EF2A 1SE7A 3PUZF 4CI2B 4G2AA 3K1MA 3O2AA 1LVFA 3OO9A 3H6UA 4QHQA 3S2VA 3N26A 1NV4A 1P1NA 2V1DB 4P1EA 1GR2A 4XKQA 3MZKB 1UQWA 2VASA 4RK2A 1FTOA 2DWGA 2M8CA 4PJJA 2F78A 3FXEB 3E9XA 1UK5A 1E1HB 4JI1T 2Z22A 4OENA 2JMKA 4PJNA 1B7HA 3U92A 3Q9DA 2DLRA 1WR0A 3LBXB 3GBBA 2HZLA 3OSQA 3O9PA 2WDVA 4MHFA 1G73A 5L4EA 2PFZA 4DR2T 3ZN1B 2AL4A 1E7PA 4GIWA 5ABGA 2LKHA 4H9SE 3D4CA 2CMRA 1Y01A 2HHHT 5CMBA 4YXDA 3SOLA 3MP6A 4PFPA 1EU8A 1B7ZA 5H8NA 3K1NA 2I0MA 5LGTB 2WZIA 1A7LA 4IE6A 2D0UA 3NRYA 5DYHA 1AMFA 5FXXA 3HV1A 3EPEA 1D0YA 1HNXT 2UUAT 4XFEA 4LMLA 2VHAA 3MZ1A 3MA9A 4GK0E 4KHPT 5CM6A 1X9BA 2BS4A 4DR3T 1N34T 3AE5A 4RXLA 3RQTA 3N9LA 3I9WA 2UVJA 4FIMA 4RJZA 4ZE8A 4X04A 3EABA 1FPIA 2I4CA 4TNWA 1SUMB 4NIQA 3RIAA 3SETA 1BR4A 2VVSA 1D1BA 4KBMB 2F34A 4KYEA 3UU3A 1XVXA 3QNUA 1JP4A 4KI0F 4OFOA 3CQCB 2ZM0A 5I58A 4CXXA 1URSA 4HWIB 4IDOA 2DQVA 4AI6A 1VCSA 3E78A 2VKJA 3CX8B 2ZLYA 4R6YA 5AA4A 5TAOA 2WWVA 1R9QA 2DVCA 3RRCA 5LMNT 4JI4T 3HPIA 3LBSA 4X66T 5LTCA 4FI5A 4TWDA 1Y64B 4M1VA 2XD3A 3VDFA 3N2GE 3T9UA 1MPDA 5F8PA 2ALUA 4G4PA 4QFKA 3OO6A 5IAIA 4GWSA 1NV7A 1S94A 2CZHA 4XBFB 3AEDA 4POWA 2EHOC 5L3DB 1OQGA 3VLVA 1J5WA 4BDMA 2X7PA 1B46A 2L9QA 4ILUA 4ILAA 5H8SA 4WEDA 3H7MA 2JJKA 5IZ1A 2B76A 3TQLA 4MFIA 3DTOA 3B7DA 3KN7A 2PFVA 2PJQA 2V26A 4NF6B 4JI5T 1RDYA 5HCMA 2DE2A 4CI3B 4ANJA 4AB5A 3FXRA 1YQ3A 4DMWA 5JDFA 1SPIA 3CQXC 3CSGA 4X9TA 4CZZB 4CQIA 5CBSA 2F8DA 5DVIA 1NEKA 1P1UA 4WEPA 3FVOA 4JUYA 1KNZA 3G06A 4YJ3E 5HEUA 2OJTA 2FJDA 3IEEA 4ISSA 2CBIA 5JQGE 3DP7A 5A5XA 1LFIA 3PPNA 3KVBA 2WX9A 4LATA 4NXNT 4QSCA 1FSAA 1MM7A 4DV1T 3O1JA 4XZCA 1NH8A 5KCJB 3S9EA 3K0VA 2ZMBA 3A8YC 4QX7B 4P1NA 3RLFF 2NW7A 1MXWA 2QYWA 4G8MA 3C98B 2XX8A 2QFLA 2BBJA 5HXHA 4EGWA 4NX1A 3LBXA 3IA3A 4HWFA 1WLXA 3P4WA 3VKGA 3IO4A 1MY0A 3PU8A 5C3JA 2B4MA 1UTBA 2FVZA 3MJNA 3IFCA 2CE7A 4ZZBA 4H45A 3WAJA 4H63V 4LP2B 4YU0A 3EVYA 2QRXA 2HAUA 3IORA 2XHDA 4DI3D 4Q30B 4DV3T 5AQVB 2D5UA 2PT2A 1MY4A 4WW0A 5AQKB 2XQ3A 3M3ZB 2V6YB 4X1BA 2PYYA 4JVDA 2M6IA 3MP8A 3DJBA 3JZJA 4H8IA 2LSIA 1MH4A 3AXFA 1I94T 3OENA 4NG7A 3ISPA 4JB7A 3TAJA 4AXPA 4OVTA 2OLTA 4UXNB 1LGBC 4QHOA 5LOVE 1FBEA 4ASKA 3U94A 2EHOA 3CFZA 2O68A 1QLBA 3EKIA 4FECA 4GWXA 2F4VT 4OK0A 5DT6A 3OXNA 1A8EA 1BKAA 1SYHA 4G2ZA 4UF0A 4AKRB 1MQGA 4GF8A 2E1SA 5M2VA 2WMOA 1ZJLA 2VL0A 3AEAA 1J5ET 4PF8A 2ZM6T 4AS5A 4N6PA 4ZEKA 1NNPA 4ECFA 4KMCA 5LHIB 5EQ9A 5LNKA 1GV8A 4DE8A 1Y20A 3MYUA 2X9YA 2PT1A 4H63H 4TV8E 4TV9E 3T1BA 3JC6C 4TNVA 1LSTA 2Y8DA 3AE7A 5HEOA 1QJMA 4H5FA 5KCJA 1FJ6A 3SRZA 2DYXA 1XDOA 1LFGA 2LKGA 1FMWA 4NF8A 1XWMA 1QUJA 3Q27A 4YB7A 2BVLA 4H1XA 5CGMA 3ZCIA 1NWMX 3ILUB 5HAXA 1DK4A 3GXAA 5LDZA 4F8HA 1BIYA 2GHBA 3HKBE 4IY6A 2DL1A 3D0TA 1H3DA 5ETWA 3U3IA 3L6HA 3MKDA 4YT0A 5FY1A 3TTMA 3GYYA 4DLDA 4L0RA 1IMAA 1N33T 1PB9A 3TLUA 4MIJA 2ONKE 4DCYA 4DZ1A 4YY3T 1FQCA 3AE9A 1SW5A 4U1ZA 3VHLA 1R1NA 4O4IE 1W09A 4QH4A 4OYKA 4PETA 3UUMA 5ET7A 2XXVA 1HS7A 3IB1A 1J1JA 2N9DA 2J47A 1ZOYA 1DSNA 2AXDS 4H9RC 2CLYB 2VQFT 3EHUA 3IOUA 4EXLA 2F3BA 3MZ9A 2OZZA 4R74A 2WBBA 3C36A 3VVFA 1IJ5A 5JDGA 5AQJB 3I0OA 3UULA 4GOTA 4X8RA 3O29A 5DVJA 1ZBMA 4OTEA 3MC2A 2YU1A 1HX1B 2L5VA 4EQ9A 4EZHA 4TWHA 1KA0A 4P8BA 2HH7A 3AAIA 5LA6E 3N6TA 4NAPA 2Q8JA 1MRPA 4IE5A 4O4JE 1Q9DA 4NUVA 4X1KE 5JR9B 4DR6T 4U21A 2B1EA 4C90A 4ZEIA 1F9BA 1MPBA 2V4CA 4IO4A 2NOOA 4P11A 5DQVA 1NV3A 2CEXA 3E13X 4HW8A 4KR5A 5ADXL 1OVTA 2E9XC 4GYSA 4ISTA 4GWZA 4QXDA 4DXBA 4KXPA 1US5A 5EYHA 3P4SA 5L9SA 2WSSV 3KV9A 4U23A 3L39A 3RKGA 3A3UA 3F31A 4PFUA 4Z7EA 1W0AA 3SESA 4PAKA 1B51A 1XI6A 3THIA 4PBHA 2JIWA 3SS1A 3DELB 4H65A 4WNKA 2I3VA 3ESLA 3FZFB 1XMQT 2CEYA 2QVAA 3MP1A 3PUWE 4Q25A 4GWWA 1TFAA 4NMYA 2BVMA 4MAGA 2QSXA 4DDDA 5FL1A 1JNFA 4ZHQE 3O97A 1LFHA 5AA2B 1LBZA 3WAKA 3T9HB 2UXBT 4NUUA 4FEDA 5FKYA 2XQYA 1LBXA 1D1CA 4KD5A 4YKIA 3QK6A 3FASA 1ZKEA 3MVWA 3RPLB 3B6WA 3UU5A 5JK4A 1LRZA 2A2FX 4HFEA 4PE5B 2XWOA 4IR8A 3KC0A 5HXSA 3ZSTA 1O63A 5J16A 3NZPA 2QMXA 1B3EA 5I84A 4IL9A 2OWZA 2CRBA 4GFRA 2RP4A 1POY1 1GTKA 4NF0A 1LBCA 3JAFA 3PU3A 4JI7T 2V93A 4UELA 3ZEFB 4KFQA 4OYJA 2REJA 1FJ9A 1B4HA 3JAEA 3UGWA 3C4WA 4UACA 1MQJA 4FE8A 4KI0E 3J7Yq 1ZLQA 4B3RT 2FJAA 3V5AA 4RA1A 5ET6A 2X9WA 2IDOB 3QYTA 3N6UA 1OLAA 1T8BA 1DPPA 3I5OA 2B3BA 1B32A 4LMKA 3KSJA 3CX7B 2XA5A 3RKOA 4NTLA 2BJIA 4GL8A 2E0SA 3HO7A 4YSXA 1SHZC 1IZ1A 2X0HA 5I2NB 4OHNA 1IBKT 1AL3A 5ABFA 4OFJA 5AA4B 4FATA 2W61A 2BKOA 1XZYA 2VVNA 3EF7A 3DP8A 2KQZA 2VPOA 3JADA 2BG9E 1ZMGA 3P4QA 2CMOA 3VFJA 4N8YA 3LFMA 2W66A 2GH9A 4JLEA 4L9IA 4FEBA 4ZS9A 2UYEA 4B3TT 2I49A 4DR4T 1N0TA 4K3FA 1G8XA 1JW1A 2VOZA 5FVLA 2YDRA 4B3MT 4R6HA 1QUKA 5ESYA 4ILBA 3IL1B 3AVRA 4RPOA 2VGQA 3IHRA 3BQLA 2FIEA 3W15B 2IW5B 4P1LA 2IUBA 2UXAA 4U72A 3KC1A 3AEEA 1S50A 1MM6A 4XEQA 1LB9A 5J2TE 5CB4E 2DXRA 1OQHA 3O6IA 3ANWB 5HXCA 1CUNA 3RGLA 2FIXA 1P99A 3PMVA 3EUHA 2LM9A 2MOZA 4PCDA 3ZPOA 3PDYA 4JXIA 1AWBA 2KWHA 5A1LA 1B7TA 4AQYT 2ZYOA 3OO8A 5EZYE 3KFMA 4O4HE 5LJMA 1Y4CA 5CC2A 3ONJA 4OVSA 5IGAA 3EDUA 2R6GE 2HN2A 4BDQA 2CXLA 2NTXA 2O69A 1FCKA 5DEXB 4AQ4A 1MY3A 2RC9A 1FPKA 4ZS3A 3ZLIA 4GKJT 1WYCA 4Z91A 4DR7T 3C4MA 2CXDA 3CI8A 4O7IA 1NMUA 1B0HA 3PJAA 4EV6A 4QFNA 3H3AA 1T72A 1OMPA 3PUWF 4OEVA 1NUWA 3IK6B 1W0BA 3I9YA 2Y6XA 3USDA 4TUYE 4AISA 3VLWA 4AS4A 4F31B 1P1WA 1W9RA 2F36A 4QH5A 1MQHA 4OVJA 1POTA 1XHYA 1MG1A 5HWYA 1Y4TA 1UUSA 2D2SA 2R8TA 3U1OA 2BDEA 5L4HA 4ZI2C 3CQGB 2Q88A 4ZE9A 3V5UA 1LCFA 4Q0CA 3N9MA 4G68B 1I6AA 3G3HA 4HFCA 1RDZA 4I3EA 3O1IA 4FAJA 4HN9A 4I0UA 5J1GA 2QS2A 2XX9A 3SEVA 3IJXB 3CVRA 1SDXA 2XD2A 3ZSSA 2XQAA 3EI0A 2BJJX 3MSTA 3LUYA 1WDNA 4MJOA 1YD8G 2F7BA 1EYJA 3DP4A 2KXPB 5FY7A 4PK5A 2WCAA 1UX5A 4N6KA 5B7DA 2D5WA 3HKCE 1B58A 3J9X1 2WDQA 1FPDA 4LUBA 1LCTA 2Y7IA 3TYHA 2UUBT 5FMNA 4N78D 4ZZAA 3IOTA 1UIUA 1ATGA 2O1LA 3TLSA 3FBPA 1MMGA 2D9DA 5JR9C 1XDPA 4OETA 4C0RA 2ES0A 2Q9QA 3O1HA 4E7ZA 2KLQA 5HPQA 1IMDA 4EEDA 2Q9TA 4ERRA 3UU8A 3MBPA 3K00A 3ETVA 2GFEA 5JRCB 2H3RA 4OWDA 4JBWF 1USYE 3IBPA 5AQNB 5FYMA 2J1DG 4CN1A 1NNKA 4FBPA 3B57A 1UX4A 4LF5T 4PC9A 4GWYA 1SI0A 3FV2A 3TDJA 1FPFA 4MNPA 3B8BA 4THIA 4I4TE 3FGSA 1NENA 2JJ9A 4IHJE 1MY2A 4EF1A 2FBWA 4YB5A 1N76A 3PUYF 2WB5A 2W00A 2UVHA 5JTYB 2J4GA 3ILTB 4GX3A 4QF9A 2E9XD 4P09A 4C1UA 5J0ZA 1SW2A 2YDQA 1FTJA 4IT4A 3K3OA 4K0UA 1MPCA 2VP1A 2LT3A 2X51A 1BR1A 3SFDA 4E0XA 2REGA 2FNCA 4PGPA 2BS3A 4NQ8A 4HGAA 2V5DA 4OFLA 2XQ5A 3RX6A 4IO6A 2MYSA 3UP9A 2XQ6A 4BJMA 2CHNA 2NW9A 1I69A 3TCHA 5EQ7A 1MXVA 2KWIB 4F1YA 4LF4T 3OBVE 4UV9B 2DWIA 5AQGB 3UUXB 1XNQT 3M3LA 3HHGA 2F5XA 1GGGA 1D9QA 1IAPA 2E5VA 2QA7A 1LKXA 2VQET 4OXVA 5ET8A 5AA2D 3OEMA 2F6GA 2XM1A 1N3XA 3G3KA 3OD7A 3RIUA 1NL5A 2HAVA 2EHOB 4AKIA 4P0AA 3I0QA 4PFOA 4O7MA 4BAYB 3IJOB 3S9NC 1FIOA 3RQWA 2ZZVA 2DCFA 2H88A 3N9OA 2GHAA 3M65A 2KSRA 3LR1A 3CRBA 3VE1B 1LVKA 5KXJA 5FHOA 3GWHA 4N15A 1U5PA 4IY5A 3V83A 4RY1A 4KUMB 2ZYKA 5H6QB 2QGSA 5I58B 3JYRA 2DI4A 3RYCE 1R9LA 2Q8MA 3RPWA 4QWNB 3ZS6A 4MLVA 3ZKRA 3V89B 3LK2B 4IDZA 5JH7E 1KA1A 3T0JA 1LBWA 3JV9A 3SERA 2CHOA 2QS3A 1UTBB 2XXRA 3Q26A 3B6TA 1DPEA 4OVQA 4PE3A 4QFPA 3C4XA 1JW4A 1MIYA 3W15C 2VT5A 2WU2A 4PAIA 2R6GF 2PMSA 2WS3A 1OIBA 5ABEA 1LAFE 4MALA 1B3LA 4MLQA 3ZMZB 3T66A 4P0IA 3T96B 3CG3A 1FJGT 2LHRA 4U4XA 4DCXA 2CWYA 5I3SA 2H89A 5EK3A 2DS9A 2V25A 2XXWA 2AL5A 3RF1A 3C9HA 3FV1A 1O3XA 2HXRA 3C32A 2OWSA 3RH3A 2R9JA 2CBJA 3GN5B 2XWVA 3K1PA 4R72A 3UN6A 4YJ2E 1WCRA 1YAEA 2LEHA 1DCUA 2YPNA 5E0OA 4PDHA 3CSBA 1IUDA 2XWKA 2ZNUA 3KJTA 4H5GA 1KFYA 4ZOLE 5FHNA 5TP9B 4IGRA 3TODA 4OVRA 2H7VC 3HSTA 1N84A 3C33A 1MXZA 4F2QA 5ABHA 5AQOB 1I6ZA 1DU2A 1AH5A 5AE4A 2HEUA 1P1OA 1TT1A 4HTEA 4OFZA 2XXIA 3OO7A 1B2HA 3ZKLA 2E8IA 1XVYA 1OVBA 5J1DA 5HEJA 4DNDA 2WZHA 3ZYKA 2JQQA 2YK0A 4QH1A 4GBVA 1JNRA 5JTYA 3BFTA 4QXBB 2Y84A 2BG9B 3TTKA 1WRDA 3GN5A 4IDPA 2YKSA 1SYIA 2ZNTA 4LMJA 1DBZA 1SQYA 4YTPA 1B3HA 2QVUA 1QVSA 4RNSA 2VKOA 3TUSA 2JQKA 4U2ZA 1PC3A 1SW4A 5I2KB 3FHNA 1HSLA 3W9VA 2MAWA 4B6XA 1P1QA 3RPUA 1B7UA 4MEVA 5LXTE 5JTGA 4GYRA 3OJAA 4F2OA 2H25A 4DIDB 4WZXA 4EYYR 2WU5A 2I48A 4R9GA 2XXHA 3ETUA 4Q5TA 3K1SA 4GXSB 2VKDA 1Y1ZA 5FTIA 4QXCB 1K9ZA 5L9MA 3SWHA 5IZ3B 4EZ4A 2WM9A 5FXWA 3DP6A 3FJGA 4HFDA 4JEHB 5HEGA 4BLAA 4AKLA 3FVNA 1BK4A 2NP9A 3R26A 3O9XA 4RK9A 3KSXA 4HCWA 2FA7A 2K24A 1N04A 4ILCA 2HFBA 2VKHA 2I6HA 2X66A 1EZ3A 2Z23A 1HTJF 3BFUA 2WQYA 2BG9A 4I40A 4UR9A 3RN8A 3B6QA 1UTHA 3SZPA 3EQ1A 3IAZA 2UYFA 1XS5A 3V8XB 3NRXA 5H8QB 2CLYC 5CA0E 1Y3NA 2O51A 1QUUA 3C64A 3EN3A 3H06B 4MHCA 2NWBA 2KINB 1PB8A 4ZXLA 4X5TA 5KMGP 4HEAA 1RKMA 3VXBA 3HL6A 2BS2A 2I0BA 3NBXX 1FEWA 2DWJA 1FTAA 4PFTA 3GLBA 2Z8DA 3N9QA 3MUQA 4MCOA 2YDSA 1M5BA 5TP9A 2H98A 3KN3A 3AB3B 1G0IA 1YXIA 3PUYE 2H99A 5IHYA 2Z8FA 5I59A 5DTBA 4UA8A 3T22A 3ZMUB 2ACZA 2E9XB 1B3GA 5ITPA 5HWXA 1M5CA 3BQIA 3BQKA 1MDP1 4R2FA 2XXQA 3R7XA 2LLYA 2V7JA 2QS4A 2N2NA 3QOFA 5AQHB 3UFEA 1NV5A 2Z8EA 4YMBA 3E79A 5DVFA 2XQ9A 3HCQA 3PUSA 4CXWA 2VPNA 4IE4A 3CMLA 1LLSA 1B52A 3NKZA 1WYBA 2K48A 3PPRA 1ZHCA 4O3BA 3RC3A 3ZC0A 4ZZEA 4X48A 4IE7A 3QAXA 3H6TA 2QVRA 3K2DA 3TFLA 3FJ7A 4POXA 4NF6A 4X62T 3U72A 1ELJA 3RYHE 4EXTA 3PD9A 1BR2A 2XUEA 3Q5EA 3MQ9A 4F3SA 4I55E 2QL3A
chains in the Genus database with same CATH topology
4HE8A 1Z0PA 3Q2MA 3ZN0B 5AA1A 3BK9A 1HG5A 4OHFA 2F97A 1IXGA 3UIFA 1IXCA 2NWJA 1B6HA 1IZNB 1VSOA 2X7QA 4DXCA 1Q35A 4ELPA 2CCQA 4Z0IA 2Q2CA 5AFUL 1D0XA 3A3CA 1Z7ME 4EDPA 3M3KA 3LG7A 1VOMA 4XTCQ 3ZYMA 4NF5B 3UTKA 1MQIA 3VU7H 1O7TA 4TQUQ 3OKQA 2IC9A 3S4UA 1LAGE 1Y9UA 1FTKA 3SEXA 4EIWA 3L6GA 3CR9A 4L5GA 5KDMC 1YKEB 4QFOA 2DSFA 2N1GA 4TLMB 3T9VA 3C51A 3GMIA 3NZQA 3CG1A 2AIXA 2NXOA 2C5IT 2PBWA 5LBQB 1ZIUA 2WAUA 3FUZA 1Y1MA 2ESNA 2HQ0A 2ZM2A 5F3JA 2WMNA 4P0GA 2GRVA 4N13A 1T98A 1N3WA 3N9PA 4MF3A 4PP0A 4MLKA 3SEWA 2YINA 1T0KA 3FXUA 3ZMVB 2NTYA 3N9NA 3PV0E 2OCUA 2Q9QC 2GK9A 2UXNB 3RNNA 1ZKBA 4O8SA 4JWOA 4OQOA 1V9DA 1D4NA 3T9XB 2NOXA 4UEMA 3HN0A 3PGFA 4IO2A 3BKIB 1FQDA 4G8HA 3S9MC 2ODVA 1UTHB 5BMVE 2ZNSA 4F1VA 2L8KA 5LG4A 5DEXA 3PURA 1OLCA 3MAMA 4J2CA 3FATA 1FQEA 4A56A 3UT5E 3FVGA 5DQWA 4HTGA 4ONYA 3LC8A 3TCFA 1QULA 1SW1A 1AOVA 1II5A 1S35A 4H0WA 3VVDA 4N07A 3QC9A 2DP8A 1H43A 3IOVA 3RY3A 3FZVA 1Y3PA 2G0UA 3AAAB 1H44A 3H4ZA 4M1PA 4DBQA 2YEVC 1CB6A 2DXYA 5CI5A 1NH7A 2DVZA 5BWJA 4DMVA 1SBPA 2M67A 5HBCA 4KP3C 3VV5A 4EQBA 2YLNA 1LAHE 5CA1E 4H67A 2MTQA 1DTZA 5I57B 4G68C 2I6EA 4BA9A 1ZV4X 4JEUB 2V7LA 1HFAA 3JC6D 3LJCA 1KWHA 1LAXA 2X9XA 1D1AA 3O4XE 5LHGB 1WODA 2XAHB 5CMMA 3IB2A 3UK4A 4HKAA 3OSRA 3KZGA 5ICTA 3FXQA 1B5HA 1QSDA 1GVCA 4U2RA 3AVSA 1MH3A 2DOJA 2H9BA 1VFDA 4YKJA 2KZ7B 2LOSA 5EHSA 4QFLA 1DTGA 3AA1B 2V3TA 3KN8A 2O7IA 3CFLA 3H03A 3ONMA 4I1DA 4BDNA 4YFSA 1B1XA 3K3NA 2JMHA 2UXXB 3HI2A 4F29A 5DJQC 2CZLA 3WI3A 4UF0B 3HKDE 1VFEA 4ZEBA 1OWAA 3RT6B 2XAGB 3LSFB 3N2OA 4UVAB 3M3FA 3H6WA 4PFWA 3OYZA 3T93B 4MH5A 2DE4A 4FJOA 2I58A 4AB6A 4X1DA 1JQFA 1SI1A 3HR0A 4LONB 4OZ9A 5LOMA 3MPLA 2B65A 4LQ2A 3AAEB 3ANWA 1H76A 2SPCA 2G29A 3AA0B 3E08A 3E22E 4F19A 5I56B 3E0ZA 2YJPA 2Q89A 1US4A 3PE0A 5H8HB 2XX7A 2P9BA 1JVYA 2W62A 2ONRA 3RT8A 3CVGA 3PUQA 3FXDB 4YHJA 4WKMA 3LK42 4ZI2D 2KT9A 1EZOA 3GZGA 4BDLA 2ODUA 3MXZA 4ZEDA 2D21A 4I8CA 3A5XA 3TQWA 1EH3A 5CMCA 4F39A 3H37A 1ANFA 4GLIA 3TTLA 2B3FA 3CFXA 3F57A 4YICA 4JWXA 2K5BB 2V7IA 5HM4B 3K8PC 4JSOA 2RA1A 4H9NC 4JSDA 4QRZA 3PUGA 4GWOA 4GD5A 3KINB 5LBMA 1Q1KA 2VWAA 3TELA 3AA6B 4IGTA 4EOZB 1OXZA 2RC7A 3Q29A 2C0SA 2OBGA 2IC6A 5BUUA 4QKNA 1FQFA 5CRYA 2DHRA 2DE3A 4O3CA 5A5XB 4LZ8A 3LSWA 4F22A 3R84B 2ABHA 3FIRA 1PEBA 4KPTA 4KQPA 5TPAA 4F3GA 3EHSA 5JRCA 3PUXE 5FP3A 3G3GA 3SEYA 1X79A 2X67A 1NKXA 5F1QA 5FY0A 4KCCA 5FXZA 1YW0A 4YKKA 2Q9QB 3Q5WA 5EYFA 2PVUA 1YKHB 1Z7NE 3TMGA 4ZEFA 5KZTA 4G63A 3PMWA 3QUJA 4PK6A 1URGA 3RUMA 2HPLA 4JBZA 4H9PC 2V7KA 4PJMA 1UCUA 3LK3B 2PG8A 2QMWA 4ZS2A 1TFDA 4GXAA 4R6KA 4RPNA 3TPAA 1D0ZA 3RYFE 1MMNA 2BZBA 5FXVA 2LHNA 1A40A 4XKPA 2OK2A 3KG2A 4IO7A 1IEJA 4X1IE 3FBZA 3O66A 1B1HA 3RGYA 4NF4A 2HPJA 1EZPA 4F3BA 3KBRA 1MIVA 2A5TA 2XAFB 2E9XA 1VRBA 2ZYNA 1LB8A 2RKMA 4TN7B 2H4IA 4AQFC 3OYXA 2DWAA 4I9DA 2KMFA 2F7CA 2IA4A 2XXUA 3KDSE 5C8YE 3O28A 3VKHA 3TEPA 2A72A 4LVQA 5L3EB 3Q5XA 1KK7A 2XXPA 4CI1B 3PPQA 3KV6A 5HXEA 4GL0A 1PBPA 2ACXA 1A99A 3OOAA 3IF8B 3C4ZA 2V3QA 1MMDA 3U93A 5H8NB 1A54A 1FQAA 3OEKA 4G77A 3WAEA 4TLLB 3MK7C 2ZM8A 1IJ6A 4U22A 2LAOA 3H6VA 3PD8A 2Y7RA 3TTRA 2D3IA 3L09A 2QPQA 5CBRA 1NAFA 3MJXA 2DWHA 2CM0A 2NUVA 4LQ5A 4CXYA 4O3AA 2OWTA 1MNDA 3IO6A 2C5JA 3TKDA 2LSKA 5IYZE 4PNIA 2K9AA 5L3CB 3RC8A 1B5IA 4LZ7A 3U8QA 5EK4A 2H7OA 3EHTA 4AKHA 1A55A 2UVGA 1JVXA 5FHMA 1MY1A 1WVJA 3MWBA 3CX6B 4G8NA 3ZC1A 1PBQA 1TWYA 3QSLA 4PFYA 4Q8RA 4H9OC 4H9QC 1U4QA 4PJLA 2X0LB 3PUVE 3UORA 1USYH 1FQBA 2ZYMA 1MMAA 1D9YA 2LSGA 3B13A 5I2NA 4P0BA 4YMAA 5JDQA 1AJ3A 4FJPA 4GIZA 3IR1A 4H6DA 1FTMA 4UVCB 4IGUA 1LBBA 3UUNA 5TPAB 3KJ7A 2VD3A 2CA5A 4WBOA 3K02A 3EDVA 5LGNB 4V1Av 3Q28A 1MXXA 3HKEE 1IITA 4I43B 2IEEA 4XAXB 4ADZA 4IB2A 1Y3QA 4WBNE 2RCAA 2KLFA 2X68A 2O6AA 3PPOA 4JWYA 3VXCA 3RLFE 1HCIA 3WAFA 5ISUA 3C35A 4YKPA 3F2EA 3MVYA 5H8FB 1B05A 4M4GA 3S9LC 1PB7A 4ELOA 2XAQB 5TU0A 2H5YA 4PAGA 1N7WA 2V7MA 3CPZA 2NVUB 3CIJA 4X1YE 4AKGA 3TZAA 1UIVA 4IIJE 4UIGA 1BR0A 5AA2A 3VVEA 3N94A 3DLNA 5H8FA 3VLUA 1JETA 1HX8A 5EHMA 1O64A 1B4ZA 1HSJA 4TZ4C 4EB6E 1M5EA 5J2UE 5LGUB 3FJMA 2O1MA 4KHZE 2OA5A 3PTRB 4U4SA 3ZCJA 4ZI3D 3PUAA 4XXUA 4E0WA 4HFVA 1B0LA 2I0CA 4PW8A 4O4LE 4LA9A 4NF5A 2Y7WA 1WR6A 3H3GA 4HCYA 4OMBA 3K3QC 4ELQA 2W0GA 2Y48B 2XAJB 1B9JA 1HSEA 5JREA 4O2AE 3O6GA 2X26A 5LP6E 1US7B 2P2AA 2IAKA 2XASB 5I2KA 5B70A 2RCBA 1J1NA 3FD3A 4F1UA 3R6UA 1MNEA 4DO0A 5L3FB 1IQ7A 4R2BA 2P1SA 4IO5A 4EUOA 4PK4A 4U1OA 2V84A 5JR9A 4ELRA 3D4GA 3ONXA 2WKYA 2F6PA 2RINA 1AIVA 1S9TA 2CXFA 3M8UA 2XXTA 3PMXA 1FMVA 4DBRA 1RYOA 2DWKA 2LSJA 2VL8A 2X9HA 4G68A 3IB0A 5K2YA 4I50E 4ZECA 1MS7A 1I6BA 4BDRA 1IXHA 1TXFA 2F35A 1QW0A 3KV4A 2ZXTA 4F18A 3N2KE 4C1TA 5I59B 2ZMAA 3T8OA 3O6HA 4NWDA 3RTWB 1BTJA 3Q25A 3N5LA 1NNTA 4NF8B 1B3FA 3P7IA 4OYVA 4I62A 5JDLA 4F6RC 2D0TA 3QUFA 1N7XA 4NF4B 2W63A 1M5DA 5JDNA 2RF1A 3ZMTB 1IXIA 1URDA 1QKAA 4BDOA 5HYAA 5LYJE 4HS7A 5H8QA 5M4YA 2W7YA 2NW8A 2HZKA 4DIGA 2P0SA 4PQJA 4XKRA 3ZYLA 4Z8XA 2Y7KA 4GK5E 5H8HA 4EXKA 4FORA 3ZSFA 3ZMSB 5KDTB 2I59A 4XKNA 3K6VA 5JDMA 3MVZA 2A5TB 5I56A 2VB6A 1YTVA 5FTHA 1SVXB 4OEUA 2AYSA 4IO3A 3TTNA 2C5KT 2I4BA 4GVOA 3BBRA 5KDTA 3ECRA 4QX8B 2VD2A 3E3KA 1D3KA 3MZBA 4XIGQ 1R6ZA 4EQ7A 5AA3A 4YB6A 1B5JA 3HHFA 4ESWA 5LCYA 3FBLA 2Q9QD 3HA4A 3G7WA 4QSEA 1I6QA 1BLFA 2QS1A 1SA0E 5H6RB 5LHHB 4ZI7E 3PUZE 4EYUA 4OERA 4QXHB 3KGCA 3K6UA 1SD3A 4U74A 2LOPA 2UVIA 5CMKA 1HF8A 4O2BE 4DVDA 3OMBA 4R73A 5GONE 4NEDA 1MDQA 5F7VA 4R9FA 3QIMA 1FW0A 5L9OA 4KCDA 3K6XA 5I57A 1MXUA 2JPFA 1MQDA 3K6WA 4UVBB 2KNDA 2LSYA 2XXYA 2O84X 2XTLA 1JEUA 5ITOA 2Z6EA 4KYDA 4YZZA 2MBGA 4YAHX 3I1AA 1XT8A 4EAHA 3G3IA 1D9VA 2FYIA 2A3DA 2EHOD 4JDFA 2L3LA 3LSLA 3QXMA 4KYSA 3V5SA 1ZTYA 3I3VA 4ND9A 1MIWA 2V3UA 3SKPA 3FVKA 1DMBA 1QUIA 4TX5A 1FTLA 2QJEA 1XOCA 2LJLA 5L2LA 2Q2AA 4GQOA 3GBAA 1BP5A 3G3FA 2R71A 1IIWA 4NWCA 3FB2A 3ZKKA 2G93A 3GA8A 4ZDMA 1JEVA 1QKBA 4ESXA 2I3WA 1RYXA 1NFTA 1ZU0A 3MPKA 4BJNA 1B40A 4NE4A 3LSXA 3OELA 2PBIA 3MW0A 4MBQA 4E7SA 1YPNA 4TOZA 4UV8B 3KOTA 2VK9A 3RRWA 5EK2A 3C50A 3IOWA 3CKDA 4LZ5A 1S7YA 2F7AA 5JDHA 5HXRA 1L5TA 3KOSA 3K4UA 3F11A 2QRYA 5KX5E 5ICQA 3ZJ2A 5L3GB 4ZI3C 3C31A 3R6NA 2XHEB 2HCAA 2JRKA 1XC1A 4ISUA 2A5SA 3AA7B 2RC8A 2XXXA 1NNFA 4AQGA 2Y7PA 3DM0A 4H8JA 1YCJA 1VR5A 3MACA 3RYIE 4DXUA 1HG2A 1EZ9A 4X20E 3KBTA 4GRKA 5FNVE 2PX1A 2WBLA 5LJNA 2O7UA 3SEUA 3MVXA 3A09A 3K01A 3ZJ1A 4L17A 3L3PA 2ANJA 2CEAA 1DOTA 1H45A 3RTFB 4RYAA 5JEIA 3E4RA 3KFWX 3KVAA 5DABA 1H7CA 3SDFA 4GOUA 2HXWA 5K2XA 4QSDA 3W9WA 4C91A 1PDAA 1A8FA 3U78A 3TKLB 3ODBA 3P8CD 5ELVA 3UA8A 2LE8A 4MFRA 3KBUA 3PU5A 4R75A 4MBPA 3TCGA 1VE4A 1M5FA 3KV5A 4OESA 3C34A 2WWUA 4AQFA 4WXJA 4YLHA 5JVDE 3I6VA 3KEIA 5L3BB 5L8DA 3G3JA 2OLBA 5IKBA 3IX1A 3PPPA 2ONSA 1CE2A 1ZEEA 4IE0A 1JW5A 2DNXA 3CWZB 2CWOA 2THIA 4F3PA 1MXYA 2YU2A 4EF2A 4CI2B 4G2AA 3K1MA 3O2AA 1LVFA 3OO9A 3H6UA 4QHQA 3S2VA 3N26A 1P1NA 2V1DB 1GR2A 4XKQA 3MZKB 1UQWA 2VASA 4RK2A 1FTOA 2DWGA 2M8CA 4PJJA 2F78A 3FXEB 3E9XA 1E1HB 2Z22A 4OENA 2JMKA 4PJNA 1B7HA 3U92A 3Q9DA 2DLRA 3LBXB 3GBBA 2HZLA 3OSQA 3O9PA 1G73A 3ZN1B 2AL4A 4GIWA 4H9SE 3D4CA 2CMRA 5CMBA 3SOLA 3MP6A 4PFPA 1EU8A 1B7ZA 5H8NA 3K1NA 5LGTB 1A7LA 4IE6A 2D0UA 3NRYA 5DYHA 1AMFA 5FXXA 3HV1A 3EPEA 1D0YA 2VHAA 3MZ1A 3MA9A 4GK0E 5CM6A 4RXLA 3RQTA 3N9LA 3I9WA 2UVJA 4FIMA 4RJZA 4ZE8A 2I4CA 3SETA 1BR4A 1D1BA 4KBMB 2F34A 4KYEA 1XVXA 4OFOA 3CQCB 2ZM0A 5I58A 4CXXA 1URSA 2DQVA 4AI6A 2VKJA 3CX8B 2ZLYA 4R6YA 5AA4A 5TAOA 1R9QA 2DVCA 3HPIA 3RRCA 3LBSA 4FI5A 1Y64B 4M1VA 2XD3A 3VDFA 3N2GE 3T9UA 1MPDA 5F8PA 2ALUA 4G4PA 4QFKA 3OO6A 5IAIA 1S94A 4XBFB 4POWA 2EHOC 5L3DB 1OQGA 3VLVA 4BDMA 2X7PA 1B46A 2L9QA 4ILUA 5H8SA 4WEDA 3H7MA 3TQLA 4MFIA 3DTOA 3B7DA 3KN7A 2PFVA 2PJQA 2V26A 4NF6B 2DE2A 4CI3B 4ANJA 4AB5A 3FXRA 4DMWA 5JDFA 3CQXC 3CSGA 4X9TA 4CZZB 4CQIA 5CBSA 2F8DA 5DVIA 1P1UA 4WEPA 3FVOA 4JUYA 1KNZA 4YJ3E 2OJTA 3IEEA 4ISSA 3DP7A 5JQGE 5A5XA 1LFIA 3PPNA 3KVBA 4LATA 4QSCA 1MM7A 3O1JA 4XZCA 1NH8A 5KCJB 3S9EA 3K0VA 2ZMBA 4QX7B 2NW7A 1MXWA 4G8MA 3C98B 2XX8A 5HXHA 3LBXA 1WLXA 3VKGA 3IO4A 1MY0A 3PU8A 1UTBA 3MJNA 2CE7A 3WAJA 4H63V 4LP2B 4YU0A 3EVYA 2HAUA 3IORA 2XHDA 4Q30B 2D5UA 2PT2A 1MY4A 4WW0A 4X1BA 2PYYA 3MP8A 3DJBA 3JZJA 4H8IA 2LSIA 1MH4A 3AXFA 3OENA 4JB7A 3TAJA 4AXPA 4UXNB 1LGBC 4QHOA 5LOVE 4ASKA 3U94A 2EHOA 3CFZA 2O68A 4FECA 4OK0A 5DT6A 3OXNA 1A8EA 1BKAA 1SYHA 4G2ZA 4UF0A 4AKRB 1MQGA 4GF8A 2E1SA 5M2VA 2WMOA 1ZJLA 4N6PA 4ZEKA 1NNPA 4ECFA 4KMCA 5LHIB 5LNKA 1GV8A 4DE8A 1Y20A 2X9YA 2PT1A 4H63H 4TV8E 4TV9E 3JC6C 1LSTA 2Y8DA 1QJMA 5KCJA 4H5FA 2DYXA 3SRZA 1LFGA 1FMWA 4NF8A 1QUJA 3Q27A 4YB7A 2BVLA 4H1XA 3ZCIA 1NWMX 3ILUB 5HAXA 3GXAA 1BIYA 2GHBA 3HKBE 4IY6A 3D0TA 1H3DA 5ETWA 3U3IA 3L6HA 3MKDA 5FY1A 3TTMA 4DLDA 4L0RA 1PB9A 2ONKE 4DCYA 4DZ1A 1FQCA 1SW5A 4U1ZA 3VHLA 1R1NA 4O4IE 4OYKA 4PETA 3UUMA 2XXVA 1HS7A 3IB1A 2N9DA 1DSNA 4H9RC 2CLYB 3EHUA 3IOUA 4EXLA 3MZ9A 2OZZA 4R74A 3VVFA 3C36A 1IJ5A 5JDGA 3I0OA 3UULA 4GOTA 3O29A 5DVJA 1ZBMA 4OTEA 3MC2A 2YU1A 4EQ9A 4EZHA 2Q8JA 3AAIA 2HH7A 5LA6E 3N6TA 1MRPA 4IE5A 4O4JE 4NUVA 4X1KE 5JR9B 4U21A 2B1EA 4C90A 4ZEIA 1F9BA 1MPBA 4IO4A 2NOOA 4P11A 5DQVA 3E13X 4HW8A 4KR5A 5ADXL 1OVTA 2E9XC 4GYSA 4ISTA 4DXBA 1US5A 5L9SA 2WSSV 3KV9A 3A3UA 3F31A 4PFUA 4Z7EA 3SESA 1B51A 3THIA 3SS1A 3DELB 4H65A 4WNKA 2I3VA 3ESLA 3MP1A 3PUWE 1TFAA 4NMYA 2BVMA 2QSXA 4DDDA 1JNFA 4ZHQE 3O97A 1LFHA 5AA2B 3WAKA 3T9HB 4FEDA 4NUUA 2XQYA 1D1CA 4KD5A 4YKIA 3QK6A 3FASA 1ZKEA 3MVWA 5JK4A 3B6WA 1LRZA 2A2FX 4PE5B 5HXSA 1O63A 3NZPA 2QMXA 1B3EA 5I84A 4GFRA 2RP4A 1POY1 1GTKA 1LBCA 3PU3A 2V93A 4UELA 3ZEFB 4KFQA 4OYJA 2REJA 1B4HA 3UGWA 3C4WA 4UACA 1MQJA 4FE8A 4KI0E 3J7Yq 1ZLQA 4RA1A 2X9WA 3QYTA 3N6UA 1OLAA 1DPPA 3I5OA 2B3BA 1B32A 3KSJA 3CX7B 3RKOA 4NTLA 4GL8A 2E0SA 3HO7A 1SHZC 1IZ1A 5I2NB 4OHNA 1AL3A 4OFJA 5AA4B 4FATA 2W61A 3EF7A 3DP8A 1ZMGA 2CMOA 3VFJA 3LFMA 2GH9A 4JLEA 4L9IA 4FEBA 4ZS9A 2UYEA 2I49A 4K3FA 1N0TA 1G8XA 1JW1A 2VOZA 4R6HA 1QUKA 3IL1B 3AVRA 4RPOA 2VGQA 3IHRA 3BQLA 3W15B 2IW5B 2UXAA 4U72A 1S50A 1MM6A 1LB9A 5J2TE 5CB4E 2DXRA 1OQHA 3O6IA 3ANWB 5HXCA 1CUNA 3PMVA 1P99A 3EUHA 2LM9A 2MOZA 3ZPOA 3PDYA 4JXIA 2KWHA 5A1LA 1B7TA 2ZYOA 3OO8A 5EZYE 3KFMA 4O4HE 5LJMA 1Y4CA 5CC2A 3EDUA 2R6GE 4BDQA 2CXLA 2NTXA 2O69A 1FCKA 5DEXB 4AQ4A 1MY3A 2RC9A 4ZS3A 3ZLIA 1WYCA 3C4MA 2CXDA 3CI8A 1NMUA 1B0HA 4QFNA 3H3AA 1OMPA 4OEVA 3IK6B 3I9YA 2Y6XA 3USDA 4TUYE 3VLWA 4F31B 1P1WA 2F36A 4OVJA 1MQHA 1POTA 1XHYA 1MG1A 5HWYA 1Y4TA 2D2SA 3U1OA 2BDEA 4ZI2C 3CQGB 2Q88A 4ZE9A 3V5UA 1LCFA 4Q0CA 3N9MA 4G68B 1I6AA 3G3HA 3O1IA 4FAJA 4HN9A 2QS2A 5J1GA 2XX9A 3SEVA 3IJXB 3CVRA 1SDXA 2XD2A 3V5AA 2BJJX 3LUYA 1WDNA 1YD8G 2F7BA 3DP4A 2KXPB 5FY7A 4PK5A 1UX5A 5B7DA 2D5WA 3HKCE 1B58A 3J9X1 4LUBA 1LCTA 2Y7IA 3TYHA 5FMNA 4N78D 4ZZAA 3IOTA 1UIUA 1ATGA 2O1LA 1MMGA 5JR9C 4OETA 4C0RA 2ES0A 2Q9QA 3O1HA 4E7ZA 2KLQA 5HPQA 2Q9TA 4ERRA 3MBPA 3K00A 3ETVA 2GFEA 5JRCB 2H3RA 4OWDA 1USYE 3IBPA 5FYMA 2J1DG 1NNKA 3B57A 1UX4A 1SI0A 3FV2A 3TDJA 4THIA 4I4TE 3FGSA 2JJ9A 4IHJE 1MY2A 4EF1A 4YB5A 1N76A 2W00A 2UVHA 5JTYB 3ILTB 4QF9A 2E9XD 4P09A 4C1UA 1SW2A 1FTJA 1MPCA 3K3OA 2VP1A 4K0UA 2LT3A 2X51A 1BR1A 4E0XA 2REGA 2FNCA 4HGAA 4OFLA 3RX6A 4IO6A 2MYSA 3UP9A 4BJMA 2NW9A 1I69A 3TCHA 1MXVA 2KWIB 4F1YA 3OBVE 4UV9B 2DWIA 3UUXB 3M3LA 3HHGA 2F5XA 1GGGA 1IAPA 2QA7A 1LKXA 4OXVA 5AA2D 3OEMA 2F6GA 1N3XA 3G3KA 3OD7A 1NL5A 2HAVA 2EHOB 4AKIA 4P0AA 3I0QA 4PFOA 3S9NC 4BAYB 3IJOB 1FIOA 2DCFA 3N9OA 2GHAA 3M65A 3LR1A 3CRBA 3VE1B 1LVKA 5FHOA 3GWHA 1U5PA 4IY5A 3V83A 4RY1A 4KUMB 2ZYKA 5H6QB 2QGSA 5I58B 3JYRA 2DI4A 3RYCE 1R9LA 3RPWA 4QWNB 3ZS6A 4MLVA 3V89B 3LK2B 4IDZA 5JH7E 3JV9A 3SERA 2QS3A 1UTBB 2XXRA 3Q26A 3B6TA 1DPEA 4QFPA 3C4XA 1JW4A 1MIYA 3W15C 2PMSA 1OIBA 1LAFE 4MALA 1B3LA 4MLQA 3ZMZB 3T66A 4P0IA 3T96B 3CG3A 2LHRA 4U4XA 4DCXA 2CWYA 5EK3A 2DS9A 2V25A 2XXWA 2AL5A 3FV1A 3C9HA 4U23A 1O3XA 3C32A 2OWSA 3RH3A 2R9JA 3GN5B 3K1PA 4R72A 3UN6A 4YJ2E 1YAEA 2LEHA 2YPNA 5E0OA 3CSBA 1IUDA 2ZNUA 3KJTA 4H5GA 4ZOLE 5FHNA 5TP9B 4IGRA 3TODA 2H7VC 3HSTA 1N84A 3C33A 1MXZA 4F2QA 1AH5A 5AE4A 2HEUA 1P1OA 1TT1A 4HTEA 4OFZA 2XXIA 3OO7A 1B2HA 3ZKLA 2E8IA 1XVYA 1OVBA 5J1DA 4DNDA 3ZYKA 2JQQA 2YK0A 5JTYA 3BFTA 4QXBB 2Y84A 3TTKA 1WRDA 3GN5A 1SYIA 2ZNTA 1SQYA 1B3HA 1QVSA 4RNSA 2VKOA 3TUSA 1PC3A 1SW4A 5I2KB 3FHNA 1HSLA 3W9VA 4B6XA 1P1QA 3RPUA 1B7UA 5LXTE 4GYRA 3OJAA 4F2OA 2H25A 4EYYR 2I48A 4R9GA 2XXHA 3ETUA 4Q5TA 4GXSB 2VKDA 1Y1ZA 5FTIA 4QXCB 5L9MA 3SWHA 4EZ4A 2WM9A 5FXWA 3DP6A 3FJGA 4JEHB 4BLAA 4AKLA 3FVNA 2NP9A 3R26A 3O9XA 4RK9A 3KSXA 4HCWA 2FA7A 2K24A 1N04A 2HFBA 2VKHA 2X66A 1EZ3A 2Z23A 1HTJF 3BFUA 3RN8A 3B6QA 1UTHA 3EQ1A 3IAZA 2UYFA 1XS5A 3V8XB 3NRXA 5H8QB 2CLYC 5CA0E 2O51A 1Y3NA 3EN3A 3C64A 1QUUA 3H06B 4MHCA 2NWBA 2KINB 1PB8A 5KMGP 4HEAA 1RKMA 3VXBA 3HL6A 2I0BA 3NBXX 1FEWA 2DWJA 4PFTA 3GLBA 2Z8DA 3N9QA 3MUQA 1M5BA 5TP9A 2H98A 3KN3A 3AB3B 3PUYE 2H99A 5IHYA 2Z8FA 5I59A 5DTBA 4UA8A 3T22A 3ZMUB 2E9XB 1B3GA 5ITPA 5HWXA 1M5CA 3BQIA 3BQKA 1MDP1 4R2FA 2XXQA 3R7XA 2V7JA 2QS4A 2N2NA 3UFEA 2Z8EA 4YMBA 5DVFA 3HCQA 3PUSA 4CXWA 4IE4A 3CMLA 1LLSA 1B52A 1WYBA 2K48A 3PPRA 1ZHCA 4O3BA 3RC3A 3ZC0A 4ZZEA 4X48A 4IE7A 3QAXA 3H6TA 3K2DA 3TFLA 3FJ7A 4POXA 4NF6A 3U72A 1ELJA 3RYHE 4EXTA 3PD9A 1BR2A 2XUEA 3MQ9A 4F3SA 4I55E 2QL3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z0P A;  2GH9 A;  1A55 A;  2UVG A;  3PU5 A;  4FEB A;  1JVX A;  2I49 A;  2UYE A;  1N0T A;  4K3F A;  4MBP A;  4R75 A;  1JW1 A;  2VOZ A;  5FHM A;  5AA1 A;  3TCG A;  1VE4 A;  1M5F A;  1MY1 A;  1WVJ A;  4R6H A;  3MWB A;  1QUK A;  2F97 A;  3C34 A;  4OES A;  1IXG A;  3UIF A;  3IL1 B;  4RPO A;  4WXJ A;  1IXC A;  2VGQ A;  4G8N A;  3I6V A;  2NWJ A;  1B6H A;  3KEI A;  1PBQ A;  2UXA A;  1TWY A;  1VSO A;  2X7Q A;  3QSL A;  4PFY A;  3G3J A;  5L8D A;  2OLB A;  4Q8R A;  4DXC A;  5IKB A;  3IX1 A;  3PPP A;  3PUV E;  2ONS A;  1Q35 A;  1S50 A;  3RTW B;  1MM6 A;  1CE2 A;  1USY H;  3UOR A;  1LB9 A;  1FQB A;  4Z0I A;  2Q2C A;  2DXR A;  2ZYM A;  4ELP A;  1D9Y A;  1JW5 A;  1OQH A;  3A3C A;  1Z7M E;  3O6I A;  4EDP A;  3PMV A;  1P99 A;  3M3K A;  4XTC Q;  5I2N A;  4NF5 B;  2THI A;  4JXI A;  4YMA A;  4F3P A;  1MQI A;  4FJP A;  2KWH A;  1O7T A;  2ZYO A;  4GIZ A;  1MXY A;  3OO8 A;  3IR1 A;  4H6D A;  4TQU Q;  4EF2 A;  1FTM A;  2IC9 A;  3O2A A;  3S4U A;  1LAG E;  3K1M A;  1LVF A;  1LBB A;  3KFM A;  3OO9 A;  3H6U A;  1Y9U A;  1FTK A;  1Y4C A;  3KJ7 A;  3N26 A;  4QHQ A;  5TPA B;  3S2V A;  3SEX A;  2VD3 A;  2CA5 A;  1P1N A;  5CC2 A;  3K02 A;  1GR2 A;  2R6G E;  3L6G A;  4XKQ A;  1UQW A;  3CR9 A;  4BDQ A;  3Q28 A;  4RK2 A;  2O69 A;  1MXX A;  1FCK A;  4QFO A;  5DEX B;  1FTO A;  1IIT A;  4AQ4 A;  2IEE A;  2DSF A;  2M8C A;  4TLM B;  1MY3 A;  2RC9 A;  3T9V A;  2F78 A;  3E9X A;  3FXE B;  4IB2 A;  1Y3Q A;  2Z22 A;  4OEN A;  2RCA A;  2KLF A;  3CG1 A;  2O6A A;  3C4M A;  1B7H A;  2AIX A;  2NXO A;  3U92 A;  2C5I T;  3CI8 A;  1NMU A;  3GBB A;  3PPO A;  2PBW A;  4JWY A;  2HZL A;  3OSQ A;  3O9P A;  1B0H A;  3RLF E;  3VXC A;  1ZIU A;  4QFN A;  2AL4 A;  3WAF A;  3FUZ A;  5ISU A;  3C35 A;  4YKP A;  3MVY A;  1Y1M A;  2ESN A;  1OMP A;  5H8F B;  1B05 A;  4OEV A;  3D4C A;  2HQ0 A;  4M4G A;  3IK6 B;  3S9L C;  1PB7 A;  4YKJ A;  5CMB A;  3USD A;  4ELO A;  4P0G A;  5TU0 A;  2GRV A;  4N13 A;  2H5Y A;  3MP6 A;  3VLW A;  1EU8 A;  4F31 B;  1N3W A;  1P1W A;  1N7W A;  2F36 A;  4OVJ A;  1MQH A;  1B7Z A;  1POT A;  3K1N A;  5H8N A;  4MF3 A;  4PP0 A;  1XHY A;  1MG1 A;  3CIJ A;  2NVU B;  3SEW A;  1A7L A;  3FXU A;  1T0K A;  1Y4T A;  5DYH A;  1AMF A;  3PV0 E;  3HV1 A;  3EPE A;  3TZA A;  1UIV A;  2OCU A;  5AA2 A;  3U1O A;  2Q88 A;  3VVE A;  4ZE9 A;  3N94 A;  3DLN A;  4Q0C A;  1LCF A;  1ZKB A;  3RNN A;  5H8F A;  4G68 B;  4JWO A;  2VHA A;  1I6A A;  3MZ1 A;  4OQO A;  3VLU A;  3G3H A;  1JET A;  5CM6 A;  5EHM A;  1D4N A;  3T9X B;  4FAJ A;  2QS2 A;  1O64 A;  2XX9 A;  3HN0 A;  3PGF A;  1B4Z A;  1HSJ A;  4RXL A;  3IJX B;  3CVR A;  1SDX A;  2XD2 A;  3RQT A;  3SEV A;  3V5A A;  2BJJ X;  4IO2 A;  1M5E A;  1WDN A;  2UVJ A;  3BKI B;  1FQD A;  3LUY A;  4FIM A;  4G8H A;  4RJZ A;  3FJM A;  4ZE8 A;  2O1M A;  2F7B A;  2I4C A;  4KHZ E;  1UTH B;  4F1V A;  2ZNS A;  4U4S A;  3DP4 A;  3SET A;  5DEX A;  2F34 A;  4ZS9 A;  4KYE A;  1OLC A;  1XVX A;  4XXU A;  4E0W A;  1B0L A;  2I0C A;  3MAM A;  4NF5 A;  4LA9 A;  4OFO A;  5B7D A;  4J2C A;  2D5W A;  2Y7W A;  1FQE A;  3FAT A;  1B58 A;  3H3G A;  5I58 A;  3FVG A;  1URS A;  4HCY A;  4HTG A;  4LUB A;  1LCT A;  4OMB A;  4ONY A;  2Y7I A;  3LC8 A;  3TCF A;  1QUL A;  1SW1 A;  4ELQ A;  1II5 A;  2DQV A;  3TYH A;  1AOV A;  4H0W A;  4R6Y A;  3VVD A;  4N07 A;  1B9J A;  5AA4 A;  1HSE A;  2DP8 A;  5KCJ A;  1H43 A;  3IOV A;  3O6G A;  1R9Q A;  2DVC A;  3HPI A;  3LBS A;  4ZZA A;  3IOT A;  3FZV A;  3RY3 A;  1UIU A;  2X26 A;  1Y3P A;  4FI5 A;  1ATG A;  2G0U A;  4M1V A;  2O1L A;  1H44 A;  2P2A A;  5I2K A;  3H4Z A;  2XD3 A;  3VDF A;  5B70 A;  4OET A;  3T9U A;  4C0R A;  2RCB A;  1MPD A;  2ALU A;  1J1N A;  4G4P A;  4QFK A;  1CB6 A;  2DXY A;  3FD3 A;  4F1U A;  5HPQ A;  3OO6 A;  3R6U A;  1NH7 A;  2Q9T A;  5CI5 A;  5IAI A;  2DVZ A;  1IQ7 A;  5BWJ A;  4R2B A;  1SBP A;  2P1S A;  3MBP A;  4POW A;  5HBC A;  1OQG A;  3K00 A;  4IO5 A;  3VLV A;  4EUO A;  3VV5 A;  4BDM A;  4U1O A;  2X7P A;  1B46 A;  2GFE A;  4EQB A;  2YLN A;  1LAH E;  2V84 A;  4OWD A;  4WED A;  1USY E;  3H7M A;  5H8S A;  4ELR A;  3D4G A;  4H67 A;  2WKY A;  1DTZ A;  2F6P A;  2RIN A;  3B7D A;  3KN7 A;  1NNK A;  4MFI A;  3TQL A;  1AIV A;  1S9T A;  5I57 B;  4NF6 B;  4G68 C;  1SI0 A;  3FV2 A;  2I6E A;  2DE2 A;  3TDJ A;  4AB5 A;  3FXR A;  2XXT A;  3M8U A;  3PMX A;  4THI A;  3FGS A;  1RYO A;  1MY2 A;  5K2Y A;  4G68 A;  3IB0 A;  4EF1 A;  3CSG A;  4X9T A;  1KWH A;  4CQI A;  1LAX A;  2X9X A;  1N76 A;  1WOD A;  4YB5 A;  4ZEC A;  1MS7 A;  1I6B A;  2UVH A;  5CMM A;  1IXH A;  1TXF A;  3ILT B;  2F8D A;  3IB2 A;  2F35 A;  1P1U A;  4QF9 A;  4WEP A;  1QW0 A;  2ZXT A;  3OSR A;  3KZG A;  3FVO A;  5DVI A;  4C1U A;  3FXQ A;  4F18 A;  5ICT A;  1B5H A;  1SW2 A;  4C1T A;  1QSD A;  5I59 B;  1GVC A;  4U2R A;  2OJT A;  1FTJ A;  1MH3 A;  3O6H A;  1MPC A;  2DOJ A;  1VFD A;  2H9B A;  2VP1 A;  1BTJ A;  3Q25 A;  1LFI A;  3N5L A;  1NNT A;  2FNC A;  2REG A;  3PPN A;  4NF8 B;  1B3F A;  3P7I A;  1DTG A;  2V3T A;  3KN8 A;  4I62 A;  2O7I A;  3CFL A;  4LAT A;  1MM7 A;  4OYV A;  4QSC A;  1NH8 A;  5EHS A;  3QUF A;  3K0V A;  5KCJ B;  2ZMB A;  4OFL A;  3S9E A;  3H03 A;  4IO6 A;  3ONM A;  4I1D A;  3UP9 A;  1MXW A;  1N7X A;  4BDN A;  4NF4 B;  1I69 A;  1M5D A;  4G8M A;  2XX8 A;  3TCH A;  2RF1 A;  1B1X A;  1IXI A;  1URD A;  2KWI B;  1MXV A;  4F1Y A;  1QKA A;  4BDO A;  2DWI A;  4F29 A;  3M3L A;  3HHG A;  3IO4 A;  2F5X A;  4HS7 A;  1GGG A;  1MY0 A;  1VFE A;  2CZL A;  5H8Q A;  5JEI A;  4ZEB A;  3RT6 B;  1UTB A;  2W7Y A;  3LSF B;  2HZK A;  4OXV A;  3MJN A;  3OEM A;  4DIG A;  2P0S A;  3M3F A;  3H6W A;  2F6G A;  4PQJ A;  4XKR A;  5AA2 D;  1N3X A;  3G3K A;  3OD7 A;  1NL5 A;  4LP2 B;  4YU0 A;  2Y7K A;  2HAV A;  2HAU A;  3IOR A;  4FOR A;  5H8H A;  2XHD A;  4PFW A;  3ZSF A;  4Q30 B;  4EXK A;  3T93 B;  3S9N C;  3IJO B;  4MH5 A;  2DE4 A;  5KDT B;  2I58 A;  4XKN A;  2PT2 A;  4AB6 A;  2GHA A;  1MY4 A;  3K6V A;  4X1D A;  1JQF A;  1SI1 A;  4LON B;  4OZ9 A;  5I56 A;  3MVZ A;  2A5T B;  3MPL A;  5LOM A;  3LR1 A;  4X1B A;  2B65 A;  3S9M C;  3CRB A;  4LQ2 A;  1YTV A;  5FTH A;  2PYY A;  3VE1 B;  5FHO A;  3MP8 A;  1H76 A;  4IY5 A;  1SVX B;  3JZJ A;  3V83 A;  4H8I A;  2G2