3QK6A

Crystal structure of escherichia coli phnd
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
308
structure length
304
Chain Sequence
KALNFGIISTESQQNLKPQWTPFLQDMEKKLGVKVNAFFAPDYAGIIQGMRFNKVDIAWYGNLSAMEAVDRANGQVFAQTVAADGSPGYWSVLIVNKDSPINNLNDLLAKRKDLTFGNGDPNSTSGFLVPGYYVFAKNNISASDFKRTVNAGHETNALAVANKQVDVATNNTENLDKLKTSAPEKLKELKVIWKSPLIPGDPIVWRKNLSETTKDKIYDFFMNYGKTPEEKAVLERLGWAPFRASSDLQLVPIRQLALFKEMQSVKDNEQDKLAKTTAIQAQLDDLDRLNNALSAMSSVSKAVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Escherichia coli Phosphonate Binding Protein PhnD and Rationally Optimized Phosphonate Biosensors.
pubmed doi rcsb
source organism Escherichia coli uti89
molecule tags Transport protein
molecule keywords PhnD, subunit of alkylphosphonate ABC transporter
total genus 103
structure length 304
sequence length 308
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12974 Phosphonate-bd ABC transporter, phosphonate, periplasmic substrate-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.90 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3qk6A03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3qk6A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3qk6A02
2H99A 3CR9A 3ONMA 4ELQA 2ONSA 1MQIA 1A7LA 3O6HA 1MY2A 4R73A 5HM4B 1Y20A 2F8DA 3KN3A 3FUZA 4RK2A 4OENA 3CRBA 2Y7WA 4NF6B 2REGA 4OFOA 4EUOA 4F3BA 4U23A 1I69A 3IO4A 1B4HA 1ZIUA 3U72A 2THIA 3EN3A 2HAVA 2I6EA 2QS4A 2X9WA 1XHYA 5L9SA 2XTLA 3FJMA 4G68A 4R74A 4OYVA 1LCTA 1MQGA 3KZGA 3MPLA 4PFTA 3KOSA 3B6TA 4QFOA 4XXUA 1MY1A 1Y9UA 1P1UA 3P7IA 2GRVA 3K01A 3KJ7A 4PFUA 3Q26A 1Y1ZA 4I62A 4ZE9A 3E4RA 4KYDA 2R71A 3A3CA 3PMVA 5EHSA 1S50A 4ZEBA 3IB2A 3TKDA 2UVIA 4NF4B 3OENA 2H98A 4G77A 1B51A 1RYXA 1WVJA 2OWSA 2DP8A 3K6UA 3ZS6A 4JSDA 3VVDA 4C1UA 1ZMGA 2E0SA 4GVOA 4F22A 1B6HA 1USYH 3O6IA 2GFEA 1QVSA 2CZLA 2I49A 2V84A 2I0CA 4KYEA 1PB8A 1ZKBA 3CFLA 4UACA 1GR2A 1Z0PA 1LFGA 1B05A 1P1WA 4KPTA 3HN0A 4EDPA 3JZJA 4UA8A 2XD2A 3KSXA 1Z7ME 3UA8A 2DQVA 3HPIA 3N6TA 3MAMA 1S7YA 1TFAA 4MLVA 1N7WA 3K1NA 4RXLA 2B65A 5IKBA 3QUFA 3FASA 3T9VA 4F39A 1MY3A 1A8EA 3ODBA 2PT1A 3GBAA 4H5FA 1JVYA 3N26A 2OWTA 2F78A 2UYFA 2ZYNA 4MFIA 4N07A 4PP0A 3ZSFA 5IAIA 2OCUA 1SI0A 4POWA 3MVXA 5I2KA 4ZZEA 3PPPA 4DZ1A 1HSJA 2XXQA 2F6GA 1EZ9A 2OK2A 4ZS9A 4OTEA 1B3FA 3T9UA 3TFLA 2QS2A 3DP8A 1QUIA 3IR1A 3OO7A 4R6YA 1MXVA 1PC3A 5CMBA 3MXZA 1VE4A 4QF9A 5DVJA 1LAHE 2X26A 4MBPA 3KBRA 4JBZA 4R6HA 5H8QA 4ISUA 1MDQA 4FE8A 3TELA 4EQBA 2ZYOA 3KGCA 2M8CA 5KDTA 5F1QA 1PDAA 4IGTA 3PUZE 3QYTA 1B3EA 1IJ6A 2I48A 4LQ5A 1NMUA 3TCGA 4KCDA 5CMMA 1A99A 3VLVA 3TCFA 4LATA 2AL5A 5I84A 2QMXA 1N7XA 3S9EA 2HZKA 3B7DA 3G3KA 2D5WA 2OLBA 2C5IT 4LZ7A 3K6XA 2Q8JA 3MP8A 1QJMA 1OVBA 3PD8A 2RCBA 4U4SA 5ICTA 5H8NA 3IX1A 3O66A 4X1DA 5EHMA 1UTHA 3FATA 3PMXA 2ESNA 1USYE 4I9DA 4E0WA 1NL5A 2HXWA 4JXIA 4QHQA 3U92A 1DPEA 2VHAA 1US5A 3MW0A 3DP4A 3K1PA 4NWDA 3W9VA 1AIVA 1H43A 4ESWA 3TTKA 1POY1 3KJTA 3SEWA 2HQ0A 5TP9B 2F34A 1MXZA 2W7YA 1JQFA 4K3FA 2O69A 4IY5A 5B70A 4ZZAA 1LBCA 1M5DA 3PPQA 1JEVA 4HTGA 1P1NA 1TT1A 1A55A 2P1SA 1OQHA 3FXQA 3MQ9A 1DSNA 1JW4A 3DLNA 4Q8RA 2YLNA 1OVTA 4H8IA 4RNSA 3C32A 2VD3A 3EHUA 4BDQA 2F7CA 4G8HA 1LAFE 3RNNA 5I2KB 1Y3QA 3S4UA 2NVUB 2NXOA 3GZGA 4FIMA 1SDXA 4PQJA 3BFUA 4ZEIA 1JW5A 2Y7PA 2VOZA 2XHDA 4F2QA 2QPQA 1JETA 4L17A 3WAEA 4IO2A 4WXJA 3VDFA 2RKMA 1ZJLA 3K2DA 4F3PA 1NNTA 2FYIA 1B1XA 2QMWA 4OERA 4EXKA 3CVRA 5AA3A 5I56B 3FD3A 3D4CA 3G3FA 5DVIA 2IA4A 1POTA 3HCQA 5TPAA 4ZE8A 1IITA 2OBGA 4DCYA 1YTVA 3SETA 4OZ9A 4NWCA 4PFWA 2V3TA 4OFJA 4QFNA 4Q5TA 4YMAA 3MP1A 3MPKA 3RT8A 5AA1A 1MH4A 3OSRA 1LSTA 3OO8A 2QS1A 4GL8A 4P11A 1YAEA 1B46A 3V5AA 4G4PA 1QULA 5AA2A 4HS7A 5AA4B 4R75A 1MXWA 4THIA 4QFPA 3C35A 3ECRA 1B3GA 3UK4A 1JNFA 2A5TA 1N04A 2XXPA 3C34A 3ILTB 4F19A 2I3VA 3G3IA 4PETA 1URDA 1DMBA 1Y4CA 1GVCA 5I59A 4RPNA 2Q2AA 3TZAA 2CMOA 2GH9A 3E9XA 3MWBA 4LUBA 3U1OA 2H25A 1BLFA 3MVYA 3OELA 4KI0E 3VXCA 5I2NA 1O64A 2FA7A 2PT2A 4X48A 2B3FA 2WKYA 4POXA 4WKMA 3VVEA 4R2BA 1L5TA 5LOMA 2HZLA 4QFKA 1N0TA 1Q1KA 3FV2A 4L0RA 1OIBA 3FXDB 2V93A 3TMGA 1DOTA 2IC6A 3H6WA 3K4UA 4YB5A 4F2OA 1XS5A 3IJXB 4BDLA 1LFHA 2IC9A 1I6AA 2Z8EA 4KQPA 3LUYA 2P0SA 3PV0E 1AH5A 2PVUA 3PMWA 4LONB 4F29A 2XXIA 1LAXA 4OXVA 1UQWA 5AA4A 3C4MA 1NNPA 4KR5A 3UP9A 3L6GA 2QJEA 5B7DA 1PEBA 1NH8A 2Z8DA 1UTBB 3M8UA 3QUJA 5JTYB 4H0WA 1ZTYA 2UVJA 4IO3A 1OLCA 2X9YA 3M3LA 1FQDA 4H8JA 3Q25A 3MZBA 5H8NB 1D4NA 1PB7A 3L6HA 4N13A 4FEBA 3VXBA 3BKIB 3E3KA 3HSTA 1TXFA 1SYHA 2I3WA 3N6UA 4NE4A 3IOUA 4ZEFA 4NTLA 3RUMA 2I0BA 4BDOA 4MH5A 3G3GA 3N5LA 2ZNUA 1MDP1 1IJ5A 4IO4A 1P99A 5AE4A 4BLAA 1SBPA 5JEIA 5K2YA 4DXUA 3VE1B 2DE2A 2ALUA 2AYSA 5I59B 2F36A 1D9YA 3C31A 3G3JA 1M5EA 3H03A 2Z8FA 5I57B 4FI5A 3SEUA 1DTGA 3UIFA 3IOVA 3RQTA 3BBRA 5FTIA 4E0XA 3O97A 2AL4A 1QSDA 4I8CA 4MF3A 4AQ4A 1Y4TA 3K00A 1ATGA 4YZZA 2YJPA 4FJPA 3H6TA 3ZKKA 1UIVA 4H65A 3TCHA 4KHZE 4NF4A 1MH3A 4EQ9A 1LB9A 4IO5A 4OMBA 1I6BA 2NOOA 1SW4A 3PUWE 2G29A 3KSJA 2HFBA 1XT8A 2R9JA 3DM0A 2O84X 5FHNA 1BP5A 1FQAA 4KCCA 4YU0A 5H8FB 3LR1A 4PE5B 2NWJA 1H45A 4GF8A 4OQOA 1FTOA 4OWDA 4U22A 1LAGE 2DVCA 2VP1A 2XX8A 4GFRA 3U8QA 3IOTA 3CSGA 2H5YA 3F11A 1M5BA 4XKRA 3VLWA 2O1MA 1MG1A 4GXSB 4LVQA 2V25A 5CBRA 4NEDA 4XIGQ 4YAHX 1MY4A 4X9TA 1VFDA 1B0HA 1ZKEA 1MQHA 2XXTA 1LVFA 3C33A 2ANJA 2DWIA 4YKJA 2KLFA 3FXRA 3U93A 1OQGA 1N76A 2O7IA 4RY1A 4ELRA 3PU5A 3TYHA 4YICA 3TUSA 3S9MC 1NH7A 2Q2CA 2C5JA 1SW5A 1IXGA 1FQEA 2K48A 3IORA 1A8FA 3H6VA 4Q30B 4F3GA 3T9XB 1B5JA 1R1NA 2RF1A 3MBPA 1N3WA 3M3KA 3MC2A 3H4ZA 3FZVA 3OO6A 2DWHA 5BUUA 1YCJA 5CBSA 4TLLB 3GLBA 3E13X 3UN6A 3LSWA 4G8MA 3MJNA 5H8QB 3CKDA 3CG1A 3MUQA 4IY6A 1SQYA 4I1DA 5TP9A 3MP6A 4R9FA 1FW0A 1GGGA 2Q89A 3D4GA 2RCAA 3CIJA 2C5KT 1IXHA 5DTBA 1EZPA 1JVXA 3FGSA 1FTJA 1N84A 3K6WA 3RN8A 3S2VA 3S9LC 3KEIA 2RC8A 3PD9A 2Q88A 1MM6A 2VGQA 3RLFE 5TU0A 2XXWA 1FCKA 1FTKA 4HCWA 3RTFB 4YB7A 1ZLQA 2XXHA 5L9OA 1D9VA 1TFDA 4ZECA 4DLDA 3TQLA 2I58A 1URSA 4JWXA 3KN8A 4OEUA 1HSLA 1R9LA 2XX7A 4OFLA 1J1NA 2XXXA 1H7CA 2XXRA 4DDDA 1NNFA 4JDFA 4XKQA 4OESA 2GHBA 3Q29A 5CC2A 2XD3A 1B32A 1B40A 3HHFA 1CE2A 1S9TA 2O68A 3FJGA 4QFLA 5AA2B 4NF8A 1NKXA 1IUDA 1QUJA 5KDTB 2P2AA 5JTYA 4EYYR 2RINA 3O9PA 4F1YA 1A54A 4FATA 5A5XB 4F1VA 5ICQA 5CRYA 4U4XA 2D21A 3TDJA 4ELPA 3H6UA 1BKAA 2HEUA 3CFXA 3A09A 3DELB 1B5IA 4GOTA 5JK4A 3O6GA 4FECA 4DNDA 3IO6A 4NF5A 3FVKA 1LB8A 2Z23A 4RK9A 3L3PA 4KYSA 3OD7A 2F5XA 3MVZA 5L8DA 4OETA 2B3BA 4XKNA 1QW0A 4NF8B 3SKPA 1MQDA 1IZ1A 4EXLA 1MQJA 5TPAB 4MLQA 1QKAA 1FTMA 1RYOA 4C1TA 4ND9A 1GTKA 2DXRA 4DCXA 4ECFA 1LCFA 1II5A 4U21A 1AMFA 5I2NB 4QSCA 2ZYKA 4H6DA 1QUKA 3IB0A 2ZXTA 4O3BA 4P0IA 4GRKA 3RT6B 3TTNA 3SDFA 1SYIA 2AIXA 4RYAA 3LSFB 3R6UA 3FXUA 1N3XA 2XXYA 5FHOA 4N6PA 4OVJA 1MY0A 3EPEA 2H4IA 4R2FA 3K02A 4GIZA 4JSOA 4EF2A 4DXCA 2F7AA 3I5OA 4YKKA 4AB6A 4H5GA 2G0UA 4EQ7A 3VV5A 1MS7A 1VSOA 1LGBC 4XKPA 1MM7A 1IIWA 1ZU0A 1B2HA 2A5SA 3T96B 1FQFA 5FHMA 1Y1MA 1MXUA 5EYFA 4F1UA 3QK6A 5CI5A 2CA5A 2UVHA 4LA9A 3THIA 2FNCA 2REJA 4GWOA 4F31B 4FAJA 3SEVA 1IQ7A 1F9BA 2ONKE 3H3GA 3Q27A 4ZDMA 2Z22A 2DVZA 1US4A 5FTHA 4ONYA 1IXCA 4XTCQ 2F35A 5DT6A 4QRZA 3TTRA 1LFIA 2PYYA 3T9HB 5CM6A 3MZ1A 3V8XB 1EH3A 3GXAA 3R26A 2UYEA 5I58B 5DVFA 1MPDA 4O3AA 3HHGA 4WEPA 1PB9A 3TQWA 4IGRA 5ITOA 2OJTA 1AOVA 1XC1A 1B4ZA 3LSLA 5DEXB 1LBBA 4LZ5A 1IEJA 1VFEA 3KFMA 3IJOB 2E1SA 4GQOA 2DSFA 3PPOA 1PBQA 2RC7A 3O2AA 4NF5B 2O7UA 1B1HA 2F97A 3CG3A 2V3QA 1UTBA 3OEMA 1FQCA 1URGA 1DTZA 5K2XA 5A5XA 3FVNA 5I58A 1T0KA 1B7HA 2XX9A 2XXUA 1Y3NA 2X7QA 2ZNSA 3CSBA 2QRYA 4TOZA 4BDNA 2KWIB 2MBGA 1ELJA 4O3CA 2QL3A 2O1LA 4YKPA 1XVXA 4DXBA 5DEXA 5I56A 3FJ7A 3UGWA 2V3UA 5I57A 1P1QA 3IOWA 3OO9A 2DWAA 1ZBMA 1XVYA 2DE3A 3EHTA 3RPWA 4AB5A 3IK6B 4JWYA 3PGFA 1B52A 2XXVA 1B9JA 2ZNTA 4TLMB 3WAFA 4J2CA 1FQBA 4GXAA 3UORA 3EHSA 3EQ1A 5HPQA 1WODA 1B7UA 3FVGA 2ONRA 3OMBA 3Q28A 1SD3A 5J1DA 4R6KA 4TQUQ 3T66A 3V83A 3MZ9A 1OMPA 3N94A 1B0LA 1BIYA 1BTJA 5ITPA 3CVGA 2D3IA 3JYRA 4FORA 3RGYA 1MRPA 3CFZA 5KCJB 4Z7EA 3USDA 3TKLB 2I4CA 2Q9TA 5CMCA 4PFYA 1Y3PA 2Y7KA 3C36A 1Z7NE 3BFTA 4B6XA 2GHAA 3SEXA 5M2VA 1D3KA 2QSXA 3M3FA 3OEKA 3PUXE 1SVXB 4EF1A 4X1BA 3TEPA 3U94A 2Y84A 2R6GE 3B6WA 2DXYA 4GD5A 4U1OA 5KZTA 5L9MA 5ISUA 3VLUA 1JW1A 3AXFA 1HSEA 1TWYA 3I3VA 3A3UA 4LP2B 1EZOA 1P1OA 3FVOA 1GV8A 3T93B 1PBPA 1UTHB 1SI1A 4G68B 1QKBA 3H06B 3FXEB 4G68C 2O6AA 3JV9A 4ELOA 5H8FA 3ILUB 2O51A 1B7ZA 5H8HA 1H76A 1ANFA 1MXXA 2HAUA 4YKIA 4F18A 1LLSA 2RC9A 1NFTA 1XOCA 1KWHA 1RKMA 2DWJA 3IAZA 2PBWA 2DOJA 3FIRA 3G3HA 4R9GA 2Y7IA 4U2RA 4KFQA 3PUYE 3PUVE 4NF6A 2LAOA 3O29A 3EF7A 4DE8A 3OOAA 1SW2A 1R9QA 3CI8A 3LSXA 1YPNA 3SEYA 5H8SA 1O7TA 4U1ZA 3T22A 3HV1A 1H44A 2UVGA 2YPNA 4GLIA 4QSDA 5H8HB 4F3SA 4IO7A 3HO7A 2PMSA 3O28A 4BDMA 4RPOA 5CMKA 1CB6A 1FTLA 1B5HA 3G7WA 1R6ZA 3SESA 2X7PA 4OEVA 3S9NC 3VVFA 1B3HA 1LRZA 4LQ2A 3FV1A 1DPPA 4OHNA 3LC8A 1O63A 1B3LA 2F6PA 3OSQA 3H7MA 3K6VA 3I6VA 3K1MA 4Z0IA 5AA2D 3K0VA 4ESXA 1NNKA 1VR5A 3MVWA 5ELVA 4C0RA 3OXNA 2DE4A 2X9XA 3PPRA 5KCJA 3QAXA 1M5CA 3C9HA 2DS9A 4YB6A 3W15C 4G8NA 2H9BA 4ZEDA 3TPAA 4RA1A 4QSEA 3TAJA 3QSLA 4BDRA 1UIUA 2ZYMA 5DYHA 2UXAA 4H67A 4LZ8A 4GL0A 4RJZA 5HBCA 4ZEKA 3ZKLA 4G2ZA 1OLAA 2Y7RA 3QIMA 4JB7A 1B58A 1JEUA 1MXYA 3B6QA 4IO6A 3RTWB 1M5FA 3TTLA 3LBSA 3W9WA 2PX1A 2KWHA 1Q35A 2A5TB 2F7BA 3PPNA 4M4GA 1WDNA 4R72A 2DYXA 2VD2A 2OZZA 4NMYA 4P0GA 3R7XA 2ABHA 3DP6A 3VFJA 4DIGA 3TTMA 1MPBA 2I4BA 5F7VA 4Q0CA 4HCYA 1A40A 1MPCA 3SERA 4YMBA 2NUVA 1EU8A 3IB1A 2ZMBA 1AL3A 1IXIA 3KG2A 4WEDA 1SW1A 4IB2A 3RY3A 2IEEA 2QS3A 4H1XA 4CQIA 3KN7A 2G93A 1I6QA 4HW8A 4KD5A 1H3DA 3IL1B 3KOTA 4FEDA 4M1VA 2HCAA 3GBBA 3V89B 3TODA 5BWJA 2BJJX 3QXMA 4JWOA
chains in the Genus database with same CATH superfamily
2H99A 2ONSA 1A7LA 3KN3A 2CXFA 3MKDA 4A98A 3N9NA 3H37A 1IMEA 1B4HA 1K9ZA 3EN3A 3Q5XA 2HAVA 1M62A 1XHYA 1MMAA 3FJMA 4QFOA 4PFTA 2LT3A 3KZGA 1WR0A 3B6TA 3P7IA 4HN9A 4X1IE 5FVLA 1IMBA 1MIVA 2KXPB 1Y1ZA 4ZE9A 4KYDA 2R71A 3PMVA 2VKOA 1S50A 3IB2A 2UVIA 3AA1B 4G77A 2DP8A 4C1UA 4JSDA 4F22A 2E0SA 2GQ1A 5EK2A 2H7VC 2QRXA 2ZZXA 1QVSA 4UACA 2I49A 2I0CA 1ZKBA 5EQAA 1GR2A 2XAFB 4KPTA 4YTPA 3EAMA 5JR9C 2XD2A 3N6TA 1SUMB 1N7WA 3K1NA 2B65A 3NVOA 3A29A 2CHOA 2I6HA 1JVYA 4G63A 2OWTA 4N07A 3N9PA 1KA1A 5CB4E 1SI0A 2X9HA 4O7IA 1HTJF 1Z8UA 4DZ1A 2XXQA 2F6GA 2OK2A 4ZS9A 1B3FA 2QS2A 1QUIA 3IR1A 5EK4A 3GWHA 4L9IA 4JBZA 4R6HA 4ISUA 1MDQA 4FE8A 2MOZA 3UULA 3GYYA 4EQBA 2B4LA 5F1QA 4NPPA 1W9RA 5ABEA 3TCGA 5CGMA 5CMMA 5LBQB 3AE3A 4ASKA 4LATA 2DNXA 2QMXA 2HZKA 2QVVA 3O1JA 3B7DA 4MHFA 3G3KA 4PFOA 2BG9B 4M1PA 4TX5A 2ZM0A 4GKKT 4QH5A 2WSSV 3J9X1 5JDMA 3PD8A 4U4SA 3UQ7A 4X1DA 2R8TA 2EHOA 1USYE 5LA6E 5LJNA 4QHQA 3U92A 4NWDA 2MPKA 3DP4A 3K1PA 3Q5DA 3W9VA 5EQ9A 5AQKB 3KJTA 2H3RA 2HQ0A 5TP9B 1XMOT 2W7YA 3ZT6A 2O69A 3A8YC 2IMLA 2P1SA 3FXQA 4AXPA 2UXDT 3C51A 4UF0A 2RP4A 2YLNA 2W67A 2XQYA 2VD3A 4X8RA 4DR7T 5FYMA 2XHEB 4G8HA 2LEHA 3RNNA 5I2KB 3TQLA 4PQJA 4ZEIA 1FTAA 3BFUA 2HHHT 2QPQA 2BG9E 3CQCB 3WAEA 3DP7A 4N15A 2BVMA 3JADA 4IDPA 4IL9A 4OERA 3FD3A 3G3FA 1X9BA 2EHOD 2LHRA 3Q5EA 2IAKA 1IITA 3PUXF 1IZNB 1D1AA 2V4CA 1M7KA 2V3TA 4CZZB 5CJ5A 3MP1A 3MPKA 3RT8A 1MH4A 3OSRA 3OO8A 1D9QA 3V5AA 1YAEA 1KNZA 3C35A 3ECRA 2A5TA 1N04A 4AIUA 4P56A 4PAKA 2Q2AA 3UTKA 4X66T 2CMOA 5KMGP 3AEAA 1O64A 4X48A 2X0LB 5LHGB 3PU3A 4QKNA 1L5TA 4O4JE 3M3ZB 2OWZA 1Q1KA 4L0RA 5LB7B 3FXDB 1HNWT 5LG4A 3H6WA 3K4UA 1LFHA 4JI0T 2Z8EA 2XSAA 4EV6A 2XXIA 5JREA 3UP9A 3L6GA 2QJEA 4GBWA 1PEBA 4BJNA 5FXZA 1ZTYA 3PTYA 3CX8B 5ET7A 3Q25A 3MZBA 1PB7A 3L6HA 4WNKA 3P4SA 1SYHA 1YXIA 2FBWA 3EDVA 4NE4A 4ZEFA 3RUMA 4I3YA 3G3GA 3N5LA 4IE5A 2ZNUA 4IO4A 3T1HT 2PG8A 3ZC0A 2WBBA 4BLAA 3VE1B 3LBXA 5FXXA 2ALUA 2F36A 4JI2T 4GKJT 4GOUA 3ZJ2A 5L3CB 4HE2A 4FI5A 2QVAA 3VU7H 3IOVA 5CFBA 2AL4A 3K00A 4YZZA 2CRBA 4HEAA 1LB9A 4NN3A 3DM0A 5AQGB 1BP5A 4KCCA 2B76A 4ZS2A 4OQOA 2DVCA 2VP1A 2XX8A 4GFRA 3CSGA 2H5YA 3F11A 5BMVE 4DR6T 1YKEB 1MMNA 4NEDA 4YAHX 1MY4A 1VFDA 2XXTA 1LVFA 1FPFA 3SZPA 5KX5E 4OHFA 1SE7A 2ODUA 3PU5A 3TYHA 4YICA 1NH7A 1G0IA 1FQEA 2WBDA 2K48A 3MZKB 3IORA 2CE7A 5ABGA 1FPGA 1N3WA 2UUAT 1W09A 3T1YT 1WLXA 2NTYA 5A1LA 5CBSA 4UEMA 3MK7C 1G0HA 2HXRA 3CKDA 3KV6A 2JRKA 3RX6A 3N9LA 3CG1A 2NW8A 2V6XA 2XY8B 4HE1A 1FW0A 2YU2A 1GGGA 3D4GA 1FTJA 1N84A 5JDNA 3K6WA 3RN8A 2PJQA 4JI4T 2RC8A 3RLFE 3UIFA 5L9OA 1K9YA 2XXHA 3ZC1A 3K3QC 5LGUB 3AE6A 4AISA 4U7YA 4TNWA 4KX6A 1H7CA 4MLKA 1NNFA 3UT5E 4OESA 2GHBA 3Q29A 5ET6A 1HS7A 4V1Av 2LJLA 1CE2A 1S9TA 2O68A 1NKXA 2WY2A 1IUDA 5KDTB 2M6BA 3UFEA 1CNQA 2P2AA 3UUMA 4FJOA 2LM2A 4F1VA 5CRYA 5IZ3A 4I4TE 3DELB 2V7KA 2F4VT 5JK4A 2W63A 3IO6A 5F8PA 4KYSA 1DK4A 4XKNA 1B7TA 2XAQB 3FB2A 4N6KA 4H9PC 4PFBA 1GTKA 2DXRA 4P9KA 2VL0A 3DJBA 4OVRA 3ZSTA 4H6DA 2WYPA 2IIUA 1DBZA 4O3BA 4GRKA 2AIXA 4RYAA 2UUBT 4IR8A 4QWNB 5FHOA 4OVJA 5J16A 5J2TE 4AKRB 4EF2A 4XBFB 2F7AA 5LHHB 4ZI3D 3VV5A 3O1HA 5AQOB 1DU2A 4Z8XA 1MS7A 3IFAA 4HE0A 1MM7A 1G8XA 2VT5A 2A5SA 1HG2A 4ILCA 2CLYC 4CXYA 1MXUA 2N2NA 2P9BA 4MHCA 4WYVA 4OANA 1HNZT 1F9BA 2ONKE 3Q27A 4HWFA 2Z22A 1BR1A 2DVZA 5FTHA 1MMGA 4XTCQ 3TTRA 4GX4A 3MZ1A 3V8XB 1NI9A 3R26A 5DVFA 3HHGA 3TQWA 2XQ6A 4AQGA 1AOVA 1B4ZA 5LP6E 2AE9A 5L3EB 1VFEA 2OA5A 4GX3A 2F97A 3BK9A 1Y64B 5JDQA 2P3VA 5J2UE 2JIWA 2ACZA 2XX9A 3HKCE 1MIWA 4B3ST 2LSGA 3I1AA 1ELJA 4I43B 2QRYA 4AKGA 2O1LA 2QL3A 1HR0T 1XVXA 5DEXA 5LHIB 3FJ7A 2HN2A 2DLRA 5AQSB 4J2CA 2JJKA 1WODA 2XQ8A 2ONRA 2PFVA 1IMDA 3PURA 1NV0A 2H7OA 5ITPA 3CVGA 4HFHA 3JYRA 4XEQA 4QXDA 3C50A 4PFPA 4PJNA 5EK3A 4Z7EA 3USDA 4N17A 4PFYA 1Y3PA 4XAXB 3RRWA 3ONXA 5H8FA 5M2VA 3K8PC 3IBPA 3JCFA 2R6GE 3AA6B 4GWWA 2V6YA 3N9QA 5DQWA 1EZOA 1P1OA 3SWHA 4G68B 1QKBA 4ELOA 2ZZWA 2VL8A 3P50A 4YKIA 2ZMAA 1N33T 5HXEA 4R9GA 2PBWA 2DOJA 2Y7IA 2JMKA 4UV8B 2LAOA 3GN5B 2V5DA 1SW2A 3SEYA 3T22A 3MYUA 3VHLA 1I6ZA 4MIJA 3RIUC 1CB6A 3SESA 2WX9A 2VK9A 5CA0E 1KFYA 4TV8E 3ONLC 4YJ2E 5LMUT 1DPPA 4OHNA 3FHNA 3QB5A 1O63A 2L5VA 2MTQA 2VPNA 3I6VA 1NNKA 5ELVA 3B13A 4C0RA 3VR8A 2CBJA 2X9XA 3QAXA 1M5CA 4YB6A 3V5SA 3P4PA 2OV9A 3N2GE 1UIUA 2UXAA 4RJZA 5JRCB 4JB7A 1B58A 4IO6A 4JVDA 3W9WA 4TWFA 2F7BA 3PPNA 4UABA 2VD2A 3R7XA 3OYXA 4DIGA 3TTMA 1MPBA 2I4BA 4TZ4C 4HFBA 3ZCIA 2X0HA 2WU5A 1EU8A 3RY3A 2NOXA 4IB2A 3KN7A 4YXDA 4WZXA 1FRPA 3SOLA 3KOTA 3V89B 3GBBA 2V7JA 3ZMSB 3QXMA 3TLWA 4JUYA 4NGUA 3K3NA 4R73A 5HM4B 2E2AA 1Y20A 4DV5T 2F8DA 2REGA 4F3BA 4EUOA 2FJEA 2X51A 3VRBA 2I6EA 2XQ5A 2X9WA 2XTLA 5FXWA 1LCTA 1MQGA 5FMNA 5EHMA 3IFCA 4H63H 3KJ7A 3K01A 4PFIA 5F5WA 5LOVE 3Q26A 4I62A 4PFUA 4NF4B 4NHBA 1WVJA 3K6UA 3PUQA 3RGLA 3RC8A 4P09A 2IDOB 4GVOA 4CI3B 1USYH 2V7MA 2CEYA 2GFEA 4U2ZA 1PB8A 4DI3D 2JPFA 5JDLA 1LFGA 3B8BA 3HN0A 4EDPA 3JZJA 3KSXA 1Z7ME 3HPIA 4MLVA 4RXLA 3ANWA 4MEVA 1KNRA 5IKBA 4YHJA 3QUFA 3T9VA 3AEGA 1MY3A 2KR0A 2XUEA 3PUVF 3GBAA 2UYFA 4PP0A 3ZT5A 3EKIA 1S35A 4TN7B 3E79A 5I2KA 4ZZEA 3LK42 1HSJA 4MFRA 3T9UA 4R6YA 4BA9A 1Q9DA 4EEBA 1VE4A 4MBPA 5H8QA 3KBRA 3ETVA 3BQKA 3ZN1B 2ZYOA 2WEFA 5L47A 4IGTA 1B3EA 1YW0A 1A99A 2UXXB 3VLVA 3TCFA 3CQXC 2XQ9A 4JI3T 5C8YE 4HWDA 4P0BA 3CIRA 3F31A 2LLYA 3D0TA 2D5WA 3E0ZA 1E7PA 4OYKA 4LZ7A 3K6XA 3MP8A 4O4LE 5ICTA 2LKGA 5H8NA 4JV5T 3PMXA 4HFIA 1N36T 3RKGA 3PTRB 1US5A 2VHAA 3MW0A 1AIVA 1H43A 4ESWA 4LFCT 3CX6B 5EYGA 1JQFA 1FPDA 5FY0A 1HF8A 4P1EA 4TWDA 1P1NA 1A55A 3AE9A 3CHGA 4PBQA 4FBPA 3FZLB 4O2BE 1OVTA 4H8IA 4PFRA 4BDQA 2F7CA 4GWXA 4GYSA 2NXOA 2HPGA 3GZGA 3KC1A 3GA8A 2VOZA 4F2QA 4LF5T 4LF9T 4IO2A 1ZJLA 3ZMTB 3K2DA 2FYIA 3CVRA 3D4CA 2D0UA 3HCQA 2VURA 1POTA 4H63V 3SETA 4OZ9A 1W0AA 2WDRA 4GIWA 4WW0A 3OJAA 4Q5TA 4JI8T 5AQLB 1MNEA 2W62A 3RH3A 3RYHE 4P11A 5AA2A 4G4PA 1QULA 5AA4B 4R75A 1MXWA 4MMPA 4QFPA 1VOMA 3JAEA 3C34A 2RA1A 3UK4A 4PETA 1URDA 2PCRA 4MBQA 1GVCA 3GN5A 2ZM2A 2GH9A 4HFCA 3E9XA 4DUYT 3MA9A 1FJ9A 3MWBA 3U1OA 3OELA 3MVYA 3VXCA 4GWYA 5I2NA 4WKMA 4R2BA 2E5LT 4C91A 4PE3A 3FV2A 2V93A 2XWKA 2CMRA 1XS5A 3IJXB 3L39A 3FZKB 1I6AA 2KZ7B 3LUYA 2FJAA 3N9MA 4MX6A 1AH5A 2PVUA 3PMWA 3C4MA 4DBRA 4KR5A 4P3LA 3AE4A 4LF7T 4MCOA 3M8UA 3ZSSA 3KBUA 3KV5A 1OLCA 2X9YA 2FJDA 2XXKA 4DV2T 1D4NA 5FNVE 2YDSA 4FEBA 1LEVA 3BKIB 4LN5A 4PJJA 2QA7A 3N6UA 4YTMA 2XQ3A 2LRLA 1IJ5A 5AE4A 1SBPA 1X79A 5JEIA 5LMNT 2AYSA 5I59B 4U2YA 4ZS3A 4DV6T 3H03A 3N2OA 3MJXA 4PBHA 2YEVC 3IHRA 3BBRA 3UUBA 2D5UA 4HE8A 1ATGA 4DV0T 4FJPA 3ZKKA 3H6TA 2IW5B 4H65A 2ES0A 3TCHA 4IO5A 2CEXA 3JAFA 1SW4A 4PCDA 2HFBA 5H8FB 5FHNA 3RYDA 4YSXA 1FQAA 3OKQA 4UV9B 4HWHA 2NW7A 4U22A 3H3MA 5C3JA 5I58B 2J4GA 3RHWA 4LMJA 3VLWA 1M5BA 4XKRA 5ABFA 2O1MA 1MG1A 4GXSB 3NRXA 5AQMB 4X9TA 1ZKEA 1N34T 2I0MA 5AQIB 2DWIA 2KLFA 4RY1A 2Y5LA 2D2SA 3TUSA 2C5JA 2LRKA 4QX8B 1IXGA 1A8FA 5JVDE 4F3GA 3T9XB 1BR2A 3MBPA 3KVBA 1W0BA 3C64A 3RPLA 3MC2A 3RIFA 3H4ZA 5LG3A 1YCJA 3UN6A 3GLBA 3PUAA 3E13X 4G8MA 5LBMA 5IUXA 5KDMC 1XWMA 3QB5K 2RCAA 3CIJA 3VRAA 3PE0A 3S2VA 4JEHB 3ZKLA 1MM6A 3RTFB 5TU0A 1ZLQA 2BG9A 4PTKA 2XASB 1TFDA 4JWXA 4IIJE 3RYIE 1J1NA 1RDXA 4UVCB 2WBLA 1SA0E 5AQHB 4N91A 4YY3T 2UXCT 2Q9QD 4E7SA 3A7MA 4U7IA 4QFLA 5AA2B 2DHRA 4QH4A 4EYYR 1ZHCA 4EZ4A 2RINA 1A54A 1FPJA 3L09A 5ICQA 3T0JA 1BKAA 3A09A 2K3WA 4ILBA 3U78A 4PW8A 4GOTA 2VB6A 1YZ0A 4DNDA 2E9XA 4NF5A 3L3PA 3MVZA 5L8DA 4PJMA 3FBPA 2Y48B 5LGTB 1QW0A 4EXLA 4PK6A 1LBYA 4MLQA 4YT0A 1OEDA 4DCXA 4ECFA 3FZFB 1II5A 1AMFA 2ZYKA 2WCAA 2ZXTA 3RT6B 3TTNA 3SDFA 1SYIA 4OVSA 2B4MA 3LSFB 3R6UA 3FXUA 3CQGB 2XXYA 4N6PA 4K0KT 3EPEA 2KMFA 4DXCA 5AQUB 1IAPA 4DR3T 4NF0A 4EQ7A 1VSOA 4XKPA 3KBZA 3N2KE 4O4IE 4DV1T 3NZPA 3UU6A 2BS4A 2CA5A 1OWAA 2REJA 1IQ7A 1LBZA 2J62A 1U4QA 5FKYA 5LCYA 5T3JA 5DT6A 2F35A 3ESLA 3FXBA 4PC9A 5A5LA 2UXBT 4NQ8A 4OVPA 5HXHA 5FXVA 1MMDA 3QNUA 4O3AA 3ZMZB 1XC1A 3LSLA 1MIYA 1BR0A 1IEJA 2JQKA 1US7B 3IJOB 4UR9A 3PPOA 1PBQA 3O2AA 2O7UA 1B1HA 1BK4A 5L3GB 1E1HB 3AE8A 2K24A 4H9NC 1Y3NA 3CSBA 1SPIA 3NRYA 1R8IA 4IE4A 3VR9A 2MBGA 1EYJA 4BDNA 4YKPA 2E9XD 4KHZF 3LUZA 4ZI3C 5BR8T 1BR4A 5I57A 2YU1A 1UUSA 2V3UA 3IOWA 4ZOLE 4NUUA 2NW9A 1XVYA 1ZBMA 3EHTA 3IK6B 3RPWA 4PGPA 1B52A 2XXVA 2WAUA 4GXAA 3EQ1A 3CWZB 1B7UA 4GX6A 3ZYMA 1CUNA 3Q28A 1SD3A 2CZKA 4ADZA 4KBMB 4H45A 4TQUQ 3C98B 1B0LA 1BTJA 4GK5E 1N32T 2D3IA 3RGYA 3CFZA 4WBNE 5LXTE 4P1NA 2I4CA 4YSYA 2Q9TA 4CI1B 3BFTA 3H3AA 3SEXA 1YKHB 3PUXE 3M3FA 2JQHA 3B50A 2Y84A 4U1OA 3NKZA 3PV0F 5L9MA 5KZTA 4CN6A 3RLFF 1FBCA 4LP2B 3ZLIA 3T93B 1PBPA 3ZT7A 1UTHB 4U3CA 3FXEB 3JV9A 2O51A 1B7ZA 5AQQB 1H76A 5AQJB 1MXXA 5FVKA 2F3DA 1RKMA 3G3HA 2XPKA 4U2RA 3PUYE 1INPA 2IUBA 3SFDA 4MAGA 5DQVA 1FBFA 3LSXA 5AFUL 3NBXX 3HV1A 3KC0A 4GLIA 2UVGA 2YPNA 2A9UA 4KXPA 2E9XC 5H8HB 4IO7A 1S94A 4EOZB 5HEHA 3O28A 2VWAA 1DCUA 1FTLA 1B5HA 3S9NC 4OEVA 1Y01A 2QVRA 2FBPA 2KQZA 1B3HA 1UX4A 2LM9A 4ZEYA 1B3LA 2F6PA 4COFA 4I0UA 3K1MA 3WI3A 2Q9QC 2CM0A 1VR5A 2DE4A 3EABA 4X1KE 2DS9A 4G8NA 1IBKT 1CHUA 2ZYMA 3L8RA 5AQRB 4G2ZA 2YINA 3B6QA 2K5BB 2KWHA 2XQ4A 1Q35A 4R72A 3RKOA 1WDNA 1NUXA 2OZZA 4NMYA 4P0GA 4ZZCA 2WU2A 4PAIA 3KV4A 5F7VA 1MPCA 4IE0A 4ERRA 3Q9DA 2CCQA 3LSVA 2V8SV 3IB1A 4QH1A 2XWVA 1IXIA 3FBZA 4H1XA 1I6QA 4HW8A 4KD5A 4M1VA 2HCAA 4ILUA 2WWVA 3W15B 3TODA 1T8BA 4OVQA 4ELQA 3PJAJ 1MQIA 1MY2A 1VCSA 4RK2A 2HPJA 4IDQA 5L2LA 2Y7WA 3CRBA 3AE5A 4NF6B 4OENA 4EYUA 4OFOA 1ZIUA 2THIA 1QGXA 2QS4A 5L9SA 4G68A 4R74A 3B5MA 3C4ZA 3KOSA 1MY1A 2KINB 1P1UA 4F8HA 1Y9UA 2B1EA 3E4RA 4ZEBA 3A3CA 3TKDA 5I56B 5EHSA 1B51A 3P4QA 3VVDA 4YSZA 3O1IA 2CZLA 2V84A 3D1RA 4KYEA 3CFLA 1P1WA 1B05A 4UA8A 1ZOYA 3UA8A 2DQVA 3MAMA 1UK5A 2VKDA 2W4XA 4F39A 2F78A 2ZYNA 2Q74A 5JH7E 4MFIA 4POWA 1KF6A 3MVXA 4TUYE 4ISSA 5L4EA 4AQFA 4NX1A 4OTEA 3OO7A 5CMBA 3QMFA 3MXZA 5DVJA 1LAHE 2X26A 4LMKA 4MALA 1O3XA 3LFMA 2YDRA 5KDTA 1T7SA 4LF8T 3PUZE 3QYTA 2I48A 1IJ6A 1NMUA 3RPLB 4KCDA 2QYWA 2WYKA 2AL5A 4B3RT 5I84A 2LSKA 2JQQA 1OEDE 3I9WA 3AAIA 2C5IT 2FUPA 2Q8JA 1OVBA 2WWUA 2RCBA 5JDFA 3IX1A 4XF5A 3FATA 2ESNA 2HXWA 2XAGB 4UVAB 1DPEA 3M65A 4PAFA 3SEWA 1FIOA 2CBIA 2F34A 1MXZA 1KK7A 4K3FA 1V9DA 4IY5A 5B70A 1M5DA 1VRBA 3PPQA 4JVCA 2C0SA 2Y8DA 4X65T 4HTGA 3MQ9A 1DSNA 1JW4A 5HWYA 1J5WA 3QC9A 4GWUA 4DR1T 2L8KA 4RNSA 3EHUA 4HTEA 1LAFE 1Y3QA 3S4UA 2NWBA 4GWSA 4CN4A 1G73A 1WCRA 4DR5T 2WB5A 5EQ7A 1JETA 1JNRA 4CXWA 1OEDC 4WXJA 3VDFA 4BAYB 4U33A 4EXKA 2QMWA 2Y5KA 3AE1A 5TPAA 4ZE8A 4DCYA 2BKPA 1YTVA 1HCIA 2N9DA 4NWCA 2PFZA 4PFWA 4OFJA 4I55E 3UUNA 3NWIA 5LYJE 1LSTA 4GL8A 3FBLA 3R84B 3N9OA 4THIA 4HFVA 3RIAA 3I9YA 2VVNA 3HKEE 2XXPA 4RPNA 3TZAA 5F24A 1D0YA 3PUYF 3BQLA 2H25A 1BLFA 2KSRA 3HR0A 3WAKA 2PT2A 4TV9E 2B3FA 2WKYA 3VVEA 5LOMA 5ET8A 1N0TA 2W61A 1OIBA 5J0ZA 1FBGA 4YB5A 4F2OA 4ISTA 2P0SA 3PV0E 4U31A 4DV7T 5AQNB 4OXVA 4PDDA 3PUZF 5AA4A 2CWYA 2IHR1 2Z8DA 1NH8A 1UTBB 3QUJA 2KT9A 5JTYB 4IO3A 1HG5A 3M3LA 1FQDA 4H8JA 3RYCE 5H8NB 2CPTA 4N13A 3HSTA 1KZ8A 5AQFB 4BDOA 1MDP1 2XM1A 3RQUA 1P99A 2UUCT 5K2YA 4DXUA 2DE2A 4ZXLA 4YHHT 3C31A 3CK6A 2K9AA 4HFDA 5I57B 1XDOA 3F2EA 3SEUA 3U3IA 3RQTA 5FTIA 4ANJA 4I8CA 4MF3A 2VVSA 1FBHA 2YJPA 4AQ4A 5F3JA 4NF4A 4JI6T 4YTNA 2NOOA 4GWZA 2UU9T 3ONJA 2R9JA 5IZ3B 4DBQA 3LR1A 4PE5B 2YOEA 3ZN0B 2NWJA 1KNPA 1H45A 4GF8A 2XAJB 1XNRT 4NAPA 4LVQA 4N8GA 5ADXL 2V25A 5CBRA 4LFAT 4OYJA 4XIGQ 2VPOA 3B57A 1B0HA 3C33A 2ANJA 2XWIA 2O7IA 1N76A 2UXNB 4PAGA 4ELRA 2Q2CA 1SW5A 4P47A 1JP4A 5M4YA 3H6VA 1R1NA 2RF1A 1NV5A 3AEFA 2WZIA 1YQ3A 3FZVA 2DWHA 3V5UA 1IMAA 5H8QB 2W66A 2HHMA 4CN1A 1FEWA 1SQYA 1U5PA 5TP9A 3MP6A 2Q89A 4ZHQE 4OVTA 2C5KT 1IXHA 5DTBA 2EHOC 1JVXA 3FGSA 5ESYA 1HX8A 3S9LC 5GONE 3KEIA 3NOHA 2Q88A 2WQYA 1FTKA 4YB7A 1D9VA 4X04A 1IBLT 2XM2A 3UU4A 5HXRA 2DDKA 1R9LA 2XWOA 4OFLA 2XXXA 1NWMX 5HEJA 2XXRA 5CC2A 2XD3A 5FY7A 4EAHA 2Q9QA 4DO0A 3O9XA 1B32A 1T98A 4NIQA 3SS1A 3RI5A 4NF8A 1QUJA 1LBXA 5HYAA 3O9PA 4F1YA 4PF6A 5A5XB 2I59A 5EZYE 2OX3A 1LKXA 4KHPT 3H6UA 2HEUA 1XDPA 3CFXA 3EHZA 3E22E 3FVKA 2Z23A 2N1GA 4UVBB 4OETA 4IDOA 4DIDB 4NF8B 3SKPA 1I94T 4H9OC 3O4XE 3PDYA 2YKSA 2XQ7A 3KFWX 4PDHA 1LCFA 4U21A 2MKZA 4P0IA 4I40A 4XZCA 3RPUA 3E78A 4ZZBA 4AKHA 4JSOA 4I50E 4DV4T 2V7LA 3PUWF 4YKKA 4H5GA 1LGBC 1ZU0A 5HEOA 1B2HA 4ZI2C 4IE7A 3T96B 1SHZC 1FQFA 5FHMA 1Y1MA 5EYFA 4F1UA 5CI5A 3THIA 2RPAA 2UVHA 4LA9A 2FNCA 4GWOA 2BJIA 2WP9A 3H3GA 4U72A 3T1BA 4YFSA 3ETUA 1US4A 4MNCA 4ONYA 2QGSA 1LFIA 2PYYA 2SPCA 5FL1A 3T9HB 5CM6A 2ZM8A 4DV3T 1JNZA 4IDNA 2E5VA 4AS4A 4EXTA 2NP9A 1LBWA 1MPDA 4WEPA 4IGRA 4A97A 5DEXB 1NV2A 1LBBA 4LZ5A 5LJMA 2OLTA 3KFMA 1WRDA 1GV8A 1L0VA 2E9XB 4NF5B 4X62T 4F29A 4YMBA 5K2XA 1FQCA 4TWHA 1URGA 1HNXT 5A5XA 3FVNA 1T0KA 5I3SA 1D1BA 2XXUA 2VKHA 2X7QA 2ZNSA 4TOZA 4YMAA 5ETWA 4DXBA 4CXXA 1YXRA 4AKIA 3OO9A 2DWAA 3PGFA 3V83A 1B9JA 3WAFA 4KI0F 5ABHA 1FQBA 3UORA 3EHSA 2VQFT 5HPQA 1D0ZA 5E0OA 1OMPA 3N94A 4PGNA 3KDSE 5JR9A 1MRPA 3DTOA 3Q5WA 2WZHA 2P3NA 5KCJB 4OA4A 2Y7KA 3AE7A 4B6XA 5IHYA 1D3KA 2QSXA 3OEKA 1SVXB 3TEPA 3U94A 4GD5A 4QHOA 2DXYA 2FJBA 4IT4A 1JW1A 3VLUA 4QBAA 3A3UA 3FVOA 2CZHA 2BKOA 2JMHA 2LKHA 2XQAA 4G68C 2O6AA 1NUWA 4N6DA 3R6NA 2HAUA 1FMVA 5H6QB 1AJ3A 1YD8G 1NFTA 1XOCA 2DWJA 3IAZA 3AA0B 4PJLA 3PUVE 5CA1E 4EB6E 4DE8A 3OOAA 3AE2A 1R9QA 3CI8A 2BBJA 5HAXA 3P4RA 1O7TA 1H44A 3BIGA 2PMSA 2A3DA 1NV6A 1FBDA 4RPOA 5CMKA 2Y6XA 3C4XA 1NUYA 5HEGA 3VVFA 1LRZA 1RDZA 3FV1A 5HWXA 3LC8A 5HCJA 1NV1A 3H7MA 3AEEA 3X1DA 5JR9B 4NG7A 4ESXA 3HA4A 5KCJA 4DVDA 3ZMVB 4HFEA 3TPAA 4RA1A 4O2AE 5HBCA 4GL0A 4ZEKA 2Y7RA 3QIMA 3CPZA 2BG9C 4IHJE 3TTLA 3E08A 1M5FA 5TAOA 2A5TB 5L3DB 2DYXA 3F57A 2W2UA 4E7ZA 2ABHA 3VFJA 3I0QA 2BKNA 4Q0CA 1A40A 2DL1A 1MNDA 4HKAA 2NUVA 4DMWA 4WEDA 1SW1A 2MYSA 1LBVA 4BJMA 4B3TT 5LDZA 2G93A 1IMFA 3OYZA 2EHOB 2PTFA 4FEDA 4UELA 3OVUA 3CR9A 3ONMA 1YYZA 3O6HA 3ZEFB 4KP3C 3FUZA 3ABVA 4U23A 1I69A 3IO4A 3U72A 2XZEA 3EUHA 1HX1B 1OEDB 5DABA 3HKBE 5EYHA 2V7IA 3RF1A 3WAJA 4OYVA 4UF0B 3MPLA 4XXUA 2DWKA 2GRVA 2WMNA 3VKHA 3ZYLA 3OENA 2D0TA 5JDHA 2H98A 3RQWA 2XAHB 3ZJ1A 1RYXA 2OWSA 3ZS6A 4EIWA 3NZQA 3RYFE 4X5TA 1ZMGA 1B6HA 3O6IA 5EQ8A 2LSYA 3ZCJA 5ET5A 2LOPA 4MNIA 3QOFA 1FBEA 2MAWA 1Z0PA 4JVIA 1S7YA 1TFAA 3UFGA 2W0GA 5FP3A 1FMWA 1EYIA 3FASA 4N78D 3UU8A 1A8EA 1XI6A 3ODBA 2PT1A 5JRCA 3CMLA 4H5FA 3KV9A 3N26A 5IAIA 4IREA 3ZSFA 2ZZVA 4JI1T 2OCUA 3ROJA 4K0UA 5FY1A 3PPPA 1EZ9A 4Z90A 3TFLA 1FPBA 3DP8A 1MXVA 1PC3A 4QF9A 4LMLA 5AQPB 1WYCA 1QLBA 5JQGE 1KA0A 3LDQB 2WS3A 1FPEA 3KGCA 2X68A 2M8CA 1PDAA 2CWOA 2CLYB 2Q8MA 4AQFC 4LQ5A 3UU3A 5JDGA 4YJ3E 2LHNA 1NAFA 1N7XA 3P4WA 3S9EA 4AKLA 1NV3A 2OLBA 4O7MA 2LSJA 1FJGT 3RRCA 4UIGA 3OPCA 3HFUA 4DI4B 1QJMA 4MNPA 3IF8B 3O66A 2FIXA 2BBHA 4E0WA 1UTHA 4I9DA 4DR2T 2WDQA 2YDQA 1NL5A 4JXIA 3TTKA 1POY1 2M6IA 3AAAB 3ZYKA 4ZI7E 5H6RB 3SRZA 4ZZAA 1LBCA 2M67A 1JEVA 5L3BB 3OBVE 1TT1A 1OQHA 1NUZA 4NXNT 2H89A 3DLNA 2BS2A 4Q8RA 5LNKA 3OTOT 3C32A 4X64T 2ACXA 4AB5A 2NVUB 4FIMA 1SDXA 1JW5A 2Y7PA 2XHDA 1WR6A 4L17A 4MJOA 2RKMA 3TLUA 4F3PA 1NNTA 4QX7B 1B1XA 1FPLA 2PBIA 5DVIA 1IMCA 2IA4A 2OBGA 3BIHA 5IGAA 1LVKA 2LSIA 5IZ1A 3K1SA 4QFNA 1QUUA 5AA1A 4G2AA 2QS1A 1B46A 4HS7A 1XMQT 1GQEA 5KXJA 1B3GA 1JNFA 2L3LA 3UUXB 3ILTB 4N8YA 4F19A 4GBVA 2I3VA 3G3IA 5I59A 1DMBA 4HWIB 1Y4CA 4LUBA 5IZZA 4Q25A 4KI0E 4C90A 2FA7A 2ZM6T 4POXA 2HZLA 4QFKA 3TMGA 1FJ6A 3UU5A 1DOTA 2IC6A 3MACA 4BDLA 2IC9A 4KQPA 3EDUA 4LONB 1LAXA 1UQWA 2HPLA 1NNPA 4JI7T 5B7DA 4NXMT 1XZYA 2KLQA 2J1DG 4H0WA 2UVJA 1D1CA 4PK5A 3CX7B 3VXBA 3E3KA 1TXFA 2I3WA 3T8OA 3AEBA 3IOUA 4NTLA 2I0BA 4MH5A 2F3BA 2BZBA 4IDZA 5IWAT 1D9YA 3G3JA 4DMVA 1M5EA 5I7IA 2Z8FA 2W00A 1NV7A 3LG7A 1DTGA 4E0XA 3O97A 3SFEA 1QSDA 2X67A 4HWCA 4QXHB 1Y4TA 1OXZA 2V6YB 1UIVA 4KHZE 4OX9T 1MH3A 4EQ9A 4OMBA 3AVSA 2CZIA 1I6BA 4N4UA 3MSTA 3PUWE 5IYZE 2G29A 3KSJA 1XT8A 1ZV4X 2O84X 1UX5A 1WFDA 1VDWA 3J7Yq 4YU0A 4L5GA 1FTOA 4OWDA 1LAGE 1UCUA 3AB3B 3U8QA 3IOTA 2LOSA 2CXLA 2BS3A 5L3FB 3Q2MA 1MQHA 4EEDA 4P8BA 3ZPOA 1WYBA 4YKJA 4LF4T 3FXRA 3U93A 1OQGA 4UXNB 4P0AA 4PF8A 2QFLA 2YK0A 3S9MC 1D0XA 4HGAA 4JLEA 3UQ4A 4WBOA 2QVUA 4Q30B 3LV0A 1B5JA 1ZP0A 4H9QC 5ABFB 3KBTA 5DW8A 3M3KA 2NTXA 2JQ9A 3LK3B 3OO6A 5BUUA 3AXJA 4TLLB 3LSWA 3MJNA 5C2TA 4O8SA 4NUVA 4H9SE 1FPIA 3FZMB 3MUQA 4IY6A 3ZMUB 4I1DA 3EVYA 4R9FA 4GK0E 4N81A 1EZPA 2NR4A 3PD9A 1FBPA 2H88A 2VGQA 3AXJB 5AA3A 2XXWA 1FCKA 4HCWA 4EZHA 4A5XA 4IL4A 2XSBA 4DLDA 4ZECA 3K3OA 3ANWB 1URSA 2I58A 3KN8A 2Z6EA 4OEUA 1HSLA 2XX7A 2GK9A 4LFBT 2D9DA 4DDDA 3JC6D 4JDFA 1FSAA 4XKQA 1B40A 3HHFA 3FJGA 4JBWF 1EYKA 5JTYA 5HEUA 4FATA 4F6RC 5J1GA 3TDJA 4U4XA 3TLSA 3PJAA 2D21A 4ELPA 1B5IA 4X20E 5JTGA 3O6GA 4FECA 2ZLYA 1LB8A 3P8CD 3TLVA 4RK9A 3OD7A 2F5XA 2B3BA 1MQDA 1IZ1A 1MQJA 5TPAB 1QKAA 1FTMA 1RYOA 3PUGA 4C1TA 4ND9A 2LE8A 4QXCB 5I2NB 4QSCA 4B3MT 2XJ7A 3HI2A 1QUKA 3IB0A 5HXSA 1J1JA 2V5CA 2J47A 1N3XA 1MY0A 2PFYA 2H4IA 4R2FA 4O94A 3K02A 4GIZA 4AQYT 2AXDS 3I5OA 3PU8A 4AB6A 4XFEA 2X66A 2G0UA 1NEKA 4ILAA 1XNQT 1IIWA 4Z91A 2R6GF 2CXDA 4I3EA 2CEAA 3KVAA 2FVZA 3QK6A 4FAJA 4F31B 3TLTA 3SEVA 5LGNB 4ZDMA 3IA3A 4JYAT 3JC6C 2HN1A 5DJQC 1IXCA 4LF6T 4QRZA 4YLHA 4O4HE 5HCMA 4H46A 1EH3A 3GXAA 1E2AA 5AQTB 2UYEA 3PUSA 1PB9A 2DCFA 2OJTA 5ITOA 4KUMB 2YN6A 3FZHB 1IBMT 1T72A 1UURA 2E1SA 4GQOA 2V26A 2WDVA 2DSFA 2RC7A 3TELA 1EZ3A 2ODVA 5L4HA 3CG3A 2V3QA 1UTBA 3OEMA 2VQET 5I58A 1DTZA 1B7HA 2WMOA 1AWBA 3LK2B 2KWIB 4O3CA 5IM2A 5AQVB 3IEEA 5I56A 3UGWA 1P1QA 3RIUA 2DE3A 3AA7B 4IGUA 2FIEA 4JWYA 2ZNTA 3ISPA 2XA5A 4TLMB 3FVGA 5FL0A 3OMBA 4A56A 5J1DA 4R6KA 2A2FX 1FPKA 3T66A 3MZ9A 1BIYA 3ZKRA 4X1YE 4JI5T 4G61A 4FORA 3AEDA 2FHYA 3TKLB 4U74A 5CMCA 4ZI2D 3C36A 3HL6A 2CHNA 1Z7NE 4AS5A 2GHAA 4EF1A 3AECA 4X1BA 3B6WA 1J5ET 3LJCA 5ISUA 3AXFA 1HSEA 1TWYA 3A5XA 3I3VA 3VKGA 2L9QA 5HXCA 1SI1A 3H06B 3ILUB 5H8HA 1NV4A 1ANFA 4F18A 5LTCA 1LLSA 2RC9A 1VCTA 1KWHA 3FIRA 4H9RC 4JEUB 1KEYA 4KFQA 3BQIA 3O29A 4NF6A 3EF7A 2A72A 2BDEA 1YPNA 5H8SA 5FBPA 2KNDA 4U1ZA 4EGWA 4QSDA 4F3SA 3HO7A 4BDMA 3G7WA 1R6ZA 2X7PA 4QXBB 4TNVA 2X0YA 4LQ2A 2WM9A 4DUZT 3AVRA 3I0OA 4DR4T 3OSQA 4Z0IA 3K6VA 5AA2D 4PNIA 2Q9QB 5I5PA 3K0VA 2VASA 3MVWA 4P1LA 3OXNA 3G06A 3KINB 4OK0A 3PPRA 3C9HA 3W15C 2V1DB 2H9BA 4ZEDA 1UGOA 4QSEA 3TAJA 3RC3A 3LBXB 3QSLA 4BDRA 5DYHA 4H67A 4LZ8A 3U65A 1OLAA 3EI0A 1JEUA 1MXYA 3HKDE 3RTWB 1ZEEA 4IE6A 4KMCA 3LBSA 1YQ4A 3C4WA 2PX1A 2JJ9A 4M4GA 2E8IA 3DP6A 2DWGA 4GYRA 4CI2B 4HCYA 2HH7A 2DI4A 3SERA 4AI6A 2ZMBA 1AL3A 3KG2A 1NENA 1RDYA 2IEEA 2QS3A 3AAEB 4CQIA 1HFAA 4O8MA 4PK4A 4HXVA 2BVLA 2VKJA 1H3DA 3IL1B 4OFZA 5BWJA 2BJJX 3GMIA 4JWOA
chains in the Genus database with same CATH topology
2H99A 2ONSA 1A7LA 3KN3A 2CXFA 3MKDA 3N9NA 3H37A 1B4HA 3EN3A 3Q5XA 2HAVA 1XHYA 1MMAA 3FJMA 4QFOA 4PFTA 2LT3A 3KZGA 3B6TA 3P7IA 4HN9A 4X1IE 1MIVA 2KXPB 1Y1ZA 4ZE9A 4KYDA 2R71A 3PMVA 2VKOA 1S50A 3IB2A 2UVIA 3AA1B 4G77A 2DP8A 4C1UA 4JSDA 4F22A 2E0SA 5EK2A 2H7VC 1QVSA 4UACA 2I49A 2I0CA 1ZKBA 1GR2A 2XAFB 4KPTA 5JR9C 2XD2A 3N6TA 1N7WA 3K1NA 2B65A 1JVYA 4G63A 2OWTA 4N07A 3N9PA 1SI0A 5CB4E 2X9HA 1HTJF 4DZ1A 2XXQA 2F6GA 2OK2A 4ZS9A 1B3FA 2QS2A 1QUIA 3IR1A 5EK4A 3GWHA 4L9IA 4JBZA 4R6HA 4ISUA 1MDQA 4FE8A 2MOZA 3UULA 4EQBA 5F1QA 3TCGA 5CMMA 5LBQB 4ASKA 4LATA 2DNXA 2QMXA 2HZKA 3O1JA 3B7DA 3G3KA 4PFOA 4M1PA 4TX5A 2ZM0A 3J9X1 2WSSV 5JDMA 3PD8A 4U4SA 4X1DA 2EHOA 1USYE 5LA6E 5LJNA 4QHQA 3U92A 4NWDA 3DP4A 3K1PA 3W9VA 3KJTA 2H3RA 2HQ0A 5TP9B 2W7YA 2O69A 2P1SA 3FXQA 4AXPA 3C51A 4UF0A 2RP4A 2YLNA 2XQYA 2VD3A 5FYMA 2XHEB 4G8HA 2LEHA 3RNNA 5I2KB 3TQLA 4PQJA 4ZEIA 3BFUA 2QPQA 3CQCB 3WAEA 3DP7A 2BVMA 4OERA 3FD3A 3G3FA 2EHOD 2LHRA 2IAKA 1IITA 1IZNB 1D1AA 2V3TA 4CZZB 3MP1A 3MPKA 3RT8A 1MH4A 3OSRA 3OO8A 3V5AA 1YAEA 1KNZA 3C35A 3ECRA 2A5TA 1N04A 2Q2AA 3UTKA 2CMOA 5KMGP 1O64A 4X48A 2X0LB 5LHGB 3PU3A 4QKNA 1L5TA 4O4JE 1Q1KA 4L0RA 3FXDB 5LG4A 3H6WA 3K4UA 1LFHA 2Z8EA 2XXIA 5JREA 3UP9A 3L6GA 2QJEA 1PEBA 4BJNA 5FXZA 1ZTYA 3CX8B 3Q25A 3MZBA 1PB7A 3L6HA 4WNKA 1SYHA 3EDVA 4NE4A 4ZEFA 3RUMA 3G3GA 3N5LA 4IE5A 2ZNUA 4IO4A 2PG8A 3ZC0A 4BLAA 3VE1B 3LBXA 5FXXA 2ALUA 2F36A 4GOUA 3ZJ2A 5L3CB 4FI5A 3VU7H 3IOVA 2AL4A 3K00A 4YZZA 4HEAA 1LB9A 3DM0A 1BP5A 4KCCA 4ZS2A 4OQOA 2DVCA 2VP1A 2XX8A 4GFRA 3CSGA 2H5YA 3F11A 5BMVE 1YKEB 1MMNA 4NEDA 4YAHX 1MY4A 1VFDA 2XXTA 1LVFA 5KX5E 4OHFA 2ODUA 3PU5A 3TYHA 4YICA 1NH7A 3IORA 1FQEA 2K48A 3MZKB 2CE7A 1N3WA 5CBSA 1WLXA 2NTYA 5A1LA 4UEMA 3MK7C 3CKDA 3KV6A 2JRKA 3RX6A 3N9LA 3CG1A 2NW8A 1FW0A 2YU2A 1GGGA 3D4GA 1FTJA 1N84A 5JDNA 3K6WA 3RN8A 2PJQA 2RC8A 3RLFE 3UIFA 5L9OA 2XXHA 3ZC1A 3K3QC 5LGUB 1H7CA 4MLKA 1NNFA 3UT5E 4OESA 2GHBA 3Q29A 4V1Av 1HS7A 2LJLA 1CE2A 1S9TA 2O68A 1NKXA 1IUDA 5KDTB 3UFEA 2P2AA 3UUMA 4FJOA 4F1VA 5CRYA 4I4TE 3DELB 2V7KA 5JK4A 2W63A 3IO6A 5F8PA 4KYSA 4XKNA 1B7TA 2XAQB 3FB2A 4H9PC 1GTKA 2DXRA 3DJBA 4H6DA 4O3BA 4GRKA 2AIXA 4RYAA 4QWNB 5FHOA 4OVJA 5J2TE 4AKRB 4EF2A 4XBFB 2F7AA 5LHHB 4ZI3D 3VV5A 3O1HA 1MS7A 4Z8XA 1MM7A 1G8XA 2A5SA 1HG2A 2CLYC 4CXYA 1MXUA 2N2NA 2P9BA 4MHCA 1F9BA 2ONKE 3Q27A 2Z22A 1BR1A 2DVZA 5FTHA 1MMGA 4XTCQ 3TTRA 3MZ1A 3V8XB 3R26A 5DVFA 3HHGA 3TQWA 4AQGA 1AOVA 1B4ZA 5LP6E 5L3EB 1VFEA 2OA5A 2F97A 3BK9A 1Y64B 5JDQA 5J2UE 2XX9A 3HKCE 1MIWA 2QRYA 2LSGA 3I1AA 1ELJA 4I43B 4AKGA 2O1LA 2QL3A 1XVXA 5DEXA 5LHIB 3FJ7A 2DLRA 4J2CA 1WODA 2ONRA 2PFVA 3PURA 2H7OA 5ITPA 3CVGA 3JYRA 3C50A 4PFPA 4PJNA 5EK3A 4Z7EA 3USDA 4PFYA 1Y3PA 4XAXB 3RRWA 3ONXA 5H8FA 5M2VA 3K8PC 3IBPA 2R6GE 3AA6B 3N9QA 5DQWA 1EZOA 1P1OA 3SWHA 4G68B 1QKBA 4ELOA 2VL8A 4YKIA 2ZMAA 5HXEA 4R9GA 2PBWA 2DOJA 2Y7IA 2JMKA 4UV8B 2LAOA 3GN5B 1SW2A 3SEYA 3T22A 3VHLA 1CB6A 3SESA 2VK9A 5CA0E 4TV8E 4YJ2E 1DPPA 4OHNA 3FHNA 1O63A 2MTQA 3I6VA 1NNKA 5ELVA 3B13A 4C0RA 2X9XA 3QAXA 1M5CA 4YB6A 3V5SA 3N2GE 1UIUA 2UXAA 4RJZA 5JRCB 4JB7A 1B58A 4IO6A 3W9WA 2F7BA 3PPNA 2VD2A 3R7XA 3OYXA 4DIGA 3TTMA 1MPBA 2I4BA 4TZ4C 3ZCIA 1EU8A 3RY3A 2NOXA 4IB2A 3KN7A 3SOLA 3KOTA 3V89B 3GBBA 2V7JA 3ZMSB 3QXMA 4JUYA 3K3NA 4R73A 5HM4B 1Y20A 2F8DA 2REGA 4F3BA 4EUOA 2X51A 2I6EA 2X9WA 2XTLA 5FXWA 1LCTA 1MQGA 5FMNA 5EHMA 4H63H 3KJ7A 3K01A 4PFUA 3Q26A 5LOVE 4I62A 4NF4B 1WVJA 3K6UA 3PUQA 3RC8A 4P09A 4GVOA 4CI3B 1USYH 2V7MA 2GFEA 1PB8A 4EDPA 2JPFA 5JDLA 1LFGA 3HN0A 3JZJA 3KSXA 1Z7ME 3HPIA 4MLVA 4RXLA 3ANWA 5IKBA 4YHJA 3QUFA 3T9VA 1MY3A 2XUEA 3GBAA 2UYFA 4PP0A 1S35A 4TN7B 5I2KA 4ZZEA 3LK42 1HSJA 4MFRA 3T9UA 4R6YA 4BA9A 1VE4A 4MBPA 5H8QA 3KBRA 3ETVA 3BQKA 3ZN1B 2ZYOA 4IGTA 1B3EA 1YW0A 1A99A 2UXXB 3VLVA 3TCFA 3CQXC 5C8YE 4P0BA 3F31A 3D0TA 2D5WA 3E0ZA 4OYKA 4LZ7A 3K6XA 3MP8A 4O4LE 5ICTA 5H8NA 3PMXA 2VHAA 3PTRB 1US5A 3MW0A 1AIVA 1H43A 4ESWA 3CX6B 1JQFA 5FY0A 1HF8A 1P1NA 1A55A 4O2BE 1OVTA 4H8IA 4BDQA 2F7CA 4GYSA 2NXOA 3GZGA 3GA8A 2VOZA 4F2QA 4IO2A 1ZJLA 3ZMTB 3K2DA 2FYIA 3CVRA 3D4CA 2D0UA 3HCQA 1POTA 4H63V 3SETA 4OZ9A 4GIWA 4WW0A 3OJAA 4Q5TA 1MNEA 2W62A 3RH3A 3RYHE 4P11A 5AA2A 4G4PA 1QULA 5AA4B 4R75A 1MXWA 4QFPA 1VOMA 3C34A 3UK4A 2RA1A 4PETA 1URDA 1GVCA 4MBQA 3GN5A 2ZM2A 2GH9A 3E9XA 3MWBA 3MA9A 3U1OA 3OELA 3MVYA 3VXCA 5I2NA 4WKMA 4R2BA 4C91A 3FV2A 2V93A 2CMRA 1XS5A 3IJXB 1I6AA 2KZ7B 3LUYA 3N9MA 1AH5A 2PVUA 3PMWA 3C4MA 4DBRA 4KR5A 3M8UA 3KBUA 3KV5A 1OLCA 2X9YA 1D4NA 5FNVE 4FEBA 3BKIB 4PJJA 2QA7A 3N6UA 1IJ5A 5AE4A 1SBPA 1X79A 5JEIA 2AYSA 5I59B 4ZS3A 3H03A 3N2OA 3MJXA 2YEVC 3IHRA 3BBRA 2D5UA 4HE8A 1ATGA 4FJPA 3ZKKA 3H6TA 2IW5B 4H65A 2ES0A 3TCHA 4IO5A 1SW4A 2HFBA 5H8FB 5FHNA 1FQAA 3OKQA 4UV9B 2NW7A 4U22A 5I58B 3VLWA 1M5BA 4XKRA 2O1MA 1MG1A 4GXSB 3NRXA 4X9TA 1ZKEA 2DWIA 2KLFA 4RY1A 2D2SA 3TUSA 2C5JA 4QX8B 1IXGA 1A8FA 5JVDE 4F3GA 3T9XB 1BR2A 3MBPA 3KVBA 3C64A 3MC2A 3H4ZA 1YCJA 3UN6A 3GLBA 3PUAA 3E13X 4G8MA 5LBMA 5KDMC 2RCAA 3CIJA 3PE0A 3S2VA 4JEHB 3ZKLA 1MM6A 3RTFB 5TU0A 1ZLQA 2XASB 1TFDA 4JWXA 4IIJE 3RYIE 1J1NA 4UVCB 2WBLA 1SA0E 2Q9QD 4E7SA 4QFLA 5AA2B 2DHRA 4EYYR 1ZHCA 4EZ4A 2RINA 1A54A 3L09A 5ICQA 1BKAA 3A09A 3U78A 4PW8A 4GOTA 2VB6A 4DNDA 2E9XA 4NF5A 3L3PA 3MVZA 5L8DA 4PJMA 1QW0A 2Y48B 5LGTB 4EXLA 4PK6A 4MLQA 4DCXA 4ECFA 1II5A 1AMFA 2ZYKA 2ZXTA 3RT6B 3TTNA 3SDFA 1SYIA 3LSFB 3R6UA 3FXUA 3CQGB 2XXYA 4N6PA 3EPEA 2KMFA 4DXCA 1IAPA 4EQ7A 1VSOA 4XKPA 3N2KE 4O4IE 3NZPA 2CA5A 1OWAA 2REJA 1IQ7A 1U4QA 5LCYA 5DT6A 2F35A 3ESLA 5HXHA 5FXVA 1MMDA 4O3AA 3ZMZB 1XC1A 3LSLA 1MIYA 1BR0A 1IEJA 1US7B 3IJOB 3PPOA 1PBQA 3O2AA 2O7UA 1B1HA 5L3GB 1E1HB 2K24A 4H9NC 1Y3NA 3CSBA 3NRYA 4BDNA 4IE4A 2MBGA 4YKPA 2E9XD 4ZI3C 1BR4A 5I57A 2YU1A 2V3UA 3IOWA 4ZOLE 4NUUA 2NW9A 1XVYA 1ZBMA 3EHTA 3IK6B 3RPWA 1B52A 2XXVA 2WAUA 4GXAA 3EQ1A 3CWZB 1B7UA 3ZYMA 1CUNA 3Q28A 1SD3A 4ADZA 4KBMB 4TQUQ 3C98B 1B0LA 1BTJA 4GK5E 2D3IA 3RGYA 3CFZA 4WBNE 5LXTE 2I4CA 2Q9TA 4CI1B 3BFTA 3H3AA 3SEXA 1YKHB 3PUXE 3M3FA 2Y84A 4U1OA 5KZTA 5L9MA 4LP2B 3ZLIA 3T93B 1PBPA 1UTHB 3FXEB 3JV9A 2O51A 1B7ZA 1H76A 1MXXA 1RKMA 3G3HA 4U2RA 3PUYE 5DQVA 3LSXA 5AFUL 3NBXX 3HV1A 4GLIA 2UVGA 2YPNA 5H8HB 2E9XC 4IO7A 1S94A 4EOZB 3O28A 2VWAA 1FTLA 1B5HA 3S9NC 4OEVA 1B3HA 1UX4A 2LM9A 1B3LA 2F6PA 3K1MA 3WI3A 2Q9QC 2CM0A 1VR5A 2DE4A 4X1KE 2DS9A 4G8NA 2ZYMA 4G2ZA 2YINA 3B6QA 2K5BB 2KWHA 1Q35A 4R72A 3RKOA 1WDNA 2OZZA 4NMYA 4P0GA 3KV4A 5F7VA 1MPCA 4IE0A 4ERRA 3Q9DA 2CCQA 3IB1A 1IXIA 3FBZA 4H1XA 1I6QA 4HW8A 4KD5A 4M1VA 2HCAA 4ILUA 3TODA 3W15B 4ELQA 1MQIA 1MY2A 4RK2A 2HPJA 3CRBA 5L2LA 2Y7WA 4NF6B 4OENA 4OFOA 4EYUA 1ZIUA 2THIA 2QS4A 5L9SA 4G68A 4R74A 3C4ZA 3KOSA 1MY1A 2KINB 1P1UA 1Y9UA 2B1EA 3E4RA 4ZEBA 3A3CA 3TKDA 5I56B 5EHSA 1B51A 3VVDA 3O1IA 2CZLA 2V84A 4KYEA 3CFLA 1P1WA 1B05A 4UA8A 3UA8A 2DQVA 3MAMA 2VKDA 4F39A 2F78A 2ZYNA 4MFIA 5JH7E 4POWA 3MVXA 4TUYE 4ISSA 4AQFA 4OTEA 3OO7A 5CMBA 3MXZA 5DVJA 1LAHE 2X26A 4MALA 1O3XA 3LFMA 5KDTA 3PUZE 3QYTA 2I48A 1IJ6A 1NMUA 4KCDA 2AL5A 5I84A 2LSKA 2JQQA 3I9WA 3AAIA 2C5IT 2Q8JA 1OVBA 2WWUA 2RCBA 5JDFA 3IX1A 3FATA 2ESNA 2HXWA 2XAGB 4UVAB 1DPEA 3M65A 3SEWA 1FIOA 2F34A 1MXZA 1KK7A 4K3FA 1V9DA 4IY5A 5B70A 1M5DA 1VRBA 3PPQA 2C0SA 2Y8DA 4HTGA 3MQ9A 1DSNA 1JW4A 5HWYA 3QC9A 4RNSA 2L8KA 3EHUA 4HTEA 1LAFE 1Y3QA 3S4UA 2NWBA 1G73A 1JETA 4CXWA 4WXJA 3VDFA 4BAYB 4EXKA 2QMWA 5TPAA 4ZE8A 4DCYA 1YTVA 1HCIA 2N9DA 4NWCA 4PFWA 4OFJA 4I55E 3UUNA 5LYJE 1LSTA 4GL8A 3FBLA 3R84B 3N9OA 4THIA 4HFVA 3I9YA 3HKEE 2XXPA 4RPNA 3TZAA 1D0YA 3BQLA 2H25A 1BLFA 3HR0A 3WAKA 2PT2A 4TV9E 2B3FA 2WKYA 3VVEA 5LOMA 1N0TA 2W61A 1OIBA 4YB5A 4F2OA 4ISTA 2P0SA 3PV0E 4OXVA 5AA4A 2CWYA 2Z8DA 1NH8A 1UTBB 3QUJA 2KT9A 5JTYB 4IO3A 1HG5A 3M3LA 1FQDA 4H8JA 3RYCE 5H8NB 4N13A 3HSTA 4BDOA 1MDP1 1P99A 5K2YA 4DXUA 2DE2A 3C31A 2K9AA 5I57B 3F2EA 3SEUA 3U3IA 3RQTA 5FTIA 4ANJA 4I8CA 4MF3A 4AQ4A 2YJPA 5F3JA 4NF4A 2NOOA 2R9JA 4DBQA 3LR1A 4PE5B 3ZN0B 2NWJA 1H45A 4GF8A 2XAJB 4LVQA 5ADXL 2V25A 5CBRA 4XIGQ 4OYJA 3B57A 1B0HA 3C33A 2ANJA 2O7IA 1N76A 2UXNB 4PAGA 4ELRA 2Q2CA 1SW5A 5M4YA 3H6VA 1R1NA 2RF1A 3FZVA 2DWHA 3V5UA 5H8QB 1FEWA 1SQYA 1U5PA 5TP9A 3MP6A 2Q89A 4ZHQE 2C5KT 1IXHA 5DTBA 2EHOC 1JVXA 3FGSA 1HX8A 3S9LC 5GONE 3KEIA 2Q88A 1FTKA 4YB7A 1D9VA 5HXRA 1R9LA 4OFLA 2XXXA 1NWMX 2XXRA 5CC2A 2XD3A 5FY7A 4EAHA 2Q9QA 4DO0A 3O9XA 1B32A 1T98A 3SS1A 4NF8A 1QUJA 5HYAA 3O9PA 4F1YA 5A5XB 2I59A 5EZYE 1LKXA 3H6UA 2HEUA 3CFXA 3E22E 3FVKA 2Z23A 2N1GA 4UVBB 4OETA 4NF8B 3SKPA 4H9OC 3O4XE 3PDYA 3KFWX 1LCFA 4U21A 4P0IA 4XZCA 3RPUA 4AKHA 4JSOA 4I50E 2V7LA 4YKKA 4H5GA 1LGBC 1ZU0A 1B2HA 4ZI2C 4IE7A 3T96B 1SHZC 1FQFA 5FHMA 1Y1MA 5EYFA 4F1UA 5CI5A 3THIA 2UVHA 4LA9A 2FNCA 4GWOA 3H3GA 4U72A 4YFSA 3ETUA 1US4A 4ONYA 2QGSA 1LFIA 2PYYA 2SPCA 3T9HB 5CM6A 2ZM8A 4EXTA 2NP9A 1MPDA 4WEPA 4IGRA 5DEXB 1LBBA 4LZ5A 5LJMA 3KFMA 1WRDA 1GV8A 2E9XB 4NF5B 4F29A 4YMBA 5K2XA 1FQCA 1URGA 5A5XA 1T0KA 3FVNA 1D1BA 2ZNSA 2X7QA 2XXUA 2VKHA 4TOZA 4YMAA 5ETWA 4DXBA 4CXXA 4AKIA 3OO9A 2DWAA 3PGFA 3V83A 1B9JA 3WAFA 1FQBA 3UORA 3EHSA 5HPQA 1D0ZA 5E0OA 1OMPA 3N94A 3KDSE 5JR9A 1MRPA 3DTOA 3Q5WA 5KCJB 2Y7KA 4B6XA 5IHYA 1D3KA 2QSXA 3OEKA 1SVXB 3TEPA 3U94A 4GD5A 4QHOA 2DXYA 3VLUA 1JW1A 3A3UA 3FVOA 2JMHA 4G68C 2O6AA 3R6NA 2HAUA 1FMVA 5H6QB 1AJ3A 1YD8G 1NFTA 1XOCA 2DWJA 3IAZA 3AA0B 4PJLA 3PUVE 5CA1E 4EB6E 4DE8A 3OOAA 1R9QA 3CI8A 5HAXA 1O7TA 1H44A 2PMSA 2A3DA 4RPOA 5CMKA 2Y6XA 3C4XA 3VVFA 1LRZA 3FV1A 5HWXA 3LC8A 3H7MA 5JR9B 4ESXA 3HA4A 5KCJA 4DVDA 3ZMVB 3TPAA 4RA1A 4O2AE 5HBCA 4GL0A 4ZEKA 2Y7RA 3QIMA 3CPZA 4IHJE 3TTLA 3E08A 1M5FA 5TAOA 2A5TB 5L3DB 2DYXA 3F57A 4E7ZA 2ABHA 3VFJA 3I0QA 4Q0CA 1A40A 1MNDA 4HKAA 2NUVA 4DMWA 4WEDA 1SW1A 2MYSA 4BJMA 2G93A 3OYZA 2EHOB 4FEDA 4UELA 3CR9A 3ONMA 3O6HA 3ZEFB 4KP3C 3FUZA 4U23A 1I69A 3IO4A 3U72A 3EUHA 5DABA 3HKBE 2V7IA 3WAJA 4OYVA 4UF0B 3MPLA 4XXUA 2DWKA 2GRVA 2WMNA 3VKHA 3ZYLA 3OENA 2D0TA 5JDHA 2OWSA 1RYXA 2XAHB 3ZJ1A 2H98A 3ZS6A 4EIWA 3NZQA 3RYFE 1ZMGA 1B6HA 3O6IA 2LSYA 3ZCJA 2LOPA 1Z0PA 1S7YA 1TFAA 2W0GA 5FP3A 1FMWA 3FASA 4N78D 1A8EA 3ODBA 2PT1A 5JRCA 3CMLA 4H5FA 3KV9A 3N26A 5IAIA 3ZSFA 2OCUA 4K0UA 5FY1A 3PPPA 1EZ9A 3TFLA 3DP8A 1MXVA 1PC3A 4QF9A 1WYCA 5JQGE 3KGCA 2X68A 2M8CA 1PDAA 2CWOA 2CLYB 4AQFC 4LQ5A 5JDGA 4YJ3E 2LHNA 1NAFA 1N7XA 3S9EA 4AKLA 2OLBA 2LSJA 3RRCA 4UIGA 1QJMA 3IF8B 3O66A 4E0WA 1UTHA 4I9DA 1NL5A 4JXIA 3TTKA 1POY1 3AAAB 3ZYKA 4ZI7E 5H6RB 3SRZA 4ZZAA 1LBCA 2M67A 1JEVA 5L3BB 3OBVE 1TT1A 1OQHA 3DLNA 4Q8RA 5LNKA 3C32A 2ACXA 4AB5A 2NVUB 4FIMA 1SDXA 1JW5A 2Y7PA 2XHDA 1WR6A 4L17A 2RKMA 4F3PA 1NNTA 4QX7B 1B1XA 2PBIA 5DVIA 2IA4A 2OBGA 1LVKA 2LSIA 4QFNA 1QUUA 5AA1A 4G2AA 2QS1A 1B46A 4HS7A 1B3GA 1JNFA 2L3LA 3UUXB 3ILTB 4F19A 2I3VA 3G3IA 5I59A 1DMBA 1Y4CA 4LUBA 4KI0E 4C90A 2FA7A 4POXA 2HZLA 4QFKA 3TMGA 1DOTA 2IC6A 3MACA 4BDLA 2IC9A 4KQPA 3EDUA 4LONB 1LAXA 1UQWA 2HPLA 1NNPA 5B7DA 2KLQA 2J1DG 4H0WA 2UVJA 1D1CA 4PK5A 3CX7B 3VXBA 3E3KA 1TXFA 2I3WA 3T8OA 3IOUA 4NTLA 2I0BA 4MH5A 2BZBA 4IDZA 1D9YA 3G3JA 4DMVA 1M5EA 2Z8FA 2W00A 3LG7A 1DTGA 4E0XA 3O97A 1QSDA 2X67A 4QXHB 1Y4TA 1OXZA 1UIVA 4KHZE 1MH3A 4EQ9A 4OMBA 3AVSA 1I6BA 3PUWE 5IYZE 2G29A 3KSJA 1XT8A 1ZV4X 2O84X 1UX5A 3J7Yq 4YU0A 4L5GA 1FTOA 4OWDA 1LAGE 1UCUA 3AB3B 3U8QA 3IOTA 2LOSA 2CXLA 5L3FB 3Q2MA 1MQHA 3ZPOA 1WYBA 4YKJA 3FXRA 3U93A 1OQGA 4UXNB 4P0AA 2YK0A 3S9MC 1D0XA 4HGAA 4JLEA 4WBOA 4Q30B 1B5JA 4H9QC 3KBTA 3M3KA 2NTXA 3LK3B 3OO6A 5BUUA 4TLLB 3LSWA 3MJNA 4O8SA 4NUVA 4H9SE 3MUQA 4IY6A 3ZMUB 4I1DA 3EVYA 4R9FA 4GK0E 1EZPA 3PD9A 5AA3A 2VGQA 2XXWA 1FCKA 4HCWA 4EZHA 4ZECA 4DLDA 3K3OA 3ANWB 1URSA 2I58A 3KN8A 2Z6EA 4OEUA 1HSLA 2XX7A 2GK9A 4DDDA 3JC6D 4JDFA 4XKQA 1B40A 3HHFA 3FJGA 5JTYA 4FATA 4F6RC 5J1GA 3TDJA 4U4XA 2D21A 4ELPA 1B5IA 4X20E 3O6GA 4FECA 2ZLYA 1LB8A 3P8CD 4RK9A 3OD7A 2F5XA 2B3BA 1MQDA 1IZ1A 1MQJA 5TPAB 1QKAA 1FTMA 1RYOA 3PUGA 4C1TA 4ND9A 2LE8A 4QXCB 5I2NB 4QSCA 3HI2A 1QUKA 3IB0A 5HXSA 1N3XA 1MY0A 2H4IA 4R2FA 3K02A 4GIZA 3I5OA 3PU8A 4AB6A 2X66A 2G0UA 1IIWA 2CXDA 2CEAA 3KVAA 3QK6A 4FAJA 4F31B 3SEVA 5LGNB 4ZDMA 3JC6C 5DJQC 1IXCA 4QRZA 4YLHA 4O4HE 1EH3A 3GXAA 2UYEA 3PUSA 1PB9A 2DCFA 2OJTA 5ITOA 4KUMB 2E1SA 4GQOA 2V26A 2DSFA 2RC7A 3TELA 1EZ3A 2ODVA 3CG3A 3OEMA 2V3QA 1UTBA 5I58A 1DTZA 1B7HA 2WMOA 3LK2B 2KWIB 4O3CA 3IEEA 5I56A 3UGWA 1P1QA 2DE3A 3AA7B 4IGUA 4JWYA 2ZNTA 4TLMB 3FVGA 3OMBA 4A56A 5J1DA 4R6KA 2A2FX 3T66A 3MZ9A 1BIYA 4X1YE 4FORA 3TKLB 4U74A 5CMCA 4ZI2D 3C36A 3HL6A 1Z7NE 2GHAA 4EF1A 4X1BA 3B6WA 3LJCA 5ISUA 3AXFA 1HSEA 1TWYA 3A5XA 3I3VA 3VKGA 2L9QA 5HXCA 1SI1A 3H06B 3ILUB 5H8HA 1ANFA 4F18A 1LLSA 2RC9A 1KWHA 3FIRA 4H9RC 4JEUB 4KFQA 3BQIA 3O29A 4NF6A 3EF7A 2A72A 2BDEA 1YPNA 5H8SA 2KNDA 4U1ZA 4QSDA 4F3SA 3HO7A 4BDMA 3G7WA 1R6ZA 2X7PA 4QXBB 4LQ2A 2WM9A 3AVRA 3I0OA 3OSQA 4Z0IA 3K6VA 5AA2D 4PNIA 2Q9QB 3K0VA 2VASA 3MVWA 3OXNA 3KINB 4OK0A 3PPRA 3C9HA 3W15C 2V1DB 2H9BA 4ZEDA 4QSEA 3TAJA 3RC3A 3LBXB 3QSLA 4BDRA 5DYHA 4H67A 4LZ8A 1OLAA 1MXYA 1JEUA 3HKDE 3RTWB 1ZEEA 4IE6A 4KMCA 3LBSA 3C4WA 2PX1A 2JJ9A 4M4GA 2E8IA 3DP6A 2DWGA 4GYRA 4CI2B 4HCYA 2HH7A 2DI4A 3SERA 4AI6A 2ZMBA 1AL3A 3KG2A 2IEEA 2QS3A 3AAEB 4CQIA 1HFAA 4PK4A 2BVLA 2VKJA 1H3DA 3IL1B 4OFZA 5BWJA 2BJJX 3GMIA 4JWOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H99 A;  3CR9 A;  3ONM A;  4ELQ A;  2ONS A;  1MQI A;  1A7L A;  3O6H A;  1MY2 A;  4R73 A;  5HM4 B;  1Y20 A;  2F8D A;  3KN3 A;  3FUZ A;  4RK2 A;  4OEN A;  3CRB A;  2Y7W A;  4NF6 B;  2REG A;  4OFO A;  4EUO A;  4F3B A;  4U23 A;  1I69 A;  3IO4 A;  1B4H A;  1ZIU A;  3U72 A;  2THI A;  3EN3 A;  2HAV A;  2I6E A;  2QS4 A;  2X9W A;  1XHY A;  5L9S A;  2XTL A;  3FJM A;  4G68 A;  4R74 A;  4OYV A;  1LCT A;  1MQG A;  3KZG A;  3MPL A;  4PFT A;  3KOS A;  3B6T A;  4QFO A;  4XXU A;  1MY1 A;  1Y9U A;  1P1U A;  3P7I A;  2GRV A;  3K01 A;  3KJ7 A;  4PFU A;  3Q26 A;  1Y1Z A;  4I62 A;  4ZE9 A;  3E4R A;  4KYD A;  2R71 A;  3A3C A;  3PMV A;  5EHS A;  1S50 A;  4ZEB A;  3IB2 A;  3TKD A;  2UVI A;  4NF4 B;  3OEN A;  2H98 A;  4G77 A;  1B51 A;  1RYX A;  1WVJ A;  2OWS A;  2DP8 A;  3K6U A;  3ZS6 A;  4JSD A;  3VVD A;  4C1U A;  1ZMG A;  2E0S A;  4GVO A;  4F22 A;  1B6H A;  1USY H;  3O6I A;  2GFE A;  1QVS A;  2CZL A;  2I49 A;  2V84 A;  2I0C A;  4KYE A;  1PB8 A;  1ZKB A;  3CFL A;  4UAC A;  1GR2 A;  1Z0P A;  1LFG A;  1B05 A;  1P1W A;  4KPT A;  3HN0 A;  4EDP A;  3JZJ A;  4UA8 A;  2XD2 A;  3KSX A;  1Z7M E;  3UA8 A;  2DQV A;  3HPI A;  3N6T A;  3MAM A;  1S7Y A;  1TFA A;  4MLV A;  1N7W A;  3K1N A;  4RXL A;  2B65 A;  5IKB A;  3QUF A;  3FAS A;  3T9V A;  4F39 A;  1MY3 A;  1A8E A;  3ODB A;  2PT1 A;  3GBA A;  4H5F A;  1JVY A;  3N26 A;  2OWT A;  2F78 A;  2UYF A;  2ZYN A;  4MFI A;  4N07 A;  4PP0 A;  3ZSF A;  5IAI A;  2OCU A;  1SI0 A;  4POW A;  3MVX A;  5I2K A;  4ZZE A;  3PPP A;  4DZ1 A;  1HSJ A;  2XXQ A;  2F6G A;  1EZ9 A;  2OK2 A;  4ZS9 A;  4OTE A;  1B3F A;  3T9U A;  3TFL A;  2QS2 A;  3DP8 A;  1QUI A;  3IR1 A;  3OO7 A;  4R6Y A;  1MXV A;  1PC3 A;  5CMB A;  3MXZ A;  1VE4 A;  4QF9 A;  5DVJ A;  1LAH E;  2X26 A;  4MBP A;  3KBR A;  4JBZ A;  4R6H A;  5H8Q A;  4ISU A;  1MDQ A;  4FE8 A;  3TEL A;  4EQB A;  2ZYO A;  3KGC A;  2M8C A;  5KDT A;  5F1Q A;  1PDA A;  4IGT A;  3PUZ E;  3QYT A;  1B3E A;  1IJ6 A;  2I48 A;  4LQ5 A;  1NMU A;  3TCG A;  4KCD A;  5CMM A;  1A99 A;  3VLV A;  3TCF A;  4LAT A;  2AL5 A;  5I84 A;  2QMX A;  1N7X A;  3S9E A;  2HZK A;  3B7D A;  3G3K A;  2D5W A;  2OLB A;  2C5I T;  4LZ7 A;  3K6X A;  2Q8J A;  3MP8 A;  1QJM A;  1OVB A;  3PD8 A;  2RCB A;  4U4S A;  5ICT A;  5H8N A;  3IX1 A;  3O66 A;  4X1D A;  5EHM A;  1UTH A;  3FAT A;  3PMX A;  2ESN A;  1USY E;  4I9D A;  4E0W A;  1NL5 A;  2HXW A;  4JXI A;  4QHQ A;  3U92 A;  1DPE A;  2VHA A;  1US5 A;  3MW0 A;  3DP4 A;  3K1P A;  4NWD A;  3W9V A;  1AIV A;  1H43 A;  4ESW A;  3TTK A;  1POY 1;  3KJT A;  3SEW A;  2HQ0 A;  5TP9 B;  2F34 A;  1MXZ A;  2W7Y A;  1JQF A;  4K3F A;  2O69 A;  4IY5 A;  5B70 A;  4ZZA A;  1LBC A;  1M5D A;  3PPQ A;  1JEV A;  4HTG A;  1P1N A;  1TT1 A;  1A55 A;  2P1S A;  1OQH A;  3FXQ A;  3MQ9 A;  1DSN A;  1JW4 A;  3DLN A;  4Q8R A;  2YLN A;  1OVT A;  4H8I A;  4RNS A;  3C32 A;  2VD3 A;  3EHU A;  4BDQ A;  2F7C A;  4G8H A;  1LAF E;  3RNN A;  5I2K B;  1Y3Q A;  3S4U A;  2NVU B;  2NXO A;  3GZG A;  4FIM A;  1SDX A;  4PQJ A;  3BFU A;  4ZEI A;  1JW5 A;  2Y7P A;  2VOZ A;  2XHD A;  4F2Q A;  2QPQ A;  1JET A;  4L17 A;  3WAE A;  4IO2 A;  4WXJ A;  3VDF A;  2RKM A;  1ZJL A;  3K2D A;  4F3P A;  1NNT A;  2FYI A;  1B1X A;  2QMW A;  4OER A;  4EXK A;  3CVR A;  5AA3 A;  5I56 B;  3FD3 A;  3D4C A;  3G3F A;  5DVI A;  2IA4 A;  1POT A;  3HCQ A;  5TPA A;  4ZE8 A;  1IIT A;  2OBG A;  4DCY A;  1YTV A;  3SET A;  4OZ9 A;  4NWC A;  4PFW A;  2V3T A;  4OFJ A;  4QFN A;  4Q5T A;  4YMA A;  3MP1 A;  3MPK A;  3RT8 A;  5AA1 A;  1MH4 A;  3OSR A;  1LST A;  3OO8 A;  2QS1 A;  4GL8 A;  4P11 A;  1YAE A;  1B46 A;  3V5A A;  4G4P A;  1QUL A;  5AA2 A;  4HS7 A;  5AA4 B;  4R75 A;  1MXW A;  4THI A;  4QFP A;  3C35 A;  3ECR A;  1B3G A;  3UK4 A;  1JNF A;  2A5T A;  1N04 A;  2XXP A;  3C34 A;  3ILT B;  4F19 A;  2I3V A;  3G3I A;  4PET A;  1URD A;  1DMB A;  1Y4C A;  1GVC A;  5I59 A;  4RPN A;  2Q2A A;  3TZA A;  2CMO A;  2GH9 A;  3E9X A;  3MWB A;  4LUB A;  3U1O A;  2H25 A;  1BLF A;  3MVY A;  3OEL A;  4KI0 E;  3VXC A;  5I2N A;  1O64 A;  2FA7 A;  2PT2 A;  4X48 A;  2B3F A;  2WKY A;  4POX A;  4WKM A;  3VVE A;  4R2B A;  1L5T A;  5LOM A;  2HZL A;  4QFK A;  1N0T A;  1Q1K A;  3FV2 A;  4L0R A;  1OIB A;  3FXD B;  2V93 A;  3TMG A;  1DOT A;  2IC6 A;  3H6W A;  3K4U A;  4YB5 A;  4F2O A;  1XS5 A;  3IJX B;  4BDL A;  1LFH A;  2IC9 A;  1I6A A;  2Z8E A;  4KQP A;  3LUY A;  2P0S A;  3PV0 E;  1AH5 A;  2PVU A;  3PMW A;  4LON B;  4F29 A;  2XXI A;  1LAX A;  4OXV A;  1UQW A;  5AA4 A;  3C4M A;  1NNP A;  4KR5 A;  3UP9 A;  3L6G A;  2QJE A;  5B7D A;  1PEB A;  1NH8 A;  2Z8D A;  1UTB B;  3M8U A;  3QUJ A;  5JTY B;  4H0W A;  1ZTY A;  2UVJ A;  4IO3 A;  1OLC A;  2X9Y A;  3M3L A;  1FQD A;  4H8J A;  3Q25 A;  3MZB A;  5H8N B;  1D4N A;  1PB7 A;  3L6H A;  4N13 A;  4FEB A;  3VXB A;  3BKI B;  3E3K A;  3HST A;  1TXF A;  1SYH A;  2I3W A;  3N6U A;  4NE4 A;  3IOU A;  4ZEF A;  4NTL A;  3RUM A;  2I0B A;  4BDO A;  4MH5 A;  3G3G A;  3N5L A;  2ZNU A;  1MDP 1;  1IJ5 A;  4IO4 A;  1P99 A;  5AE4 A;  4BLA A;  1SBP A;  5JEI A;  5K2Y A;  4DXU A;  3VE1 B;  2DE2 A;  2ALU A;  2AYS A;  5I59 B;  2F36 A;  1D9Y A;  3C31 A;  3G3J A;  1M5E A;  3H03 A;  2Z8F A;  5I57 B;  4FI5 A;  3SEU A;  1DTG A;  3UIF A;  3IOV A;  3RQT A;  3BBR A;  5FTI A;  4E0X A;  3O97 A;  2AL4 A;  1QSD A;  4I8C A;  4MF3 A;  4AQ4 A;  1Y4T A;  3K00 A;  1ATG A;  4YZZ A;  2YJP A;  4FJP A;  3H6T A;  3ZKK A;  1UIV A;  4H65 A;  3TCH A;  4KHZ E;  4NF4 A;  1MH3 A;  4EQ9 A;  1LB9 A;  4IO5 A;  4OMB A;  1I6B A;  2NOO A;  1SW4 A;  3PUW E;  2G29 A;  3KSJ A;  2HFB A;  1XT8 A;  2R9J A;  3DM0 A;  2O84 X;  5FHN A;  1BP5 A;  1FQA A;  4KCC A;  4YU0 A;  5H8F B;  3LR1 A;  4PE5 B;  2NWJ A;  1H45 A;  4GF8 A;  4OQO A;  1FTO A;  4OWD A;  4U22 A;  1LAG E;  2DVC A;  2VP1 A;  2XX8 A;  4GFR A;  3U8Q A;  3IOT A;  3CSG A;  2H5Y A;  3F11 A;  1M5B A;  4XKR A;  3VLW A;  2O1M A;  1MG1 A;  4GXS B;  4LVQ A;  2V25 A;  5CBR A;  4NED A;  4XIG Q;  4YAH X;  1MY4 A;  4X9T A;  1VFD A;  1B0H A;  1ZKE A;  1MQH A;  2XXT A;  1LVF A;  3C33 A;  2ANJ A;  2DWI A;  4YKJ A;  2KLF A;  3FXR A;  3U93 A;  1OQG A;  1N76 A;  2O7I A;  4RY1 A;  4ELR A;  3PU5 A;  3TYH A;  4YIC A;  3TUS A;  3S9M C;  1NH