3QK6A

Crystal structure of escherichia coli phnd
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
308
structure length
304
Chain Sequence
b'KALNFGIISTESQQNLKPQWTPFLQDMEKKLGVKVNAFFAPDYAGIIQGMRFNKVDIAWYGNLSAMEAVDRANGQVFAQTVAADGSPGYWSVLIVNKDSPINNLNDLLAKRKDLTFGNGDPNSTSGFLVPGYYVFAKNNISASDFKRTVNAGHETNALAVANKQVDVATNNTENLDKLKTSAPEKLKELKVIWKSPLIPGDPIVWRKNLSETTKDKIYDFFMNYGKTPEEKAVLERLGWAPFRASSDLQLVPIRQLALFKEMQSVKDNEQDKLAKTTAIQAQLDDLDRLNNALSAMSSVSKAVQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PhnD, subunit of alkylphosphonate ABC transporter
publication title Structure of the Escherichia coli Phosphonate Binding Protein PhnD and Rationally Optimized Phosphonate Biosensors.
pubmed doi rcsb
source organism Escherichia coli uti89
molecule tags Transport protein
total genus 103
structure length 304
sequence length 308
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12974 Phosphonate-bd ABC transporter, phosphonate, periplasmic substrate-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.90 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3qk6A03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3qk6A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3qk6A02
3USDA 2H4IA 1R9QA 3IK6B 2R71A 5CRYA 1PB7A 3IR1A 3Q28A 4ZECA 5AA4A 1OLCA 1DOTA 4ZS9A 5CMCA 3PUYE 1Y4TA 3VFJA 1MPBA 5M2VA 1OVTA 2OJTA 1EU8A 3MC2A 5DEXA 1MPCA 2P2AA 3VDFA 2ESNA 2F34A 1ANFA 4G8MA 1URGA 4ECFA 1MXXA 2C5KT 4GF8A 1EZ9A 5FTHA 1FTOA 2XXXA 2A5TB 4P0IA 3PGFA 2Z8EA 4PFWA 3FJGA 1JVXA 3EF7A 1GV8A 4WEPA 3I6VA 4BDOA 3RT8A 3FD3A 1LLSA 3O66A 2ABHA 3PUZE 2IC9A 3TYHA 1TFAA 4QFPA 1I6BA 4XXUA 4OHNA 5I2NA 1SBPA 1B4ZA 3L3PA 1MXUA 3M3FA 4NWCA 4G2ZA 1EZOA 3JZJA 3T9HB 1JEUA 2GRVA 3SERA 1MQGA 5IAIA 3U8QA 3PMXA 1JW4A 3W9VA 4YZZA 2I3VA 3E3KA 3MBPA 1AOVA 2W7YA 4XTCQ 1AIVA 5KDTA 1YCJA 3B6TA 1N0TA 3OD7A 1BKAA 4U21A 4HTGA 3OO6A 4OFJA 5L9OA 1NL5A 2C5IT 1N3WA 1H76A 4NF4A 2OZZA 4YKKA 1FTMA 2DOJA 2QS1A 3T22A 1Y4CA 5TP9B 4JXIA 4R75A 1DSNA 1N3XA 2AYSA 1PC3A 2VD3A 2ZYMA 1QW0A 1II5A 2ONRA 3AXFA 3TDJA 1MXYA 3EN3A 1ZBMA 2XX8A 3KJTA 3SESA 5L9MA 3CR9A 1US5A 1AH5A 4MFIA 1MH3A 3KEIA 4H6DA 4BLAA 2DWIA 3H7MA 4OVJA 2X7PA 2XXWA 5I59A 3N6UA 3K01A 5TU0A 2OK2A 4TQUQ 4HS7A 5CM6A 3OSQA 2HAUA 1IUDA 1DTGA 3TKLB 3S9MC 4FE8A 3E13X 3A3CA 4DIGA 3PPRA 3V8XB 1QUIA 3S4UA 4F19A 3O28A 4YKPA 1IXIA 2KWIB 4IO5A 1OVBA 1TT1A 1B7HA 4PFUA 3P7IA 4B6XA 1D9YA 4F29A 3H6WA 1SDXA 2ZNUA 4RA1A 3GZGA 2UVGA 3PUWE 4F1VA 1B5JA 1Q35A 3PMWA 3UA8A 3JYRA 4H67A 2O68A 3IOTA 2F8DA 2LAOA 1B7ZA 5AA2D 1AMFA 4KYDA 4U4SA 3T66A 2CMOA 3H3GA 2PMSA 1B2HA 2I3WA 5LOMA 3IJOB 5H8NB 4FEBA 1TFDA 1MG1A 4YKJA 3IOUA 2NUVA 4QRZA 1VE4A 4F22A 2VD2A 1FQEA 1FQAA 4X1BA 1MM6A 4IO4A 2RC7A 4QFNA 3IOWA 1JQFA 4AB6A 3CKDA 1OIBA 3KJ7A 4OQOA 3MP1A 3W15C 1MY0A 3TFLA 1S9TA 2X9WA 1MXZA 5JTYB 4EQ9A 4M4GA 4JWYA 1LB8A 4F3SA 3G3KA 3GLBA 2Y7IA 3DP4A 5IKBA 4GWOA 1D9VA 2Q88A 1UIVA 4BDRA 1Q1KA 1PEBA 2H5YA 4XKPA 1YTVA 2I4BA 3FVGA 3MVXA 4OENA 3FXRA 5DVFA 5KCJB 1OLAA 3QSLA 3ECRA 4QSDA 1B3LA 3CFLA 4RPNA 4DLDA 1WVJA 2B65A 1B0LA 2I0BA 5B70A 3DLNA 5I2KA 2HFBA 3A3UA 4ZEBA 2MBGA 2Y7KA 3SEWA 5CI5A 4TLLB 5I56B 3TKDA 4F3BA 5HPQA 1EZPA 1MQDA 1SD3A 1ZU0A 2QSXA 4U2RA 2Y84A 3BKIB 3VVEA 1NNFA 1B3EA 4FATA 2PYYA 4BDMA 3FVOA 1UTHA 3T9XB 4ZZAA 2I4CA 2QMWA 2FNCA 2ONKE 4YMAA 3LC8A 4FAJA 3OO9A 2E1SA 1B5HA 2ZYNA 4F2OA 2ZNTA 4GLIA 3IX1A 5AA2B 5H8QA 4Q5TA 2F35A 4GXSB 2PBWA 1IZ1A 4ESXA 4OXVA 5CMMA 3CG3A 5CBSA 3PV0E 3ZSFA 3G3JA 1NNPA 3MPKA 3IOVA 4U1ZA 1MS7A 2NOOA 5I58A 2V84A 3LSWA 3MWBA 4GOTA 3RPWA 1A8FA 3G7WA 2XTLA 1B5IA 3LSXA 1O7TA 4YB6A 1N7WA 3HCQA 3IORA 3IB1A 3V83A 3WAFA 4G8HA 1JNFA 3TTKA 4Q30B 2P0SA 4DE8A 5EYFA 4OFLA 1UIUA 4I1DA 3FXQA 3G3GA 1D4NA 2XXTA 3EPEA 5CC2A 4JWOA 4TOZA 1SYHA 3OMBA 2XX7A 1MY3A 3H03A 3S9EA 2UXAA 4ZE9A 5A5XB 3IB2A 2M8CA 3DP8A 5HM4B 3A09A 2QS4A 1ZJLA 1P99A 2O7UA 3N94A 1ATGA 3S9NC 4Z0IA 1OMPA 1DPPA 2AL4A 5BWJA 2X9YA 1FQDA 4P11A 2NWJA 3ZKKA 3PMVA 3FASA 3R6UA 1L5TA 3QUFA 1MY2A 3K0VA 5AE4A 1R9LA 1M5BA 2O69A 5I57A 3U94A 4IB2A 1PB8A 1NH7A 4ELOA 4GVOA 4DXBA 3PPQA 4H8JA 3QIMA 4C0RA 3QK6A 1IITA 3KN7A 4JBZA 3TQWA 2XXPA 4ESWA 3HO7A 3FJMA 2I6EA 1RKMA 2F6PA 2I48A 4LQ2A 2V3UA 3T9VA 3VLUA 3Q27A 3SEYA 3UN6A 2V3QA 1R6ZA 2FYIA 1DPEA 4RNSA 3KN3A 4DNDA 3O6IA 1JW5A 2Q89A 1LAGE 5H8HB 2I49A 1QUJA 4LONB 1USYH 2F97A 3PPPA 3IO4A 3DP6A 2A5TA 4NF8B 3RTWB 5EHMA 4NF5B 3K1PA 2Q8JA 4NWDA 3G3HA 3TQLA 1LSTA 3UK4A 4EXKA 4DCXA 2ZYKA 2GFEA 2ZMBA 1PB9A 2QJEA 4H65A 4R6YA 1TWYA 1HSEA 1S50A 3E4RA 4MLQA 3FXUA 3OELA 1A40A 2HAVA 3KGCA 4YB7A 1IXGA 2B3BA 3N6TA 3ODBA 1N84A 1VSOA 2YJPA 1B1HA 3K02A 4LATA 3PUVE 4KCDA 5DTBA 3TTRA 2PX1A 1B1XA 3U1OA 3N26A 4GRKA 4X48A 3D4GA 2QS3A 2O51A 5FTIA 5BUUA 3SEUA 3TCFA 1CB6A 3IJXB 3PUXE 3ZKLA 1M5DA 3RUMA 2O7IA 2QS2A 3SDFA 1OQGA 1QVSA 4QHQA 1LFIA 3PU5A 3KOTA 3MAMA 4WKMA 3FATA 4R2FA 3MZBA 1QSDA 2XXYA 4YMBA 3UP9A 1B51A 2HQ0A 4MH5A 4R73A 5TP9A 3MP8A 1IJ5A 1IJ6A 1P1QA 2GH9A 3KZGA 2DYXA 2G0UA 1N76A 1ZIUA 1BP5A 2BJJX 4ZEFA 3O9PA 3VV5A 1H45A 4IO6A 4F2QA 4ZEKA 4GFRA 1B6HA 4N13A 3O6HA 4M1VA 2ZXTA 5JK4A 4U23A 4NEDA 3D4CA 4LVQA 1FQFA 2F36A 3E9XA 1EH3A 2R6GE 3EQ1A 2VOZA 4ONYA 3TAJA 3MZ9A 1B4HA 1B40A 4F3GA 2OWSA 1MQIA 1B3HA 1QJMA 3OO8A 5EHSA 4RYAA 4L0RA 1WODA 1DTZA 3F11A 4PETA 4EF1A 3HHGA 1A55A 1B0HA 4FECA 5DVIA 2CA5A 4FORA 3OO7A 3DELB 5F7VA 1BLFA 3MXZA 3ZS6A 1NFTA 1XOCA 1FCKA 3EHTA 4ELQA 3OSRA 3O2AA 5HBCA 3T93B 3GBAA 3M3KA 4F31B 5FHOA 4E0XA 1SYIA 2D5WA 2AL5A 4U22A 1ZLQA 5CMBA 4R72A 4I62A 3G3IA 3CIJA 4WEDA 3O6GA 2GHAA 3H6VA 5H8NA 1B05A 1B3FA 4FIMA 4NF6B 1LBBA 4X9TA 4ZEIA 5ITOA 2DXYA 4OTEA 2XXHA 3K2DA 4RJZA 3IL1B 1JETA 4IO2A 3FUZA 3B7DA 2H25A 1IQ7A 3RN8A 5K2YA 3C36A 3TMGA 2Y7WA 1SQYA 1IXCA 1MRPA 1HSJA 1LAFE 1QKAA 1NKXA 4GD5A 1LRZA 1FQCA 3MJNA 2DSFA 4P0GA 4YB5A 1XS5A 1Z0PA 1I6QA 4UA8A 3MUQA 4JSOA 2F6GA 1N7XA 3T9UA 4POXA 2G93A 1VFDA 1I69A 4KFQA 4KI0E 3IO6A 1FTJA 1FW0A 3CG1A 5I2KB 5KCJA 2Z8FA 4QSCA 5ICTA 2IC6A 1XC1A 4YICA 3IB0A 3FZVA 5L9SA 1O64A 3LUYA 1XVYA 2DWHA 2HXWA 4KQPA 4QSEA 4F1UA 1CE2A 2UYFA 4G68C 3KOSA 4N07A 1P1WA 2KWHA 5I56A 2ZNSA 4R6KA 4OFOA 1XVXA 5H8FB 4G68B 4AB5A 3FVNA 3UIFA 1SW4A 1FTLA 3TCGA 2Q9TA 2OWTA 1VR5A 1RYXA 3FGSA 1MXVA 2XD2A 1I6AA 4EYYR 2YLNA 3CI8A 1JEVA 2XX9A 1LAHE 2UVHA 1NMUA 5AA2A 3CFZA 5TPAB 5I58B 3U93A 4LZ7A 4DXCA 2RINA 3I5OA 1VFEA 2V93A 2Z22A 2NVUB 1Y1MA 2XD3A 1Y9UA 2HZLA 4IY6A 1B46A 3O97A 3RGYA 4G4PA 1DMBA 3MVZA 4ZZEA 4ND9A 4PP0A 3RT6B 1D3KA 3CVGA 1A99A 3OOAA 3KN8A 1LCFA 3TCHA 5DVJA 1Y3NA 4X1DA 2V3TA 1SW1A 3LSLA 3KSXA 2UYEA 2R9JA 2UVIA 1MXWA 4PFYA 4OERA 1FTKA 1XT8A 3FXDB 2XHDA 3CSBA 3C4MA 1POY1 2RCBA 3CRBA 4NE4A 1UTBB 3MPLA 4RXLA 1MPDA 3K4UA 3Q29A 5L8DA 2Z23A 3GXAA 4OZ9A 1QKBA 1US4A 3BFTA 4H5GA 5A5XA 4QFKA 3C33A 1PDAA 3H6UA 1B9JA 3H06B 1QUKA 3VVFA 3FJ7A 5B7DA 5ICQA 2REGA 4GQOA 4GL0A 1SI1A 3S9LC 3TTNA 5KZTA 3BFUA 3JV9A 5CBRA 1RYOA 3HHFA 4JB7A 2NXOA 4YU0A 1MY4A 5AA4B 3C31A 3K1MA 5ISUA 2QPQA 1M5EA 3HSTA 1LCTA 3SKPA 3ONMA 1QULA 4F39A 1A54A 5DEXB 1NNKA 4NMYA 5I84A 2QL3A 2H99A 5AA1A 2ANJA 4F1YA 4PE5B 3H6TA 1JVYA 4R9GA 4OEVA 4NTLA 1KWHA 3OXNA 1P1UA 2Z8DA 2VP1A 5ELVA 4BDNA 4WXJA 1T0KA 2DS9A 1R1NA 4C1TA 3O29A 3FIRA 4J2CA 5JEIA 3L6HA 4XKQA 2DE3A 4ZEDA 4BDLA 1UQWA 1B58A 4QF9A 3TEPA 2WKYA 4G77A 1M5FA 3V89B 1YPNA 1Y1ZA 3K6UA 2GHBA 1Y3PA 5H8HA 5I2NB 1LB9A 2DE4A 2XXUA 2ZYOA 1FQBA 4PFTA 1SW2A 4NF8A 3VVDA 1GR2A 4R9FA 4NF5A 4RY1A 4H5FA 2I58A 4POWA 4HW8A 3OENA 3RLFE 4Q0CA 1ZKEA 2AIXA 4F18A 2XXRA 5AA3A 4IO3A 5CMKA 1PBPA 1LVFA 2XXQA 4Z7EA 3W9WA 2F5XA 4EQ7A 3N5LA 3HN0A 2RC9A 2DVCA 2DWAA 5F1QA 1N04A 3FV1A 5KDTB 3I3VA 4FJPA 3QYTA 4PQJA 2DVZA 4OETA 1H43A 3Q25A 1IXHA 3DM0A 4LZ5A 4H1XA 4NF4B 4RPOA 4DZ1A 1USYE 2IEEA 2C5JA 1H3DA 1MDQA 4IGTA 4LUBA 1POTA 2V25A 1ZTYA 3RQTA 2Q2AA 4ISUA 2Q2CA 4EXLA 3UORA 1BIYA 4IO7A 2HEUA 1MQHA 3VLVA 3KSJA 3TTMA 4YKIA 3R26A 3S2VA 2B3FA 2DXRA 1B7UA 3TPAA 1IEJA 2RKMA 1MH4A 5I59B 4AQ4A 4RK9A 2RC8A 2DE2A 3T96B 3MQ9A 1B52A 3OEKA 1Y3QA 2VHAA 1PBQA 3C9HA 4TLMB 3LBSA 2XXVA 1A7LA 3K1NA 1GGGA 3K6XA 4OYVA 3L6GA 5FHNA 1J1NA 2X9XA 3LSFB 4ELRA 1H7CA 3SETA 4FI5A 4EDPA 4ELPA 3U92A 1B3GA 4XIGQ 1F9BA 3KG2A 3UGWA 4Q8RA 1P1NA 4R74A 1NNTA 4EUOA 2H9BA 3QAXA 2PVUA 2PT1A 4KD5A 3CVRA 1ZMGA 4K3FA 1MQJA 2ALUA 3M3LA 4HCYA 4IGRA 4THIA 1LFHA 1GVCA 2F7CA 3QUJA 4KCCA 4H8IA 5J1DA 2D3IA 4ZDMA 1MY1A 1SW5A 1A8EA 2KLFA 1SVXB 2HCAA 4JWXA 2DWJA 4UACA 1O63A 3QXMA 1MM7A 2A5SA 4L17A 2FA7A 4C1UA 2O1LA 3KBRA 2P1SA 2RCAA 2UVJA 4XKNA 2YPNA 2RF1A 4KHZE 1IIWA 1SI0A 2VGQA 3ILUB 1ELJA 2OBGA 4NF6A 2Y7RA 4U1OA 2OLBA 4H0WA 2I0CA 4BDQA 4KYEA 4KYSA 3H4ZA 3FVKA 5JTYA 1TXFA 4GXAA 4O3CA 2ONSA 3MP6A 3KFMA 2DQVA 3VE1B 1YAEA 3SEXA 5DT6A 4GIZA 4DXUA 3RY3A 2F78A 3CSGA 1LBCA 2X26A 1XHYA 3EHUA 4R6HA 5ITPA 1OQHA 4I9DA 3THIA 1NH8A 1M5CA 1JW1A 1ZKBA 4MF3A 3TELA 2G29A 4LZ8A 4ZE8A 4JDFA 3PPNA 3VXCA 4MBPA 3TODA 1UTHB 3K6VA 4KR5A 4I8CA 3VLWA 3LR1A 3PD9A 4EQBA 4OMBA 4RK2A 3GBBA 1LFGA 4XKRA 1S7YA 2THIA 3WAEA 1MDP1 5H8QB 4OEUA 5H8FA 2F7AA 4G68A 3TZAA 2XXIA 3MVYA 4DCYA 3RNNA 2QMXA 2F7BA 3M8UA 3C35A 2K48A 4U4XA 3OEMA 4JSDA 1HSLA 5H8SA 3B6WA 3MW0A 2X7QA 4KPTA 3TUSA 4CQIA 3FXEB 5TPAA 3FV2A 4LP2B 3B6QA 2O1MA 1GTKA 3K6WA 1P1OA 4F3PA 2CZLA 3EHSA 4EF2A 4QFOA 4QFLA 3C34A 4LQ5A 2Y7PA 2D21A 4G8NA 3SEVA 2E0SA 1AL3A 1LGBC 1H44A 1Z7ME 5DYHA 3RTFB 4E0WA 3Q26A 4GL8A 3HV1A 3R7XA 1Y20A 2REJA 3VXBA 3HPIA 4OWDA 3PPOA 4DDDA 2HZKA 3IAZA 4YAHX 4N6PA 4O3AA 1BTJA 1Z7NE 1URSA 4FEDA 4HCWA 2O6AA 2O84X 3U72A 3C32A 5K2XA 2PT2A 3MVWA 4R2BA 4MLVA 1LAXA 4O3BA 4LA9A 3V5AA 3K00A 1UTBA 3TTLA 5FHMA 2IA4A 3MZ1A 3G3FA 1B32A 1URDA 1WDNA 3ILTB 2OCUA 2DP8A 4OESA 3BBRA 3PD8A 3CFXA 2H98A 5I57B 2QRYA 4IY5A
chains in the Genus database with same CATH superfamily
3USDA 4OVSA 3RPUA 5H8NA 2H4IA 3LV0A 2J1DG 3PTRB 5FY7A 2Y8DA 1R9QA 4YXDA 2NWBA 3IK6B 2R71A 4GWWA 5CRYA 1PB7A 2V7KA 3RPLB 3IR1A 4M1PA 3AE5A 4X20E 3Q28A 4CN6A 3B13A 2D9DA 4ZECA 1WR0A 4X1KE 1OLCA 5AA4A 3AEEA 5F5WA 3A7MA 1DOTA 4ZS9A 5CMCA 1N34T 1S94A 3PUYE 4H9NC 4GWZA 4P3LA 5A5LA 1AWBA 1Y4TA 3MYUA 3VFJA 1MPBA 2XY8B 5M2VA 1OVTA 3RGLA 3KVBA 4IDNA 4OVQA 2OJTA 1EU8A 3MC2A 5IZ1A 3JC6D 5DEXA 1MPCA 1IAPA 2P2AA 2CXFA 3VDFA 1NV4A 2ESNA 1NEKA 4E7ZA 4DR3T 1ANFA 2F34A 4G8MA 4GX3A 3Q5WA 4L9IA 5LOVE 1URGA 3ONJA 4ECFA 2BDEA 1MXXA 2FJBA 2V7MA 3U65A 2C5KT 4GF8A 3L8RA 1EZ9A 5FTHA 1FTOA 1SUMB 2JJ9A 2XXXA 2A5TB 4P0IA 2CHNA 3PGFA 2Z8EA 4PFWA 2BS4A 2N9DA 3CMLA 4TWHA 2YK0A 3FJGA 2JQHA 4MJOA 5FXXA 2V8SV 2W0GA 3RQUA 1JVXA 1YYZA 1DK4A 3EF7A 2KQZA 1GV8A 2ZLYA 3P4SA 3PJAA 4WEPA 4GWXA 3NRXA 2LKHA 1G0HA 4XFEA 3I6VA 4BDOA 3NKZA 3RT8A 5L3DB 3FD3A 4HE8A 2DI4A 3UQ4A 4DV3T 1LLSA 3O66A 2ABHA 3PUZE 3UULA 2OWZA 2IC9A 5LMUT 5KX5E 4PGPA 3TYHA 1TFAA 4PK5A 4QFPA 2ES0A 3QB5A 1KK7A 1I6BA 4A98A 4H9PC 2HPJA 4H9QC 4XXUA 4OHNA 5F24A 5I2NA 5C3JA 1NV5A 2UXNB 5IHYA 4GIWA 4N8YA 1SBPA 1B4ZA 3L3PA 1MXUA 3M3FA 4NWCA 3PDYA 5A1LA 4G2ZA 4CN1A 4IGUA 1EZOA 3JZJA 2WZHA 3LK3B 4X65T 3T9HB 1JEUA 5LGNB 4MFRA 2GRVA 1IMBA 4ZOLE 4OA4A 3SERA 1MQGA 4YSXA 3IHRA 5IAIA 3I1AA 3U8QA 2W61A 1KA0A 3ZT6A 2V26A 5LA6E 3PMXA 1JW4A 3W9VA 4OVTA 3E79A 4LF4T 4N4UA 5F3JA 4IDPA 4IIJE 5L3GB 3T1HT 4YZZA 2I3VA 3E3KA 4OVPA 5FY1A 1KFYA 4UEMA 3MBPA 1AOVA 2W7YA 2L3LA 2WCAA 5JDQA 4XTCQ 5H6RB 1AIVA 4N17A 5KDTA 1MMNA 1YCJA 3B6TA 1N0TA 3OD7A 3RI5A 2LSGA 3PUWF 2KT9A 1BKAA 2BS3A 4U21A 4HTGA 3OO6A 1FJ6A 4OFJA 2CMRA 3ZT5A 5L9OA 3K1SA 2NW7A 1NL5A 2C5IT 3ETUA 1N3WA 3AXJA 4K0UA 1H76A 5J1GA 4NF4A 2OZZA 4YKKA 1FTMA 2DOJA 2QS1A 3T22A 5DW8A 5FL0A 1Y4CA 5TP9B 3AVRA 4JXIA 4R75A 3LG7A 1DSNA 3LK2B 2XWKA 1N3XA 2AYSA 3CX8B 4WW0A 1PC3A 2VD3A 2ZYMA 3IFAA 4KX6A 1QW0A 4EOZB 1FPEA 5LG4A 1II5A 5JR9A 3HA4A 2ONRA 2XAQB 3AECA 5C2TA 3AXFA 2IUBA 3TDJA 2CLYC 4JI0T 1MXYA 3EN3A 1ZBMA 2J62A 3PUSA 4AISA 3JC6C 4EEDA 2XX8A 1MMDA 2LEHA 3KJTA 2LJLA 3SESA 5L9MA 3CR9A 4KHZF 1US5A 1AH5A 4MFIA 4KP3C 5IYZE 1MH3A 4V1Av 3KEIA 2X0HA 1BR2A 3IF8B 2FJDA 4H6DA 4BLAA 2DWIA 3H7MA 2CLYB 4OVJA 3PURA 2X7PA 2JIWA 1FPJA 2XXWA 3GMIA 1NUZA 2CEYA 3N6UA 5I59A 4NXNT 3CQGB 3K01A 5TU0A 2N2NA 1IMEA 2ZZXA 2OK2A 3D0TA 4C91A 5HEUA 4TQUQ 4HS7A 5CM6A 3OSQA 2HAUA 1IUDA 2F3DA 3ZMVB 1DTGA 3TKLB 4TV9E 2XQ5A 3AA7B 4FE8A 3S9MC 3RIAA 4GWYA 2X66A 3JADA 5FNVE 3E13X 3A3CA 5HEGA 1KA1A 4AQFA 3PPRA 4DIGA 3V8XB 1QUIA 4X66T 4NUUA 3S4UA 4F19A 3AA1B 2LT3A 3O28A 4H9OC 4C90A 4DV2T 4UABA 4YKPA 1IXIA 2KWIB 4IO5A 2XQ3A 1OVBA 4P1LA 1TT1A 1B7HA 4ZEYA 4PFUA 3RYFE 4NHBA 2XA5A 3P7IA 2WWVA 4B6XA 1D9YA 4F29A 4YT0A 3ESLA 3ZCJA 3AVSA 1FPIA 3H6WA 1SDXA 2ZNUA 3CQXC 3GZGA 2QVAA 2XQAA 4ANJA 4RA1A 2UVGA 3PUWE 1W09A 4F1VA 4HWDA 1NWMX 1B5JA 1Q35A 3PMWA 1N32T 3UA8A 3UU6A 3JYRA 4H67A 3IOTA 2F8DA 2LAOA 1B7ZA 5AA2D 1AMFA 3QMFA 3H3AA 4I3EA 3RH3A 4KYDA 3AEAA 4HN9A 3LSVA 4ZI7E 4U4SA 3T66A 5JH7E 2CMOA 3H3GA 2PMSA 1D0ZA 4IDQA 4AKHA 3UUBA 3R6NA 2AXDS 1B2HA 4HXVA 2I3WA 5LOMA 3IJOB 1FIOA 5H8NB 4FEBA 1TFDA 4DR7T 5CJ5A 4QXHB 1MG1A 4YKJA 3IOUA 2NUVA 4QRZA 2VPOA 1VE4A 2UXXB 5HEHA 4X5TA 4F22A 2VD2A 1FMVA 2VT5A 1FQEA 1FQAA 1FPGA 4X1BA 1MM6A 1L0VA 3ZC1A 4IO4A 1XNRT 2RC7A 4XF5A 4PW8A 4QFNA 5LBMA 3C64A 3IOWA 1JQFA 4I43B 3RC8A 4AB6A 3CKDA 1X9BA 1OIBA 1CNQA 1OEDA 3KJ7A 4OQOA 1W0AA 2P9BA 1LBWA 3MP1A 3W15C 1MY0A 1WYCA 3TFLA 4O7IA 1S9TA 2J4GA 4U7YA 1ZV4X 2X9WA 5LDZA 1MXZA 5JTYB 3FZKB 2W2UA 4EQ9A 4XBFB 1FPFA 4NF0A 4P0BA 1NV6A 4M4GA 4JWYA 1LB8A 5ET8A 4F3SA 3G3KA 2WYKA 2PG8A 2YN6A 3HKCE 4YJ2E 3GLBA 2Y7IA 1UK5A 2QRXA 5DQWA 3DP4A 2RA1A 2HPGA 5IKBA 4GWOA 1D9VA 5ABFA 1T98A 2Q88A 3RKGA 1UIVA 4ILUA 5EQ9A 3AE9A 4BDRA 1Q1KA 3LBXA 1FBGA 1PEBA 2H5YA 4PE3A 4XKPA 1YTVA 2I4BA 4H9RC 3SWHA 3FVGA 3MVXA 4MLKA 2WS3A 4BJMA 4NIQA 2HN2A 4OENA 3AEBA 3GA8A 3FXRA 5DVFA 5KCJB 1OLAA 1HNZT 4O8MA 3CWZB 3QSLA 1YQ3A 2BG9A 3ECRA 4QSDA 3WI3A 4GK5E 1B3LA 3CFLA 4RPNA 2VURA 4DLDA 2CBJA 4AQGA 1WVJA 1B7TA 5LGUB 2B65A 5FYMA 1B0LA 1VDWA 2I0BA 4PFIA 5B70A 4DI4B 3DLNA 5I2KA 2BS2A 4IE4A 3O4XE 2HFBA 3A3UA 3OKQA 4DIDB 5ADXL 2MBGA 2Y7KA 4ZEBA 4GKKT 2Q74A 3SEWA 5CI5A 4TLLB 4OVRA 5I56B 1G73A 4P09A 3TKDA 3DTOA 3F2EA 3P4RA 2XSAA 4F3BA 5HPQA 1ZHCA 1UX5A 5AQNB 4P0AA 1MQDA 1SD3A 4MEVA 1EZPA 2IW5B 3PUQA 1ZU0A 2K9AA 2QSXA 4U2RA 2Y84A 3GN5A 3BKIB 1NAFA 3EI0A 3VVEA 1LVKA 1B3EA 1NNFA 2LSYA 4FATA 5EQAA 2PYYA 3ZYLA 2UXDT 2LRKA 4BDMA 2QVVA 3FVOA 1UTHA 2WDRA 3T9XB 1UURA 5FMNA 3UT5E 4MX6A 4ZZAA 2NW8A 2I4CA 2QMWA 1IZNB 5AQPB 4TNWA 2FNCA 2ONKE 4AQYT 4YMAA 5L4EA 4KHPT 2ZMAA 5L3CB 3LC8A 4FAJA 3OO9A 2E1SA 1B5HA 2ZYNA 4DO0A 4F2OA 2ZNTA 4IE0A 2JMKA 4GLIA 3K3NA 3IX1A 1XMQT 4GBVA 5AA2B 5H8QA 4Q5TA 4CXWA 3VR8A 2F35A 4GXSB 5AQFB 1IZ1A 2PBWA 3VKGA 4ESXA 1UGOA 4O4JE 2Z6EA 3HKEE 4OXVA 4JI1T 5CMMA 3CG3A 4NPPA 1J5ET 2VVNA 1HNXT 4U74A 2M67A 5CBSA 2LSJA 3NVOA 4GBWA 5L4HA 3PV0E 4UR9A 2QFLA 4P47A 3ZSFA 2LSKA 2JQQA 3G3JA 3C4ZA 1NNPA 3MPKA 3IOVA 1JNZA 4U1ZA 2WU2A 1FTAA 1HNWT 1MS7A 2NOOA 5I58A 1FMWA 3ZCIA 4MHFA 1HFAA 3UU3A 2V84A 3LSWA 3MWBA 4GOTA 2V6YB 1A8FA 3RPWA 2CE7A 4DR2T 4EB6E 3G7WA 2XTLA 2V7IA 4HEAA 1OEDE 1B5IA 3LSXA 2Q9QD 3ZSSA 3HKDE 1ZP0A 4PTKA 2XAHB 1O7TA 4YTMA 5BR8T 4YB6A 4DVDA 4LMJA 1N7WA 3C50A 3NZPA 4KUMB 5AQRB 3HCQA 3T1BA 5GONE 4IY5A 1VRBA 4AKLA 1KNZA 3IORA 1WR6A 3IB1A 3V83A 2H3RA 1INPA 1NV0A 3WAFA 4G8HA 4DR6T 1JNFA 2JJKA 3TLUA 3TTKA 1LBVA 4Q30B 2P0SA 4DE8A 5EYFA 4OFLA 1UIUA 3C51A 3K3OA 1FBEA 2WB5A 3AA6B 3FXQA 4I1DA 2BG9E 3G3GA 4P9KA 4LN5A 2E2AA 4O4IE 1D4NA 2XXTA 3EPEA 3QNUA 4IR8A 5CC2A 4JWOA 3WAJA 2BZBA 4ILBA 4ZXLA 4TOZA 3RHWA 2WMOA 3JAEA 2OA5A 5KXJA 1SYHA 3OMBA 4YTNA 1VCSA 2XX7A 1CUNA 1RDZA 1MY3A 3H03A 1LBYA 3KV4A 3S9EA 5L3BB 2UXAA 3L39A 4ZE9A 3JAFA 4HWHA 5A5XB 2WBBA 2BBJA 4ILCA 3IB2A 2M8CA 3DP8A 3O1HA 5CB4E 5FKYA 5HM4B 3E08A 2FJAA 2EHOA 3A09A 1YXRA 2DWKA 4HE2A 4Z90A 2QS4A 2Y48B 1ZJLA 2WMNA 1T72A 1P99A 1N36T 2O7UA 1U5PA 3N94A 1ATGA 3S9NC 2XUEA 1EYIA 4Z0IA 1OMPA 5EQ7A 3SS1A 1DPPA 2AL4A 3QOFA 5BWJA 5LHHB 2X9YA 1FQDA 4P11A 5BMVE 2NWJA 3ZKKA 2VB6A 1YW0A 3N9MA 3PMVA 3FASA 3R6UA 4PCDA 3CK6A 1L5TA 3QUFA 1MY2A 3K0VA 4PNIA 5AE4A 1R9LA 1M5BA 1QUUA 2O69A 5I57A 3U94A 2HH7A 4OYJA 4IB2A 3NZQA 3ZC0A 2F3BA 4TWDA 4BJNA 1PB8A 1OWAA 1NH7A 2CEXA 2CCQA 4GVOA 2WEFA 3PPQA 4O94A 4DXBA 4ELOA 1HX1B 4ZZCA 4H8JA 3QIMA 4C0RA 1NV2A 3QK6A 3A29A 1IITA 2H88A 4G63A 3KN7A 4I3YA 4JBZA 3TQWA 2XXPA 3PUXF 4ESWA 3HO7A 2ZZVA 4CXXA 5FVKA 3FJMA 2X51A 2XPKA 2I6EA 1US7B 3RPLA 4AXPA 1RKMA 2DCFA 2F6PA 3V5SA 2XWOA 3PTYA 2I48A 4LQ2A 2Q9QC 2V3UA 4JVDA 1FBFA 3MKDA 3EVYA 4EIWA 3T9VA 2E9XD 3VLUA 3Q27A 3SEYA 1XDPA 3UN6A 4JVIA 2V3QA 5ET5A 2VL8A 1R6ZA 4X1YE 2FYIA 4TV8E 1DPEA 3UUMA 4RNSA 3RYIE 2E5VA 2Q9QB 3KN3A 4DNDA 3O6IA 1JW5A 1MNDA 2Q89A 4N78D 4TNVA 1LAGE 3VRBA 5H8HB 2I49A 2V4CA 3DJBA 1QUJA 4LONB 1USYH 2F97A 3PPPA 4GWSA 5FXZA 3RQWA 3VKHA 2Y5LA 1G8XA 3IO4A 3DP6A 3KINB 2XQYA 5LHGB 4PAGA 2A5TA 4NF8B 4JYAT 3RTWB 3AE1A 2XAGB 3AE7A 5EHMA 4NF5B 3CX7B 5EZYE 1FRPA 3K1PA 3X1DA 5JQGE 4YHHT 2Q8JA 4NWDA 3G3HA 3TQLA 1LSTA 3UK4A 4EXKA 4DCXA 2ZYKA 3P4WA 1DCUA 2GFEA 2ZMBA 4Q25A 2ZM8A 2ZM2A 1PB9A 4F8HA 4JI6T 2QJEA 4H65A 4R6YA 5IZ3A 1TWYA 1HSEA 1QGXA 1W0BA 5AQUB 1FPBA 1S50A 3E4RA 4MLQA 2IMLA 3FXUA 3OELA 3UU8A 5JDGA 1LBZA 2HXRA 1A40A 2HAVA 3KGCA 4IE5A 4UF0B 3K3QC 4ISSA 2CBIA 4YB7A 1IXGA 2B3BA 2Y6XA 3N6TA 3ODBA 1N84A 1VSOA 2VKOA 2YJPA 1B1HA 3K02A 1SHZC 5DABA 4LATA 3PUAA 4P56A 3PUVE 5AQTB 4KCDA 5DTBA 3TTRA 2A3DA 2PX1A 1B1XA 3U1OA 2K5BB 3MZKB 3N26A 4GRKA 2LE8A 4G61A 3SFEA 3D4GA 4X48A 4WNKA 2QS3A 2O51A 3UFGA 3BIGA 3BQIA 2LHNA 5FTIA 5BUUA 5HXCA 3SEUA 3OYZA 2WM9A 3TCFA 3ANWB 2RP4A 1CB6A 3IJXB 3PUXE 2CZIA 3ZKLA 1M5DA 3RUMA 3N2OA 1XDOA 3UUNA 1D1BA 4HFHA 1UUSA 3HR0A 2O7IA 2QS2A 3AAAB 3SDFA 2WBLA 3M65A 5AQLB 1OQGA 1QVSA 1ZEEA 4QHQA 5IWAT 1LFIA 3AB3B 3PU5A 2DNXA 3KOTA 2KSRA 2HN1A 3MAMA 3FXBA 3KBUA 4WKMA 4YSYA 3FATA 5ET6A 4R2FA 3MZBA 1QSDA 2WU5A 3ZMUB 2XXYA 2CEAA 4YMBA 1MIYA 1FBHA 3UP9A 3IBPA 1B51A 2HQ0A 3N9OA 3KC1A 4MH5A 5CA0E 4R73A 5TP9A 3MP8A 1IJ5A 4B3ST 4PFOA 4UVAB 5HEJA 3KV5A 4WZXA 3RX6A 1IJ6A 1MIVA 5FXWA 1P1QA 3N2GE 2GH9A 4HFVA 4WYVA 3KZGA 5JRCA 2DYXA 2G0UA 3RRCA 2QVUA 2E9XC 1N76A 1ZIUA 1BP5A 2BJJX 2IHR1 1HF8A 2CZHA 4ZEFA 4MIJA 3O9PA 2H7OA 3OJAA 3VV5A 4JUYA 2X67A 3KDSE 2R8TA 3FHNA 3PU3A 2QA7A 4HFIA 4IT4A 3V5UA 1H45A 2E9XB 2W00A 1JNRA 2ODUA 4HWCA 4IO6A 2XSBA 4YSZA 4F2QA 4LFBT 1FSAA 4ZEKA 4GFRA 3KC0A 1B6HA 4N13A 2L8KA 1EYJA 1NV7A 3VRAA 3O6HA 1FJGT 4M1VA 4ERRA 2ZXTA 5JK4A 4UVCB 4U23A 2WBDA 4NEDA 3D4CA 4LVQA 3O9XA 1FQFA 4QH5A 2F36A 3E9XA 1EH3A 2R6GE 3EQ1A 2VOZA 4ONYA 3TAJA 3P8CD 3MZ9A 1B4HA 2YOEA 1B40A 4F3GA 2OWSA 2UUCT 1MQIA 1B3HA 1QJMA 1ZOYA 3OO8A 5EHSA 2FHYA 5HXHA 4RYAA 4L0RA 1WODA 3AEFA 1DTZA 3F11A 1JP4A 4PETA 4KI0F 1UCUA 2BJIA 4A56A 4NAPA 4EF1A 3HHGA 2OX3A 1A55A 4EGWA 2B4LA 1B0HA 4FECA 5DVIA 2CA5A 4MCOA 3TLWA 4FORA 5EYGA 3OO7A 3DELB 4DV0T 5F7VA 1BLFA 2BKOA 2XQ6A 5EQ8A 3MXZA 3OPCA 3AA0B 3ZS6A 1NFTA 5FP3A 4KBMB 1XOCA 4OK0A 1FCKA 3EHTA 5LCYA 4ELQA 4L5GA 3OSRA 2X0YA 3O2AA 2I59A 5HBCA 3T93B 4HFBA 3BQLA 3GBAA 1HX8A 3DP7A 3M3KA 1UX4A 4F31B 5FHOA 4E0XA 4BAYB 4QH1A 2NTXA 3Q5DA 1SYIA 3UUXB 2I0MA 2AL5A 2D5WA 4U22A 4U7IA 1ZLQA 4ADZA 5CMBA 4R72A 4I62A 3ZT7A 3CIJA 3G3IA 2LM2A 3SFDA 2KZ7B 4WEDA 3O6GA 3SZPA 1KF6A 2GHAA 5L3FB 3H6VA 5JDLA 2CRBA 4FBPA 2GK9A 3UQ7A 4GKJT 1I6ZA 3VHLA 1LEVA 2PCRA 1B05A 1B3FA 1FBDA 4FIMA 4NF6B 1LBBA 4X9TA 4ZEIA 5ITOA 2DXYA 4OTEA 5FBPA 5HWXA 2XXHA 4PAKA 3K2DA 1HG5A 4RJZA 3IL1B 4U3CA 1JETA 4IO2A 3FUZA 2UUBT 3B7DA 4JI3T 5LGTB 2H25A 3I0QA 1IQ7A 4B3TT 5ABGA 3RN8A 5K2YA 3PV0F 1BR0A 3C36A 4P8BA 3TMGA 4KXPA 4ASKA 4ZI2D 3M3ZB 3PU8A 2Y7WA 1SQYA 4PDDA 4PF6A 3AEDA 4YLHA 1IXCA 1MRPA 3LBXB 2VWAA 4EAHA 1XI6A 1HSJA 1LAFE 1QKAA 1G0IA 2JQKA 2YKSA 4PK4A 4QKNA 2YDRA 1NKXA 4GD5A 3PUGA 1LRZA 1FQCA 2BBHA 3MJNA 2KNDA 2DSFA 4P0GA 4YB5A 1XS5A 3K8PC 1Z0PA 1I6QA 1Y64B 4IL4A 4MAGA 4UA8A 5JREA 4PFBA 3MUQA 4JSOA 2F6GA 4N91A 5IGAA 1N7XA 3T9UA 4TUYE 4X62T 4LF8T 4POXA 5LYJE 2G93A 1VFDA 1I69A 4KFQA 4KI0E 3IO6A 3QB5K 3RYHE 1FTJA 1FW0A 2VL0A 3CG1A 1SPIA 5I2KB 3I0OA 5KCJA 3BIHA 4U31A 2JQ9A 3ZPOA 4H63V 2Z8FA 2MOZA 4QSCA 2QVRA 5ICTA 2IC6A 1XC1A 1HG2A 3N2KE 2JPFA 4YICA 3IB0A 3FZVA 2BKNA 5L9SA 1O64A 3LUYA 1XVYA 2DWHA 2HXWA 4KQPA 2PTFA 4PBHA 4QSEA 2K24A 4F1UA 1NUYA 5E0OA 1CE2A 2D5UA 2W63A 2UYFA 2NOXA 4G68C 3H3MA 5CGMA 3KOSA 4N07A 1P1WA 2W4XA 2KWHA 3H37A 5I56A 2ZNSA 4R6KA 1KEYA 5FXVA 4UVBB 4OFOA 3C98B 1FJ9A 4N81A 1XVXA 5H8FB 3CIRA 4G68B 3VR9A 4XEQA 4AB5A 2DL1A 1S35A 1M7KA 4MBQA 5HCMA 3FVNA 5LMNT 2DWGA 2UXBT 3UIFA 1SW4A 3ETVA 1FTLA 3TCGA 2Q9TA 2ZM6T 2OWTA 4HTEA 4YTPA 2XXKA 1VR5A 4GOUA 3MACA 5J0ZA 4MMPA 5LB7B 4PF8A 2XJ7A 4E7SA 4HFDA 4IE6A 1RYXA 4AS4A 4UXNB 1FPKA 4O7MA 3FGSA 1HTJF 4CXYA 3P4PA 1MXVA 2D0UA 5LHIB 4LMLA 2V1DB 4YJ3E 2QGSA 3PE0A 1I6AA 4EYYR 2XD2A 3AE3A 1W9RA 2YLNA 5EK4A 1X79A 3AEGA 2WY2A 1JEVA 1NUXA 3CI8A 4GWUA 2XX9A 1LAHE 1K9YA 2UVHA 1NMUA 5FL1A 5AA2A 3BK9A 3CFZA 5TPAB 5I58B 3U93A 1IMFA 3O1IA 4QX8B 4X64T 3LFMA 4LZ7A 2CPTA 3B8BA 4DXCA 2RINA 4TX5A 3I9WA 3OYXA 3SOLA 2ODVA 1KNPA 1HS7A 1QLBA 1VFEA 4DMWA 4EEBA 1LBXA 5C8YE 2MPKA 1Y1MA 2P3NA 2V93A 2Z22A 2NVUB 5HYAA 2XD3A 5LJNA 2H7VC 1Y9UA 2PFZA 2HZLA 4IY6A 1B46A 3O97A 3RGYA 4ISTA 4HFEA 4N6KA 4XZCA 2XQ9A 3LUZA 4G4PA 1Z8UA 2V7LA 3MA9A 3R84B 1VCTA 4ZI2C 2V6YA 1DMBA 1OXZA 2LSIA 2MAWA 4U72A 4PBQA 1E2AA 4EZHA 3MVZA 2JMHA 2LLYA 4ZZEA 4ND9A 3EUHA 2V7JA 4PP0A 3RT6B 3RIUC 4DV5T 1D3KA 3CVGA 1A99A 3OOAA 2P3VA 3KN8A 2XQ4A 3FBZA 3KVAA 1LCFA 3TCHA 4U33A 5DVJA 1Y3NA 4AIUA 4X1DA 2V3TA 3UTKA 1SW1A 3LSLA 4HE0A 4HGAA 3KSXA 2QYWA 4GK0E 2B1EA 5EYHA 4NXMT 5J2UE 3Q5XA 2UYEA 3MSTA 4DUYT 2R9JA 2XQ8A 2UVIA 1MXWA 4PFYA 4OERA 1FTKA 5JDFA 2CWOA 1XT8A 3FXDB 2ACXA 2XHDA 3CSBA 3C4MA 1POY1 2RCBA 3CRBA 2X0LB 4DR4T 5TAOA 1HR0T 3P4QA 2XWIA 4NE4A 2IIUA 1UTBB 3FBLA 5DQVA 2MKZA 3MPLA 4RXLA 1MPDA 5FVLA 3K4UA 5HXSA 3EHZA 1RDXA 3Q29A 5L8DA 2Z23A 3GXAA 4I0UA 3NOHA 4OZ9A 1DBZA 1XZYA 1QKBA 2NW9A 1US4A 1EZ3A 3NRYA 3BFTA 1MIWA 3EAMA 4H5GA 5A5XA 4QFKA 3C33A 4PFPA 1PDAA 2B76A 3H6UA 1BR1A 1KNRA 2D2SA 1B9JA 3H06B 4PFRA 1QUKA 3F57A 3VVFA 3FJ7A 4IL9A 5B7DA 5ICQA 4JV5T 2REGA 4GL0A 4LFCT 4GQOA 1SI1A 5J2TE 3S9LC 3ZEFB 3TTNA 5KZTA 3GYYA 3BFUA 4TZ4C 3JV9A 5CBRA 5HXRA 1RYOA 2CM0A 4PAIA 3PUVF 4MNPA 3HHFA 4JB7A 4QWNB 4IDZA 2CWYA 1XWMA 3D1RA 2NXOA 4YU0A 1MY4A 1BK4A 2KINB 5H6QB 5AA4B 3C31A 2WZIA 5AQIB 2FBPA 3K1MA 4AKRB 2QPQA 5ISUA 4NX1A 2XAJB 4PC9A 1M5EA 3HSTA 4DV6T 4MNCA 1LCTA 3SKPA 3N9PA 3ONMA 1QULA 4F39A 1A54A 5DEXB 3UU5A 1D9QA 2XM1A 1NNKA 2SPCA 4NMYA 5I84A 4B3RT 1SA0E 3GWHA 2QL3A 2A72A 4CI3B 5JDHA 2H99A 5AA1A 2LOPA 5L2LA 2XAFB 4UIGA 2ANJA 4F1YA 2GQ1A 2C0SA 3ZSTA 3H6TA 4NGUA 4PE5B 1JVYA 4R9GA 4F6RC 4OEVA 4NTLA 4GX6A 3UFEA 1KWHA 2B4MA 4DBRA 3TLVA 3OXNA 3E0ZA 1P1UA 4MNIA 2Z8DA 4JLEA 2VP1A 1DU2A 4YY3T 5ELVA 4BDNA 3I5OA 3G06A 4OYKA 4WXJA 1SE7A 2DS9A 1T0KA 4JVCA 1R1NA 3EKIA 4C1TA 2J47A 3O29A 3FIRA 4HE1A 4J2CA 5JEIA 3L6HA 4EXTA 4XKQA 2DE3A 2VQFT 3WAKA 2WWUA 3P50A 4ZEDA 4X8RA 4JI8T 4BDLA 1UQWA 4QXDA 1MMAA 1VOMA 2Q9QA 1B58A 4QF9A 3TEPA 1IBKT 1E1HB 2HPLA 2WKYA 4G77A 4BA9A 1M5FA 3ZLIA 3V89B 1YPNA 1CHUA 2HHMA 1Y1ZA 2Y5KA 3K6UA 5AQQB 2GHBA 1Y3PA 5H8HA 5I2NB 1WCRA 3RKOA 1LB9A 2DE4A 2XXUA 2ZYOA 2OV9A 5IZ3B 1FQBA 2IDOB 2E5LT 4PFTA 1SW2A 4NF8A 3VVDA 2KLQA 1GR2A 1WRDA 5L3EB 3FZMB 4NF5A 4QXBB 4R9FA 4RY1A 4HWIB 4H5FA 4IHJE 2I58A 4POWA 4IREA 3KV9A 5HAXA 1IMDA 4X1IE 4HW8A 3FB2A 3OENA 3RLFE 4Q0CA 1ZKEA 2AIXA 1NENA 2XXRA 4F18A 2R6GF 5AA3A 1WYBA 3N9QA 4DV1T 4IO3A 1D0YA 2WP9A 5CMKA 1PBPA 1LVFA 2CHOA 4UELA 4GX4A 2XXQA 2WDQA 4Z7EA 3W9WA 3LDQB 3ISPA 4PJMA 2UUAT 2KR0A 2F5XA 3IFCA 4OANA 2YU2A 3I9YA 3N5LA 4UF0A 2MYSA 4JI5T 3HN0A 2RC9A 3IA3A 2DVCA 2DWAA 5F1QA 1N04A 3CHGA 3FV1A 4DI3D 5KDTB 3I3VA 4FJPA 3RYCE 4PAFA 4ZHQE 5JTGA 5LBQB 3CQCB 2I6HA 3QYTA 1WFDA 4HWFA 1E7PA 2MTQA 4PQJA 3IEEA 2DVZA 4OETA 1H43A 3Q25A 1XNQT 4I50E 1IXHA 3DM0A 4LZ5A 4H1XA 3AXJB 4AI6A 3L09A 3TLTA 4QHOA 2XZEA 3C4XA 2VPNA 4NF4B 4RPOA 1YD8G 5HXEA 1IBMT 1USYE 4DZ1A 2WSSV 3N9NA 5JR9C 1IBLT 1N33T 4K0KT 2IEEA 2C5JA 1H3DA 4KMCA 4XAXB 2RPAA 2KXPB 4MALA 3ANWA 1MDQA 4IGTA 4NQ8A 4LUBA 3U78A 1POTA 4HKAA 2V25A 5AFUL 3E78A 3A5XA 1ZTYA 3RQTA 2Q2AA 5JR9B 2Q2CA 4ISUA 5IZZA 4JI7T 4EXLA 4A5XA 2XASB 3UORA 1BIYA 4LFAT 4IO7A 3RC3A 2HEUA 3MJXA 5I3SA 5IM2A 2K3WA 2CXDA 4P1NA 1MQHA 3VLVA 3KSJA 5AQOB 4DUZT 4N15A 3TTMA 5JRCB 4TWFA 4YKIA 4AKGA 2NTYA 4JBWF 4U2YA 4CZZB 3R26A 3S2VA 2B3FA 2DXRA 1B7UA 3TPAA 4MHCA 1IEJA 2RKMA 3VU7H 4FJOA 4Z91A 1MH4A 5I59B 4DMVA 2X68A 5I5PA 3KBTA 5F8PA 3B50A 4AQFC 2M6BA 4AQ4A 1KZ8A 4Z8XA 3CPZA 4RK9A 2RC8A 4O4HE 5M4YA 2W67A 2WDVA 3HI2A 2DE2A 4IDOA 3ZMSB 4H45A 3T96B 2NR4A 2FUPA 3MQ9A 1B52A 4DV7T 3OEKA 4COFA 4O8SA 1Y3QA 2XM2A 2HHHT 5AQVB 2VHAA 2E9XA 3B57A 5KMGP 1FEWA 1IMAA 4CI1B 1PBQA 3C9HA 4TLMB 2LHRA 1MNEA 3LBSA 2XXVA 2PJQA 3EDVA 4AKIA 4NUVA 1U4QA 1A7LA 5AQKB 3K1NA 1GGGA 4H9SE 3K6XA 4OYVA 3KV6A 4YFSA 3Q2MA 4ZS2A 3OTOT 3L6GA 5FHNA 1J1NA 5I7IA 2X9XA 2JRKA 4I55E 3LSFB 4PGNA 3ZN1B 1H7CA 4OFZA 3T8OA 3SETA 4ELRA 1I94T 2CZKA 4FI5A 4EDPA 1Q9DA 3TLSA 3ZYMA 4ELPA 4U2ZA 4O2AE 4DV4T 3ZKRA 3U92A 1B3GA 4XIGQ 2V5CA 2DHRA 1F9BA 2XWVA 3KG2A 3UGWA 2PFVA 4Q8RA 4O4LE 4LF9T 1P1NA 5ABEA 4R74A 2E8IA 1NNTA 1YXIA 2FIXA 4EUOA 4QBAA 2H9BA 3QAXA 3FZFB 2PVUA 5AQGB 3FBPA 2PT1A 4H63H 5L47A 2VQET 4KD5A 3CVRA 3HL6A 3O1JA 5AQHB 1ZMGA 4K3FA 1MQJA 2ALUA 3M3LA 4HCYA 4IGRA 4THIA 1RDYA 1LFHA 1GVCA 2VKHA 2F7CA 3PJAJ 1HCIA 3QUJA 4KCCA 4H8IA 5J1DA 2D3IA 4IE7A 4ZDMA 4X04A 4PDHA 2KMFA 4OX9T 1MY1A 1OEDC 1SW5A 2VASA 1A8EA 4EZ4A 1NUWA 1SVXB 2FIEA 2HCAA 2KLFA 2D0TA 5DJQC 4JWXA 2DWJA 1V9DA 4ZZBA 4UACA 1O63A 3QXMA 1MM7A 2A5SA 4L17A 2FA7A 4C1UA 1OEDB 2O1LA 3KBRA 3FZLB 2P1SA 2RCAA 2F4VT 4JEHB 2UVJA 4XKNA 2YPNA 3EDUA 2X9HA 2RF1A 4KHZE 1IIWA 1SI0A 2VGQA 2A9UA 3ILUB 1ELJA 3ZJ2A 2BVLA 2OBGA 4WBNE 4NF6A 5HWYA 3RIFA 2Y7RA 5ABFB 4ZI3D 4U1OA 1J1JA 2OLBA 4H0WA 2I0CA 4BDQA 2BG9C 2WQYA 4EV6A 1K9ZA 4KYEA 4KYSA 3H4ZA 3NWIA 1D0XA 3FVKA 5JTYA 1FBCA 1TXFA 4GXAA 4HFCA 4EQ7A 4O3CA 4O2BE 2ONSA 3MP6A 1M62A 3KFMA 4ZS3A 4LF6T 2WYPA 2DQVA 1NV3A 2BG9B 3W15B 3VE1B 1YAEA 3SEXA 5DT6A 2YDQA 4GIZA 3T0JA 2ZZWA 4DXUA 3ONLC 5JDNA 2NP9A 3QC9A 3RY3A 2F78A 3CSGA 2A2FX 5J16A 5LG3A 5ESYA 2W66A 4DBQA 3N9LA 1LBCA 2X26A 1XHYA 3EHUA 5AQSB 3T1YT 2EHOD 4R6HA 5AQMB 5ETWA 4P1EA 2LM9A 4LF7T 4JEUB 5ITPA 5HEOA 2VKDA 2WAUA 1OQHA 2UXCT 4PJLA 3RRWA 3ZYKA 4I9DA 3CX6B 5IUXA 2DDKA 2W62A 4GYSA 4NN3A 4I40A 4G2AA 3THIA 5LXTE 1NH8A 4LF5T 4I4TE 1M5CA 4OHFA 1JW1A 1ZKBA 4MF3A 2H89A 3GN5B 3TELA 3ZMZB 2VKJA 2G29A 4LZ8A 4ZE8A 1BR4A 4JDFA 3PPNA 3VXCA 4MBPA 1XMOT 3TODA 1UTHB 3K6VA 4KR5A 4I8CA 3VLWA 2PBIA 3LR1A 3PD9A 4EQBA 4GYRA 5ABHA 4OMBA 4RK2A 3GBBA 1IMCA 2YU1A 1LFGA 2FJEA 4UV9B 3RYDA 4XKRA 2V5DA 5LNKA 1S7YA 2THIA 3HKBE 3WAEA 1MDP1 1FPDA 1LKXA 3OVUA 5H8QB 5CA1E 3U3IA 4OEUA 5H8FA 2F7AA 4G68A 2DLRA 4DR5T 2WX9A 3TZAA 2XXIA 3MVYA 5AQJB 1NI9A 5ET7A 3J7Yq 4PJJA 3KBZA 3C4WA 4DCYA 3RNNA 3AE8A 3AE4A 4B3MT 2QMXA 2F7BA 2YEVC 3M8UA 4N8GA 2ACZA 2XHEB 3C35A 4UV8B 3ZMTB 5LP6E 2K48A 4CI2B 4U4XA 3SRZA 3OEMA 4TN7B 2LKGA 4JSDA 4YHJA 1HSLA 3MK7C 1T8BA 5H8SA 3B6WA 3MW0A 2PFYA 2X7QA 4KPTA 3TUSA 3BQKA 2ZM0A 3ROJA 4CQIA 2BKPA 3FXEB 5TPAA 3FV2A 4LP2B 3B6QA 2O1MA 1GTKA 2AE9A 3K6WA 4ZI3C 1J5WA 1P1OA 4F3PA 2XQ7A 5T3JA 2CZLA 1YQ4A 4N6DA 2V6XA 3EHSA 1YZ0A 3OBVE 4EF2A 2VK9A 3EABA 2FBWA 4WBOA 3E22E 4QFOA 4LMKA 4QFLA 3C34A 2L5VA 3AAIA 4LQ5A 3F31A 2Y7PA 2D21A 2YDSA 4G8NA 3SEVA 2E0SA 1AL3A 5CFBA 1LGBC 1H44A 1Z7ME 5DYHA 3RTFB 4E0WA 3PUYF 4QXCB 2OLTA 3Q26A 4GL8A 2IAKA 3J9X1 3FZHB 2LRLA 1FPLA 1EYKA 5KDMC 3UU4A 2L9QA 3HV1A 3ZJ1A 3R7XA 1Y20A 1D1CA 2REJA 3VXBA 4A97A 4NG7A 3HPIA 1AJ3A 4JI4T 4OWDA 3PPOA 4PK6A 4DDDA 4EYUA 2HZKA 3ZN0B 5HCJA 2UU9T 2YINA 3IAZA 3HFUA 4YAHX 4H46A 3B5MA 4JI2T 2EHOC 4N6PA 4O3AA 1YKEB 1BTJA 1Z7NE 5JDMA 1URSA 4FEDA 4HCWA 5LTCA 2O6AA 5EK2A 5LJMA 2BVMA 3RIUA 3RF1A 2O84X 4QH4A 3KFWX 4QX7B 2EHOB 3C32A 3U72A 4CN4A 1Y01A 5K2XA 2PT2A 3MVWA 4R2BA 2Q8MA 1GQEA 4MLVA 1LAXA 4AS5A 4O3BA 4LA9A 4PJNA 3AE2A 3V5AA 3K00A 1T7SA 1UTBA 5FY0A 3PUZF 3TTLA 4ILAA 5FHMA 2IA4A 3MZ1A 3G3FA 1B32A 3ABVA 1URDA 1WDNA 1MMGA 3ILTB 2OCUA 2DP8A 4DR1T 3RLFF 5EK3A 4OESA 3LK42 1D1AA 3BBRA 3PD8A 1NV1A 2FVZA 3NBXX 3Q5EA 3JCFA 3CFXA 3AAEB 3ONXA 2H98A 5I57B 3LJCA 2CXLA 2QRYA 2N1GA 1O3XA 1WLXA 2LOSA 3AE6A 2VVSA 2M6IA 3Q9DA 1R8IA 3A8YC 5JVDE 1FBPA 1YKHB 2O68A
chains in the Genus database with same CATH topology
3USDA 3RPUA 2H4IA 2J1DG 3PTRB 5FY7A 2Y8DA 1R9QA 2NWBA 3IK6B 2R71A 5CRYA 1PB7A 2V7KA 3IR1A 4M1PA 4X20E 3Q28A 3B13A 4ZECA 4X1KE 1OLCA 5AA4A 1DOTA 4ZS9A 5CMCA 1S94A 3PUYE 4H9NC 1Y4TA 3VFJA 1MPBA 5M2VA 1OVTA 3KVBA 2OJTA 1EU8A 3MC2A 3JC6D 5DEXA 1MPCA 1IAPA 2P2AA 2CXFA 3VDFA 2ESNA 4E7ZA 2F34A 1ANFA 4G8MA 3Q5WA 4L9IA 5LOVE 1URGA 4ECFA 2BDEA 1MXXA 2V7MA 2C5KT 4GF8A 1EZ9A 5FTHA 1FTOA 2JJ9A 2XXXA 2A5TB 4P0IA 3PGFA 2Z8EA 4PFWA 2N9DA 3CMLA 3FJGA 2YK0A 5FXXA 1JVXA 2W0GA 3EF7A 1GV8A 2ZLYA 4WEPA 3NRXA 3I6VA 4BDOA 3RT8A 5L3DB 3FD3A 4HE8A 2DI4A 1LLSA 3O66A 2ABHA 3PUZE 3UULA 2IC9A 5KX5E 3TYHA 1TFAA 4PK5A 4QFPA 2ES0A 1KK7A 1I6BA 4H9PC 2HPJA 4H9QC 4XXUA 4OHNA 5I2NA 2UXNB 5IHYA 4GIWA 1SBPA 1B4ZA 3L3PA 1MXUA 3M3FA 4NWCA 3PDYA 5A1LA 4G2ZA 4IGUA 1EZOA 3JZJA 3LK3B 3T9HB 1JEUA 5LGNB 4MFRA 2GRVA 4ZOLE 3SERA 1MQGA 3IHRA 5IAIA 3I1AA 3U8QA 2W61A 2V26A 5LA6E 3PMXA 1JW4A 3W9VA 5F3JA 5L3GB 4IIJE 4YZZA 2I3VA 3E3KA 5FY1A 4UEMA 3MBPA 1AOVA 2W7YA 2L3LA 5JDQA 4XTCQ 5H6RB 1AIVA 5KDTA 1MMNA 1YCJA 3B6TA 1N0TA 3OD7A 2LSGA 2KT9A 1BKAA 4U21A 4HTGA 3OO6A 4OFJA 2CMRA 5L9OA 2NW7A 1NL5A 2C5IT 3ETUA 1N3WA 4K0UA 1H76A 5J1GA 4NF4A 2OZZA 4YKKA 1FTMA 2DOJA 2QS1A 3T22A 1Y4CA 5TP9B 3AVRA 4JXIA 4R75A 3LG7A 1DSNA 3LK2B 1N3XA 2AYSA 3CX8B 4WW0A 1PC3A 2VD3A 2ZYMA 1QW0A 4EOZB 5LG4A 1II5A 5JR9A 3HA4A 2ONRA 2XAQB 3AXFA 3TDJA 2CLYC 1MXYA 3EN3A 1ZBMA 3PUSA 3JC6C 2XX8A 1MMDA 2LEHA 3KJTA 2LJLA 3SESA 5L9MA 3CR9A 1US5A 1AH5A 4MFIA 4KP3C 5IYZE 1MH3A 4V1Av 3KEIA 1BR2A 3IF8B 4H6DA 4BLAA 2DWIA 3H7MA 2CLYB 4OVJA 3PURA 2X7PA 2XXWA 3GMIA 5I59A 3N6UA 3CQGB 3K01A 5TU0A 2N2NA 2OK2A 3D0TA 4C91A 4TQUQ 4HS7A 5CM6A 3OSQA 2HAUA 1IUDA 3ZMVB 1DTGA 3TKLB 4TV9E 3AA7B 4FE8A 3S9MC 2X66A 5FNVE 3E13X 3A3CA 4AQFA 3PPRA 4DIGA 3V8XB 1QUIA 4NUUA 3S4UA 4F19A 3AA1B 2LT3A 3O28A 4H9OC 4C90A 4YKPA 1IXIA 2KWIB 4IO5A 1OVBA 1TT1A 1B7HA 4PFUA 3RYFE 3P7IA 4B6XA 1D9YA 4F29A 3ESLA 3ZCJA 3AVSA 3H6WA 1SDXA 2ZNUA 3CQXC 3GZGA 4ANJA 4RA1A 2UVGA 3PUWE 4F1VA 1NWMX 1B5JA 1Q35A 3PMWA 3UA8A 3JYRA 4H67A 3IOTA 2F8DA 2LAOA 1B7ZA 5AA2D 1AMFA 3H3AA 3RH3A 4KYDA 4HN9A 4ZI7E 4U4SA 3T66A 5JH7E 2CMOA 3H3GA 2PMSA 1D0ZA 4AKHA 3R6NA 1B2HA 2I3WA 5LOMA 3IJOB 1FIOA 5H8NB 4FEBA 1TFDA 4QXHB 1MG1A 4YKJA 3IOUA 2NUVA 4QRZA 1VE4A 2UXXB 4F22A 2VD2A 1FMVA 1FQEA 1FQAA 4X1BA 1MM6A 4IO4A 3ZC1A 2RC7A 4PW8A 4QFNA 5LBMA 3C64A 3IOWA 1JQFA 4I43B 3RC8A 4AB6A 3CKDA 1OIBA 3KJ7A 4OQOA 2P9BA 3MP1A 3W15C 1MY0A 1WYCA 3TFLA 1S9TA 1ZV4X 2X9WA 1MXZA 5JTYB 4EQ9A 4XBFB 4P0BA 4M4GA 4JWYA 1LB8A 4F3SA 3G3KA 2PG8A 3HKCE 4YJ2E 3GLBA 2Y7IA 5DQWA 3DP4A 2RA1A 5IKBA 4GWOA 1D9VA 1T98A 2Q88A 1UIVA 4ILUA 4BDRA 1Q1KA 3LBXA 1PEBA 2H5YA 4XKPA 1YTVA 2I4BA 4H9RC 3SWHA 3FVGA 3MVXA 4MLKA 4BJMA 4OENA 3GA8A 3FXRA 5DVFA 5KCJB 1OLAA 3CWZB 3QSLA 3ECRA 4QSDA 3WI3A 4GK5E 1B3LA 3CFLA 4RPNA 4DLDA 4AQGA 1WVJA 1B7TA 5LGUB 2B65A 5FYMA 1B0LA 2I0BA 5B70A 3DLNA 5I2KA 4IE4A 3O4XE 2HFBA 3A3UA 3OKQA 5ADXL 2MBGA 2Y7KA 4ZEBA 3SEWA 5CI5A 4TLLB 5I56B 1G73A 4P09A 3TKDA 3DTOA 3F2EA 4F3BA 5HPQA 1ZHCA 1UX5A 1MQDA 4P0AA 1SD3A 1EZPA 2IW5B 3PUQA 1ZU0A 2K9AA 2QSXA 4U2RA 2Y84A 3GN5A 3BKIB 1NAFA 3VVEA 1LVKA 1B3EA 1NNFA 2LSYA 4FATA 2PYYA 3ZYLA 4BDMA 3FVOA 1UTHA 3T9XB 5FMNA 3UT5E 4ZZAA 2NW8A 2I4CA 2QMWA 1IZNB 2FNCA 2ONKE 4YMAA 2ZMAA 5L3CB 3LC8A 4FAJA 3OO9A 2E1SA 1B5HA 2ZYNA 4DO0A 4F2OA 2ZNTA 4IE0A 2JMKA 4GLIA 3K3NA 3IX1A 5AA2B 5H8QA 4Q5TA 4CXWA 2F35A 4GXSB 2PBWA 1IZ1A 4ESXA 3VKGA 4O4JE 2Z6EA 3HKEE 4OXVA 5CMMA 3CG3A 4U74A 2M67A 5CBSA 2LSJA 3PV0E 3ZSFA 2LSKA 2JQQA 3G3JA 3C4ZA 1NNPA 3MPKA 3IOVA 4U1ZA 1MS7A 2NOOA 5I58A 1FMWA 3ZCIA 1HFAA 2V84A 3LSWA 3MWBA 4GOTA 3RPWA 1A8FA 2CE7A 3G7WA 4EB6E 2XTLA 2V7IA 4HEAA 1B5IA 3LSXA 2Q9QD 3HKDE 2XAHB 1O7TA 4YB6A 4DVDA 1N7WA 3C50A 3NZPA 4KUMB 3HCQA 5GONE 4IY5A 1VRBA 4AKLA 1KNZA 3IORA 1WR6A 3IB1A 3V83A 2H3RA 3WAFA 4G8HA 1JNFA 3TTKA 4Q30B 2P0SA 4DE8A 5EYFA 4OFLA 1UIUA 3C51A 3K3OA 4I1DA 3AA6B 3FXQA 3G3GA 4O4IE 1D4NA 2XXTA 3EPEA 5CC2A 4JWOA 3WAJA 2BZBA 4TOZA 2WMOA 2OA5A 1SYHA 3OMBA 2XX7A 1CUNA 1MY3A 3H03A 3KV4A 3S9EA 5L3BB 2UXAA 4ZE9A 5A5XB 3IB2A 2M8CA 3DP8A 3O1HA 5CB4E 5HM4B 3E08A 2EHOA 3A09A 2DWKA 2QS4A 2Y48B 1ZJLA 2WMNA 1P99A 2O7UA 1U5PA 3N94A 1ATGA 3S9NC 2XUEA 4Z0IA 1OMPA 3SS1A 1DPPA 2AL4A 5BWJA 5LHHB 2X9YA 1FQDA 4P11A 5BMVE 2NWJA 3ZKKA 2VB6A 1YW0A 3N9MA 3PMVA 3FASA 3R6UA 1L5TA 3QUFA 1MY2A 3K0VA 4PNIA 5AE4A 1R9LA 1M5BA 1QUUA 2O69A 5I57A 3U94A 2HH7A 4OYJA 4IB2A 3NZQA 3ZC0A 4BJNA 1PB8A 1OWAA 1NH7A 2CCQA 4GVOA 4DXBA 3PPQA 4ELOA 4H8JA 3QIMA 4C0RA 3QK6A 1IITA 4G63A 3KN7A 4JBZA 3TQWA 2XXPA 4ESWA 3HO7A 4CXXA 3FJMA 2X51A 2I6EA 1US7B 4AXPA 1RKMA 2DCFA 2F6PA 3V5SA 2I48A 4LQ2A 2Q9QC 2V3UA 3MKDA 3EVYA 4EIWA 3T9VA 2E9XD 3VLUA 3Q27A 3SEYA 3UN6A 2V3QA 2VL8A 1R6ZA 4X1YE 2FYIA 4TV8E 1DPEA 3UUMA 4RNSA 3RYIE 2Q9QB 3KN3A 4DNDA 3O6IA 1JW5A 1MNDA 2Q89A 4N78D 1LAGE 5H8HB 2I49A 3DJBA 1QUJA 4LONB 1USYH 2F97A 3PPPA 5FXZA 3VKHA 3IO4A 1G8XA 3DP6A 3KINB 2XQYA 5LHGB 4PAGA 2A5TA 4NF8B 3RTWB 2XAGB 5EHMA 4NF5B 3CX7B 5EZYE 3K1PA 5JQGE 2Q8JA 4NWDA 3G3HA 3TQLA 1LSTA 3UK4A 4EXKA 4DCXA 2ZYKA 2GFEA 2ZMBA 2ZM8A 2ZM2A 1PB9A 2QJEA 4H65A 4R6YA 1TWYA 1HSEA 1S50A 3E4RA 4MLQA 3FXUA 3OELA 5JDGA 1A40A 2HAVA 3KGCA 4IE5A 4UF0B 3K3QC 4ISSA 4YB7A 1IXGA 2B3BA 2Y6XA 3N6TA 3ODBA 1N84A 1VSOA 2VKOA 2YJPA 1B1HA 3K02A 1SHZC 5DABA 4LATA 3PUAA 3PUVE 4KCDA 5DTBA 3TTRA 2A3DA 2PX1A 1B1XA 3U1OA 2K5BB 3MZKB 3N26A 4GRKA 2LE8A 4X48A 3D4GA 4WNKA 2QS3A 2O51A 3BQIA 2LHNA 5FTIA 5BUUA 5HXCA 3SEUA 3OYZA 2WM9A 3TCFA 3ANWB 2RP4A 1CB6A 3IJXB 3PUXE 3ZKLA 1M5DA 3RUMA 3N2OA 3UUNA 1D1BA 3HR0A 2O7IA 2QS2A 3AAAB 3SDFA 2WBLA 3M65A 1OQGA 1QVSA 4QHQA 1ZEEA 1LFIA 3AB3B 3PU5A 2DNXA 3KOTA 3MAMA 3KBUA 4WKMA 3FATA 4R2FA 3MZBA 1QSDA 3ZMUB 2XXYA 2CEAA 4YMBA 1MIYA 3UP9A 3IBPA 1B51A 2HQ0A 3N9OA 4MH5A 5CA0E 4R73A 5TP9A 3MP8A 1IJ5A 4PFOA 4UVAB 3KV5A 3RX6A 1IJ6A 1MIVA 5FXWA 1P1QA 3N2GE 2GH9A 4HFVA 3KZGA 5JRCA 2DYXA 2G0UA 3RRCA 2E9XC 1N76A 1ZIUA 1BP5A 2BJJX 1HF8A 4ZEFA 3O9PA 2H7OA 3OJAA 3VV5A 4JUYA 2X67A 3KDSE 3FHNA 3PU3A 2QA7A 3V5UA 1H45A 2E9XB 2W00A 2ODUA 4IO6A 4F2QA 4ZEKA 4GFRA 1B6HA 4N13A 2L8KA 3O6HA 4M1VA 4ERRA 2ZXTA 5JK4A 4UVCB 4U23A 4NEDA 3D4CA 4LVQA 3O9XA 1FQFA 2F36A 3E9XA 1EH3A 2R6GE 3EQ1A 2VOZA 4ONYA 3TAJA 3P8CD 3MZ9A 1B4HA 1B40A 4F3GA 2OWSA 1MQIA 1B3HA 1QJMA 3OO8A 5EHSA 5HXHA 4RYAA 4L0RA 1WODA 1DTZA 3F11A 4PETA 1UCUA 4A56A 4EF1A 3HHGA 1A55A 1B0HA 4FECA 5DVIA 2CA5A 4FORA 3OO7A 3DELB 5F7VA 1BLFA 3MXZA 3AA0B 3ZS6A 1NFTA 5FP3A 4KBMB 1XOCA 4OK0A 1FCKA 3EHTA 5LCYA 4ELQA 4L5GA 3OSRA 3O2AA 2I59A 5HBCA 3T93B 3BQLA 3GBAA 1HX8A 3DP7A 3M3KA 1UX4A 4F31B 5FHOA 4E0XA 4BAYB 2NTXA 1SYIA 3UUXB 2D5WA 2AL5A 4U22A 1ZLQA 4ADZA 5CMBA 4R72A 4I62A 3G3IA 3CIJA 2KZ7B 4WEDA 3O6GA 2GHAA 5L3FB 3H6VA 5JDLA 2GK9A 5H8NA 3VHLA 1B05A 1B3FA 4FIMA 4NF6B 1LBBA 4X9TA 4ZEIA 5ITOA 2DXYA 4OTEA 5HWXA 2XXHA 3K2DA 1HG5A 4RJZA 3IL1B 1JETA 4IO2A 3FUZA 3B7DA 5LGTB 2H25A 3I0QA 1IQ7A 3RN8A 5K2YA 1BR0A 3C36A 3TMGA 4ASKA 4ZI2D 3PU8A 2Y7WA 1SQYA 4YLHA 1IXCA 1MRPA 3LBXB 2VWAA 4EAHA 1HSJA 1LAFE 1QKAA 4PK4A 4QKNA 1NKXA 4GD5A 3PUGA 1LRZA 1FQCA 3MJNA 2KNDA 2DSFA 4P0GA 4YB5A 1XS5A 3K8PC 1Z0PA 1I6QA 1Y64B 4UA8A 5JREA 3MUQA 4JSOA 2F6GA 1N7XA 3T9UA 4TUYE 4POXA 5LYJE 2G93A 1VFDA 1I69A 4KFQA 4KI0E 3IO6A 3RYHE 1FTJA 1FW0A 3CG1A 5I2KB 3I0OA 5KCJA 3ZPOA 4H63V 2Z8FA 2MOZA 4QSCA 5ICTA 2IC6A 1XC1A 1HG2A 3N2KE 2JPFA 4YICA 3IB0A 3FZVA 5L9SA 1O64A 3LUYA 1XVYA 2DWHA 2HXWA 4KQPA 4QSEA 2K24A 4F1UA 5E0OA 1CE2A 2D5UA 2W63A 2UYFA 2NOXA 4G68C 3KOSA 4N07A 1P1WA 2KWHA 3H37A 5I56A 2ZNSA 4R6KA 5FXVA 4UVBB 4OFOA 3C98B 1XVXA 5H8FB 4G68B 4AB5A 1S35A 4MBQA 3FVNA 2DWGA 3UIFA 1SW4A 3ETVA 1FTLA 3TCGA 2Q9TA 2OWTA 4HTEA 1VR5A 4GOUA 3MACA 4E7SA 4IE6A 1RYXA 4UXNB 3FGSA 1HTJF 4CXYA 1MXVA 2D0UA 5LHIB 4YJ3E 2V1DB 2QGSA 3PE0A 1I6AA 4EYYR 2XD2A 2YLNA 5EK4A 1X79A 3CI8A 1JEVA 2XX9A 1LAHE 2UVHA 1NMUA 5AA2A 3BK9A 3CFZA 5TPAB 5I58B 3U93A 3O1IA 4QX8B 3LFMA 4LZ7A 4DXCA 2RINA 4TX5A 3I9WA 3OYXA 3SOLA 2ODVA 1HS7A 3I5OA 1VFEA 4DMWA 2V93A 2Z22A 5C8YE 1Y1MA 2NVUB 5HYAA 2XD3A 5LJNA 2H7VC 1Y9UA 2HZLA 4IY6A 1B46A 3O97A 3RGYA 4ISTA 4XZCA 4G4PA 2V7LA 3MA9A 3R84B 4ZI2C 1DMBA 1OXZA 2LSIA 4U72A 4EZHA 3MVZA 2JMHA 4ZZEA 4ND9A 3EUHA 2V7JA 4PP0A 3RT6B 1D3KA 3CVGA 1A99A 3OOAA 3KN8A 3FBZA 3KVAA 1LCFA 3TCHA 5DVJA 1Y3NA 4X1DA 2V3TA 3UTKA 1SW1A 3LSLA 4HGAA 3KSXA 4GK0E 2B1EA 5J2UE 3Q5XA 2UYEA 2R9JA 2UVIA 1MXWA 4PFYA 4OERA 1FTKA 5JDFA 2CWOA 1XT8A 3FXDB 2ACXA 2XHDA 3CSBA 3C4MA 1POY1 2RCBA 3CRBA 2X0LB 5TAOA 4NE4A 1UTBB 3FBLA 5DQVA 3MPLA 4RXLA 1MPDA 3K4UA 5HXSA 3Q29A 5L8DA 2Z23A 3GXAA 4OZ9A 1QKBA 2NW9A 1US4A 1EZ3A 3NRYA 3BFTA 1MIWA 4H5GA 5A5XA 4QFKA 3C33A 4PFPA 1PDAA 3H6UA 1BR1A 1B9JA 2D2SA 3H06B 1QUKA 3F57A 3VVFA 3FJ7A 5B7DA 5ICQA 2REGA 4GQOA 4GL0A 1SI1A 5J2TE 3S9LC 3ZEFB 3TTNA 5KZTA 3BFUA 4TZ4C 3JV9A 5CBRA 5HXRA 1RYOA 2CM0A 3HHFA 4JB7A 4QWNB 4IDZA 2CWYA 2NXOA 4YU0A 1MY4A 2KINB 5H6QB 5AA4B 3C31A 3K1MA 4AKRB 2QPQA 5ISUA 2XAJB 1M5EA 3HSTA 1LCTA 3SKPA 3N9PA 3ONMA 1QULA 4F39A 1A54A 5DEXB 1NNKA 2SPCA 4NMYA 5I84A 1SA0E 3GWHA 2QL3A 2A72A 4CI3B 5JDHA 2H99A 5AA1A 2LOPA 2XAFB 5L2LA 2ANJA 4UIGA 4F1YA 2C0SA 4PE5B 3H6TA 1JVYA 4R9GA 4F6RC 4OEVA 4NTLA 3UFEA 1KWHA 4DBRA 3OXNA 3E0ZA 1P1UA 2Z8DA 4JLEA 2VP1A 5ELVA 4BDNA 4WXJA 1T0KA 4OYKA 2DS9A 1R1NA 4C1TA 3O29A 3FIRA 4J2CA 5JEIA 3L6HA 4EXTA 4XKQA 2DE3A 3WAKA 2WWUA 4ZEDA 4BDLA 1UQWA 1MMAA 1VOMA 2Q9QA 1B58A 4QF9A 3TEPA 1E1HB 2HPLA 2WKYA 4G77A 4BA9A 1M5FA 3ZLIA 3V89B 1YPNA 1Y1ZA 3K6UA 2GHBA 1Y3PA 5H8HA 5I2NB 3RKOA 1LB9A 2DE4A 2XXUA 2ZYOA 1FQBA 4PFTA 1SW2A 4NF8A 3VVDA 2KLQA 1GR2A 1WRDA 5L3EB 4R9FA 4NF5A 4QXBB 4RY1A 4H5FA 4IHJE 2I58A 4POWA 3KV9A 5HAXA 4X1IE 4HW8A 3FB2A 3OENA 3RLFE 4Q0CA 1ZKEA 2AIXA 4F18A 2XXRA 5AA3A 1WYBA 3N9QA 4IO3A 1D0YA 5CMKA 1PBPA 1LVFA 4UELA 2XXQA 4Z7EA 3W9WA 4PJMA 2F5XA 2YU2A 3I9YA 3N5LA 4UF0A 2MYSA 3HN0A 4EQ7A 2RC9A 2DVCA 2DWAA 5F1QA 1N04A 3FV1A 5KDTB 3I3VA 4FJPA 3RYCE 4ZHQE 5LBQB 3CQCB 3QYTA 2MTQA 4PQJA 3IEEA 2DVZA 4OETA 1H43A 3Q25A 4I50E 1IXHA 3DM0A 4LZ5A 4H1XA 4AI6A 3L09A 4QHOA 3C4XA 4NF4B 4RPOA 1YD8G 5HXEA 4DZ1A 1USYE 2WSSV 3N9NA 5JR9C 2IEEA 2C5JA 1H3DA 4KMCA 4XAXB 2KXPB 4MALA 3ANWA 1MDQA 4IGTA 4LUBA 3U78A 1POTA 4HKAA 2V25A 5AFUL 3A5XA 1ZTYA 3RQTA 2Q2AA 5JR9B 2Q2CA 4ISUA 4EXLA 2XASB 3UORA 1BIYA 4IO7A 3RC3A 2HEUA 3MJXA 2CXDA 1MQHA 3VLVA 3KSJA 3TTMA 5JRCB 4YKIA 4AKGA 2NTYA 4CZZB 3R26A 3S2VA 2B3FA 2DXRA 1B7UA 3TPAA 4MHCA 1IEJA 2RKMA 3VU7H 4FJOA 1MH4A 5I59B 4DMVA 2X68A 3KBTA 5F8PA 4AQFC 4AQ4A 4Z8XA 3CPZA 4RK9A 2RC8A 4O4HE 5M4YA 3HI2A 2DE2A 3ZMSB 3T96B 3MQ9A 1B52A 3OEKA 4O8SA 1Y3QA 2VHAA 2E9XA 3B57A 5KMGP 1FEWA 4CI1B 1PBQA 3C9HA 4TLMB 2LHRA 1MNEA 3LBSA 2XXVA 2PJQA 3EDVA 4AKIA 4NUVA 1U4QA 1A7LA 3K1NA 1GGGA 4H9SE 3K6XA 4OYVA 3KV6A 4YFSA 3Q2MA 4ZS2A 3L6GA 5FHNA 1J1NA 2X9XA 2JRKA 4I55E 3LSFB 4ELRA 3ZN1B 1H7CA 4OFZA 3T8OA 3SETA 4FI5A 4EDPA 3ZYMA 4ELPA 4O2AE 3U92A 1B3GA 4XIGQ 2DHRA 1F9BA 3KG2A 3UGWA 2PFVA 4Q8RA 4O4LE 1P1NA 4R74A 2E8IA 1NNTA 4EUOA 2H9BA 3QAXA 2PVUA 2PT1A 4H63H 4KD5A 3CVRA 3HL6A 3O1JA 1ZMGA 4K3FA 1MQJA 2ALUA 3M3LA 4HCYA 4IGRA 4THIA 1LFHA 1GVCA 2VKHA 2F7CA 3QUJA 1HCIA 4KCCA 4H8IA 5J1DA 2D3IA 4IE7A 4ZDMA 2KMFA 1MY1A 1SW5A 2VASA 1A8EA 4EZ4A 2KLFA 1SVXB 2HCAA 2D0TA 5DJQC 4JWXA 2DWJA 1V9DA 4UACA 1O63A 3QXMA 1MM7A 2A5SA 4L17A 2FA7A 4C1UA 2O1LA 3KBRA 2P1SA 2RCAA 4JEHB 2UVJA 4XKNA 2YPNA 3EDUA 2X9HA 2RF1A 4KHZE 1IIWA 1SI0A 2VGQA 3ILUB 1ELJA 3ZJ2A 2BVLA 2OBGA 4WBNE 4NF6A 5HWYA 2Y7RA 4ZI3D 4U1OA 2OLBA 4H0WA 2I0CA 4BDQA 4KYEA 4KYSA 3H4ZA 1D0XA 3FVKA 5JTYA 1TXFA 4GXAA 4O3CA 4O2BE 2ONSA 3MP6A 3KFMA 4ZS3A 2DQVA 3W15B 3VE1B 1YAEA 3SEXA 5DT6A 4GIZA 4DXUA 5JDNA 2NP9A 3QC9A 3RY3A 2F78A 3CSGA 2A2FX 4DBQA 3N9LA 1LBCA 2X26A 1XHYA 3EHUA 4R6HA 2EHOD 5ETWA 2LM9A 4JEUB 5ITPA 2VKDA 2WAUA 1OQHA 4PJLA 3RRWA 3ZYKA 4I9DA 3CX6B 2W62A 4GYSA 4G2AA 3THIA 5LXTE 1NH8A 4I4TE 1M5CA 4OHFA 1JW1A 1ZKBA 4MF3A 3GN5B 3TELA 3ZMZB 2VKJA 2G29A 4LZ8A 4ZE8A 1BR4A 4JDFA 3PPNA 3VXCA 4MBPA 3TODA 1UTHB 3K6VA 4KR5A 4I8CA 3VLWA 2PBIA 3LR1A 3PD9A 4EQBA 4GYRA 4OMBA 4RK2A 3GBBA 2YU1A 1LFGA 4UV9B 4XKRA 5LNKA 1S7YA 2THIA 3HKBE 3WAEA 1MDP1 1LKXA 5H8QB 5CA1E 3U3IA 4OEUA 5H8FA 2F7AA 4G68A 2DLRA 3TZAA 2XXIA 3MVYA 3J7Yq 4PJJA 3C4WA 4DCYA 3RNNA 2QMXA 2F7BA 2YEVC 3M8UA 2XHEB 3C35A 4UV8B 3ZMTB 5LP6E 2K48A 4CI2B 4U4XA 3SRZA 3OEMA 4TN7B 4JSDA 4YHJA 1HSLA 3MK7C 5H8SA 3B6WA 3MW0A 2X7QA 4KPTA 3TUSA 3BQKA 2ZM0A 4CQIA 3FXEB 5TPAA 3FV2A 4LP2B 3B6QA 2O1MA 1GTKA 3K6WA 4ZI3C 1P1OA 4F3PA 2CZLA 3EHSA 4EF2A 3OBVE 2VK9A 4WBOA 3E22E 4QFOA 4QFLA 3C34A 3AAIA 4LQ5A 3F31A 2Y7PA 2D21A 4G8NA 3SEVA 2E0SA 1AL3A 1LGBC 1H44A 1Z7ME 5DYHA 3RTFB 4E0WA 4QXCB 3Q26A 4GL8A 2IAKA 3J9X1 5KDMC 2L9QA 3HV1A 3ZJ1A 3R7XA 1Y20A 1D1CA 2REJA 3VXBA 3HPIA 1AJ3A 4OWDA 3PPOA 4PK6A 4DDDA 4EYUA 2HZKA 3ZN0B 2YINA 3IAZA 4YAHX 2EHOC 4N6PA 4O3AA 1YKEB 1BTJA 1Z7NE 5JDMA 1URSA 4FEDA 4HCWA 2O6AA 5EK2A 5LJMA 2BVMA 2O84X 3KFWX 4QX7B 2EHOB 3C32A 3U72A 5K2XA 2PT2A 3MVWA 4R2BA 4MLVA 1LAXA 4O3BA 4LA9A 4PJNA 3V5AA 3K00A 1UTBA 5FY0A 3TTLA 5FHMA 2IA4A 3MZ1A 3G3FA 1B32A 1URDA 1WDNA 1MMGA 3ILTB 2OCUA 2DP8A 5EK3A 4OESA 3LK42 1D1AA 3BBRA 3PD8A 3NBXX 3CFXA 3AAEB 3ONXA 2H98A 5I57B 3LJCA 2CXLA 2QRYA 2N1GA 1O3XA 1WLXA 2LOSA 3Q9DA 5JVDE 1YKHB 2O68A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3USD A;  2H4I A;  1R9Q A;  3IK6 B;  2R71 A;  5CRY A;  1PB7 A;  3IR1 A;  3Q28 A;  4ZEC A;  5AA4 A;  1OLC A;  1DOT A;  4ZS9 A;  5CMC A;  3PUY E;  1Y4T A;  3VFJ A;  1MPB A;  5M2V A;  1OVT A;  2OJT A;  1EU8 A;  3MC2 A;  5DEX A;  1MPC A;  2P2A A;  3VDF A;  2ESN A;  2F34 A;  1ANF A;  4G8M A;  1URG A;  4ECF A;  1MXX A;  2C5K T;  4GF8 A;  1EZ9 A;  5FTH A;  1FTO A;  2XXX A;  2A5T B;  4P0I A;  3PGF A;  2Z8E A;  4PFW A;  3FJG A;  1JVX A;  3EF7 A;  1GV8 A;  4WEP A;  3I6V A;  4BDO A;  3RT8 A;  3FD3 A;  1LLS A;  3O66 A;  2ABH A;  3PUZ E;  2IC9 A;  3TYH A;  1TFA A;  4QFP A;  1I6B A;  4XXU A;  4OHN A;  5I2N A;  1SBP A;  1B4Z A;  3L3P A;  1MXU A;  3M3F A;  4NWC A;  4G2Z A;  1EZO A;  3JZJ A;  3T9H B;  1JEU A;  2GRV A;  3SER A;  1MQG A;  5IAI A;  3U8Q A;  3PMX A;  1JW4 A;  3W9V A;  4YZZ A;  2I3V A;  3E3K A;  3MBP A;  1AOV A;  2W7Y A;  4XTC Q;  1AIV A;  5KDT A;  1YCJ A;  3B6T A;  1N0T A;  3OD7 A;  1BKA A;  4U21 A;  4HTG A;  3OO6 A;  4OFJ A;  5L9O A;  1NL5 A;  2C5I T;  1N3W A;  1H76 A;  4NF4 A;  2OZZ A;  4YKK A;  1FTM A;  2DOJ A;  2QS1 A;  3T22 A;  1Y4C A;  5TP9 B;  4JXI A;  4R75 A;  1DSN A;  1N3X A;  2AYS A;  1PC3 A;  2VD3 A;  2ZYM A;  1QW0 A;  1II5 A;  2ONR A;  3AXF A;  3TDJ A;  1MXY A;  3EN3 A;  1ZBM A;  2XX8 A;  3KJT A;  3SES A;  5L9M A;  3CR9 A;  1US5 A;  1AH5 A;  4MFI A;  1MH3 A;  3KEI A;  4H6D A;  4BLA A;  2DWI A;  3H7M A;  4OVJ A;  2X7P A;  2XXW A;  5I59 A;  3N6U A;  3K01 A;  5TU0 A;  2OK2 A;  4TQU Q;  4HS7 A;  5CM6 A;  3OSQ A;  2HAU A;  1IUD A;  1DTG A;  3TKL B;  3S9M C;  4FE8 A;  3E13 X;  3A3C A;  4DIG A;  3PPR A;  3V8X B;  1QUI A;  3S4U A;  4F19 A;  3O28 A;  4YKP A;  1IXI A;  2KWI B;  4IO5 A;  1OVB A;  1TT1 A;  1B7H A;  4PFU A;  3P7I A;  4B6X A;  1D9Y A;  4F29 A;  3H6W A;  1SDX A;  2ZNU A;  4RA1 A;  3GZG A;  2UVG A;  3PUW E;  4F1V A;  1B5J A;  1Q35 A;  3PMW A;  3UA8 A;  3JYR A;  4H67 A;  2O68 A;  3IOT A;  2F8D A;  2LAO A;  1B7Z A;  5AA2 D;  1AMF A;  4KYD A;  4U4S A;  3T66 A;  2CMO A;  3H3G A;  2PMS A;  1B2H A;  2I3W A;  5LOM A;  3IJO B;  5H8N B;  4FEB A;  1TFD A;  1MG1 A;  4YKJ A;  3IOU A;  2NUV A;  4QRZ A;  1VE4 A;  4F22 A;  2VD2 A;  1FQE A;  1FQA A;  4X1B A;  1MM6 A;  4IO4 A;  2RC7 A;  4QFN A;  3IOW A;  1JQF A;  4AB6 A;  3CKD A;  1OIB A;  3KJ7 A;  4OQO A;  3MP1 A;  3W15 C;  1MY0 A;  3TFL A;  1S9T A;  2X9W A;  1MXZ A;  5JTY B;  4EQ9 A;  4M4G A;  4JWY A;  1LB8 A;  4F3S A;  3G3K A;  3GLB A;  2Y7I A;  3DP4 A;  5IKB A;  4GWO A;  1D9V A;  2Q88 A;  1UIV A;  4BDR A;  1Q1K A;  1PEB A;  2H5Y A;  4XKP A;  1YTV A;  2I4B A;  3FVG A;  3MVX A;  4OEN A;  3FXR A;  5DVF A;  5KCJ B;  1OLA A;  3QSL A;  3ECR A;  4QSD A;  1B3L A;  3CFL A;  4RPN A;  4DLD A;  1WVJ A;  2B65 A;  1B0L A;  2I0B A;  5B70 A;  3DLN A;  5I2K A;  2HFB A;  3A3U A;  4ZEB A;  2MBG A;  2Y7K A;  3SEW A;  5CI5 A;  4TLL B;  5I56 B;  3TKD A;  4F3B A;  5HPQ A;  1EZP A;  1MQD A;  1SD3 A;  1ZU0 A;  2QSX A;  4U2R A;  2Y84 A;  3BKI B;  3VVE A;  1NNF A;  1B3E A;  4FAT A;  2PYY A;  4BDM A;  3FVO A;  1UTH A;  3T9X B;  4ZZA A;  2I4C A;  2QMW A;  2FNC A;  2ONK E;  4YMA A;  3LC8 A;  4FAJ A;  3OO9 A;  2E1S A;  1B5H A;  2ZYN A;  4F2O A;  2ZNT A;  4GLI A;  3IX1 A;  5AA2 B;  5H8Q A;  4Q5T A;  2F35 A;  4GXS B;  2PBW A;  1IZ1 A;  4ESX A;  4OXV A;  5CMM A;  3CG3 A;  5CBS A;  3PV0 E;  3ZSF A;  3G3J A;  1NNP A;  3MPK A;  3IOV A;  4U1Z A;  1MS7 A;  2NOO A;  5I58 A;  2V84 A;  3LSW A;  3MWB A;  4GOT A;  3RPW A;  1A8F A;  3G7W A;  2XTL A;  1B5I A;  3LSX A;  1O7T A;  4YB6 A;  1N7W A;  3HCQ A;  3IOR A;  3IB1 A;  3V83 A;  3WAF A;  4G8H A;  1JNF A;  3TTK A;  4Q30 B;  2P0S A;  4DE8 A;  5EYF A;  4OFL A;  1UIU A;  4I1D A;  3FXQ A;  3G3G A;  1D4N A;  2XXT A;  3EPE A;  5CC2 A;  4JWO A;  4TOZ A;  1SYH A;  3OMB A;  2XX7 A;  1MY3 A;  3H03 A;  3S9E A;  2UXA A;  4ZE9 A;  5A5X B;  3IB2 A;  2M8C A;  3DP8 A;  5HM4 B;  3A09 A;  2QS4 A;  1ZJL A;  1P99 A;  2O7U A;  3N94 A;  1ATG A;  3S9N C;  4Z0I A;  1OMP A;  1DPP A;  2AL4 A;  5BWJ A;  2X9Y A;  1FQD A;  4P11 A;  2NWJ A;  3ZKK A;  3PMV A;  3FAS A;  3R6U A;  1L5T A;  3QUF A;  1MY2 A;  3K0V A;  5AE4 A;  1R9L A;  1M5B A;  2O69 A;  5I57 A;  3U94 A;  4IB2 A;  1PB8 A;  1NH7 A;  4ELO A;  4GVO A;  4DXB A;  3PPQ A;  4H8J A;  3QIM A;  4C0R A;  3QK6 A;  1IIT A;  3KN7 A;  4JBZ A;  3TQW A;  2XXP A;  4ESW A;  3HO7 A;  3FJM A;  2I6E A;  1RKM A;  2F6P A;  2I48 A;  4LQ2 A;  2V3U A;  3T9V A;  3VLU A;  3Q27 A;  3SEY A;  3UN6 A;  2V3Q A;  1R6Z A;  2FYI A;  1DPE A;  4RNS A;  3KN3 A;  4DND A;  3O6I A;  1JW5 A;  2Q89 A;  1LAG E;  5H8H B;  2I49 A;  1QUJ A;  4LON B;  1USY H;  2F97 A;  3PPP A;  3IO4 A;  3DP6 A;  2A5T A;  4NF8 B;  3RTW B;  5EHM A;  4NF5 B;  3K1P A;  2Q8J A;  4NWD A;  3G3H A;  3TQL A;  1LST A;  3UK4 A;  4EXK A;  4DCX A;  2ZYK A;  2GFE A;  2ZMB A;  1PB9 A;  2QJE A;  4H65 A;  4R6Y A;  1TWY A;  1HSE A;  1S50 A;  3E4R A;  4MLQ A;  3FXU A;  3OEL A;  1A40 A;  2HAV A;  3KGC A;  4YB7 A;  1IXG A;  2B3B A;  3N6T A;  3ODB A;  1N84 A;  1VSO A;  2YJP A;  1B1H A;  3K02 A;  4LAT A;  3PUV E;  4KCD A;  5DTB A;  3TTR A;  2PX1 A;  1B1X A;  3U1O A;  3N26 A;  4GRK A;  4X48 A;  3D4G A;  2QS3 A;  2O51 A;  5FTI A;  5BUU A;  3SEU A;  3TCF A;  1CB6 A;  3IJX B;  3PUX E;  3ZKL A;  1M5D A;  3RUM A;  2O7I A;  2QS2 A;  3SDF A;  1OQG A;  1QVS A;  4QHQ A;  1LFI A;  3PU5 A;  3KOT A;  3MAM A;  4WKM A;  3FAT A;  4R2F A;  3MZB A;  1QSD A;  2XXY A;  4YMB A;  3UP9 A;  1B51 A;  2HQ0 A;  4MH5 A;  4R73 A;  5TP9 A;  3MP8 A;  1IJ5 A;  1IJ6 A;  1P1Q A;  2GH9 A;  3KZG A;  2DYX A;  2G0U A;  1N76 A;  1ZIU A;  1BP5 A;  2BJJ X;  4ZEF A;  3O9P A;  3VV5 A;  1H45 A;  4IO6 A;  4F2Q A;  4ZEK A;  4GFR A;  1B6H A;  4N13 A;  3O6H A;  4M1V A;  2ZXT A;  5JK4 A;  4U23 A;  4NED A;  3D4C A;  4LVQ A;  1FQF A;  2F36 A;  3E9X A;  1EH3 A;  2R6G E;  3EQ1 A;  2VOZ A;  4ONY A;  3TAJ A;  3MZ9 A;  1B4H A;  1B40 A;  4F3G A;  2OWS A;  1MQI A;  1B3H A;  1QJM A;  3OO8 A;  5EHS A;  4RYA A;  4L0R A;  1WOD A;  1DTZ A;  3F11 A;  4PET A;  4EF1 A;  3HHG A;  1A55 A;  1B0H A;  4FEC A;  5DVI A;  2CA5 A;  4FOR A;  3OO7 A;  3DEL B;  5F7V A;  1BLF A;  3MXZ A;  3ZS6 A;  1NFT A;  1XOC A;  1FCK A;