3QK7A

Crystal structure of putative transcriptional regulator from yersinia pestis biovar microtus str. 91001
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
280
structure length
280
Chain Sequence
RTDAIALAYPSRPRVLNNSTFLEMISWIGIELGKRGLDLLLIPDEPGEKYQSLIHLVETRRVDALIVAHTQPEDFRLQYLQKQNFPFLALGRSHLPKPYAWFDFDNHAGASLAVKRLLELGHQRIAFVSTDARISYVDQRLQGYVQTMSEAGLMPLAGYLQKADPTRPGGYLAASRLLALEVPPTAIITDCNMLGDGVASALDKAGLLGGEGISLIAYDGLPDDSLLDIAVTPIVQNTRTSVGKQIASMICDLLGGKDPKELQVLWQPEIGEGETDGVNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of putative Transcriptional regulator from Yersinia pestis biovar Microtus str. 91001
rcsb
source organism Yersinia pestis
molecule tags Transcription regulator
molecule keywords Transcriptional regulators
total genus 89
structure length 280
sequence length 280
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2011-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00532 Peripla_BP_1 Periplasmic binding proteins and sugar binding domain of LacI family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3qk7A02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3qk7A01
4IF4A 1MB3A 3O2SB 5DKFA 3ROFA 4HNRA 2ZAYA 3SG0A 2JBAB 2IPNA 3A10A 4YV7A 1NXXA 1D4ZA 4RK1A 3EODA 3OLZA 3C3KA 1UDRA 4G86A 4W5TA 3LUGA 4P1ZA 1W25A 3LFTA 3RVNA 2GI4A 5DCLA 1QO0A 2A9PA 2WWVD 5C5CA 4N47A 5IUNC 4N41A 3O1JC 3OO1A 2IPLA 5KQGA 2QV0A 4WUTA 2X7XA 1JYFA 3O75A 5I4CA 3QLUA 1JYEA 7ABPA 1VKRA 1DBQA 3UKJA 5KQLA 5TQ2B 4WZZA 1Z16A 1ZN2A 2FMIA 4MLCA 5JNTA 1D1QA 4RS3A 5T7BA 3T8YA 1J56A 2GX6A 1E2BA 1RNLA 1Z2EA 5TE9A 1DBPA 3HS3A 5EWLA 2A9QA 2JK1A 2PUDA 4Z99A 2E4WA 1NXVA 3HDGA 4Q6BA 4LDZA 1JDPA 4HNQA 5TPWA 4GNRA 3KG2A 3OLYA 1VRVA 1P6QA 3Q7SA 4KVFA 4S04A 1LJUA 2FN8A 4OLAA 2NT4A 3KHTA 1C4WA 5TPZA 1S8NA 2FXIA 4RKRA 3H5IA 1ZITA 2WJWA 4F06A 1Z12A 4KZKA 2JRLA 2QU7A 1QKKA 4MYRA 3RVMA 1P2FA 4RU1A 3O21A 1QP0A 1P8AA 2HJ9A 3LUHA 4JB2A 1LBIA 4MLDA 3NNNA 3Q9SA 5CNJA 1JFVA 4EVRA 2IDMA 5EWLB 1MIHA 4KREA 1M5TA 5TQJA 3HUUA 4JP1A 3RVQA 4Z4HA 4Z9AA 5BR1A 4Z4GA 5HSGA 5IULC 1QPZA 1U2PA 4LDAA 4O5AA 1T34A 4EVQA 3CG4A 1DRJA 1BDIA 3O2JA 4OATA 3OLWA 1P6UA 5DLEA 2PE5A 3K4HA 1VPWA 4RXTA 3JS5A 2PJUA 5FBHA 1U04A 3H6GA 3T38A 3E3MA 2ZWMA 2DRIA 3GWGA 1L5ZA 4O1IA 1ZY2A 3RH0A 2VUHB 1IIBA 3IPAA 3MYYA 5JNRA 1JBEA 2RDMA 3OLXA 4YRZA 3RVLA 3QLVA 4HNSA 3M9WA 2PUBA 3OM0A 5BQ3A 3DZDA 3KCNA 4H3KB 4JA2A 3F73A 3FFXA 1TLFA 4S05A 1JH9A 3R0JA 4KMRA 4L85A 4LRQA 2N9UA 1YK0A 2A9RA 4XXHA 2OQRA 2FSPA 3T6KA 2B4AA 1YVUA 1LK0A 4QYMA 5TPWB 5KQMA 3BILA 1Z18A 4QICA 4KPYA 3L6UA 2MYUA 4MPTA 4ETMA 5GOTA 4UHKA 2YHBA 4JASB 1AB6A 2GKGA 3JPWA 2GBPA 4N0QA 1HEYA 1ZH2A 1DZ3A 2WMYA 3FMVA 2LPMA 3RVSA 5KI6A 3QEMA 1NXOA 3CZCA 1DP4A 4YGXB 2VYCA 4FB4A 1GCGA 4NCBA 1OXBB 5GQSA 2E4ZA 3MQ4A 1JX6A 2PKXA 2RJOA 1M2FA 3IDOA 1ZGZA 1KRXA 3GL9A 2JB9A 2MSLA 3URMA 1JFSA 3MIZA 1ZHHA 1FFGA 2QR3A 1QNLA 3D02A 4KQ9A 2I6FA 3LKBA 5CNIA 2CHEA 4H60A 1SXIA 4JOQA 4D6YA 2NUBA 3A0RB 3CKMA 2QXYA 4RWEA 4PYRA 4WT7A 1DJMA 4H3HB 4F11A 2O20A 1E6MA 3H1EA 4IGAA 4UHJA 2RJNA 3QEMB 3MF4A 3HDVA 3HXMA 3RVJA 2RGYA 3GBVA 3QX9A 4JB0A 1ABFA 3H5TA 4MRMA 4YO7A 2PUGA 4MQEA 3CNBA 4IMJB 1YMVA 3LMKA 3QX8A 1FQWA 4MR8B 3DLHA 1W9HA 3LUFA 4P98A 5TQ0B 2M1ZA 4WXEA 1NXSA 4RXUA 5IEBA 1RPJA 3RVOA 5BRAA 3NBMA 2PL1A 4WWHA 4RXMA 3TD9A 5EWJA 8ABPA 2PUCA 2WRZA 1JWLA 2MSWA 2W42A 2R4QA 4DN6A 4RKQA 4YLEA 4G0OA 2V0NA 4GPAA 4EY3A 4EYQA 4PZ0A 5HM6A 3KJXA 2WB4A 1PNTA 2CHFA 3CLKA 1SD5A 3I5AA 3I45A 3KLOA 4NCAA 2FVYA 4LE1A 4MQFA 3F6CA 4MQEB 2QVCA 3RVRA 3KKEA 2PMCA 3O1HB 2NZVG 4L4UA 3K9CA 1NTRA 4KK3A 4NICA 1USIA 3TX6A 5TQ0A 5PNTA 4G0MA 3IP6A 1D1PA 3QLVC 3QEKA 3FFWA 2IOYA 4XFKA 4G0XA 2PUAA 4N0PA 4RK5A 2KYRA 2M98A 1RXEA 5CHYA 2R25B 1K66A 1EWVA 1GLGA 3H6HA 1ZGGA 3W9SA 3KYJB 5B3JC 2L2QA 3P9YA 1MB0A 3JY6A 2J48A 5ABPA 2BGGA 4W5NA 1YS7A 4EYKA 3SAJA 4MR7A 1ISRA 1YK1A 6ABPA 3BRSA 2LUOA 4OBBA 4WXMA 2LIVA 2FQXA 4JAVC 1D2AA 1C0EA 1PEAA 1NY5A 3CG0A 1DCFA 2HQOA 1GCAA 3OO0A 5D2CA 2QVGA 4N03A 3JPYA 1TM2A 1ZDMA 3LUAA 3MM4A 1I3CA 2JCGA 1PHRA 4G0QA 3IPCA 1BVHA 1A04A 3KLNA 2HPHA 1TMYA 4MGEA 4Q6WA 2LBPA 4MRMB 1DC7A 1DCKA 1YMUA 1EHCA 5IBQA 5JNUA 4E7PA 3C3MA 3Q41A 2FEKA 4Y9TA 1LBHA 3GRCA 2YHAA 4MR8A 4Z4FA 5JNWA 3JVIA 1USGA 3Q7RA 4RY0A 4Z4CA 3LTEA 1WETA 3D8UA 3H1GA 4MR7B 3LUKA 1Z13A 4XASA 4KNYA 1QP4A 5EWJB 1QQBA 3CU5A 1JF8A 4PE5B 4MR9A 5KC8A 3H75A 1K68A 3I42A 5EWMB 4IRXA 1Z26A 2IPMA 3HVRA 3LOPA 4OG2A 3MMNA 3TMYA 3F6PA 4MS3B 4NV3A 3EJWA 3CZ5A 5HKOA 3HM9A 3KS9A 3RVKA 4MQFB 3JTEA 3N75A 4D6XA 4RY8A 1TVMA 2QW1A 3QLUC 3BREA 3HV2A 3N8IA 4ETIA 5DTEA 1JL3A 5T3YA 4KRFA 3LUCA 1DBWA 3VNBA 2R47A 4G0PA 2F8TA 4FE4A 2FMKA 4O1HA 4TN5A 1APBA 3FFTA 3RQIA 1Z15A 1EAYA 1OXKB 1YIOA 2IYNA 1ZVVA 5B3JA 4EGSA 1BAPA 3CFYA 5IUKC 3IP5A 1ISSA 2P9HA 3GA5A 3QK7A 1QQAA 4W5OA 5JS1A 4DQDA 2CD7A 3H5OA 1JLKA 3GBPA 3HK2A 3IP7A 1CEYA 5EWMA 2JVKA 2R48A 3H5LA 1QO0D 2FEWB 4E7OA 3HSYA 2HSGA 3IP9A 4RV5A 2QSJA 4MS3A 2MSKA 3EDCA 3ILHA 4TMYA 4PICA 2PUEA 1U8TA 5CNKA 3OQMA 1YTUA 1EWKA 2FLWA 1F51E 3EQZA 4PEVA 1SXHA 2AYZA 3LUDA 5C5EA 3C3WA 3NHZA 4KK4A 4ZPJA 3DBIA 4G0ZA 3GV0A 2PLNA 4EUKA 2F8SA 4B09A 3MA0A 2FKAA 5IEJA 4QPJC 1RXIA 4RK7A 2HQRA 3DGEC 4NQRA 2PUFA 3NHMA 2VK2A 2E4VA 5FBKA 1VLZA 3OLVA 1PNRA 3UUGA 3OMWA 1Z17A 4YR7A 1YS6A 1Z25A 2GWRA 2MYNA 2JVJA 3OMXA 4EVSA 4IILA 4RSMA 3GYBA 4G0YA 2WY2D 3QELA 1RZRD 2E4XA 3C97A 2LP4Y 1QMPA 5ED4A 3O2QB 3UK0A 3OQNA 3EULA 1KGSA 2E4YA 4MR9B 4OLBA 5JS2A 1JDNA 3N0WA 4YP9A 4ZMRA 5FWYA 4KV7A 1PEYA 1DRKA 1FFWA 4LE0A 2ID7A 1XHFA 3H5WA 4RDCA 1DC8A 3EQ2A 3C6QA 2L18A 1E6KA 1SXGA 1XHEA 3N6VA 5JNVA 1ZAYA 4LE2A 1LJLA 1JFTA 3CTPA 3DGFC 3KYIB 3O74A 4RK6A 3H5VA 1A2OA 5JNSA 4XARA 2H0AA 3QELB 3SNKA 4KQCA 3N0RA 1Y1LA 4RY9A 4Z9BA 4W5RA 3T95A 3G85A 5IUJC 1U0SY 4FE7A 3OQOA 3FGZA 2IKSA 3G1WA 3B2NA 5KWSA 4LX8A 4QYWA 1QP7A 5BRJA 3SY8A 4F8JA 1R8JA 2AYXA 1CYEA 3JVDA 5FWYB 1D5WA 3RVPA 1NXWA 4YWHA 4DADA 2ID9A 2WJAA 4MS4B 1A0OA 3LKVA 2IPAB 3NNDA 2FW0A 1F4VA 2QZJA 2PAFA 3CHYA 4RK4A 5TPZD 1FFSA 4YS6A 1M5UA 3DLBA 4Z4IA 2MYTA 3OM1A 1U2QA 2FTKE 1MAVA 2NZUG 3Q7TA 2P4UA 5IC5A 4RK0A 6CHYA 5IX8A 3HZHA 2FEPA 3L49A 1SRRA 4M88A 3N0XA 4F3TA 3S99A 1BDJA 3N53A 1RZRA 1NXPA 2JBAA 3ROTA 3SQNA 2FMHA 3A3KA 1L5YA 3HJFA 1M2EA 2FMFA 1BDHA 1GUDA 3E61A 3GT7A 3HCWA 3LUJA 3NNSA 4MAAA 3I09A 1NATA 4HYEA 1Z2DA 3VNAA 2JVIA 2A9OA 1AB5A 2NT3A 4Z0NA 1EWTA 3Q15C 3M9XA 5HQJA 1DCMA 2FQWA 4MS1B 1BA2A 3O1IC 4F12A 4KFCA 1KRWA 3FDFA 4OTZA 4CBVA 3CS3A 1TJYA 1XWWA 5E3JA 1KMIY 3TO5A 4ML3A 2OENG 1PUXA 3BRQA 4D74A 2Q5CA 4XAQA 4EYOA 1ABEA 2XDYA 2FN9A 5F64A 4LZLA 3H1FA 1H9CA 3HUTA 1JHZA 3F7NA 1USKA 4ETNA 2MYPA 2L19A 3HO1A 4ZYLA 4TLMB 4G97A 1E6LA 3KSMA 5FWXA 4ZMSA 2B1JA 4YCSA 2HQBA 3TB6A 4W5QA 5CNMA 4Q7EA 1URPA 4EYGA 1FSPA 4MS1A 4XLTA 2FLKA 3QLTA 3KTOA 4Z4EA 5DGCA 4MS4A 1CHNA 5KQPA 1GUBA 4ZJPA 2L17A 1DG9A 3HEBA 5KC9A 1NXTA 1B00A 2VUIB 2CWDA 2E4UA 3EAFA 3BBLA 3CRNA 3ILYA 3A0UA 4IMIB 4TLLB 2FQYA 2H3HA 4RZSA 1ZESA 2PL9A 3SM9A 9ABPA 3M6MD 1EFAA 1MVOA 1ZH4A 3EGCA 5FWXB 2TMYA 5TQ2A 4N76A
chains in the Genus database with same CATH superfamily
1SHKA 1PFQA 1W0JD 3Q7QA 3VVBA 4UC0A 1CY0A 2ZG6A 4ALIA 4CQMB 4QA9A 1H8HA 1TLTA 5JECA 4B35A 2H2DA 2O14A 3B53X 4OYRA 1L0BA 4QBIA 2V7VA 4FGUA 4DRXA 3QU9A 1E6WA 1NVAA 1E6CA 2IXFA 4Y9RA 3U39A 3TEFA 3QSYA 3IB6A 4YHBA 1T9DA 1E89A 2I3AA 5T57A 1KQPA 1ZN7A 2ZI6A 3ESAA 3ND8A 3SR4A 2HJGA 2XW6A 1AKMA 1H1LB 3NAQA 3RLIA 3P96A 1FRNA 3OU2A 5YASA 4ER0A 3CRZA 2VP9A 3QWFA 2IPLA 1O87A 1J22A 4XTRA 3WICA 2M9MA 5K05A 2E6KA 4D56A 3V7NA 3HYRA 3KB2A 2XUDA 3GNSA 5A9TA 3UKJA 2XNSA 1A82A 3K6KA 1FP4B 4J07A 1Z5WA 3ESZA 4RS3A 2VDWA 1E0SA 2QRVB 1MJHA 5DM1A 4KJZA 1QH0A 2HT6A 3RBAA 4D8TA 4EPVA 1G41A 1E2BA 3ZHZA 2OR3A 4PFSA 2XRFA 1Y8RA 2WSBA 1OFHA 2CNDA 4B83A 3U3JA 1JDPA 3IUQA 1I2ZA 4HNQA 2VP0A 4C0AC 1DC5A 1SJ9A 3JQAB 2Q7OE 3PXGA 3BC1A 1UR5A 1LJUA 3OESA 5HS6A 3PC4A 1J20A 2V4UA 3WGQA 3V7YA 4ZDJA 3FFBA 4AMGA 5GP1A 5AJHA 1EGAA 1ZO8A 5TPZA 3F49S 1NKTA 1UFKA 1F8XA 1ZITA 2LZ0A 1CDDA 2QP9X 4X92A 2WJWA 3CW9A 4ZODA 3VU9A 3IP1A 4CF4A 3AHDA 4X1IA 1DO0A 2OGSA 2JRLA 2J5QA 3ZBPA 4EG7A 1U98A 4LV6A 3JAMA 4DV2B 2FSIA 3HADA 3WAGA 5DGXA 4HDRB 5TX7A 1C3LA 1D6SA 2OEPA 4FFBB 1FUKA 1P4RA 2PKCA 3CUUA 1O9BA 3ILSA 3P4XA 4Q3BA 4YJ2F 3M9LA 1M1NB 1DC4A 1J33A 5DHSA 3AB3A 1BVYF 2VF2A 1JFVA 1B93A 2GK7A 2QIPA 5JDCA 1CZRA 1QGZA 5HJ7A 5EE1A 2PMWB 3RSZA 5C18A 4P7JA 1C1XA 1SXJE 1XCGB 1X7HA 2F43A 2QR5A 3G2MA 2FPUA 4FK8A 4XEUA 3S40A 1M83A 4CU5A 1X1QA 4O5AA 4EBFA 3GT0A 2VK4A 1RJ9A 4GOLD 4IIXA 1MGOA 2IYVA 2BMEA 1BDIA 4YMIA 2PE5A 4TYYA 2CFSA 3JS5A 2OMKA 1WMSA 2VDKB 2WG2A 3BD6A 1JIXA 3H83A 4GBED 4NFLA 3GLIB 3RYIB 1N2GA 1XAHA 5EP3A 5G02A 1DEOA 2R11A 3V7WA 3VR2D 1UKAA 1RPZA 1XZQA 4C0LA 1U11A 3R6DA 1MDBA 5DYNA 3HN7A 4IFIA 5I9SA 1NP7A 1Q44A 1BS2A 4PU0A 2GZAA 4OA5A 4H0FA 3M9WA 3H2JA 1B73A 3T99A 4TV8B 2Q7DA 3UC9A 4ZHSA 2DEUA 4H3KB 4HGZA 5CX4A 2W4MA 3EZ6A 5HM8A 4RNCA 4S05A 3HSKA 2C29D 2ZSBA 2EP7A 3N7TA 3REQA 4X84A 4S1OA 4WA7A 1UJNA 1II8B 2EBWA 2ZT8A 1G8HA 1K8XB 1KVQA 1LWOA 1JQKA 3PT5A 3KBBA 4L08A 3AHIA 3CX8A 4PCAA 5FLKA 3UWDA 4A8PA 4INOA 4D0NA 4NLLA 3M6AA 1P61B 1OH8A 3OUTA 1VHWA 2MINA 1SUWA 4MEBA 5AUOB 3L0ZA 4CKZA 4AG6A 3ZPXA 5AI0A 4CDRA 5IJ0B 5IAKA 3IDQA 5FAKA 3P0IA 5L4NA 1RI3A 4P2GA 3RVSA 2WMYA 3GGDA 1G8PA 1CKEA 5E1OA 4O5OA 1J0XO 1C81A 4Y2QA 2G8LA 3MAAC 1MV5A 3SZLA 2H63A 4E4YA 2XKKA 1UKEA 2E4ZA 4EO4A 2ZSAA 3C7TA 2COKA 3H2YA 1KDOA 3DEIA 4O4HF 5C8YB 2QYSA 2C88A 3EUFA 3P97A 4MW0A 1X15A 2JD1A 3HRHA 3DBRB 3URMA 3SQXA 2OO3A 3D02A 1IL0A 3O4JA 1PVDA 1E1CB 2A14A 2AR7A 5IDVA 2FW6A 3FI9A 1WSAA 4PLZA 2WT4A 2B2XA 2QRZA 2QXYA 3VTFA 2DBQA 3AY0A 4PYRA 5FPKA 1DAPA 1RLJA 2I2DA 3AJAA 3B1ZA 3K32A 3UYKA 2B83A 2P1RA 1Q83A 3O3NB 1YB7A 1U28C 3M4JA 1ZI6A 1E6MA 2AOWA 4RF5A 4TM8A 1RMYA 1IXRC 1Y4AE 1T5SA 2HA0A 4A1FA 1XVUA 3GEEA 2Z2XA 3C6YA 4A23A 2RARA 2I7CA 1XEFA 2OV4A 3LT1A 5B1IA 1P1CA 1DJPA 3LBYA 5E1MA 3B36A 1C9JA 1JQ3A 2HREA 4BZQA 3WK7A 3I61A 2XTMA 3JWHA 1FSFA 2A5GA 1Y42X 3T0FA 4B3XA 4OLJA 2D59A 2QGFA 5MN6A 1OV6A 4FWBA 5TQ0B 4IZOA 2DZDA 3LQ4A 4MGZR 1S89A 1KDRA 4ZVPA 3FYHA 5EXEA 3KYDA 3R9KA 4OB8A 1KPHA 5DM4A 5HRUA 1NVBA 3DMYA 4G8DA 1Y63A 3WYBA 4PPGA 5L3QA 4NENB 4DG5A 1JWLA 2GK3A 1T4GA 1Y3AA 2DTXA 1PZMA 2EYUA 2ORWA 4RD2A 3QTBA 3NGLA 4RKQA 4UHEA 5EEHA 1MNAA 1OXXK 4CKCB 2X6QA 5G3ZA 1XRNA 4LK2A 1QYIA 3F5SA 4GOND 1ND6A 4LQDA 2XUFA 4YP1A 1JVBA 3I5AA 3F67A 1W48A 4AY5A 2DT5A 2QY6A 3AFMA 3IPRA 1FDTA 3AUYA 2OCGA 4GLOA 4P93A 1ECLA 2V45A 3GXOA 1GADO 3LDUA 4RIIA 5ALOA 2NU6A 2Z3WA 4KK3A 1EQ2A 2XDWA 3LK6A 4OHBA 2OB2A 4NC9A 1U9YA 3U60B 3X2EA 3T7DA 3ML1A 3DHYA 3U40A 2QD1A 5HKKA 3LGXA 2PL5A 1TVCA 2ZAOA 3N5CA 3TRKA 4DXHA 3PL5A 5CHYA 4JJEA 2R25B 5FUVA 2IHNA 1T0PA 4MVCA 4AY2A 3CSDA 2E21A 3RI3A 2UZ1A 5DNAA 4FBLA 1AGNA 4BASA 1I32A 4QFBA 1OBOA 2ARKA 1DL5A 4S12A 5DW3A 1IBCA 3X2FA 1YL6A 3AKYA 3CJQA 1Q1BA 3NDRA 1QMGA 2J08A 1ISRA 4FWTA 1R6BX 3U62A 1EDEA 4OBBA 2YC2C 2WTBA 1G6OA 3O9ZA 3ZZMA 2A86A 5C4IA 2P2YA 1IU9A 1LEHA 3ZX5A 3O95A 4FHGA 2QN3A 4S1VA 5CJ2A 1L5LA 1JFFA 3A1EA 4OBXA 4EHHA 1ZN9A 2WF5A 1JE1A 2WDZA 1PV1A 2ATVA 2JCGA 2QU8A 1KI3A 1V4VA 3G2KA 2HPHA 3AGQA 2PPVA 5LWQA 2EV9A 1CVRA 1NE7A 3KT3A 1OBHA 3NTRA 4MRMB 4C4AA 4YV1A 5AW0A 3KJQA 3GRVA 5HCUA 5LXTF 5CAEA 1HRDA 3AESA 4YT5A 4TTPA 5GAJA 1IEQA 3N07A 4W99A 4YYEA 2QM3A 2A9KA 4C03A 4B9EA 3COPA 3AVYA 4JWTA 3TZQA 3UMMA 4URXR 5I9BA 2JZCA 3S0JA 1G3UA 3WZLA 2GQ0A 4UREA 1YFLA 4KNYA 2P2NA 4ZEVA 3RARA 1NRIA 3I5YA 1DKPA 1S8FA 1O8CA 1WHSA 2CSUA 2QUIA 4KWCA 4MR9A 3UH1A 2WW8A 3L0BA 1RS0A 1BOOA 2JIMA 1MRZA 5KNBA 1FC0A 3R76A 3GMTA 2IPMA 3LGAA 4ONEA 2OB1A 1ZSYA 4GFDA 4YFVA 4CEHB 4ILEA 5ALLA 4E21A 1EB8A 4OX9Y 5DGHA 2BFMA 1O2DA 4J16C 5F21A 3MT0A 1D07A 3NTLA 4NVRA 4WX2B 1P4GA 3DOIA 3OX3A 2L69A 1BN6A 3AIKA 3HGQA 4LJ6A 4QYXA 3FNFA 4OQDA 2KHZA 3CUEF 5DTEA 2G25A 3L1VA 3C7CB 5FOSA 4AX8A 1E1RD 4LSWA 1N2CE 1KDZA 4L8GA 1T4DA 4ENSA 5FB3A 4MV1A 1ZYUA 5B3AA 2C83A 1CEEA 1SOMA 3DZBA 3UMSA 1B1CA 1JLLA 2Q07A 4NABA 4W5OA 1SC6A 4J43A 2W98A 1FLDA 2O7SA 3FD8A 1USUA 1FDUA 1KA9H 5HOQA 1PR2A 2BI7A 4XDGA 4F6RB 3KK0A 3K2QA 2E1PA 2DHRA 4MS3A 3ILHA 2ZXEA 1ESDA 1FU4A 3JZIA 3HZZA 3JYOA 3L0IB 4OH7A 5EZSA 2WTAA 3LM8A 1W4LA 1ZVKA 1VPDA 3A8TA 2J33A 1V16B 1PQUA 2O2JA 2PLNA 3A6FA 3CMMA 4IGEA 2JGDB 4QUBA 3LA6A 4F5EA 3E8XA 1Z6QA 3N39C 1KPIA 2PUFA 2PRJA 5LUBA 3JU3A 5HF9A 2HMSA 2W6OA 1JU9A 4EX7A 3ASYA 1HTBA 2PGDA 4R8KA 4TWRA 4YDSA 1KQOA 2FF7A 2VDNB 1J4AA 2VJQA 2VDUE 5D3MA 2YZGA 1IUPA 2GFHA 1FVXA 3PZBA 5EA2A 6PFKA 1RFGE 4GUAA 3SR3A 5HMLA 1EE2A 2NGRA 4G41A 3RCBA 2JLZA 4DLRA 1M0SA 3R6TA 1G38A 4ZCIA 2TS1A 3M6FA 4WH0A 2X5XA 2G1KA 3HP1A 3SSOA 2PVPA 3W2FA 3C98A 3H6KA 3EY9A 5G3YA 1WSWA 3X1MA 5DSTA 3W7AA 5E0OA 1SIOA 4DWOA 1Y3BE 4WLUA 3HUEA 4PM4A 1SZJG 3KXIA 1SVSA 1YBVA 4LE0A 4PAQA 4HZIA 3U61B 5ESWA 2P9CA 5IT0A 4XE5A 4O2AB 2AKEA 2FZKA 1EPUA 1N75A 1SD2A 1VJ0A 1FFBA 2XKJE 3N6VA 5H68A 2Q62A 3MILA 3TLBA 1JFTA 5FR1A 1GNQA 3O74A 4ARBA 3EPHA 3RM3A 3N2GA 2ZIUB 3O0TA 1KO7A 4FYVA 1JJ7A 4DXDA 5IABA 4K9PA 2PO7A 1SRQA 1EFUA 4I50F 3IULA 4GL2A 2I3ZA 3EZ9A 2JASA 3TOXA 3BTUA 3HFSA 4YACA 2IKSA 2I6GA 4Q4HA 4KRYA 2X3FA 1P73A 3H1TA 3KT8A 4RJJA 5D51S 1G20E 4BMXA 4FCWA 5BRJA 3MLAA 3T1TA 3WNBA 3OF2A 2Z83A 1U4SA 1JB9A 3DVLA 4YECA 4NFHA 2IU0A 4DADA 3TS1A 3OF3A 4A92A 5HQTA 1UZLA 3HU5A 2DY1A 4MWGA 3W8NA 2YV5A 1EEHA 4AQYB 4B3HA 1U7DA 1EK5A 1SBNE 2ZWAA 4PLPA 4RAQA 1HM5A 2PAAA 4RMHA 5AK0A 1NM5A 2A4KA 2C2HA 2JDID 4TRMA 1GRQA 1GQFA 1YKFA 2HDOA 2JI9A 5EI5A 1R50A 2A6PA 3WMWA 3MJTA 2WILA 3CE6A 4ZI7A 1PK7A 1BMQA 5H1YA 3DLBA 3IPYA 5CCXA 2B94A 4TLDA 1MOQA 3PGKA 4RH1A 4WTOA 1GITA 1P7YA 5JRZA 2CV2A 1O08A 2HA6A 2XTAA 4RK0A 4YEDA 3BMOB 3TSCA 2JIOA 1IHXA 4TKVA 5JZ9A 1J6UA 1K5HA 1KAHA 4M88A 2WM8A 4IHJB 2PRKA 3PVSA 4KFRA 4X91A 3TF5A 2HJWA 3CLUC 1FFEA 3F9CA 1LLUA 3NX4A 5EXDA 5HCIA 3EGOA 4ZU6X 5K99A 1MQAA 4NU8X 1RRMA 5TC4A 5B1HA 5HIAA 1XDBA 4FUQA 4AK9A 3KR9A 5JTTA 1KERA 5CM2Z 2D2VA 1N2IA 1Z2DA 1DDOA 3PKIA 3TUJC 2GEJA 4WXRA 4FQ8A 3ST7A 3C7KA 4D41A 1T8WA 2GXAA 2RCYA 4J7XA 4TQUS 4OTZA 1OAOA 2FFJA 3NYRA 2SCUB 3TPFA 1QU2A 1TJYA 2P75A 2BJWA 3F78A 5BUZA 3D2BA 4ZRDA 3QY9A 4E5KA 2G09A 4K86A 4DR1B 5J5AA 4ESVA 2H0RA 3C3JA 4C0WA 3EEOA 1QCDA 1X1DA 1T4CA 5AT1A 5IAGA 3UT5B 1U7TA 3LT0A 3OE4A 1F5SA 4IEIA 4U7TB 3C14C 3QNUA 1Z7GA 1R5NA 3C43A 3L8DA 1HT1E 1S1MA 3AMVA 3RROA 2RONA 1RWKA 2ZRDA 1E6LA 3KSMA 3OP4A 4GOJA 4Q3AA 4QYIA 2EIXA 3W77A 4B3DA 3VOAA 5A4DA 5CIYA 4EPTA 1QYVA 3TB6A 2Z6AA 4YDHB 1JPNA 1UM8A 4WECA 3RIYA 3K8QA 4H2DA 1KWGA 1IVSA 2QY9A 2X77A 4WJKB 3U3KA 4JLJA 2DULA 3GDFA 1KOGA 3L6OO 1YBFA 2CDAA 4BBJA 3OP1A 2EZUA 4HZGA 5HFNA 2GLXA 2ZJ1A 3FG9A 3UVEA 1R0ZA 2CJFA 1ENZA 2H48A 1U90A 4YCLA 3CM0A 1RI2A 4L5AA 3TAHA 3OOHA 4TYNA 1B00A 4HWGA 1M34E 1V1MA 4HY3A 5CDFE 3AKZA 3MJSA 1Z6PA 1D9ZA 2ZIXA 3FOEC 3ZDDA 3K09C 3P2KA 3RF7A 3V4LA 4AYXA 4KXXA 3Q7IA 4HN9A 3KYCA 4CQJA 2NACA 3ZLUA 5LL6P 1NVEA 4N40A 4PAMA 1DQZA 1XN1A 3NTQA 1JVNA 3Q2IA 1X7DA 4XQ0A 5TMEA 3W9BA 4N76A 1T9ZA 1SUBA 3IALA 3B2QA 4YNBA 2FA9A 5CYGA 4HB0A 1AH2A 1HH4A 1T0JB 4QQFA 4JBWA 2PPLA 3MEQA 3FDZA 5TNXA 4XWAA 4WCFA 3VGJA 5LPNA 1WM1A 3WTBA 2W6JA 3G13A 4KWEA 5A02A 1XZAA 3K2BA 4WXHA 2RGDA 2M6KA 5B36A 4AKTA 5K5EA 4DR6B 5EEGA 1ZZEA 2QLFA 1TCUA 2AI2A 2HDWA 3E0QA 2ZRJA 3FZEA 3GB9A 3NI2A 2E2WA 4ILKA 4QLOA 1KZHA 4E15A 3P9XA 2XGMA 2WWVD 2QX7A 3RRYA 4DUZB 4K05A 4WUVA 2AN3A 3E84A 4M0CA 4C7KA 1MJGM 3ZDBA 4JYPA 5J1TB 3CVOA 3GUYA 4DBVO 3VAAA 1AQUA 3TLGB 3ZVRA 2ZRIA 1M8JA 3LPLA 5T6MA 1TAQA 4C89A 4HGQA 4KXUA 4EHBA 1K75A 1XNHA 1XEWX 1Z2EA 2FPLA 3UV7A 1SG9A 4E46A 3WGIA 3PQ8A 1AMOA 4H7JA 3F71A 1PWEA 1ST2A 2R6AA 1TAHA 3G0BA 5GJBA 2QRPA 5EJ2A 2C58A 3OFKA 3B51X 2I1LA 1U02A 3M5DA 3RC9A 2X1LA 4BO2A 3BXEA 2JLAA 3O8DA 3OUUA 2CLKB 2VHTA 1HNZB 3VH1A 3LHSA 3DWFA 4OU5A 3VOSA 4JGBA 4OLAA 2IKQA 4OBEA 1P33A 3DMTA 5LZ5A 1FBNA 2C59A 3UUFA 1LDMA 1MC4A 1N0IA 1XZMA 3I34X 4NRDA 3RG2A 2P9JA 5U4QA 1U5CA 2WIAA 2XBUA 2YJGA 4CM8A 5IBRA 2B34A 2X2PA 5CRIA 1AUQA 4YT8A 5FUQA 2IJGX 5BVGA 4DCTA 5LP6F 1V2HE 1ZONA 3INRA 2PKRA 1LRKA 2FN7A 3WLHA 4TTSA 3P19A 1ONOA 2O06A 4MV9A 3ZV6A 1U0OC 1SXJB 3OWOA 4MA0A 2F3PA 2HM7A 2H7YA 1TUGA 1TU0A 3H04A 1MC8A 1V11B 1UXJA 4HNUA 1WEHA 3BIFA 3L3BA 1G17A 2XNDA 4GWLA 2OXFA 2O23A 2CV1A 2GHRA 1PZGA 2ZBPA 2ZANA 1ZOLA 2Z9DA 2Z6QA 1VXOA 3H16A 3T9CA 1XA4A 2YWFA 1L4YA 1Y9AA 2EZ8A 4YC7A 1LDYA 2D06A 3EHDA 2OXTA 3SMVA 1P6UA 2BPOA 5CBPA 2XDAA 3A9UA 5KYUB 3BFVA 5REQB 3COZA 2BZSA 3BZUA 2PJUA 3M5WA 4YDRA 2XNHA 3BRCA 2UDPA 1IJBA 4MIOA 3GLGE 2ZWMA 3DOHA 3HKCA 2AX3A 1OKKA 2XOKA 4JU8A 3L9WA 3NOQA 1SC3A 3GRFA 1GV1A 5BV8A 1KMNA 4OL9A 3KQVA 3PNKA 1ECFA 2D8AA 3W05A 3QFHA 1ZGAA 2CB9A 5JNRA 4RFLA 1VRCA 3NM6B 1JEQA 5GM1A 3OLXA 1GRCA 2RFLA 2JHCA 4HNHA 4DL9A 1UPBA 1C7RA 3I1IA 2WU4A 4NCIA 4YRDA 4GUDA 2ZCUA 1VLHA 3BH0A 3AEUB 4FEAA 2IYSA 3QBJA 4G65A 3EVGA 1C3OB 2CDBA 3ESCA 3T6KA 2BGNA 3PL1A 3UFXA 1NVXQ 5MGBA 4C2UA 3BWDD 5A7GA 4E11A 4ERXA 1JT2A 1ZJJA 4M60A 3STHA 4LJ8A 3MJRA 5LUAA 2MCFA 1Q1QA 3E7FA 1DV2A 3ZY4A 3AF1A 3LW8A 2X9QA 3LPAA 4QECA 3RR2A 4R8SA 2OXCA 4FHFA 1T2AA 2ZUDA 1HEYA 5JI2E 3PRJA 4JKOA 4KGXA 4EA6A 4R16A 4RFVA 5BVHB 3NHSA 4JKYA 3QLEA 3RJ5A 1DP4A 3MB5A 3H9CA 4X61A 4AJNA 2OPHA 4BHTA 3J80A 3ZDEA 1RWNA 2EGHA 3NIWA 3ZV7A 4DV6B 1VKJA 4WKNA 1HMYA 2HBRA 3LWDA 5ALRA 4XVCA 3AUTA 2FGKA 3IDOA 1VHDA 4F56A 1AS2A 3MERA 3FA2A 4ZCSA 3OX2A 2ZSHA 3DT9A 3WISA 4E2ZA 1GSOA 2IV2X 3ZXSA 5JPCA 1LPSA 1QIJA 1Y7IA 4EPXA 1ZW6A 4MWSA 3P2JA 3TLAA 1QIEA 2BC9A 3FNEA 2YICA 4WVFA 4EUSA 4B6GA 4FFPA 1SQGA 1Z22A 1G7RA 4IEFB 5IT9A 3GOHA 3EISA 3SLGA 1W8DA 3ZZTA 4P0PB 3D4IA 2Q41A 3W8FA 2YMPA 2CXRA 3BRWA 2ZJ4A 1WO8A 4LSMA 2QNRA 4G4GA 2ZDQA 1G42A 2CFIA 4PNHA 3TDKA 1P7PA 2XMGA 5DTIA 4YMUA 2VTBA 2VFAA 1CZLA 2O4UX 4HDMB 3WKDA 4J0EA 2O3RA 2HFJA 3DH0A 5EHZA 4R1QA 1K4YA 5CIQA 4R54A 3ND7A 2OCPA 3JD1A 3KXKA 2IE0A 4HP8A 4KR3A 1X7GA 3AB8A 1C2TA 1L4EA 4KWIA 4N3NA 4RXUA 1LV7A 4UFNA 3RVOA 2MHCA 2RK3A 5J2UF 1SKYE 5EN4A 3P71T 4KQXA 3PFBA 2DLDA 2X5OA 3I0MA 3JQ7A 4Z9YA 2ZAIA 3NVMB 5BSFA 1LD3A 2IQ5A 3THWA 4K3VA 5ULLA 3G0IA 2VP3A 4BJ6A 2PR2A 3CF4A 3DAOA 4FKMA 2C5HA 5JSUA 1GG9A 4C6TA 2GARA 2P4EA 4C3VA 3UTDA 3H4VA 1Y1TA 4RJKA 3AVPA 3CTMA 1PVOA 1KJ9A 3WRXC 3EUWA 2ZE7A 3RK0A 1QIDA 4EITA 3CLKA 1QZUA 1C9EA 1OI2A 1ZVMA 1OZ0A 2ILTA 2AJTA 1NL3A 1R3DA 3FUTA 3R3VA 4JUDX 4MAMA 2H06A 4MQFA 1I3MA 4TL8A 1W85B 4BNWA 2NZVG 2PH1A 2R5NA 2Z6VA 3K9CA 2YOGA 3KJGA 4JQCA 4II3A 3F74A 4P82A 3SSAA 1BDBA 2YMLA 3OE5A 3OZUA 1ZCAA 3ECCA 3GQBA 2Y6UA 3FPEA 3UAYA 4CKWA 1IY0A 1GEGA 4DGSA 1CP3A 5H59A 3S4YA 3STUA 3NU1A 3WO0A 4DR4B 3Q40A 4E30A 4MUGA 4OREX 5KCZA 1DRUA 2PSDA 4FMBB 1JG4A 1GSIA 1MGPA 5K45A 4HDKB 3SQWA 4B6OA 4HYTA 2QNBA 5GGYA 3HABA 2UYYA 5CH3A 3WIOA 4HAZA 2XWPA 4V0KA 4PWYA 1CY1A 1T8PA 2CXUA 4TKUB 2YJTD 3C3YA 1BEUB 1VFPA 5AHKA 4BGEA 4Z6KA 4M8KA 1HPLA 3NAGA 4TL9A 2AEEA 2ZR8A 2ZUWA 1SD1A 2GJ8A 1CUCA 1N36B 3KOZA 4O3MA 2V6FA 1LNZA 4QGFA 4ZU3A 3RSCA 5DTRA 3TBKA 1EBBA 3SR0A 3CKYA 4BAUA 2C7QA 1PWHA 2VPIA 3I0NA 2QLLA 2V7XA 3DWEX 4U2KA 3ZG6A 4W5WA 1UBOS 3IT1A 1DC7A 3MS2A 1T1SA 4Y6PA 3WJAA 3RYCB 4LPKA 1Z73A 4JLPA 4ZHQA 2R66A 4DFDA 2AFIA 3GRCA 4HT3B 3AR6A 3W79A 2ANBA 3QYPA 2CL7X 3A2LA 5JNWA 3D1JA 1QS0A 1VJTA 2JFBA 4TXMA 4YJ3B 3WXMA 4KR2A 2NSDA 1NW4A 4ZO8A 3T7KA 3I9V6 1YL5A 2DPGA 4HNTA 3LUKA 1IY9A 5IH7A 3RIEA 1IAVA 1KMQA 1SQ6A 2GCGA 1B43A 2Z8YM 3ADKA 4J0GA 5JWHA 1GZ4A 1G2PA 2BI8A 5DHFA 4MKHA 1W49A 1F7VA 1L7MA 3BSFA 1KHHA 1TFUA 3DDCA 5ECGC 1PYOA 5JEEA 5IVDA 3SHOA 3D5QA 3THXB 1Z28A 2IYEA 3I9OA 5BN4A 4QT4A 2DAPA 4EZEA 2I71A 2LE0A 2QX4A 1OWPA 3G8DA 1ZRMA 3AL3A 4ZYUA 4WK4B 1CS0A 4Q9JA 4JLVA 3TI7A 2ZIGA 3WWZA 1QONA 2HF9A 1Y6JA 3LUCA 1T43A 2C2ZA 3O26A 3U09A 1X8XA 4E5PA 1DIHA 1Y9EA 3VYTB 1JQDA 5KTKA 1YIOA 2ZJBA 3ETNA 4YAEA 1IN1A 3WV5A 2BI4A 5K3SA 3A25A 1YH3A 3QXHA 1QE0A 3M6VA 4PS0A 4TYWA 3BWCA 4TRJA 1U2DC 2BEKA 3TPCA 1LSOA 4XGRA 4KR6A 2FZLA 5P8WA 3ZK7A 3D8BA 3HGTA 3QKUA 1GDTA 1TMKA 4RE6A 1LB1B 1W46A 1QU3A 2B6NA 1NN3A 4HQRA 4KRGA 1F51E 4PGHA 1Q0ZA 4X1YB 4IWXA 3NP9A 4ZN6A 3GOQA 3KQSA 9MHTA 3LUDA 3GAAA 5AESA 5B57C 4DA9A 4KJXA 2IYPA 4CQLB 3TZHA 2H4YA 5B55A 1B14A 1XMQB 2WD9A 2F8SA 2O8CB 5M29A 4MUBA 3NIGB 4M8IA 1HETA 5T6BA 3VSDA 1XNQB 2HJRA 2X19A 4HADA 1T8UA 5M5BA 3QGMA 3C7DB 3FFAA 3QBEA 5KZMB 5DN6A 4FJ0A 1X1TA 2PV0A 3WWEA 4ARIA 2I8LA 3K0FA 1XZ8A 3EVNA 1IULA 3G68A 3JQFC 5FPPA 4X97A 4B48A 4PYJA 4CM1A 4JCCA 4C6RA 1EVQA 3TCNA 3UXEA 1T24A 1PDVA 5C3MA 4N54A 1EBFA 1FYEA 5J2UB 4NXNB 1J1IA 5BWCA 2HK9A 3LHIA 4RY2A 3T5CA 3H2HA 4ND8A 4G0VA 3QKRB 1OVGA 4G5YA 4PCLA 3KX2A 2P6RA 3DFZA 2W7TA 4RSRA 5FRDA 5TY0A 4QUEA 1IBLB 4MDEA 2GRUA 1FFWA 3EG5A 2XT0A 2ZQZA 4OV6B 4EA9A 1PYGA 3CUKA 4PX5A 3C6QA 1O0SA 4P3KA 4RZHA 5C5DA 1IJEA 4XRGA 2SNIE 2XZPA 1X7XB 2FUG6 4IHQA 1L5KA 3DGFC 1K9VF 4W9MC 3CVUA 1I1QB 5IFLA 4M98A 5DSZA 2V7TA 4IRMA 4KQCA 4RPJA 3SNKA 3AHEA 3VDRA 4B0OA 4XB2A 4U6QA 3LY7A 1NKSA 1I9CA 4EI9A 4FE7A 3M4YA 1Y34E 3INTA 3SDZA 4RMGA 4U6SA 3S29A 3VTZA 2NXJA 1TD1A 4YN3A 2OA0A 1NF2A 2G04A 2AC7A 4A8HA 5IF9A 1Q91A 4MWDA 4BAZA 4J0HA 3OQVA 1WY5A 4FJ1A 3TSOA 3GF4A 2JFQA 4LHVA 4QOFA 1Y6FA 1TO1E 3TNLA 4AS3A 1GZUA 2YZKA 4AROA 5HP4A 4MDYA 5ELXA 3QKIA 5AI8A 4LHSA 3KNZA 4NCHA 4DIFA 5LDHA 1XCBA 3AUSA 4PYIA 5T3UA 3U26A 1FFSA 3B1JA 3DE7X 1Z5ZA 4IR7A 3ZX4A 1X77A 1XF9A 3KZXA 1CBUA 4BQOA 3W4IA 1M2JA 1SBYA 1MAVA 2X7JA 4R7TA 3GFGA 4DZZA 4O63O 1DKUA 4WOCA 4DV5B 1FX0A 1ZNWA 3N70A 5E6SB 1BDJA 2IHUA 4NE2A 4BLRA 5CVDA 3GLTA 2AN5A 3PUWA 1VL0A 2PWAA 3SQNA 2C57A 1R4NB 1NC1A 1BMTA 4DCCA 2I6UA 3HJFA 1SVOA 3OCVA 4IIJB 4OQMA 4BFLA 2X1MA 3LUJA 1L8LA 4PZLA 2C94A 3G9ZA 4YJ3F 1EIWA 1BRMA 1XA3A 3U4AA 3G17A 1OMOA 3C5WP 4UAGA 6ADHA 3GMIA 3U5TA 2AEFA 4NU0A 3WS7A 1DCMA 1B8VA 1NV9A 5JFOA 3AKDA 4LJYA 4F3KA 1F2UB 1VJGA 1VL1A 1ULTA 2GZ1A 4FR5A 4EATA 3QVXA 3UB4A 5JLJA 3LX5A 1Y8QB 1IPHA 1QUFA 2XB4A 2ZJ8A 4INZA 1IC6A 1L5GB 1IQRA 2XADA 3QE2A 1EFVA 1GXSB 5GONF 1X1BA 3PR3A 1ABEA 5KNLA 4GMXA 1N2SA 5K3FB 4GIBA 4PG8A 4LZLA 4JVSB 3AI2A 3V2HA 1E2MA 2IHVA 3IOCA 3JRNA 3SXUA 2OYCA 3RT1A 3GT3A 4IFBA 2FK8A 3KUDA 3KOMA 2KLBA 4YCSA 1QOPB 4KYUA 4I6GA 3BFJA 2KPOA 1YJAA 1GQSA 2BEUB 3JQ9A 4A8JA 4HEQA 3QF4A 3RHTA 1YQ9A 3ORHA 5L3RA 1NWHA 2DF8A 5DOZA 2VRNA 1UBEA 3OFJA 2AH5A 1IQPA 4Q1VA 1KDVA 1G19A 5CVCA 2BHTA 3L0OA 4HTFB 5HXAA 1XF1A 5AM4A 1TPZA 3ZGYA 5ILOA 2E4UA 2LVBA 1WCIA 1KO8A 2BHRA 2PZGA 3ADOA 2FQYA 4C7JA 4ZYTA 3SZOA 3PNOA 3UMGA 5JW6A 1RXCA 3C39A 1GPBA 2VJYA 3EQ8A 1AKVA 3DKPA 3QOWA 3V9PA 4JUIA 1VG9B 4N65A 1S0UA 5EVJA 1FLVA 3K53A 4IF4A 1COWD 3TIVA 1G5QA 2YYSA 1CJUC 2OHHA 1FY2A 3UWOA 1YULA 2VPZA 3D3NA 1JDUA 3M8KA 3ANSA 3KLPX 4FFSA 4MGHA 2ZB3A 3E9EA 5HBGA 1JMKC 5HMMA 4IOMA 5GZ1A 1AHHA 4B9AA 1PS8A 3PEWA 1XJQA 3FWZA 5AJYA 1FDSA 4Y9UA 1XVLA 3NGMA 4Z0TA 3VNRA 4DMFA 2C77A 2C8JA 2X8BA 4PHFA 3SN6A 5LQUA 1KJYA 3CKKA 3GEDA 2G1PA 4C2BA 4BFWA 3I64A 3VZCA 5FD8A 2Q9UA 1TQ2A 1YS1X 3WSVA 1ULUA 2H00A 3OO1A 1OW3B 2ZUBA 1P1RA 3UG6A 4BYGA 2V9PA 1Z5NA 2X7XA 3OKAA 3QLUA 1NRXA 2YINC 4Q01A 4TQ9A 3ZY2A 1J0BA 3G2PA 3T1VA 4BBZA 1VJ5A 5AHRA 5G40A 2FMIA 2Y92A 3FTEA 2CXSA 3T8YA 3ZDFA 1EKXA 1SPBS 2ZOSA 4K6OA 4KH1A 3UOAB 2O0LA 3ZS8A 5EJ5A 2CXHA 1NQWA 1IN7A 4LAFA 2N47A 1F2DA 3K9HA 5JAUA 3IKMB 2JK1A 1VMAA 3B12A 2QJRA 5EP2A 1SPXA 1NXVA 4UQPA 4MARA 1I6MA 3R0XA 5IS2A 3AYXB 1JQ5A 4UUMA 4PNEA 1V5EA 2V7WA 3ES9A 3K96A 4JJAA 4WDRA 3A4VA 5C8YF 5KYKA 3C16C 2ZPTX 1U9CA 4AZSA 4MW9A 3NEAA 3C3PA 3ZY5A 4DZRA 5F7XA 3F98A 5IWCA 1PJAA 2ODAA 1Y3HA 2FXIA 2W2LA 2YZ2A 2OXIA 4WBNB 4QJ4A 1EZ4A 1XZBA 3R75A 2XT6A 5I7RA 4QJ5A 4E5SA 2QK4A 4NTZA 4KNVA 1J49A 2OCAA 3EA5A 4WLNA 4UBLA 4JVMA 5CT4A 1C4XA 3G8YA 4P3YA 4OK6A 4Q66C 3RABA 5JATA 2ZXUA 4Q9DA 4ENVA 2HJ9A 3NWJA 4CN9A 4ZAVA 3NT5A 2C9BA 2Z1MA 1NXQA 3VHQA 4DUYB 3THRA 1WU8A 4AC9A 2FETA 1UINA 3TD6A 4JEUA 4DG9A 3VYRB 1KYWA 3HVKA 3JQQA 3JQFA 1FMTA 1G6Q1 2WQZA 2GD0A 4QQ8A 5F2EA 4CQMA 1Z6YA 4RVDA 2J0UB 1SG0A 1FNCA 4P34A 4Z4GA 3F7MA 4F3RA 4PAGA 4J3FA 1NW7A 4ZO7A 1DRJA 2Z1NA 4GDMA 4PV7A 4V38A 5EGSA 1FP1D 2Q5LA 1I4LD 2BDUA 5ALFA 1QVVA 3U7HB 4D25A 3OZFA 5JRJA 1RAAA 3N8DA 1WP9A 4G5GA 2VH1A 3N3AC 1YRBA 5FBHA 3RFVA 5L4LA 3B1VA 4DUGA 3WSWA 2QQFA 3C87A 3OFVA 4BX9A 3OPXA 1L5ZA 3WGZA 5KVAA 2NAFA 4KBGA 3G1UA 4PC7A 3LYAA 1ZNXA 2PBZA 4BN4A 4U7WA 3CEMA 2RDMA 2FMTA 3HHEA 3L18A 2AL7A 1Z5PA 4YROA 1Q0PA 1B8UA 1UMCA 3GAMA 3WWYA 3KDSE 5AXBA 1V71A 4DBZA 1VMIA 1UP4A 4LBYA 1HKUA 5JXWA 1WNTA 5SZIA 4LRQA 5LQAA 1J0CA 1HFWA 1KDPA 5HF8A 1Y8RB 1JE0A 1QQ5A 2NV2B 2F62A 4R1MA 1HG1A 1U94A 4V2IA 2P90A 5U4XA 4PSVA 2V7GA 4OAQA 3JQAA 1GZ7A 9LDBA 1F1BA 2D3WA 3HXLA 4HH0A 5GOTA 3K8OE 4UEQA 1EG2A 3ORQA 4EJSC 2GAFA 3A6DA 1EFPA 4FSHA 1SO8A 1XMIA 4P80A 1CUWA 4G85A 3M83A 3QEMA 1M34A 1CW2B 1OUMA 3CH7A 3LBNA 4W5RA 1OXBB 4MI9A 2ZRPA 4A2WA 3VPDA 1VKZA 3QOFA 5JMPA 4DSAA 1M6NA 2DLNA 3WL3A 2PX5A 2PKXA 4YRMA 3TMKA 3K71B 3NCTA 3RAFC 5KAPA 4TQGA 2GKOA 4FE3A 1VIVA 10MHA 1SXPA 2P6UA 4GMDA 3VZQA 4OUKX 1X19A 2J5RA 2QG6A 3Q8WA 1YCHA 1XMPA 4JOQA 4KO1S 4MVJF 4ALLA 3UAXA 3A0RB 3IFSA 4Y18A 4HB2A 5F3RA 1M1YE 1ZD2P 4NCNA 1E2PA 4GECA 2DPYA 2X0NA 5FOTA 5K0NA 1X9GA 2TMDA 2CEAA 3EQ9A 3WOVA 2O20A 1PAUA 3NG1A 2EP8A 1RJ9B 2C82A 3AGPA 4YI5A 4RHEA 1VI2A 1AXEA 2OM6A 5HQ3A 4JIMA 4D98A 7YASA 1A2KC 4O2AF 3D1LA 1KS2A 4N8SA 1W47A 1JKMA 5TXGA 1VDZA 6Q21A 4XR4A 4YO7A 3CR7A 3BF7A 1VYHA 1U31A 3CNBA 4G36A 2JEOA 3QX8A 2HSDA 3DUFA 1BS9A 4FEGA 2GR9A 5B1YA 4ENQA 1H3EA 4KB5A 2QRJA 3I9MA 2AUTA 3M6WA 3VI4B 4M6WB 5BRAA 1ODKA 1C0PA 4QOSA 2EF1A 3BWMA 2HR1A 1V2GA 2R751 1TIBA 4LW8A 3DEFA 3L7KA 5D3ZA 2QTMA 2MSWA 1I7LA 4BQSA 4BFCA 4OGFA 1QYDA 1FUUA 1ZVQA 2Z57A 3A2MA 2OZVA 2JGJA 5E1DA 3RWMB 1O94C 3COWA 3TZEA 4DANA 1CYDA 1YDEA 3NHPA 1BE1A 4UM9B 2I66A 1SHUX 1L1QA 1RQ7A 3K5WA 5C9ZA 1E3QA 4IV0A 5BMVA 1RT9A 3ZE2B 1V7CA 1VZ2A 3ITDA 4LE1A 5BN1A 2JHAA 4FQ5A 3UXMA 3U37A 4MQEB 5C1IA 3KKEA 1QK4A 5IKMA 4LRUA 4NFYA 1E79D 3GZTB 2PWYA 5BYKA 5J63A 4HR7A 5IKPA 1CUJA 1TUBA 2IGBA 3QYFA 3DEYX 3NHLA 4CE6A 3EUEA 4N0PA 3UA4A 3L04A 5KHAA 3CNLA 4F46A 3T1QA 3JTMA 4KQ6A 5DN9A 3WL8A 4QXQA 4U9IS 3WK9A 2I6SA 3SM3A 3TECE 2QQEA 1MB0A 1XVTA 3FMOB 5EHXA 2VRBA 1U9JA 1GY8A 3IXQA 5KVSA 1J7JA 1KNXA 4BL5A 2XUZA 2FR8C 4EYKA 6ABPA 2XUHA 5DLPA 3OG9A 1YR6A 4YALA 3QUAA 5INTA 4NZOA 5EOVA 1HQYE 4GWGA 2XB6A 1K7EB 1UBJS 4LC0A 1H6BA 1Q7RA 3JPYA 3MHPA 1ZDMA 2A2ZA 2IY7A 3U44A 1U7WA 3B9BA 4UATA 2GCNA 1GQOA 4HFNA 5FYDA 4KX3A 2J3DA 1GYRA 1YRQA 2BEJA 3ER6A 3OOSA 4Q6WA 5BW8A 1SOUA 4PX3A 5JSHA 4P9NA 3G8CA 3ADCA 4BLWA 4E7PA 1WPGA 3AU8A 4JLOA 1U65A 5JCJA 1R0RE 2W22A 3AHHA 1ZEMA 3EW7A 2GJSA 3U49A 5BORA 2K2QB 4K6GA 4ADSG 1Y0BA 1Z0UA 3NANA 4P4NA 2F1IA 3LTEA 4XB6B 3ZOKA 2JIZD 3KYDB 5CJJA 2R8BA 1MX3A 3FCOA 1NVKA 2W48A 1W30A 3OSZA 5L3QB 3QVUA 4L2IA 3UNXA 3CKLA 4NENA 3SXJA 4DM3A 4KAFA 4TZ6A 1Z7YA 4BEVA 2ZRCA 2B1IA 3MPUA 5FF9A 1PZFA 2KE5A 1K6EA 1E1DA 3E82A 4Q1BA 3HVRA 3ETJA 4Y0VA 5DV9A 1P5RA 2G76A 2I7TA 4G4IA 4FYJA 4KQKA 2HCTA 4N7JA 5B53A 4NV0A 3HM9A 4IVPA 1SIWA 3EXFB 2AKYA 5BSRA 1HNXB 4M76B 4K46A 4F2GA 5AUNB 1ZCFA 2X1VA 1XZLA 2YFYA 1U9IA 5KNCA 3BREA 5TGZA 1K8YB 1DBWA 4I1RA 5AK5A 5CLJA 1RR6A 2PKWA 5AKLA 5CTJA 4BOYA 4ARZA 1Y8ZA 1T9HA 3L92A 4NOJA 3CFYA 4ECEA 3RRNA 3A6PC 3DE2X 3HBAA 1AZWA 2I4MA 1NE2A 1UEIA 1GPLA 2VQ3A 2R65A 1AS0A 1GPKA 1T1RA 2WJ4A 3NDJA 4AKHA 2BEWA 4ZV7A 5TMDA 1BVRA 4DXAA 2JJQA 2VNAA 2ZREA 3NLLA 2ET6A 3EUAA 4DEXA 4YV7A 5EWMA 3IUBA 1SCJA 4AJ1A 4F4UA 1KYZA 1VLLA 4IDPA 4WN9A 1ILWA 2QSJA 4KWHA 1ZBQA 1RVV1 1C7QA 1RRGA 1XTQA 3R4CA 2AI3A 1EZ1A 1EWKA 2G6TA 3SJZA 3OQMA 1DKOA 2B5VA 1WZUA 2QLNA 3PF9A 4AY3A 3TQFA 1R5JA 2ZBDA 1KAOA 3D4LA 5DNEA 1L7NA 3DFMA 1GSHA 3U9TA 1JFFB 2QM7A 1HSOA 4B09A 4B4OA 3UK7A 5A3JA 2XNKA 1LLDA 1UJ4A 3ETHA 1NLUA 4NESA 1FFAA 3KZMA 1VLZA 1YI1A 1DO2A 1O3YA 2ZK7A 3W3AH 3K73O 3WO1A 1KQFA 2ZRBA 4P0QB 4YR7A 2GWRA 4D9BA 4MVJP 4HSGA 4EQ6B 4MIKA 5BT8A 2H85A 3NUZA 1PLJA 3EPPA 3F4BA 4RSMA 1VYUA 5AHOA 2YVAA 3LL4A 4TMVA 1JQLB 1BZYA 1O94D 2ORVA 3MZ0A 3N7UA 4UNPA 2PX3A 3H7IA 4TVOA 1GGEA 2NUPA 3LQRA 3PXXA 5CM8B 3NEJA 3VH3A 2PGLA 4MSUA 2GCOA 3PHBE 1PZXA 1KGSA 3DTNA 4IHAA 2VK8A 4MR9B 3UQZA 4B47A 1JU3A 2FWMX 1S3GA 1NR7A 1E3WA 1JDNA 3BD9A 3QEOA 4L4SA 4Q82A 1H66A 1NKVA 4ZGWA 4L9SA 1MP0A 2XMRA 4F2HA 2BFBA 1RQNA 2ID7A 1PBTA 2QTVB 2I54A 3AEKA 3LCMA 2PMEA 2VP4A 2X22A 3GH1A 1F8UA 3RS7A 3TKAA 3R5HA 1L7QA 3UATA 4YJHB 2Y1GA 3K72B 5AJVB 4CW7A 4CEIB 3OCJA 3F3YA 4AYWA 1TM7E 3TTVA 1HE5A 5A06A 2TYSB 1QIFA 4F1WA 5BWLA 3I4LA 3C3EA 4MITA 5IZCC 4CEHA 5DIZA 2R79A 1TPYA 2GZDA 2V3WA 4ACAA 4YUWA 4RHUA 2P65A 4MK4A 4JFAA 1WXIA 3CMCO 2VCYA 5D85A 4W82A 5KDDA 3W4JA 3OCXA 4B3BA 1S96A 1BU5A 2FX3A 3O73A 1ZD1A 1CZOA 3AVUA 4MV5A 3L05A 4RTSA 1XR3A 3ZDRA 1Q1NA 3G6KA 1CYEA 1PFUA 3D5TA 1D5WA 3FETA 3HB4X 5D86A 4BGUA 4C4SA 3DZKA 3E9MA 4OSOA 4IUDS 3S3TA 3TIIA 4KQ1A 4ZI7F 1T5BA 5TF0A 1Y9DA 3L7CA 5IW8A 1BEZA 3H2GA 2ONKA 1Z07A 3OX1A 5EE3A 4P7KA 1AM4D 1F2VA 1ACJA 3PXEA 3KOYA 1IY8A 4NONA 1G4AE 5DT9A 4ZC8A 3WNZA 1W36B 3WOHA 3H5RA 1V16A 4TYMA 4JENA 5JAQA 4FS3A 2XUOA 1RI5A 2JGDA 2ZRGA 3F4KA 1QQTA 4OGKA 3GVCA 1TLLA 1QYXA 1XDUA 1R9GA 1IHOA 2G17A 5FI1B 5LDDC 4RTOA 1ENYA 1HLPA 1JQBA 3INGA 4X95A 3VV2A 4FI3C 4HAUA 4BQRA 1AMUA 2VR1A 2RMKA 1NUSA 2HRQA 3DT6A 5E7QA 2OV6A 1QV9A 1NXPA 3S27A 3QVGB 4E0BA 5CB0A 1IXKA 3PLNA 2QQ0A 2WFLA 3CONA 3QU2A 3R0IA 1J24A 5BO5A 5L6LB 1LK7A 4PTLA 1QH8B 1X74A 2Y1OA 3RUAA 3HCWA 2PSSA 1KK0A 4MQBA 4B6JA 3RADC 3PPYA 1H3FA 1NOJA 4AJPA 1XZIA 2C92A 3GRRA 1R64A 4KH0A 4CR8A 1IHYA 3T3MB 5K0CA 3UMBA 1KRWA 4Y3UA 1TL7C 4EGFA 3GRKA 1I2AA 5BUQA 2QE6A 2VAPA 1CP2A 4F2PA 2Q5CA 4OJNA 2BP7B 5G4KB 2B8JA 4A8TA 1QCZA 4Q1EA 4Q48A 3PNVA 2PG3A 2VXYA 1XU7A 4RFSA 2QZZA 4Z3DA 1F60A 3EG9A 5IKXA 2VRWA 2MTBA 2Z2JA 3W3AA 4Q4HB 1YZLA 2PGNA 3N7AA 2FGJA 1L8XA 2FPSA 5ITSA 1YONA 4BMVA 3DDHA 3HCDA 2HDNB 3KQOA 1SHLA 3OE7D 3U3XA 2G9ZA 1X42A 2YASA 3CVXA 2VT7A 4G1FA 3WK5A 4KXYA 3UMYA 5F12A 1JHPA 1V3TA 2Q5EA 5KQPA 1Q7TA 1AGPA 2OHFA 5HWSA 1M6VB 3I9JA 1TYZA 3FPCA 4K9NA 4F1JA 3C6MA 4F5WA 3MTEA 4LOIA 3ZHUA 1S01A 5G0TA 1WZEA 3U3OA 4BIIA 4CG1A 5E9JA 2Q9CA 4WIAA 5JSYA 1I36A 1WBDA 2FKNA 4FBGA 5CHEA 5FL7D 5L6MB 2GN6A 4G84A 4J91A 4CL3A 5FWXB 4L5YA 3Q3VA 2QMHA 3H8VA 1M3SA 5TQ2A 3ZCSA 4K87A 4INAA 2H29A 1EP2B 4MJ7A 1E7MA 2E9SA 1Z0FA 4OGGA 5BOVA 3SZUA 3W1WA 8OHMA 3T94A 2C4HA 5DVZA 1EUQA 5CPFA 4PAWA 4YV0A 3D6HA 3V46A 4ZT7A 1AHPA 2ZBGA 1TK3A 1OLOA 3TQIA 5KOYA 3N2ZB 1BGVA 3GRUA 3G23A 4RO0A 2WWXA 4ARVA 2IS4A 3NHJA 4QKQA 3PRYA 4QDKA 2OCIA 2QP3A 2QT1A 1W1IA 5DU2A 4N41A 2QJTA 2BMFA 3GDHA 2JGIA 2XRYA 3A1VA 4OQLA 5JZVA 2JGFA 5A1JA 1LI5A 3ENQA 3LXXA 1X80B 4X8HA 2P62A 1FUIA 3HB9A 4D46A 1MABB 2JRCA 5A0VA 1HV8A 1JYEA 2I6TA 5HK9A 3PDHA 2QL9A 4WZZA 5JZBA 4DAOA 2NO9A 2WE8A 4MLCA 1L1EA 2Y6VA 5CT8A 4EI2A 2PT5A 2AOVA 1KI1A 4Q24A 1VSQA 4ZQHA 1YI8A 4D92A 1T2NA 1FNSA 2I29A 4DYDA 1YZVA 2WEKA 3BYZA 4R7ZA 2FV8A 2EHJA 2YVQA 4AT1A 2R4TA 4QARA 4JS0A 2AOUB 2AI1A 4COKA 4PRLA 3K9LA 2CY0A 4GX1A 3TL6A 4FYIA 1QGAA 4KTTE 5TPWA 1UT6A 2XWQA 2NVUB 1NVFA 3L7YA 3LJKA 5BN3B 3HCNA 3LY8A 5ITWA 3DYIA 1FUYB 1A9XA 1H0HA 1Z2PX 3GMSA 1GARA 3OC6A 2NT4A 1IYZA 3IX7A 4Z1OA 4LJ4A 1FQKA 2PGOA 3H4MA 3VUFA 1VCMA 1S7CA 1Y7PA 2BFDB 2GYYA 1MFPA 2IP2A 4JP2A 4NOMA 3U4CA 1WZ2A 2CT8A 4HVLA 4NMHA 4MTLA 4UXHA 3L7DA 4DC1A 3ZHYA 3CLRD 3ZXUB 1QP0A 4KGZA 1POXA 4DJEC 2NQTA 2VRCD 3MGKA 4ZYYA 5BURA 2VT6A 4R3UC 2WYOA 1KRHA 1MRSA 4NHOA 1B26A 1HE2A 4E32A 1Z4LA 3HFGA 1GPAA 3IR6A 3ER9A 1ZXXA 5E8JA 2UXCB 3GCGA 1RJFA 3DDNA 4C0SA 4GOOD 2WFZA 2QMOA 5F5XA 1O5TA 2Z3ZA 1VBNA 3UOGA 1FFYA 4OXQA 1U2PA 3VSCA 1I14A 1VJCA 5IVPA 1SH7A 4O6VA 4GHWA 4OATA 5BNWA 4N4AA 2Z9BA 3BFXA 1YFZA 3I05A 4NF2A 4XA8A 4F7WA 4C07A 2Y1DA 3ED5A 5F4BA 3P20A 1HOXA 3WR5A 3P9RA 4KXMA 4RV9A 3RYIA 4YP0A 2P1ZA 2JAUA 3CNNA 4X62B 3GWGA 4ZDWA 4RTMA 3WX0A 4C0HA 4MJLA 5AK6A 3ZEAA 3QI2A 3GVHA 3IC5A 1JBEA 2ZUEA 4YRZA 4OB6A 1WMEA 2P0YA 4QBTA 2VHZA 4FCTA 4F96A 1RJWA 5A0TA 1NR5A 1P3JA 1H85A 1PBNA 4GSLA 1PNQA 4GYKA 2XTJA 3PC6A 1IG0A 1E9FA 4OFWA 4PC2A 5IZCA 2IYTA 1L7DA 3CEJA 3V4SA 4EJ0A 5LZ4A 5CMLA 1AC5A 2C07A 5I5GA 1Z4MA 1RWPA 3C4QA 5CFLA 1YK0A 1NW8A 1OI7A 1TZJA 3CRW1 1QH1B 4IXMA 5ARDA 3DVAB 3GLFB 2PN1A 2GBIA 2B4AA 2IYUA 3DLCA 3FBGA 5F9HA 3A1WA 2PL3A 1ZL2A 1KI2A 1NN1A 3Q3CA 3DD1A 4YRRA 4HYYA 1REQB 4P54A 4Q00A 2O7VA 4UMVA 2WG1A 4ZARA 5F5LA 2MYUA 5EE9A 3I32A 1C7EA 1YJCA 3EYWA 3MINB 1RAGA 3D7KA 3H97A 3CV3A 1C0IA 1DPFA 1JNYA 1W5SA 3I6QA 4GU5A 1K0FA 1KZ4A 2VJMB 1PD0A 2Q3HA 4D0LB 3PUZA 5GMOA 4A0HA 3IDZA 3KTFA 2QTWB 4URUR 5JO9A 1VL2A 3AFGA 4K9KA 1F9AA 4ZZ1A 1SZCA 5D6NA 4A6DA 4AY6A 2AN9A 2B4YA 3WA6A 2CMFA 4JUCA 3A2NA 1I3OA 2P9YA 5TGTA 5K0GA 5CB6A 2C99A 5DWDA 2D4AA 1DTWB 4X8LA 5D7BA 3GGPA 2XQKA 3L79A 1V11A 2CHVA 3HE3A 3RKSA 1S4MA 1D03A 3MQ2A 5KTMA 4YY3B 3CKMA 4RWEA 1GZ3A 4JC5A 1BYIA 5HUQA 2B8EA 2ZPAA 1SOAA 4QVIA 3O8NA 4V03A 2QRHA 1PGNA 4QSMA 4QC2A 2ACWA 3GFSA 3EC2A 3LLVA 5CBPB 1WIWA 1ZN8A 2ID4A 1QRAA 5DWQA 5REQA 4B33A 2OPBA 1T3SA 2P2SA 3HXMA 1WMFA 2V65A 2RGYA 3LYLA 1W88B 5IT5A 4FOSA 4Z2YA 3NFYA 4KAXA 3RO7A 3X44A 5GADl 2UUAB 4XVUA 2ZJAA 3NUQA 4MR8B 1TECE 1ZWKA 2YN2A 1QWSA 4LN1A 1JEQB 4NYJR 1ZISA 4ANFA 2M1ZA 2Z2ZA 3R5JA 3IHKA 2O2EA 1M0TA 3NBMA 3UYLA 2BZGA 3VM6A 1RM5A 5BQ5A 3JATB 2A58A 1ZH0A 5FBLB 1U8UA 4TN1A 1IPEA 1BD4A 2OO5C 1WVMA 2I55A 1UC8A 4J3JA 2HU2A 4N5LA 4DN6A 4AQ7A 4GMFA 4AWXA 4YRAA 4LF4B 1AIPA 3D81A 5A03A 2V0NA 4MZXA 1PP4A 3FCAA 4W8GA 4D9CA 3NEPX 3OUZA 1C4OA 4ZK2A 4WKPA 3QHAA 2JLXA 2QORA 2YN0A 3IUPA 2YYZA 4JELA 3WYEA 1GZSA 4RTPA 2D1YA 2WTNA 3VMMA 4U7DA 1DX9A 4ZT4A 4L4UA 4LY6A 5CDFA 3NUGA 2O8VA 4G1MB 3GCXA 3IIMA 3KXDA 2CD9A 4KYVA 1E9CA 1CUYA 1NF9A 3TLKA 1H2HA 2AC2A 4REQB 3WAJA 1E79A 3H7AA 3EEQA 2EARA 3QUCA 2IOYA 4Q4LA 2ZUTA 4RSHA 1H8EA 1X1AA 4Q18A 3OT1A 4CR6A 4PZZA 4K9MA 1X8LA 3JAWB 1TMOA 5A4JA 2OBNA 4IIUA 4L07A 2VT3A 2X4DA 4JL6A 5JU6A 2IQIA 4J6FA 1QNFA 1K2VN 3WHLA 3F6YA 3IQDB 4JLNA 1I5RA 2J48A 1ML3A 3NBQA 3PFCA 1OZAA 4MI6A 4QYSA 1ZZGA 4YAFA 4F92B 2BHLA 4C43A 2FQQA 2FJUA 4GZ6A 4MO9A 4BO5A 2LIVA 3TSZA 3W78A 4JFRA 2I2BA 1FFDA 1CJCA 2IZ5A 3KD3A 2HQOA 3M6LA 4FKBA 4GXQA 5DNDA 2OE2A 2OXEA 4RD4A 4V0LA 3FOAA 5K0ZA 2OBLA 1L7OA 1AN9A 4BQEA 3B89A 3FBWA 4DIMA 5LOVA 3CIOA 2DH5A 2QX8A 5AKGA 4GMHA 1EHCA 2IYFA 2ZJYA 3A3OA 4FZRA 1N0WA 1C3VA 1XD9A 4TSFA 4OHZA 2Q45A 3DR5A 2BE7A 3FYSA 5LMZA 2ES4A 3CH5A 3UMFA 3SSNA 2B25A 4HJXA 4AKSA 1IHPA 2P7IA 1TF2A 4UU1A 5BWNA 5A5EA 4WKCA 3AVWA 3IEMA 4OXRA 3VSAA 5HJ5A 2GXUA 3WA7A 1SVUA 3KOOA 4X20B 2AUMA 4FOPA 4G5XA 4LY0A 4Y9SA 2QW8A 4I9UA 4C6TB 3H99A 1T8SA 2FOIA 1OFIA 1TIKA 1TJNA 3EF1A 3I42A 2O5RA 4ME6A 4DV3B 2XJ4A 1L8OA 1WDMA 4PQGA 3JQGB 2B98A 3ANXA 1GTRA 4FSXA 3I92A 3NHAA 3S44A 4UDYX 2XDQB 4BZPA 1R27A 4FZVA 4RANA 2ZI3A 4MQFB 1T5TA 1R9NA 2VOJA 2ZGVA 4MUYA 4F9EA 3I23A 5IBCA 4N82A 3ZGVA 2BY4A 1IMJA 2R47A 1OKKD 2XOKD 2KM1A 1VBFA 2W6CX 3KUCA 4BNZA 5C7LO 1UOPA 4CKWB 1XB2A 2COEA 3WVNA 3FRIA 3U81A 1Q57A 5IUKC 5ITZA 5E6UA 3DHEA 3ZBQA 1V9CA 1YKGA 3C4VA 2AXEA 1V1RA 3AR4A 3I01A 3HK2A 4TPKA 3IP7A 3MWEA 3JD3A 1A8PA 3LBHA 3T12A 5K2OA 1SIUA 2O54A 3RUCA 3B20A 1T5HX 3IP9A 3JSAA 1YR7A 1N5RA 1V48A 3BTVA 3L7AA 3KBOA 2FZCA 4EWLA 1XCOA 4OJTA 1YTUA 1GKKA 5JHHB 1E58A 4W9RA 4R5MA 1RI4A 4EG5A 5IHPA 4HNAB 5EKUA 1BWSA 4PIMA 3SHVA 4H27A 3ELYA 2D74A 1MEJA 1P9NA 2BHSA 1DKLA 4R1NA 4R0VA 3RAJA 2IV7A 3T5PA 1E77A 4YTEA 4E2WA 1RHMA 2LKDA 3JYPA 3AEXA 3KOWA 1Y5NA 4XOUA 2Q6TA 4B7UA 1X9HA 3K3PA 2PS9A 2H1HA 3W04A 2BBSA 3QRWA 2F00A 1K3UB 1IQUA 2CXOA 2GPWA 2IY9A 2QUHA 2YS6A 3OMLA 4ZHQB 5IM4F 1G5PA 4B5KA 3DAGA 2A67A 1PU2A 5EJ9A 4XUDA 4ZCQA 2VP6A 4CTKA 3HBMA 4YJ3A 2PLFA 4JWKA 2YCLA 2WSYB 1ZLYA 2D5AA 2W2MA 2Y0PA 3CXRA 3ZZ0A 4K9SA 2XZOA 1PJ8A 2GHQA 4MOWA 1PTJA 4EGAA 3PIRA 4ZZ3A 1RZUA 5KNDH 2QRUA 2R7NA 4MWOA 4HXGA 4EW6A 3NDBB 3JZDA 2GN1A 3AFIA 1D4AA 4GC5A 1CDZA 2FOXA 4FGLA 2Q5JA 3ENWA 1I2DA 4TV9A 4LRXA 1WSDA 1PSDA 2NNLD 2YXBA 4CMCA 2L18A 5F9MA 4DT1B 3W2TA 3MS7A 1W1WA 3FYTA 3HDJA 4MKIA 1Z3CA 5EAIA 2WMDA 5IVHA 3O92A 3ISVA 3P2EA 3AL2A 1EK0A 4RQAA 5AK4A 2JLRA 4DIOA 4V0OA 3LZCA 2PGIA 2EXXA 3MWFA 1M0WA 2P7HA 3HXKA 1MORA 4J0DA 1B6RA 2QZ9A 1CC1S 4WASA 5BV0A 3L82B 4CCYB 2AB0A 1Q19A 3LDHA 5E3IA 3GRPA 4I4LA 4BO3A 4P32A 2XVAA 5K03A 4YPFA 4LX8A 3OFNA 3L6DA 1T5IA 3B3AA 1SUCA 2DX7A 3JRWA 3R7NA 4I1PA 1NIJA 3VNSA 5IZ4A 4HBGA 1A9PA 5MN4A 1MVNA 3WLNA 1ND5A 4KO3S 2FQ1A 3TAXA 3E35A 4A1OA 3TCXB 5KYWA 4FCCA 2ID9A 4UE6A 2C4KA 5CW1A 5H83A 1JTEA 4DC9A 3ZVKA 5G1OA 2IPAB 4IG9A 4RZ2A 5AD1A 2XE6A 1N5IA 4N5NA 3NASA 4RKYA 1CK4A 2YOFA 4X1YA 5DFAA 1OU0A 4OMCA 1QGUB 3QWAA 3WB9A 1T5OA 4JEMA 1A9SA 4OVKA 2BF4A 1DEXA 2PA3A 3MCVA 1R1DA 1X3SA 2JIBA 4GAEA 1T91A 2B9VA 4CQLA 3OZRA 4O33A 3U16A 2J87A 2AXQA 5I9TA 2OLEA 1G8KA 1W36C 4EY5A 3P5SA 2P6MA 2QGNA 1N8SA 5CLGA 1GT91 1NBOA 1J00A 3HZHA 4PNPA 3HYSA 4S24A 4XM2A 5ETJA 4F9GA 5AW2A 2VZ9A 4QU9A 1KYIA 5A4MS 1ODFA 5HSGA 2XCQA 3CZPA 4GZ5A 2Z58A 3VR5D 4HXEB 1XT6A 3D6AA 4D9MA 4BZZA 3OFSA 3D0QA 4L78A 1MXFA 1B3BA 1BX1A 2FPIB 4AICA 3GT7A 4II7A 5AM5A 3SGLA 3JZFA 3TZBA 3CQ9A 3DAPA 1L4KA 1E1KA 4BLQA 2RD2A 5KJFA 1UIRA 4EGQA 3Q15C 2FQWA 4KVGA 1UM9A 1Z29A 2OBMA 2M6SA 3SHQA 4CBVA 4C21A 2B78A 2Q8PA 1PL7A 2XEXA 3LIPA 3TO5A 2A94A 5E3JA 1KMIY 2AF4C 1YIAA 3GEMA 4YUVA 4BJHB 3FR8A 4PGAA 3Q9NA 1W0CA 4A16A 3KFVA 5ECYA 3QQPA 1BRTA 2AA3A 3ORYA 1E2HA 1R0SA 3AI7A 3RHFA 2G1JA 3PPIA 4XIIA 5I7OA 3JQPA 4MKFA 5AKEA 1I7PA 1IG3A 2IYZA 4Q3KA 4QUHA 4WRRA 2RGXA 4M7RA 1USKA 2YUTA 3QH4A 1TAUA 1C9MA 4LZJA 5D5HA 1VC2A 2B1RA 3WNCA 3KKQA 4IJ6A 2B1JA 1UOQA 1EFCA 2EBFX 1I1NA 1M72A 2AEJA 2WF7A 4IMRA 3W2EA 4B8YA 4R1LA 3T3GA 3BK2A 3KELA 2R8EA 5KSOA 2Q5OA 4QQKA 1GNTA 5HIKA 1B0AA 5ELLA 5LQNA 1XPOA 2MSCB 3E8MA 4NEGA 4EZIA 3C7AA 2VQEB 2CSXA 1ITZA 3QKTA 3FSGA 1W6RA 5IPFA 2ZTSA 3GVPA 4MULA 1DX6A 1LVGA 1NXTA 2FX5A 1T9BA 4UQLA 5ALUA 2CWDA 3RSSA 3BBLA 3ILYA 1BA3A 4PYMA 4DUGD 1CQIA 2Q3MA 5ADVA 4JC8A 3EB9A 3V97A 4RZSA 3DLPX 3ZHRA 1AQ6A 4UUOA 2VYFA 4DM4A 2ZB4A 1G5HA 2AD5A 2HSJA 1VSTA 5C51B 3KHTA 4A27A 1FX0B 3FTFA 2OHIA 1UKYA 3ET5A 4Q7MB 2AJLI 4V24A 3K6JA 5E6SA 4C04A 1I2CA 4JB3A 3F8SA 3AVXA 3V2IA 1BU8A 4PLYA 4NDNE 3HWX1 5LA6A 1E9RA 4L95C 4X90A 4BJ3A 1TO6A 1R4NA 3B9RA 4O8CA 1YTLA 1XP5A 2IOFK 4KQJA 1SN7A 2LGJA 1TK9A 4IIJA 4R9RA 3LUGA 4MV6A 1Y7HA 1OWNA 2EFJA 2Q5FA 2YDXA 3A7DA 2GI4A 4HX2A 3TXYA 2X76A 5C8VA 1FNNA 3G9UA 1QHGA 5EFZA 5JAIA 2CNBA 4DJFC 3V2UA 4L8WB 4DMHA 3AL0C 1GRNA 3Q5GA 2BE9A 5JQGB 1H8HD 3EPRA 1NR1A 2W2LD 3HN6A 2JCXA 3AT1A 4BE9A 3R8FA 4GKJB 3BL5A 4FFLA 4HAYA 5T7BA 3FAKA 4D45A 4ZYVA 2GX6A 5K3FA 4I4CA 2XOXA 3OZWA 3V3TA 1T5LA 4I7EA 1H0SA 1GA6A 4Q7KA 4UVGA 1C0LA 4XWOA 4CVNA 2C9YA 2I62A 4EL5A 2VJAA 4IDCA 1N6IA 5BSVA 5CXQA 3I83A 2EZ4A 3WLIA 2J7KA 1V25A 3DXYA 4XB1A 4CIAA 4QQRA 3V1KA 1K98A 2B5OA 4IH1A 1X13A 1RHJA 3ASVA 1OWMA 1JSLA 5DXJA 5KWVA 2BBWA 5ESRA 4RKRA 4D81A 3DHNA 3ZI0A 1S2OA 3UF0A 4FC7A 3I5MA 4EKEA 4UCWA 4HTFA 3D31A 2IP1A 1P2FA 4JLWA 1ESZA 3DBHB 2P9FA 3MB8A 5I7VA 5A5GA 1RD4A 2GKSA 3E0XA 1WXQA 3VPFA 3PNPA 2NU8A 2IDMA 2RHWA 4GRDA 1Y4UA 4DLYA 3KZNA 1GZVA 1Y9ZA 2OQ2A 3A4IA 1J2TA 2Q6OA 3JZAA 3ZHSA 4LXXA 3LLCA 5TQJA 3DTYA 3FJOA 3WMEA 4O2BB 3WK4A 4BY9E 3IKJA 3OEWA 1P80A 3UV3A 1E0DA 4CZ2A 3VC2A 3SZGA 3EGVA 1YZTA 4UJ3A 5EJ7A 2V1UA 1JZQA 3RRFA 5C1BA 4ZT5A 3K0CC 3ULKA 2OCYC 4ZYXA 1HT0A 3S2GA 4AECA 2QL7A 3T38A 3NWBA 4NPAA 3WZ2A 4A73A 4ZCTA 3OLCX 3KPWA 1X8JA 4X3OA 1DJNA 4G4JA 3RC3A 1AG9A 4GP6A 4I2VA 4ATNA 1E4OA 3TK1A 3F5MA 3CEAA 3ZGNA 1CUUA 1I1HA 5BQ3A 5CLLA 3UKOA 3SK0A 4TLEA 1Q7CA 2JK0A 4V3BA 5EP1A 3N8HA 2ZYTX 4M1KA 3W3AD 3U7FB 1ACLA 4ITVA 1VMDA 1LDEA 4B3GA 1F0PA 2PDAA 3JAKA 3P9SA 3VZPA 4OUDA 1JDBC 2DQ4A 2DTDA 3KUXA 4AZVA 4CODB 5K6RA 2GCPA 1EBUA 2AF3C 3ZWKA 4OHXA 3ICVA 2XVMA 3QUBA 2HCFA 1T1JA 2N1MA 4LJSA 4MPTA 2RI6A 1I3LA 2ZTHA 2YIDA 3EFOA 3FYUC 4M4SA 4RPLA 2C8KA 5DZSA 2C0CA 1XLUA 2XYHA 2C3YA 1BYUA 4AG3A 2WTMA 2HA2A 4N7MA 3TZ6A 3FF1A 5LC1A 1CS4C 4PONA 1FSZA 3DCNA 4P5DA 3UK1A 4I4NA 2XAAA 2HA4A 1UF9A 2W90A 2HCBA 4DA7A 1QXSA 2WZCA 4C1NA 2KWIA 2IA5A 4FGZA 2NZ8A 3UTCA 2JFNA 1EE9A 1X38A 4BRUA 3PUIA 2W6ZA 1Z4OA 3A4MA 1PQYA 4KQ9A 4WZAE 4AN4A 1QPBA 1NQOA 2V8BA 2XGOA 4P6VF 5JLAA 5A6SB 3WKBA 4D6YA 2XH8A 2ZIWB 3R3HA 4DCJA 2I91A 4E22A 1AZTA 4K88A 4H3HB 2VDRB 4ZEOA 1YQWA 3L40A 4AS2A 3JARA 1RLTA 3QPDA 2OK8A 1TJ3A 3VJKA 1QO7A 5H82A 4UVEA 2I1VB 3BAZA 1RHKA 2VAXA 3T7RA 1D5CA 3HDHA 1T6NA 4ZQGA 3WYGA 5JWRA 3QXJA 2AJDA 1Q2UA 3HBFA 4OYLA 2FP4B 1N2CB 4TUYB 3NV7A 4FP9A 3OHSX 4PG5A 2QTRA 1HL7A 2GESA 2JAXA 2Z4RA 3O9VA 3U3ZA 4CMJA 4X44A 1CVIA 2QTZA 2LDBA 4Q3EA 4NCJA 4R98A 1X7YB 2B1QA 4PGGA 1Z0ZA 1GPDG 2FWJA 1X1EA 2OFOA 5L3VA 4ZV4A 1KKLA 2P2LA 2P4QA 3MD9A 3HL4A 4ZGBA 3B13B 5KDOA 3VVMA 2JAPA 3TTWA 2PUCA 3HJGA 3WLKX 1MUUA 1U80A 5IMBA 3MRTA 4G0OA 1W5AA 2A5LA 4GPAA 2WT9A 3KJXA 2EJBA 2IEDA 4MYSA 2BEVA 1MJGA 4FD2A 2V5AA 1HEUA 3KLOA 1SD5A 4KMSA 3I45A 4XX0A 3RJTA 2WWYA 3BXFA 1AT1A 1VPLA 4FMCF 4K9OA 2P5SA 4ZREA 5HIMA 2IP4A 2CVHA 3KQNA 2PKQO 4KR0A 5ALYA 1DNPA 1TM5E 4P8RA 2A9JA 4JC4A 5AICA 2GXQA 3FTDA 4CNBA 4RAOA 4HTAA 3IP6A 5CXSA 4Y2RA 1E3LA 5F3WB 4PN7A 1RM3A 2ZLBA 3KAKA 3TTYA 3E4CA 2OP1A 2WVAA 2Y1KA 3QF7A 3KQKA 1MOPA 1WG8A 1ZD8A 4IX1A 1B74A 4H0CA 1H8ED 2GM9A 3I1FA 2FPMA 2P8JA 3GC6A 3KYJB 5FL7A 4AMYA 4UUQA 5BW4A 2H3EA 1E9VA 1M2KA 2JAHA 4FINA 5IJXA 1N5KA 4C0JA 1KKUA 1X87A 4R2JA 4R40A 1SQ5A 2X0IA 3FB4A 4R8LA 4UNRA 4V0QA 2IZ7A 5H4HA 1OLXA 2QVLA 1K6IA 3BRSA 3EE6A 4X5OA 4J7UA 3D6MA 2HV9A 4LZNA 4N5IX 2VSOA 1D2MA 4PZUA 4ZWNA 2B4KA 4JDPA 5T5QA 5JXIA 4CTNA 2RSLA 1E5QA 4MVWA 2JIZA 3D8TA 5DLQC 1U1GA 1ZCZA 2HTEA 1S2IA 4BDSA 1WULS 4MRAA 1I51A 4MVJD 3F5DA 3F1KA 4M0UA 4BVAA 5HQ3B 1K4MA 2GF0A 4Y1FA 4KIFA 4X7BA 1B15A 1TUEA 1SBIA 5F9FA 2X5NA 1A04A 1K7YA 2IRWA 1AHNA 2X1HA 3KLNA 3LW7A 3QVLA 4IPTA 4P3PA 4P53A 5FJJA 5IBQA 1RQLA 5A05A 4BN0A 4E5DA 5JNUA 3DYVA 4MUMA 4GYYA 4Q3NA 3UJAA 4NBLA 2Z2IA 2HEGA 4PR3A 2J4FA 1LJ8A 1J2RA 4MUEA 1Z8NA 1RYBA 1GKIA 1ZX1A