3QK9A

Yeast tim44 c-terminal domain complexed with cymal-3
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
196
structure length
174
Chain Sequence
QSLKNKLWDESENPLIVVMRKITNESSRVYSQFKFSNESFTRHLREYIVPEILEAYVKGDVKVLKKWFSEAPFNVYAAQQKIFKEQDVYADGRILDIRGVEIVSAKLLAPQDIPVLVVGCRAQEINLYRKKKTGEIAAGDEANILMSSYAMVFTRDPEGWKILEFVRGGSRQFT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Membrane Binding Mechanism of Yeast Mitochondrial Peripheral Membrane Protein TIM44.
pubmed rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
molecule keywords Mitochondrial import inner membrane translocase subunit TIM4
total genus 36
structure length 174
sequence length 196
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04280 Tim44 Tim44-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.240 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3qk9A00
3QK9A 3J7Yd 2CW9A 2FXTA
chains in the Genus database with same CATH superfamily
3N54B 4K1UA 1W2ZA 1UGHI 1IVXA 4GL6A 2HMNB 1JB5A 1B20A 3KSPA 4FMAA 3NUVA 3FF0A 3MHEA 3OX9A 1B2SA 1CH0A 1FGOA 5AIGA 1RGHA 3WOFB 1VQO3 2W56B 1NNVA 3PZWA 4KT3B 3D79A 1ASKA 1DMMA 1OUNA 1RSNA 1T2IA 3DY5A 3G4S3 1ZX2A 3S27A 1YIJ3 1SIHA 2J8XB 4MMXB 1FGRA 3H51A 3LTCA 1ZS7A 2AAEA 3BB9A 3N9HA 3WMDA 2OQEC 4HZBB 1AVLA 1LOWA 2SBLA 3OWSA 1TRQA 1VQL3 3NQYA 1O7GB 3HOHA 3PS8A 5DREA 2V1LA 1YVBI 1O7WB 1I2EA 2K54A 1RMSA 3X42A 3VF1A 1SQWA 1RN1A 1CYVA 5IERA 3DGNA 3DM8A 1O7MB 3EC9A 5BXQA 3IPTA 4L8PA 3KIIA 4K1VA 1BUJA 1UDII 1VQ73 1TJDA 4N6TA 2OQEA 2XFTA 3B4PA 3WOEB 1GMRA 3X41A 3F8XA 3CME3 1Q40A 3SOAA 3N8BA 2C4BA 2KF5A 3EX9A 4HJLB 4HOHA 3SYUA 2P0MA 4EC6A 3S67A 1Q824 1SJWA 1BANA 3LT8A 1LOYA 1RCLA 4HM6B 2RFRA 4X2HA 1IYYA 4IIAA 2C11A 3RDEA 3NHXA 1N8QA 1YJN3 1D6UA 2Z77A 1EQKA 1KD14 4WHAA 1RGEA 3AHWA 1Q7HA 4K90B 2JQ5A 2PNCA 2WOFA 5D81A 1WNHA 4NREA 2M7OA 3MG3A 3CC43 1I2FA 1OF5B 1TUHA 3GSPA 3CPOA 5IENA 1STDA 3JUPA 1PFPA 1R4CA 2W9QA 1IV7A 1GOVA 5BU4A 4WFOA 1BNSA 2I9WA 5AI1A 1VQ63 2ZHXB 4TX4A 4NHFA 1I70A 5BVBA 1GD4A 1JZOA 3I563 5BIRA 2E2VA 4QWTA 1AV4A 4L7KA 4HKVB 6RNTA 1GD3A 2CIUA 3JUMA 4RNZA 1TIJA 2UUGC 4OVMA 5M1AA 1BRKA 3DH2A 4XBXA 2IUJA 3D5GA 5IG0A 1IK3A 2CW9A 3KN4A 2CHCA 5AEUB 3DMCA 1AY7A 3PXMA 1B2MA 3NX0A 1W4NA 5M19A 2ML6A 4WP5A 1IU7A 1G0TA 2LQVA 3BLZA 1GMQA 1RLSA 2K0MA 1PU4A 3Q2PA 3QRDA 4J5KA 2OCTA 3SEDA 1I0XA 3WODG 1VQ83 2C10A 3K9MC 4J8TA 3CC23 1S723 4RNYA 4HM8B 1GS3A 2HMJB 1FGQA 1LQMB 2KF6A 3DZLA 3PCSA 4H61A 1A67A 1UCLA 3FSDA 1LOVA 2CKFB 4FMCA 1X1UA 3UNLA 1GY6A 2BU4A 3VGNA 3G713 3H3HA 1VQN3 2JDIH 4RBNA 1YNVX 4K61A 1BRIA 3S5CA 1RGCA 3SOYA 2W2CA 1WQLB 2HMMB 4KVHA 1JN5B 3CCS3 1RGFA 1C54A 1MWUA 1OHOA 5EVHA 3CCU3 1UCKA 3TDGA 2GEYA 1BGSA 2H0IA 3CPW2 2YFIB 1BNRA 2W04A 1MWTA 2SARA 4J9AA 3EB8A 5KP3A 1HZ1A 4HVNA 2OWPA 1QJGA 2BHMA 3DXOA 1VQM3 1UCJA 3UL5A 3SLUA 3JVCA 4XBYA 5JPUA 1CEWI 1O7HB 3BNEA 1UI8A 2IY2A 1IVUA 5AYSC 3URPA 1TU5A 3I553 1E3VA 3LMLA 1G02A 5ELUA 1YGWA 3B8LA 5FW5A 1BNGA 3T8NA 3D4AA 1ZO2A 1EEJA 5TGNA 1BRGA 1BNIA 3AGNA 3JUNA 4FCJA 3GWRA 2OOVA 3AMOA 4EV5A 1G96A 1WMNA 5CXOA 5KP4A 3HX8A 2QEX3 3MPHA 4LEHA 2OTL3 1K28A 1OH0A 6STDA 1W6GA 1QAKA 1ULJB 2HMOB 1K41A 4KZ1A 4WWUC 5CF1A 1JBRA 1BSDA 1AVKA 1EA2A 1HU9A 1M9GA 3LTAA 4IT7A 1JNQA 2KRTA 1RTUA 5IF6A 1B2UA 1DYUA 1ISKA 1FW7A 1US1A 3I0YA 2L1SA 4XBTA 3CCQ3 5AIIA 3GZRA 1RKYA 1IT7A 1LVNA 2Z76A 3DGYA 4ORLA 1ROVA 2OOVC 5A0OB 2KF4A 2XR8B 1UUGB 2QA43 3K5TA 4MMZB 1N8R4 4HM3B 1I8VA 2W56A 2CG1A 1JBSA 1KQS2 3EJVA 1VQ53 1BUQA 4STDA 4HYZA 4KFDA 2INXA 1I3FA 1BSBA 1F8NA 2KF3A 1QALA 3FLJA 3GZBA 1BNJA 2E2UA 2CX1A 1BSAA 1T5YA 3ALAA 4FMBA 5ELJA 3U97A 3RGRA 5LC7A 3DGMA 1BRNL 1M1XB 1YVSA 4O3VA 3FGYA 4HAAA 1JRQA 4KFFA 4FMDA 1MGWA 2BMRB 3CNMA 3GRDA 5M18A 3FH1A 1ZGXA 4N6LA 5AIFA 2OTJ3 1RHLA 2O9UX 2H0HA 1E3RA 2XFSA 1BOXA 1V74A 5CLKA 1B2XA 2F98A 2K3DA 2UX0A 5D82A 1IQXA 1SPUA 4FCMA 3EE1A 3AHSA 3UB1A 3LH4A 1TTOA 1UUVB 2FNQA 2RCDA 1RDSA 4BTWA 5CF2A 3DUKA 1CQSA 3NXJA 3EN1B 3GZYB 4HM4B 4J5GA 4RZMA 3WR2A 4R9KA 3JUQA 4BU4A 1YI23 1K734 3E99A 5IG4A 3MKIA 3EHCA 1OHPA 1VQQA 3CNXA 2P38A 1VZZA 3M8CA 1JN5A 3KE7A 4XM4A 5FGOA 3O8YA 3NV0A 2MF7A 5STDA 1BVIA 3CD63 1I0VA 2R4IA 9RNTA 3HI7A 4AKZA 6GSPA 3NV0B 1S5AA 3OW22 2Y73A 1FGTA 1Z1SA 1JV2B 1OCVA 4BL3A 4LYLB 4EYCA 2BMOB 1TFOA 1BAOA 2WOHA 1RCKA 3ER7A 4N6OB 1OACA 1BU4A 1OPYA 1KWIA 4NPBA 4Q53A 1IVVA 3AGOA 4HM0B 4U13A 1E97A 3F7SA 1FUSA 2BO9B 1YJ93 1I3IA 1V58A 3CU3A 4GHOA 4RNTA 5LC6A 3F8HA 3CCL3 3D5IA 1LQGC 1Q40B 3STDA 1TFKA 2CFGA 3A76A 1T3BA 2RBIA 3B4OA 2O3OA 3IJEB 4PEJA 1YHQ3 4XB5A 1B27A 2B1XB 2XSOB 2YX9A 4JRFA 1ROAA 1LNHA 5D83A 1W2B2 2GBXB 1NB5I 1U8CB 2KCDA 1JJ22 3NQZA 3G16A 1MWSA 3F7XA 1GOYA 1RJOA 1DMQA 1RRLA 2MC8A 2GU1A 3PCRA 1MGRA 1L5GB 2F5MA 4WYKB 1VQP3 5EQLA 1DVDA 1TRPA 1BSCA 1WTHA 1GSPA 1LOXA 1N9EA 3G0KA 4EBGA 5KP1A 4WYKA 3ECFA 1EUIC 3NBBA 2W03A 2GEXA 4EXRA 1DMNA 5IW9A 8RNTA 5DRVA 3V98A 4I5QA 3WDGB 2GXFA 4MJDA 5AYRB 3RNTA 4LMIA 1FZUA 1W02A 3OWUA 1Y4KA 4N3VA 1Q9EA 2AADA 8CHOA 3LXUX 2CX0A 3LTBA 1ULIB 2BT3A 1EKMA 2ZDJA 3RGAA 3VSYA 1PYLA 3PGBA 1J2BA 1GY7A 2WGQA 2Y74A 3X3XA 1N5HA 4CPKA 2BIRA 3BNDA 3WA2X 1BIRA 1MOLA 1OHSA 3UJMA 2D42A 3SX1A 2CWTA 4R9LA 4EV2A 2WGOA 3LTDA 4FCZA 2XGLA 2F5WA 3EF8A 5AIHA 1NDOB 3LZAA 2W0QA 1AR0A 3EBTA 3PYJA 1RN7A 4IPBA 3OWYA 4O8SA 2GSPA 3MWZA 1GYBA 2Z6BA 1IV9A 3EN8A 2RNTA 5RNTA 2P0XA 4H3UA 1UUWB 5IG5A 2KAAA 2Q07A 1SARA 1FGMA 2YFJB 5G1LA 4HM1B 1GMPA 2E2TA 3A5EA 3MSOA 3F40A 4GSPA 4XDVA 2Z7AA 3FF2A 3L0RA 5CK6A 4CCVA 7GSPA 1YJW3 1JZDA 2CFDA 1B3SA 4JF8A 3WHOA 1JKGA 4ILFA 1B2ZA 1Q864 1CYUA 1BNEA 3KFQC 2D1WA 3NBRA 4N6V0 4LGQA 2CFWA 4O02B 5AEWB 3CCR3 3FG4A 1LRAA 2F99A 2QIYA 3K7CA 1K9M4 3FG3A 1HKXA 1YGEA 1NU3A 4I4KA 4O2HA 3BNCA 1W01A 3B7CA 2IYJA 1B21A 2P09A 2F4YA 3FKAA 3LT9A 3MG2A 3FCSB 3V99A 2BNGA 3BNBA 2XRXB 3CCM3 1RRHA 1OGXA 3ROBA 1IQYA 1NB3I 1D6ZA 3Q90A 2CFLA 2HOHA 1W00A 1NO3A 2R41A 2YFLB 4G1MB 3X3YA 3X3ZA 4X2OA 4ZM8A 1A90A 1RGGA 3T0UA 5JPPA 1NJI4 2QGUA 1O7PB 2RGQA 1LNIA 3IMAB 4AEQA 5G1KA 3Q1CA 2XEPA 1RN4A 1BNFA 5HGRA 2GBWB 1RNTA 1JB4A 2HMKB 3HIIA 4N6UA 3KSED 3K0ZA 1BRJA 3NM7A 2F86B 3SXXA 4CDLA 1A2VA 4GB5A 1DE3A 2KXGA 2FGTA 2CG0A 3K63A 7STDA 1W7CA 3MYTA 1KSIA 7RNTA 1FUWA 1PY3A 2L4VA 4LZIA 1VQ43 3DGOA 3G6E3 1OGZA 1RGLA 3T8UA 1A2KA 3EBYA 3NBJA 3FG1A 1QMAA 2A15A 4BTXA 1N9JA 4XDWA 4EW5A 5JBSA 3V92A 1IDPA 1STFI 3WA3A 4R1KA 1GY5A 1JB2A 2IA7A 3FZWA 4N6NB 1N5PA 4BIRA 1UGIA 1EG9B 4FR9A 3CCE3 4HBRA 1WMPA 3S28A 1IQ8A 4L8OA 3CMA3 5IEOA 3NM2A 1MNLA 2BMQB 3D3LA 4LSOA 2ML5A 3LYGA 4BL2A 1DVCA 1Q7Y4 1V57A 2B24B 2W6JH 4OUQA 3Q3FA 1D6YA 1LXEA 1W6CA 3BIRA 3MG1A 4HM2B 5GSPA 4MEIA 4KFEA 4HM7B 2XF3A 1MWRA 2CFKA 1K8A4 2ZA4A 1YIT3 5G2GA 3BU4A 1Q42A 1NWWA 1QVF2 2XGNA 2CC3A 4OK0A 1R4YA 1U5OA 1UI7A 2RSXA 4R4KA 1QAFA 1RGAA 3CCV3 1JBTA 2LYXA 2P05A 2W9PA 3JUOA 1T2HA 3OXAA 3G8ZA 1RGKA 1VQ93 1X1WA 2GU3A 1BRSA 3DGLA 3HIGA 5IG3A 3ZG5A 3U1WA 1A2PA 1RNBA 1I2GA 1UCIA 1UW1A 3F14A 1FUTA 3UL6A 1FYSA 2CK3H 4HM5B 3CC73 2IUKA 3KZTA 2PZVA 1BRHA 1BSEA 3F9SA 1JKGB 3SVAA 4DKIA 1TP6A 1GOUA 4HZ9B 1QVG2 4AKYA 3KKGA 3D9RA 1M904 3ZG0A 3GAXA 2ZL8A 1WMOA 1Q814 3HZPA 3CXC2 2H0GA 3AMOB 5EEOA 3S29A 1HYFA 3X40A 1M1K4 4BTYA 3GZXB 1W5ZA 3CCJ3 2F56A 2HMLB 2UGIA 3LOYA 5HOHA 5IEPA 4CJNA 2XSHB 1DETA 3QK9A 2IMJA 2CWUA 1IVWA 1X1YA 3HK4A 5I97A 2WO0A 1VQK3 1W6YA 3OV4A 3KCHA 4MMYB 1FA3A 2STDA 1O7NB 2FXTA 1AQZA 2XH9A 1OF5A 1X1XA 2CH9A 1IT8A 2CWVA 4N6MA 1KC84 1C7HA 1SIIA 4R80A 3EQQB 3J7Yd 3ZFZA
chains in the Genus database with same CATH topology
3N54B 4K1UA 1W2ZA 1IVXA 4GL6A 2HMNB 1JB5A 3KSPA 4FMAA 3NUVA 3FF0A 3MHEA 3OX9A 3WOFB 1FGOA 5AIGA 1VQO3 2W56B 3PZWA 1ASKA 1DMMA 1OUNA 3DY5A 1ZX2A 3S27A 1YIJ3 1SIHA 4MMXB 1FGRA 3H51A 3LTCA 3BB9A 3N9HA 3WMDA 2OQEC 4HZBB 1AVLA 3OWSA 2SBLA 1VQL3 3NQYA 1O7GB 3PS8A 5DREA 2V1LA 1YVBI 1O7WB 2K54A 3X42A 3VF1A 1SQWA 1CYVA 5IERA 3DGNA 3EC9A 1O7MB 3DM8A 5BXQA 3IPTA 4L8PA 3KIIA 4K1VA 1VQ73 4N6TA 2OQEA 3WOEB 2XFTA 3B4PA 3X41A 3F8XA 3CME3 1Q40A 3SOAA 3N8BA 3EX9A 4EC6A 4HJLB 2P0MA 3S67A 1Q824 1SJWA 3LT8A 4HM6B 4X2HA 2RFRA 4IIAA 2C11A 3RDEA 3NHXA 1N8QA 1YJN3 1D6UA 2Z77A 1EQKA 1KD14 4WHAA 4K90B 2JQ5A 2PNCA 2WOFA 5D81A 1WNHA 4NREA 2M7OA 3MG3A 3CC43 1OF5B 1TUHA 3CPOA 5IENA 1STDA 3JUPA 1PFPA 1R4CA 2W9QA 1IV7A 4WFOA 2I9WA 5AI1A 1VQ63 4TX4A 4NHFA 5BVBA 1GD4A 3I563 2E2VA 4QWTA 1AV4A 4L7KA 4HKVB 1GD3A 2CIUA 3JUMA 4RNZA 1TIJA 4OVMA 4XBXA 2IUJA 5IG0A 1IK3A 2CW9A 3KN4A 2CHCA 5AEUB 3DMCA 3PXMA 3NX0A 1W4NA 2ML6A 4WP5A 1IU7A 2LQVA 3BLZA 2K0MA 1PU4A 3Q2PA 3QRDA 2OCTA 3SEDA 3WODG 1VQ83 2C10A 3K9MC 4J8TA 3CC23 1S723 4RNYA 4HM8B 1GS3A 2HMJB 1FGQA 3PCSA 4H61A 3DZLA 1A67A 3FSDA 2CKFB 4FMCA 3UNLA 1GY6A 3VGNA 3G713 3H3HA 1VQN3 2JDIH 4RBNA 4K61A 3S5CA 3SOYA 2W2CA 1WQLB 2HMMB 4KVHA 1JN5B 3CCS3 1OHOA 5EVHA 3CCU3 3TDGA 2GEYA 3CPW2 2YFIB 2W04A 5KP3A 4J9AA 3EB8A 4HVNA 2OWPA 1QJGA 2BHMA 3DXOA 1VQM3 3UL5A 3SLUA 3JVCA 4XBYA 5JPUA 1CEWI 1O7HB 3BNEA 1UI8A 5AYSC 1IVUA 3I553 1TU5A 1E3VA 3LMLA 5ELUA 3B8LA 5FW5A 3T8NA 1ZO2A 5TGNA 4FCJA 3JUNA 2OOVA 3GWRA 4EV5A 3AMOA 1G96A 1WMNA 5CXOA 5KP4A 3HX8A 2QEX3 3MPHA 4LEHA 2OTL3 1K28A 1OH0A 6STDA 1W6GA 1QAKA 1ULJB 2HMOB 1K41A 4KZ1A 4WWUC 5CF1A 1AVKA 1EA2A 1HU9A 1M9GA 3LTAA 4IT7A 1JNQA 2KRTA 5IF6A 1DYUA 1ISKA 1US1A 3I0YA 4XBTA 3CCQ3 5AIIA 3GZRA 1RKYA 1IT7A 1LVNA 2Z76A 4ORLA 1ROVA 2OOVC 5A0OB 2QA43 2XR8B 1N8R4 3K5TA 4MMZB 1KQS2 4HM3B 2CG1A 2W56A 1VQ53 1BUQA 3EJVA 4STDA 4HYZA 4KFDA 2INXA 1F8NA 1QALA 3FLJA 3GZBA 2E2UA 3G4S3 1T5YA 3ALAA 4FMBA 5ELJA 3U97A 3RGRA 5LC7A 3DGMA 1M1XB 4O3VA 3FGYA 1JRQA 4KFFA 4FMDA 3CNMA 2BMRB 3GRDA 3FH1A 4N6LA 5AIFA 2OTJ3 2O9UX 2XFSA 1E3RA 1V74A 5CLKA 2F98A 2UX0A 5D82A 1IQXA 1SPUA 4FCMA 3EE1A 3UB1A 3LH4A 1UUVB 2FNQA 2RCDA 4BTWA 5CF2A 3DUKA 1CQSA 3NXJA 3EN1B 3GZYB 4HM4B 4RZMA 1YI23 4R9KA 3JUQA 1K734 3E99A 5IG4A 3MKIA 3EHCA 1OHPA 3CNXA 2P38A 1VZZA 3M8CA 1JN5A 3KE7A 4XM4A 5FGOA 3O8YA 3NV0A 2MF7A 5STDA 3CD63 2R4IA 3HI7A 4AKZA 3OW22 3NV0B 1S5AA 2Y73A 1FGTA 1Z1SA 1JV2B 1OCVA 4EYCA 2BMOB 1TFOA 2WOHA 3ER7A 4N6OB 1OACA 1OPYA 1KWIA 4Q53A 1IVVA 4HM0B 4U13A 1E97A 3F7SA 1YJ93 2BO9B 3CU3A 3CCL3 5LC6A 3F8HA 1Q40B 3STDA 1TFKA 2CFGA 3A76A 3B4OA 4PEJA 2O3OA 3IJEB 1YHQ3 4XB5A 2B1XB 2XSOB 2YX9A 4JRFA 1ROAA 1LNHA 5D83A 1W2B2 2GBXB 1NB5I 1U8CB 2KCDA 3NQZA 3G16A 3F7XA 1RJOA 1DMQA 1RRLA 2MC8A 2GU1A 3PCRA 1L5GB 4WYKB 1VQP3 5EQLA 1DVDA 1WTHA 1N9EA 1LOXA 3G0KA 4EBGA 5KP1A 4WYKA 3ECFA 3NBBA 2W03A 2GEXA 4EXRA 1DMNA 5IW9A 5DRVA 3V98A 3WDGB 2GXFA 4MJDA 5AYRB 4LMIA 1W02A 3OWUA 1Y4KA 4N3VA 8CHOA 3LXUX 3LTBA 1ULIB 2BT3A 1EKMA 2ZDJA 3RGAA 3VSYA 3PGBA 1J2BA 1GY7A 2WGQA 2Y74A 3X3XA 1N5HA 3BNDA 3WA2X 1OHSA 1MOLA 3UJMA 2D42A 3SX1A 2CWTA 4R9LA 4EV2A 2WGOA 3LTDA 4FCZA 2XGLA 3EF8A 5AIHA 1NDOB 3LZAA 2W0QA 1AR0A 3EBTA 3PYJA 1RN7A 4IPBA 3OWYA 4O8SA 3MWZA 1GYBA 2Z6BA 1IV9A 3EN8A 2P0XA 4H3UA 1UUWB 5IG5A 2Q07A 1FGMA 2YFJB 4HM1B 2E2TA 3MSOA 4XDVA 3F40A 4CCVA 5CK6A 2Z7AA 3FF2A 3L0RA 1YJW3 2CFDA 4JF8A 1JKGA 1Q864 1CYUA 3KFQC 2D1WA 3NBRA 4N6V0 4LGQA 2CFWA 4O02B 5AEWB 3CCR3 3FG4A 2F99A 2QIYA 3K7CA 1K9M4 3FG3A 1HKXA 1YGEA 1NU3A 4I4KA 4O2HA 3BNCA 1W01A 3B7CA 2P09A 3FKAA 3LT9A 3MG2A 3FCSB 3V99A 2BNGA 3BNBA 2XRXB 3CCM3 1RRHA 1OGXA 3ROBA 1IQYA 1NB3I 1D6ZA 3Q90A 2CFLA 4G1MB 1W00A 1NO3A 2YFLB 3X3YA 3X3ZA 4ZM8A 1JJ22 4X2OA 1A90A 3T0UA 5JPPA 1NJI4 2QGUA 1O7PB 2RGQA 3IMAB 4AEQA 3Q1CA 2XEPA 5HGRA 2GBWB 1JB4A 2HMKB 3HIIA 4N6UA 3KSED 3K0ZA 3NM7A 2F86B 3SXXA 4CDLA 1A2VA 4GB5A 2KXGA 2FGTA 2CG0A 3K63A 7STDA 1W7CA 3MYTA 1KSIA 1FUWA 2L4VA 4LZIA 1VQ43 3DGOA 3G6E3 1OGZA 3T8UA 1A2KA 3EBYA 3NBJA 3FG1A 1QMAA 2A15A 4BTXA 1N9JA 4XDWA 5JBSA 3V92A 1IDPA 1STFI 3WA3A 4R1KA 1GY5A 1JB2A 2IA7A 3FZWA 4N6NB 1N5PA 1EG9B 4FR9A 3CCE3 4HBRA 1WMPA 3S28A 1IQ8A 4L8OA 3CMA3 5IEOA 3NM2A 1MNLA 2BMQB 3D3LA 4LSOA 2ML5A 3LYGA 1DVCA 1Q7Y4 2W6JH 2B24B 4OUQA 1D6YA 1LXEA 1W6CA 3MG1A 4HM2B 4MEIA 4KFEA 4HM7B 2XF3A 2CFKA 1K8A4 1YIT3 5G2GA 1QVF2 1Q42A 1NWWA 2XGNA 2CC3A 4OK0A 2RSXA 1U5OA 1UI7A 4R4KA 3CCV3 1QAFA 2LYXA 2P05A 2W9PA 3JUOA 3OXAA 3G8ZA 1VQ93 2GU3A 3DGLA 3HIGA 5IG3A 3U1WA 1UW1A 3F14A 3UL6A 2CK3H 4HM5B 3CC73 2IUKA 3KZTA 2PZVA 3F9SA 1JKGB 3SVAA 1TP6A 4HZ9B 1QVG2 4AKYA 3KKGA 3D9RA 1M904 3GAXA 2ZL8A 1WMOA 1Q814 3HZPA 3CXC2 3AMOB 5EEOA 3S29A 3X40A 1M1K4 4BTYA 3GZXB 1W5ZA 3CCJ3 2HMLB 3LOYA 5IEPA 2XSHB 3QK9A 2IMJA 2CWUA 1IVWA 3HK4A 5I97A 2WO0A 1VQK3 1W6YA 3OV4A 4MMYB 1FA3A 2STDA 1O7NB 2FXTA 2XH9A 1OF5A 2CH9A 1IT8A 2CWVA 4N6MA 1KC84 1C7HA 1SIIA 4R80A 3EQQB 3J7Yd
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QK9 A;  3J7Y d;  2CW9 A;  2FXT A; 
#chains in the Genus database with same CATH topology
 3N54 B;  4K1U A;  1W2Z A;  1UGH I;  1IVX A;  4GL6 A;  2HMN B;  1JB5 A;  1B20 A;  3KSP A;  4FMA A;  3NUV A;  3FF0 A;  3MHE A;  3OX9 A;  1B2S A;  1CH0 A;  1FGO A;  5AIG A;  1RGH A;  3WOF B;  1VQO 3;  2W56 B;  1NNV A;  3PZW A;  4KT3 B;  3D79 A;  1ASK A;  1DMM A;  1OUN A;  1RSN A;  1T2I A;  3DY5 A;  3G4S 3;  1ZX2 A;  3S27 A;  1YIJ 3;  1SIH A;  2J8X B;  4MMX B;  1FGR A;  3H51 A;  3LTC A;  1ZS7 A;  2AAE A;  3BB9 A;  3N9H A;  3WMD A;  2OQE C;  4HZB B;  1AVL A;  1LOW A;  2SBL A;  3OWS A;  1TRQ A;  1VQL 3;  3NQY A;  1O7G B;  3HOH A;  3PS8 A;  5DRE A;  2V1L A;  1YVB I;  1O7W B;  1I2E A;  2K54 A;  1RMS A;  3X42 A;  3VF1 A;  1SQW A;  1RN1 A;  1CYV A;  5IER A;  3DGN A;  3DM8 A;  1O7M B;  3EC9 A;  5BXQ A;  3IPT A;  4L8P A;  3KII A;  4K1V A;  1BUJ A;  1UDI I;  1VQ7 3;  1TJD A;  4N6T A;  2OQE A;  2XFT A;  3B4P A;  3WOE B;  1GMR A;  3X41 A;  3F8X A;  3CME 3;  1Q40 A;  3SOA A;  3N8B A;  2C4B A;  2KF5 A;  3EX9 A;  4HJL B;  4HOH A;  3SYU A;  2P0M A;  4EC6 A;  3S67 A;  1Q82 4;  1SJW A;  1BAN A;  3LT8 A;  1LOY A;  1RCL A;  4HM6 B;  2RFR A;  4X2H A;  1IYY A;  4IIA A;  2C11 A;  3RDE A;  3NHX A;  1N8Q A;  1YJN 3;  1D6U A;  2Z77 A;  1EQK A;  1KD1 4;  4WHA A;  1RGE A;  3AHW A;  1Q7H A;  4K90 B;  2JQ5 A;  2PNC A;  2WOF A;  5D81 A;  1WNH A;  4NRE A;  2M7O A;  3MG3 A;  3CC4 3;  1I2F A;  1OF5 B;  1TUH A;  3GSP A;  3CPO A;  5IEN A;  1STD A;  3JUP A;  1PFP A;  1R4C A;  2W9Q A;  1IV7 A;  1GOV A;  5BU4 A;  4WFO A;  1BNS A;  2I9W A;  5AI1 A;  1VQ6 3;  2ZHX B;  4TX4 A;  4NHF A;  1I70 A;  5BVB A;  1GD4 A;  1JZO A;  3I56 3;  5BIR A;  2E2V A;  4QWT A;  1AV4 A;  4L7K A;  4HKV B;  6RNT A;  1GD3 A;  2CIU A;  3JUM A;  4RNZ A;  1TIJ A;  2UUG C;  4OVM A;  5M1A A;  1BRK A;  3DH2 A;  4XBX A;  2IUJ A;  3D5G A;  5IG0 A;  1IK3 A;  2CW9 A;  3KN4 A;  2CHC A;  5AEU B;  3DMC A;  1AY7 A;  3PXM A;  1B2M A;  3NX0 A;  1W4N A;  5M19 A;  2ML6 A;  4WP5 A;  1IU7 A;  1G0T A;  2LQV A;  3BLZ A;  1GMQ A;  1RLS A;  2K0M A;  1PU4 A;  3Q2P A;  3QRD A;  4J5K A;  2OCT A;  3SED A;  1I0X A;  3WOD G;  1VQ8 3;  2C10 A;  3K9M C;  4J8T A;  3CC2 3;  1S72 3;  4RNY A;  4HM8 B;  1GS3 A;  2HMJ B;  1FGQ A;  1LQM B;  2KF6 A;  3DZL A;  3PCS A;  4H61 A;  1A67 A;  1UCL A;  3FSD A;  1LOV A;  2CKF B;  4FMC A;  1X1U A;  3UNL A;  1GY6 A;  2BU4 A;  3VGN A;  3G71 3;  3H3H A;  1VQN 3;  2JDI H;  4RBN A;  1YNV X;  4K61 A;  1BRI A;  3S5C A;  1RGC A;  3SOY A;  2W2C A;  1WQL B;  2HMM B;  4KVH A;  1JN5 B;  3CCS 3;  1RGF A;  1C54 A;  1MWU A;  1OHO A;  5EVH A;  3CCU 3;  1UCK A;  3TDG A;  2GEY A;  1BGS A;  2H0I A;  3CPW 2;  2YFI B;  1BNR A;  2W04 A;  1MWT A;  2SAR A;  4J9A A;  3EB8 A;  5KP3 A;  1HZ1 A;  4HVN A;  2OWP A;  1QJG A;  2BHM A;  3DXO A;  1VQM 3;  1UCJ A;  3UL5 A;  3SLU A;  3JVC A;  4XBY A;  5JPU A;  1CEW I;  1O7H B;  3BNE A;  1UI8 A;  2IY2 A;  1IVU A;  5AYS C;  3URP A;  1TU5 A;  3I55 3;  1E3V A;  3LML A;  1G02 A;  5ELU A;  1YGW A;  3B8L A;  5FW5 A;  1BNG A;  3T8N A;  3D4A A;  1ZO2 A;  1EEJ A;  5TGN A;  1BRG A;  1BNI A;  3AGN A;  3JUN A;  4FCJ A;  3GWR A;  2OOV A;  3AMO A;  4EV5 A;  1G96 A;  1WMN A;  5CXO A;  5KP4 A;  3HX8 A;  2QEX 3;  3MPH A;  4LEH A;  2OTL 3;  1K28 A;  1OH0 A;  6STD A;  1W6G A;  1QAK A;  1ULJ B;  2HMO B;  1K41 A;  4KZ1 A;  4WWU C;  5CF1 A;  1JBR A;  1BSD A;  1AVK A;  1EA2 A;  1HU9 A;  1M9G A;  3LTA A;  4IT7 A;  1JNQ A;  2KRT A;  1RTU A;  5IF6 A;  1B2U A;  1DYU A;  1ISK A;  1FW7 A;  1US1 A;  3I0Y A;  2L1S A;  4XBT A;  3CCQ 3;  5AII A;  3GZR A;  1RKY A;  1IT7 A;  1LVN A;  2Z76 A;  3DGY A;  4ORL A;  1ROV A;  2OOV C;  5A0O B;  2KF4 A;  2XR8 B;  1UUG B;  2QA4 3;  3K5T A;  4MMZ B;  1N8R 4;  4HM3 B;  1I8V A;  2W56 A;  2CG1 A;  1JBS A;  1KQS 2;  3EJV A;  1VQ5 3;  1BUQ A;  4STD A;  4HYZ A;  4KFD A;  2INX A;  1I3F A;  1BSB A;  1F8N A;  2KF3 A;  1QAL A;  3FLJ A;  3GZB A;  1BNJ A;  2E2U A;  2CX1 A;  1BSA A;  1T5Y A;  3ALA A;  4FMB A;  5ELJ A;  3U97 A;  3RGR A;  5LC7 A;  3DGM A;  1BRN L;  1M1X B;  1YVS A;  4O3V A;  3FGY A;  4HAA A;  1JRQ A;  4KFF A;  4FMD A;  1MGW A;  2BMR B;  3CNM A;  3GRD A;  5M18 A;  3FH1 A;  1ZGX A;  4N6L A;  5AIF A;  2OTJ 3;  1RHL A;  2O9U X;  2H0H A;  1E3R A;  2XFS A;  1BOX A;  1V74 A;  5CLK A;  1B2X A;  2F98 A;  2K3D A;  2UX0 A;  5D82 A;  1IQX A;  1SPU A;  4FCM A;  3EE1 A;  3AHS A;  3UB1 A;  3LH4 A;  1TTO A;  1UUV B;  2FNQ A;  2RCD A;  1RDS A;  4BTW A;  5CF2 A;  3DUK A;  1CQS A;  3NXJ A;  3EN1 B;  3GZY B;  4HM4 B;  4J5G A;  4RZM A;  3WR2 A;  4R9K A;  3JUQ A;  4BU4 A;  1YI2 3;  1K73 4;  3E99 A;  5IG4 A;  3MKI A;  3EHC A;  1OHP A;  1VQQ A;  3CNX A;  2P38 A;  1VZZ A;  3M8C A;  1JN5 A;  3KE7 A;  4XM4 A;  5FGO A;  3O8Y A;  3NV0 A;  2MF7 A;  5STD A;  1BVI A;  3CD6 3;  1I0V A;  2R4I A;  9RNT A;  3HI7 A;  4AKZ A;  6GSP A;  3NV0 B;  1S5A A;  3OW2 2;  2Y73 A;  1FGT A;  1Z1S A;  1JV2 B;  1OCV A;  4BL3 A;  4LYL B;  4EYC A;  2BMO B;  1TFO A;  1BAO A;  2WOH A;  1RCK A;  3ER7 A;  4N6O B;  1OAC A;  1BU4 A;  1OPY A;  1KWI A;  4NPB A;  4Q53 A;  1IVV A;  3AGO A;  4HM0 B;  4U13 A;  1E97 A;  3F7S A;  1FUS A;  2BO9 B;  1YJ9 3;  1I3I A;  1V58 A;  3CU3 A;  4GHO A;  4RNT A;  5LC6 A;  3F8H A;  3CCL 3;  3D5I A;  1LQG C;  1Q40 B;  3STD A;  1TFK A;  2CFG A;  3A76 A;  1T3B A;  2RBI A;  3B4O A;  2O3O A;  3IJE B;  4PEJ A;  1YHQ 3;  4XB5 A;  1B27 A;  2B1X B;  2XSO B;  2YX9 A;  4JRF A;  1ROA A;  1LNH A;  5D83 A;  1W2B 2;  2GBX B;  1NB5 I;  1U8C B;  2KCD A;  1JJ2 2;  3NQZ A;  3G16 A;  1MWS A;  3F7X A;  1GOY A;  1RJO A;  1DMQ A;  1RRL A;  2MC8 A;  2GU1 A;  3PCR A;  1MGR A;  1L5G B;  2F5M A;  4WYK B;  1VQP 3;  5EQL A;  1DVD A;  1TRP A;  1BSC A;  1WTH A;  1GSP A;  1LOX A;  1N9E A;  3G0K A;  4EBG A;  5KP1 A;  4WYK A;  3ECF A;  1EUI C;  3NBB A;  2W03 A;  2GEX A;  4EXR A;  1DMN A;  5IW9 A;  8RNT A;  5DRV A;  3V98 A;  4I5Q A;  3WDG B;  2GXF A;  4MJD A;  5AYR B;  3RNT A;  4LMI A;  1FZU A;  1W02 A;  3OWU A;  1Y4K A;  4N3V A;  1Q9E A;  2AAD A;  8CHO A;  3LXU X;  2CX0 A;  3LTB A;  1ULI B;  2BT3 A;  1EKM A;  2ZDJ A;  3RGA A;  3VSY A;  1PYL A;  3PGB A;  1J2B A;  1GY7 A;  2WGQ A;  2Y74 A;  3X3X A;  1N5H A;  4CPK A;  2BIR A;  3BND A;  3WA2 X;  1BIR A;  1MOL A;  1OHS A;  3UJM A;  2D42 A;  3SX1 A;  2CWT A;  4R9L A;  4EV2 A;  2WGO A;  3LTD A;  4FCZ A;  2XGL A;  2F5W A;  3EF8 A;  5AIH A;  1NDO B;  3LZA A;  2W0Q A;  1AR0 A;  3EBT A;  3PYJ A;  1RN7 A;  4IPB A;  3OWY A;  4O8S A;  2GSP A;  3MWZ A;  1GYB A;  2Z6B A;  1IV9 A;  3EN8 A;  2RNT A;  5RNT A;  2P0X A;  4H3U A;  1UUW B;  5IG5 A;  2KAA A;  2Q07 A;  1SAR A;  1FGM A;  2YFJ B;  5G1L A;  4HM1 B;  1GMP A;  2E2T A;  3A5E A;  3MSO A;  3F40 A;  4GSP A;  4XDV A;  2Z7A A;  3FF2 A;  3L0R A;  5CK6 A;  4CCV A;  7GSP A;  1YJW 3;  1JZD A;  2CFD A;  1B3S A;  4JF8 A;  3WHO A;  1JKG A;  4ILF A;  1B2Z A;  1Q86 4;  1CYU A;  1BNE A;  3KFQ C;  2D1W A;  3NBR A;  4N6V 0;  4LGQ A;  2CFW A;  4O02 B;  5AEW B;  3CCR 3;  3FG4 A;  1LRA A;  2F99 A;  2QIY A;  3K7C A;  1K9M 4;  3FG3 A;  1HKX A;  1YGE A;  1NU3 A;  4I4K A;  4O2H A;  3BNC A;  1W01 A;  3B7C A;  2IYJ A;  1B21 A;  2P09 A;  2F4Y A;  3FKA A;  3LT9 A;  3MG2 A;  3FCS B;  3V99 A;  2BNG A;  3BNB A;  2XRX B;  3CCM 3;  1RRH A;  1OGX A;  3ROB A;  1IQY A;  1NB3 I;  1D6Z A;  3Q90 A;  2CFL A;  2HOH A;  1W00 A;  1NO3 A;  2R41 A;  2YFL B;  4G1M B;  3X3Y A;  3X3Z A;  4X2O A;  4ZM8 A;  1A90 A;  1RGG A;  3T0U A;  5JPP A;  1NJI 4;  2QGU A;  1O7P B;  2RGQ A;  1LNI A;  3IMA B;  4AEQ A;  5G1K A;  3Q1C A;  2XEP A;  1RN4 A;  1BNF A;  5HGR A;  2GBW B;  1RNT A;  1JB4 A;  2HMK B;  3HII A;  4N6U A;  3KSE D;  3K0Z A;  1BRJ A;  3NM7 A;  2F86 B;  3SXX A;  4CDL A;  1A2V A;  4GB5 A;  1DE3 A;  2KXG A;  2FGT A;  2CG0 A;  3K63 A;  7STD A;  1W7C A;  3MYT A;  1KSI A;  7RNT A;  1FUW A;  1PY3 A;  2L4V A;  4LZI A;  1VQ4 3;  3DGO A;  3G6E 3;  1OGZ A;  1RGL A;  3T8U A;  1A2K A;  3EBY A;  3NBJ A;  3FG1 A;  1QMA A;  2A15 A;  4BTX A;  1N9J A;  4XDW A;  4EW5 A;  5JBS A;  3V92 A;  1IDP A;  1STF I;  3WA3 A;  4R1K A;  1GY5 A;  1JB2 A;  2IA7 A;  3FZW A;  4N6N B;  1N5P A;  4BIR A;  1UGI A;  1EG9 B;  4FR9 A;  3CCE 3;  4HBR A;  1WMP A;  3S28 A;  1IQ8 A;  4L8O A;  3CMA 3;  5IEO A;  3NM2 A;  1MNL A;  2BMQ B;  3D3L A;  4LSO A;  2ML5 A;  3LYG A;  4BL2 A;  1DVC A;  1Q7Y 4;  1V57 A;  2B24 B;  2W6J H;  4OUQ A;  3Q3F A;  1D6Y A;  1LXE A;  1W6C A;  3BIR A;  3MG1 A;  4HM2 B;  5GSP A;  4MEI A;  4KFE A;  4HM7 B;  2XF3 A;  1MWR A;  2CFK A;  1K8A 4;  2ZA4 A;  1YIT 3;  5G2G A;  3BU4 A;  1Q42 A;  1NWW A;  1QVF 2;  2XGN A;  2CC3 A;  4OK0 A;  1R4Y A;  1U5O A;  1UI7 A;  2RSX A;  4R4K A;  1QAF A;  1RGA A;  3CCV 3;  1JBT A;  2LYX A;  2P05 A;  2W9P A;  3JUO A;  1T2H A;  3OXA A;  3G8Z A;  1RGK A;  1VQ9 3;  1X1W A;  2GU3 A;  1BRS A;  3DGL A;  3HIG A;  5IG3 A;  3ZG5 A;  3U1W A;  1A2P A;  1RNB A;  1I2G A;  1UCI A;  1UW1 A;  3F14 A;  1FUT A;  3UL6 A;  1FYS A;  2CK3 H;  4HM5 B;  3CC7 3;  2IUK A;  3KZT A;  2PZV A;  1BRH A;  1BSE A;  3F9S A;  1JKG B;  3SVA A;  4DKI A;  1TP6 A;  1GOU A;  4HZ9 B;  1QVG 2;  4AKY A;  3KKG A;  3D9R A;  1M90 4;  3ZG0 A;  3GAX A;  2ZL8 A;  1WMO A;  1Q81 4;  3HZP A;  3CXC 2;  2H0G A;  3AMO B;  5EEO A;  3S29 A;  1HYF A;  3X40 A;  1M1K 4;  4BTY A;  3GZX B;  1W5Z A;  3CCJ 3;  2F56 A;  2HML B;  2UGI A;  3LOY A;  5HOH A;  5IEP A;  4CJN A;  2XSH B;  1DET A;  3QK9 A;  2IMJ A;  2CWU A;  1IVW A;  1X1Y A;  3HK4 A;  5I97 A;  2WO0 A;  1VQK 3;  1W6Y A;  3OV4 A;  3KCH A;  4MMY B;  1FA3 A;  2STD A;  1O7N B;  2FXT A;  1AQZ A;  2XH9 A;  1OF5 A;  1X1X A;  2CH9 A;  1IT8 A;  2CWV A;  4N6M A;  1KC8 4;  1C7H A;  1SII A;  4R80 A;  3EQQ B;  3J7Y d;  3ZFZ A; 
#chains in the Genus database with same CATH homology
 3N54 B;  4K1U A;  1W2Z A;  1IVX A;  4GL6 A;  2HMN B;  1JB5 A;  3KSP A;  4FMA A;  3NUV A;  3FF0 A;  3MHE A;  3OX9 A;  3WOF B;  1FGO A;  5AIG A;  1VQO 3;  2W56 B;  3PZW A;  1ASK A;  1DMM A;  1OUN A;  3DY5 A;  1ZX2 A;  3S27 A;  1YIJ 3;  1SIH A;  4MMX B;  1FGR A;  3H51 A;  3LTC A;  3BB9 A;  3N9H A;  3WMD A;  2OQE C;  4HZB B;  1AVL A;  3OWS A;  2SBL A;  1VQL 3;  3NQY A;  1O7G B;  3PS8 A;  5DRE A;  2V1L A;  1YVB I;  1O7W B;  2K54 A;  3X42 A;  3VF1 A;  1SQW A;  1CYV A;  5IER A;  3DGN A;  3EC9 A;  1O7M B;  3DM8 A;  5BXQ A;  3IPT A;  4L8P A;  3KII A;  4K1V A;  1VQ7 3;  4N6T A;  2OQE A;  3WOE B;  2XFT A;  3B4P A;  3X41 A;  3F8X A;  3CME 3;  1Q40 A;  3SOA A;  3N8B A;  3EX9 A;  4EC6 A;  4HJL B;  2P0M A;  3S67 A;  1Q82 4;  1SJW A;  3LT8 A;  4HM6 B;  4X2H A;  2RFR A;  4IIA A;  2C11 A;  3RDE A;  3NHX A;  1N8Q A;  1YJN 3;  1D6U A;  2Z77 A;  1EQK A;  1KD1 4;  4WHA A;  4K90 B;  2JQ5 A;  2PNC A;  2WOF A;  5D81 A;  1WNH A;  4NRE A;  2M7O A;  3MG3 A;  3CC4 3;  1OF5 B;  1TUH A;  3CPO A;  5IEN A;  1STD A;  3JUP A;  1PFP A;  1R4C A;  2W9Q A;  1IV7 A;  4WFO A;  2I9W A;  5AI1 A;  1VQ6 3;  4TX4 A;  4NHF A;  5BVB A;  1GD4 A;  3I56 3;  2E2V A;  4QWT A;  1AV4 A;  4L7K A;  4HKV B;  1GD3 A;  2CIU A;  3JUM A;  4RNZ A;  1TIJ A;  4OVM A;  4XBX A;  2IUJ A;  5IG0 A;  1IK3 A;  2CW9 A;  3KN4 A;  2CHC A;  5AEU B;  3DMC A;  3PXM A;  3NX0 A;  1W4N A;  2ML6 A;  4WP5 A;  1IU7 A;  2LQV A;  3BLZ A;  2K0M A;  1PU4 A;  3Q2P A;  3QRD A;  2OCT A;  3SED A;  3WOD G;  1VQ8 3;  2C10 A;  3K9M C;  4J8T A;  3CC2 3;  1S72 3;  4RNY A;  4HM8 B;  1GS3 A;  2HMJ B;  1FGQ A;  3PCS A;  4H61 A;  3DZL A;  1A67 A;  3FSD A;  2CKF B;  4FMC A;  3UNL A;  1GY6 A;  3VGN A;  3G71 3;  3H3H A;  1VQN 3;  2JDI H;  4RBN A;  4K61 A;  3S5C A;  3SOY A;  2W2C A;  1WQL B;  2HMM B;  4KVH A;  1JN5 B;  3CCS 3;  1OHO A;  5EVH A;  3CCU 3;  3TDG A;  2GEY A;  3CPW 2;  2YFI B;  2W04 A;  5KP3 A;  4J9A A;  3EB8 A;  4HVN A;  2OWP A;  1QJG A;  2BHM A;  3DXO A;  1VQM 3;  3UL5 A;  3SLU A;  3JVC A;  4XBY A;  5JPU A;  1CEW I;  1O7H B;  3BNE A;  1UI8 A;  5AYS C;  1IVU A;  3I55 3;  1TU5 A;  1E3V A;  3LML A;  5ELU A;  3B8L A;  5FW5 A;  3T8N A;  1ZO2 A;  5TGN A;  4FCJ A;  3JUN A;  2OOV A;  3GWR A;  4EV5 A;  3AMO A;  1G96 A;  1WMN A;  5CXO A;  5KP4 A;  3HX8 A;  2QEX 3;  3MPH A;  4LEH A;  2OTL 3;  1K28 A;  1OH0 A;  6STD A;  1W6G A;  1QAK A;  1ULJ B;  2HMO B;  1K41 A;  4KZ1 A;  4WWU C;  5CF1 A;  1AVK A;  1EA2 A;  1HU9 A;  1M9G A;  3LTA A;  4IT7 A;  1JNQ A;  2KRT A;  5IF6 A;  1DYU A;  1ISK A;  1US1 A;  3I0Y A;  4XBT A;  3CCQ 3;  5AII A;  3GZR A;  1RKY A;  1IT7 A;  1LVN A;  2Z76 A;  4ORL A;  1ROV A;  2OOV C;  5A0O B;  2QA4 3;  2XR8 B;  1N8R 4;  3K5T A;  4MMZ B;  1KQS 2;  4HM3 B;  2CG1 A;  2W56 A;  1VQ5 3;  1BUQ A;  3EJV A;  4STD A;  4HYZ A;  4KFD A;  2INX A;  1F8N A;  1QAL A;  3FLJ A;  3GZB A;  2E2U A;  3G4S 3;  1T5Y A;  3ALA A;  4FMB A;  5ELJ A;  3U97 A;  3RGR A;  5LC7 A;  3DGM A;  1M1X B;  4O3V A;  3FGY A;  1JRQ A;  4KFF A;  4FMD A;  3CNM A;  2BMR B;  3GRD A;  3FH1 A;  4N6L A;  5AIF A;  2OTJ 3;  2O9U X;  2XFS A;  1E3R A;  1V74 A;  5CLK A;  2F98 A;  2UX0 A;  5D82 A;  1IQX A;  1SPU A;  4FCM A;  3EE1 A;  3UB1 A;  3LH4 A;  1UUV B;  2FNQ A;  2RCD A;  4BTW A;  5CF2 A;  3DUK A;  1CQS A;  3NXJ A;  3EN1 B;  3GZY B;  4HM4 B;  4RZM A;  1YI2 3;  4R9K A;  3JUQ A;  1K73 4;  3E99 A;  5IG4 A;  3MKI A;  3EHC A;  1OHP A;  3CNX A;  2P38 A;  1VZZ A;  3M8C A;  1JN5 A;  3KE7 A;  4XM4 A;  5FGO A;  3O8Y A;  3NV0 A;  2MF7 A;  5STD A;  3CD6 3;  2R4I A;  3HI7 A;  4AKZ A;  3OW2 2;  3NV0 B;  1S5A A;  2Y73 A;  1FGT A;  1Z1S A;  1JV2 B;  1OCV A;  4EYC A;  2BMO B;  1TFO A;  2WOH A;  3ER7 A;  4N6O B;  1OAC A;  1OPY A;  1KWI A;  4Q53 A;  1IVV A;  4HM0 B;  4U13 A;  1E97 A;  3F7S A;  1YJ9 3;  2BO9 B;  3CU3 A;  3CCL 3;  5LC6 A;  3F8H A;  1Q40 B;  3STD A;  1TFK A;  2CFG A;  3A76 A;  3B4O A;  4PEJ A;  2O3O A;  3IJE B;  1YHQ 3;  4XB5 A;  2B1X B;  2XSO B;  2YX9 A;  4JRF A;  1ROA A;  1LNH A;  5D83 A;  1W2B 2;  2GBX B;  1NB5 I;  1U8C B;  2KCD A;  3NQZ A;  3G16 A;  3F7X A;  1RJO A;  1DMQ A;  1RRL A;  2MC8 A;  2GU1 A;  3PCR A;  1L5G B;  4WYK B;  1VQP 3;  5EQL A;  1DVD A;  1WTH A;  1N9E A;  1LOX A;  3G0K A;  4EBG A;  5KP1 A;  4WYK A;  3ECF A;  3NBB A;  2W03 A;  2GEX A;  4EXR A;  1DMN A;  5IW9 A;  5DRV A;  3V98 A;  3WDG B;  2GXF A;  4MJD A;  5AYR B;  4LMI A;  1W02 A;  3OWU A;  1Y4K A;  4N3V A;  8CHO A;  3LXU X;  3LTB A;  1ULI B;  2BT3 A;  1EKM A;  2ZDJ A;  3RGA A;  3VSY A;  3PGB A;  1J2B A;  1GY7 A;  2WGQ A;  2Y74 A;  3X3X A;  1N5H A;  3BND A;  3WA2 X;  1OHS A;  1MOL A;  3UJM A;  2D42 A;  3SX1 A;  2CWT A;  4R9L A;  4EV2 A;  2WGO A;  3LTD A;  4FCZ A;  2XGL A;  3EF8 A;  5AIH A;  1NDO B;  3LZA A;  2W0Q A;  1AR0 A;  3EBT A;  3PYJ A;  1RN7 A;  4IPB A;  3OWY A;  4O8S A;  3MWZ A;  1GYB A;  2Z6B A;  1IV9 A;  3EN8 A;  2P0X A;  4H3U A;  1UUW B;  5IG5 A;  2Q07 A;  1FGM A;  2YFJ B;  4HM1 B;  2E2T A;  3MSO A;  4XDV A;  3F40 A;  4CCV A;  5CK6 A;  2Z7A A;  3FF2 A;  3L0R A;  1YJW 3;  2CFD A;  4JF8 A;  1JKG A;  1Q86 4;  1CYU A;  3KFQ C;  2D1W A;  3NBR A;  4N6V 0;  4LGQ A;  2CFW A;  4O02 B;  5AEW B;  3CCR 3;  3FG4 A;  2F99 A;  2QIY A;  3K7C A;  1K9M 4;  3FG3 A;  1HKX A;  1YGE A;  1NU3 A;  4I4K A;  4O2H A;  3BNC A;  1W01 A;  3B7C A;  2P09 A;  3FKA A;  3LT9 A;  3MG2 A;  3FCS B;  3V99 A;  2BNG A;  3BNB A;  2XRX B;  3CCM 3;  1RRH A;  1OGX A;  3ROB A;  1IQY A;  1NB3 I;  1D6Z A;  3Q90 A;  2CFL A;  4G1M B;  1W00 A;  1NO3 A;  2YFL B;  3X3Y A;  3X3Z A;  4ZM8 A;  1JJ2 2;  4X2O A;  1A90 A;  3T0U A;  5JPP A;  1NJI 4;  2QGU A;  1O7P B;  2RGQ A;  3IMA B;  4AEQ A;  3Q1C A;  2XEP A;  5HGR A;  2GBW B;  1JB4 A;  2HMK B;  3HII A;  4N6U A;  3KSE D;  3K0Z A;  3NM7 A;  2F86 B;  3SXX A;  4CDL A;  1A2V A;  4GB5 A;  2KXG A;  2FGT A;  2CG0 A;  3K63 A;  7STD A;  1W7C A;  3MYT A;  1KSI A;  1FUW A;  2L4V A;  4LZI A;  1VQ4 3;  3DGO A;  3G6E 3;  1OGZ A;  3T8U A;  1A2K A;  3EBY A;  3NBJ A;  3FG1 A;  1QMA A;  2A15 A;  4BTX A;  1N9J A;  4XDW A;  5JBS A;  3V92 A;  1IDP A;  1STF I;  3WA3 A;  4R1K A;  1GY5 A;  1JB2 A;  2IA7 A;  3FZW A;  4N6N B;  1N5P A;  1EG9 B;  4FR9 A;  3CCE 3;  4HBR A;  1WMP A;  3S28 A;  1IQ8 A;  4L8O A;  3CMA 3;  5IEO A;  3NM2 A;  1MNL A;  2BMQ B;  3D3L A;  4LSO A;  2ML5 A;  3LYG A;  1DVC A;  1Q7Y 4;  2W6J H;  2B24 B;  4OUQ A;  1D6Y A;  1LXE A;  1W6C A;  3MG1 A;  4HM2 B;  4MEI A;  4KFE A;  4HM7 B;  2XF3 A;  2CFK A;  1K8A 4;  1YIT 3;  5G2G A;  1QVF 2;  1Q42 A;  1NWW A;  2XGN A;  2CC3 A;  4OK0 A;  2RSX A;  1U5O A;  1UI7 A;  4R4K A;  3CCV 3;  1QAF A;  2LYX A;  2P05 A;  2W9P A;  3JUO A;  3OXA A;  3G8Z A;  1VQ9 3;  2GU3 A;  3DGL A;  3HIG A;  5IG3 A;  3U1W A;  1UW1 A;  3F14 A;  3UL6 A;  2CK3 H;  4HM5 B;  3CC7 3;  2IUK A;  3KZT A;  2PZV A;  3F9S A;  1JKG B;  3SVA A;  1TP6 A;  4HZ9 B;  1QVG 2;  4AKY A;  3KKG A;  3D9R A;  1M90 4;  3GAX A;  2ZL8 A;  1WMO A;  1Q81 4;  3HZP A;  3CXC 2;  3AMO B;  5EEO A;  3S29 A;  3X40 A;  1M1K 4;  4BTY A;  3GZX B;  1W5Z A;  3CCJ 3;  2HML B;  3LOY A;  5IEP A;  2XSH B;  3QK9 A;  2IMJ A;  2CWU A;  1IVW A;  3HK4 A;  5I97 A;  2WO0 A;  1VQK 3;  1W6Y A;  3OV4 A;  4MMY B;  1FA3 A;  2STD A;  1O7N B;  2FXT A;  2XH9 A;  1OF5 A;  2CH9 A;  1IT8 A;  2CWV A;  4N6M A;  1KC8 4;  1C7H A;  1SII A;  4R80 A;  3EQQ B;  3J7Y d; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...