3QK9A

Yeast tim44 c-terminal domain complexed with cymal-3
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
196
structure length
174
Chain Sequence
QSLKNKLWDESENPLIVVMRKITNESSRVYSQFKFSNESFTRHLREYIVPEILEAYVKGDVKVLKKWFSEAPFNVYAAQQKIFKEQDVYADGRILDIRGVEIVSAKLLAPQDIPVLVVGCRAQEINLYRKKKTGEIAAGDEANILMSSYAMVFTRDPEGWKILEFVRGGSRQFT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Mitochondrial import inner membrane translocase subunit TIM4
publication title Membrane Binding Mechanism of Yeast Mitochondrial Peripheral Membrane Protein TIM44.
pubmed rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
total genus 36
structure length 174
sequence length 196
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04280 Tim44 Tim44-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.240 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3qk9A00
3J7Yd 2FXTA 2CW9A 3QK9A
chains in the Genus database with same CATH superfamily
4TX4A 3HK4A 1YIT3 4JF8A 2Y73A 5JBSA 3QK9A 3KIIA 3V98A 2D1WA 2XRXB 2BMQB 1RCLA 1ROAA 1W5ZA 2Y74A 3LZAA 1JB4A 4GB5A 1RGEA 1CYVA 1BGSA 3TDGA 2MC8A 2K0MA 3B7CA 1MGWA 4NPBA 1GMQA 2L1SA 4X2OA 2GBXB 3AHWA 1CH0A 3K5TA 1TRQA 3CCS3 1VQQA 5KP4A 1M1K4 1WMPA 4G1MB 1GMRA 3F40A 4EC6A 3OWUA 3AGNA 3QRDA 1W02A 3EC9A 2K3DA 1BOXA 1ULIB 2ML5A 1ZO2A 1JB5A 1OF5B 2YFIB 3HZPA 3OWSA 3U1WA 3D3LA 3T8UA 1NNVA 1R4CA 3BNBA 5KP3A 1X1WA 3NHXA 1GSPA 2XFTA 1LOWA 3DY5A 3S5CA 2ZL8A 2INXA 3CNXA 1BRSA 4XBYA 5G2GA 2ML6A 1EEJA 1YJ93 1JN5B 1S5AA 1SARA 1GYBA 2L4VA 3FZWA 3ROBA 3HOHA 1D6ZA 3PXMA 1N8R4 3SOAA 1JKGA 3PGBA 1V57A 1BSCA 1B2XA 4L8PA 5D83A 4CPKA 1BSBA 4EYCA 3EJVA 4RNZA 2ZHXB 1RGLA 3LTAA 2CK3H 2GU3A 3FH1A 2BMRB 2GBWB 3H51A 4CJNA 1KC84 1W01A 3CCJ3 3KCHA 3M8CA 4WP5A 1BNSA 2CG0A 5ELJA 2GEXA 3WA3A 1LQGC 4O02B 2KF5A 1JZOA 3SLUA 5IEOA 2CX1A 1JB2A 2B24B 2KCDA 2W9PA 3GZXB 1R4YA 4MMYB 4WYKB 4ILFA 1A2KA 1DMQA 3PYJA 2FXTA 3MPHA 2CFDA 3PCSA 2RSXA 1LNIA 2IUKA 1RSNA 3JUOA 4O8SA 3CME3 3DXOA 4K1UA 4R80A 1Q9EA 3IMAB 3WOFB 4J5GA 5CK6A 2BMOB 2CFWA 7RNTA 2GXFA 3SEDA 1AY7A 3DGMA 6STDA 2CG1A 3U97A 1F8NA 1Q40A 1BRJA 2WGOA 3CCM3 1M904 4RBNA 1GOUA 4HZ9B 2C10A 1GD3A 1I2FA 2O9UX 2C11A 1OACA 3FCSB 4N6NB 1G0TA 1IVVA 2XEPA 1RRHA 1SPUA 4N6LA 4BL3A 4L8OA 4HM3B 3CPOA 2LYXA 3B8LA 1E3VA 1RLSA 3F8HA 1IYYA 1I70A 2XR8B 4EBGA 1RKYA 1S723 1FGMA 4BL2A 3N54B 1EG9B 3AGOA 3JUQA 1BRGA 1N5HA 1NU3A 4HKVB 3EBYA 1YIJ3 2WOHA 1WMNA 3F9SA 3PCRA 2AAEA 6RNTA 3Q3FA 3DUKA 1FZUA 1UW1A 1STDA 2W03A 3LYGA 4HZBB 1PYLA 1CYUA 3SYUA 3VSYA 3URPA 1JJ22 1BANA 2F98A 5KP1A 3SX1A 1YI23 2H0HA 4IT7A 1A2VA 1EUIC 1O7GB 3D79A 1IK3A 2XGLA 1B20A 3KKGA 2P0MA 4STDA 3Q1CA 2PZVA 1NB3I 2Q07A 1RRLA 5AI1A 1X1YA 1A67A 2BHMA 3RNTA 5AEUB 2XSHB 2W56B 1CEWI 5RNTA 1UCLA 1K8A4 1LRAA 1KSIA 1NO3A 1BNGA 1ROVA 1VQ73 2W04A 5CF1A 4IIAA 4GL6A 2FNQA 4MJDA 4HVNA 1WQLB 5M1AA 3OX9A 2P38A 1B2MA 4X2HA 4LYLB 5IG0A 3HIGA 3A5EA 2QA43 2IYJA 1FUTA 1TTOA 2P05A 5I97A 5JPPA 3G4S3 3DZLA 2F56A 1BIRA 2I9WA 1BNFA 4R1KA 2CFGA 5CLKA 5AIFA 3CC23 1MWUA 2CWTA 3V92A 3D4AA 3EHCA 3CCL3 1BRNL 2HMNB 2K54A 3DH2A 1V74A 5A0OB 1FGOA 1RGHA 1Q42A 1NWWA 1BRHA 3N8BA 4FCZA 3SVAA 5IG5A 1RMSA 1OGXA 1ASKA 1ZGXA 3JVCA 3F8XA 1BRIA 4JRFA 4L7KA 3G8ZA 3GSPA 1QAKA 2WOFA 2OOVA 3F14A 2KF4A 1K28A 3KZTA 2BNGA 1RHLA 1VQ43 1IV9A 1E3RA 2IY2A 4RZMA 4XBTA 1OHOA 2E2TA 1B27A 3LH4A 3X3XA 1RCKA 3NBRA 5D81A 1LOXA 5STDA 2KF6A 1B21A 2QEX3 1U8CB 4HM7B 1BRKA 1RNBA 4IPBA 2OTJ3 1BSEA 2R41A 1I2EA 5CF2A 4CDLA 3A76A 5AIHA 3EX9A 4KFEA 5DREA 2WGQA 1Q814 1DMNA 2F99A 3D9RA 1MOLA 3KFQC 3CU3A 3JUNA 3GWRA 4H3UA 2XSOB 3IJEB 4HBRA 6GSPA 1PY3A 3BNCA 5AYRB 2H0GA 1ZS7A 3MHEA 3WHOA 5HOHA 2CH9A 4OK0A 1TP6A 2QGUA 1AV4A 1V58A 4FMDA 3X3YA 3GZBA 1HYFA 1RN4A 4KVHA 3Q2PA 3OV4A 3I563 3EB8A 3MG1A 4KZ1A 1W00A 1Y4KA 4I4KA 1JKGB 2HMJB 4BTYA 1Q7HA 1O7NB 3CCV3 3D5GA 1QVG2 4LEHA 1KWIA 4ZM8A 3FG3A 2Z6BA 4N6OB 2GEYA 2RCDA 5AIIA 3EN1B 3X40A 1X1XA 1UGIA 1RGFA 5IG4A 1VQM3 2CFKA 5M18A 1LOVA 3Q90A 3SXXA 1TU5A 1GMPA 1BNRA 2W6JH 1TFOA 2OWPA 4MEIA 5BU4A 2CW9A 2W2CA 1OHPA 4J5KA 2RFRA 1GY6A 3O8YA 3RGAA 1IV7A 1HZ1A 1UCKA 4FCJA 4O2HA 1MWTA 3WR2A 4EW5A 3I0YA 3IPTA 5BXQA 4WHAA 1VZZA 4EV5A 2KF3A 3NV0A 3S28A 1ZX2A 1PFPA 3WDGB 4HM6B 1JV2B 4FCMA 5FW5A 1DYUA 4FR9A 2RNTA 1GS3A 1ULJB 3BNDA 1DVDA 5CXOA 1UI8A 2Z77A 1FGTA 1K734 1YGEA 1DETA 2JDIH 2V1LA 3ER7A 2R4IA 3PS8A 4HJLB 3RDEA 1CQSA 2P09A 1JZDA 1FW7A 2BU4A 1WMOA 1IQ8A 3LMLA 1I2GA 1Q40B 3EE1A 3MSOA 3UNLA 5ELUA 1W6CA 2OQEA 1UI7A 3D5IA 3K7CA 1FGRA 4HM4B 3L0RA 1JNQA 4R4KA 5EQLA 3FLJA 1GOVA 1B2SA 5DRVA 5GSPA 3EBTA 3CXC2 2A15A 3LT9A 1IT7A 1RNTA 4KT3B 1JBRA 1WNHA 1DMMA 1MGRA 3BNEA 4XB5A 1IQYA 1QALA 1TIJA 3MWZA 2F86B 1HU9A 1M1XB 1LNHA 3OXAA 1WTHA 4HM8B 4XBXA 5M19A 1MWRA 1VQP3 1C54A 3GZRA 1L5GB 4NREA 1FUWA 4N6V0 4NHFA 4Q53A 4BTXA 4EV2A 4MMXB 1Z1SA 2CC3A 2QIYA 5HGRA 1OHSA 2ZA4A 3EN8A 4BU4A 3LXUX 1UUWB 2JQ5A 3ZG5A 1Q7Y4 5AYSC 4OUQA 4BTWA 2HMKB 1KD14 2E2VA 1Q824 4H61A 3AMOA 1I0VA 5BVBA 1W6GA 4XDVA 1UCIA 8CHOA 1BVIA 2XFSA 1UUVB 5FGOA 5G1LA 1GD4A 2BO9B 4AKYA 1N5PA 1GY5A 3DMCA 3KSPA 1VQL3 2CFLA 3FG1A 2HMOB 1RDSA 1T5YA 2D42A 3DGYA 3MYTA 3WODG 1VQN3 1AQZA 1FYSA 4WWUC 1YNVX 1W2ZA 5LC6A 5IENA 1BUJA 4FMAA 3WMDA 2RGQA 1IVUA 2LQVA 3G713 2OCTA 1RN7A 2H0IA 1IDPA 3E99A 2YX9A 2OOVC 1N9EA 3F7XA 3G0KA 1SJWA 3CCQ3 2XH9A 1RGGA 2CKFB 2HMLB 3H3HA 1RJOA 2M7OA 3DGOA 5JPUA 2CWVA 3NM2A 4RNTA 1VQ93 1W2B2 3FG4A 1AR0A 4GSPA 3FF0A 1BU4A 1UGHI 1G96A 7GSPA 1O7PB 3JUPA 3WA2X 3JUMA 3VF1A 2OTL3 1VQ63 4OVMA 4HOHA 2IMJA 1W6YA 1O7WB 1IT8A 1UUGB 1BSDA 3ZG0A 5IF6A 2Z7AA 1OF5A 1T2HA 2J8XB 2UGIA 3GZYB 4XM4A 4PEJA 3NUVA 1VQK3 2CX0A 1D6YA 1G02A 1E97A 1LXEA 1QMAA 1BSAA 8RNTA 3ALAA 1B2UA 5AIGA 3S29A 2SBLA 5IW9A 4HM1B 3N9HA 4KFDA 3J7Yd 1U5OA 5EVHA 1JN5A 1BUQA 1K41A 1EQKA 1US1A 1YJW3 3RGRA 3DGLA 3NBJA 1TJDA 4LMIA 2F5MA 3NQYA 4LGQA 2STDA 1FUSA 1YGWA 3LTCA 3SOYA 1HKXA 1RGCA 1RGKA 1B2ZA 3NM7A 1D6UA 3UL5A 2UX0A 4N6TA 1RGAA 1W7CA 1K9M4 2W0QA 4WFOA 3BIRA 3GRDA 4N3VA 1JBSA 3CCE3 3UL6A 4LSOA 5G1KA 3OWYA 3LTBA 4HAAA 2XGNA 4AEQA 3I553 3BLZA 2UUGC 1DVCA 4WYKA 2P0XA 3FGYA 3X42A 1YVSA 3KSED 4R9LA 5EEOA 3FSDA 2CWUA 1STFI 1JRQA 1UCJA 4U13A 4O3VA 1OPYA 2F5WA 4KFFA 4K90B 1IVWA 1GOYA 4HM2B 4GHOA 3B4PA 3HX8A 1ISKA 1MNLA 3CMA3 2SARA 2FGTA 5BIRA 3X41A 1IQXA 1SIIA 3CC43 1C7HA 4N6UA 1LVNA 1NB5I 4RNYA 1J2BA 2XF3A 1O7HB 1W4NA 2OQEC 5AEWB 3BB9A 2WO0A 4QWTA 2W9QA 5TGNA 1QVF2 1TUHA 1BAOA 2BIRA 1AVKA 7STDA 1MWSA 1YHQ3 1NJI4 1IU7A 4EXRA 3G6E3 3BU4A 3CNMA 3VGNA 3B4OA 1QJGA 4FMCA 3K63A 2KRTA 2GSPA 4ORLA 3UJMA 1T3BA 1VQ83 1FGQA 2AADA 3LTDA 3NBBA 1BNEA 1BNIA 3NV0B 3NX0A 4LZIA 3ZFZA 4BIRA 1PU4A 1VQ53 1KQS2 1T2IA 2F4YA 1RN1A 2E2UA 2O3OA 1A2PA 5IEPA 1Q864 1OCVA 3UB1A 3G16A 4DKIA 1B3SA 3CC73 1TRPA 3V99A 5IERA 1I3FA 1TFKA 3KN4A 3LOYA 4FMBA 3FKAA 1O7MB 3MKIA 1DE3A 3MG3A 4R9KA 3GAXA 5IG3A 4I5QA 1OH0A 1FA3A 2Z76A 1I0XA 3AHSA 3PZWA 3F7SA 1YVBI 1LOYA 1BNJA 2PNCA 3CPW2 1I3IA 3FF2A 1N8QA 3WOEB 4XDWA 1LQMB 1OUNA 2ZDJA 2RBIA 1NDOB 3CCU3 1OGZA 1VQO3 2C4BA 1M9GA 1SIHA 2W56A 3CCR3 3MG2A 3ECFA 3HI7A 3LT8A 1I8VA 1QAFA 1EKMA 3DM8A 3KE7A 2YFJB 1AVLA 1X1UA 5LC7A 3S27A 1YJN3 2GU1A 4HM5B 1JBTA 1RTUA 1SQWA 4K1VA 2IA7A 3OW22 4AKZA 4K61A 2YFLB 2KAAA 9RNTA 3EF8A 2KXGA 4HYZA 3T8NA 2CIUA 4N6MA 3AMOB 4MMZB 3STDA 3EQQB 1A90A 1GY7A 2BT3A 2MF7A 3T0UA 1IVXA 1N9JA 2IUJA 5D82A 3DGNA 4HM0B 4J9AA 3X3ZA 2B1XB 3HIIA 2HOHA 1EA2A 3K0ZA 3NQZA 4J8TA 2HMMB 3K9MC 3S67A 3NXJA 2CHCA 3CD63 4CCVA 1UDII
chains in the Genus database with same CATH topology
4TX4A 3HK4A 1YIT3 4JF8A 2Y73A 5JBSA 3QK9A 3KIIA 3V98A 2D1WA 2XRXB 2BMQB 4GB5A 1ROAA 1W5ZA 2Y74A 3LZAA 1JB4A 3TDGA 1CYVA 2MC8A 2K0MA 3B7CA 4X2OA 2GBXB 3K5TA 3CCS3 5KP4A 1M1K4 1WMPA 4G1MB 3F40A 4EC6A 3OWUA 3QRDA 1W02A 3EC9A 1ULIB 2ML5A 1ZO2A 1JB5A 1OF5B 2YFIB 3HZPA 3OWSA 3U1WA 3D3LA 3T8UA 1R4CA 5KP3A 3BNBA 3NHXA 3S5CA 2XFTA 3DY5A 2ZL8A 2INXA 3CNXA 4XBYA 5G2GA 2ML6A 1YJ93 1JN5B 1S5AA 3ROBA 1GYBA 2L4VA 3FZWA 1D6ZA 3PXMA 1N8R4 3SOAA 1JKGA 3PGBA 5D83A 4L8PA 4EYCA 3EJVA 4RNZA 3LTAA 2CK3H 2GU3A 3FH1A 2BMRB 2GBWB 3H51A 1KC84 1W01A 3CCJ3 3M8CA 4WP5A 2CG0A 5ELJA 2GEXA 3WA3A 4O02B 3SLUA 5IEOA 1JB2A 2B24B 2KCDA 2W9PA 3GZXB 4MMYB 4WYKB 1A2KA 1DMQA 3PYJA 2FXTA 3MPHA 2CFDA 3PCSA 2RSXA 2IUKA 3JUOA 4O8SA 3CME3 3DXOA 4K1UA 4R80A 3IMAB 3WOFB 5CK6A 2BMOB 2CFWA 2GXFA 3SEDA 3DGMA 6STDA 2CG1A 3U97A 1F8NA 1Q40A 2WGOA 3CCM3 4RBNA 4HZ9B 2C10A 1GD3A 2O9UX 2C11A 1OACA 3FCSB 4N6NB 1IVVA 2XEPA 1RRHA 1SPUA 4N6LA 4L8OA 4HM3B 3CPOA 2LYXA 3B8LA 1E3VA 3F8HA 2XR8B 4EBGA 1RKYA 1S723 1FGMA 3N54B 1EG9B 3JUQA 1N5HA 1NU3A 4HKVB 3EBYA 1YIJ3 2WOHA 1WMNA 3F9SA 3PCRA 3DUKA 2W03A 1UW1A 1STDA 3LYGA 4HZBB 1CYUA 3VSYA 1JJ22 2F98A 5KP1A 3SX1A 1YI23 4IT7A 1A2VA 1O7GB 1IK3A 2XGLA 3KKGA 2P0MA 4STDA 3Q1CA 2PZVA 1NB3I 2Q07A 1RRLA 5AI1A 1A67A 2BHMA 5AEUB 2XSHB 2W56B 1CEWI 1K8A4 1KSIA 1NO3A 1ROVA 1VQ73 2W04A 5CF1A 4IIAA 4GL6A 2FNQA 4MJDA 4HVNA 1WQLB 3OX9A 2P38A 4X2HA 5IG0A 3HIGA 2QA43 5I97A 2P05A 5JPPA 3G4S3 3DZLA 2I9WA 4R1KA 5CLKA 2CFGA 5AIFA 3CC23 2CWTA 3V92A 3EHCA 3CCL3 2HMNB 2K54A 1V74A 5A0OB 1FGOA 1Q42A 1NWWA 3N8BA 4FCZA 3SVAA 5IG5A 1OGXA 1ASKA 3JVCA 3F8XA 4JRFA 4L7KA 3G8ZA 1QAKA 2WOFA 2OOVA 3F14A 1K28A 3KZTA 2BNGA 1VQ43 1IV9A 1E3RA 4RZMA 4XBTA 1OHOA 2E2TA 3LH4A 3X3XA 3NBRA 5D81A 1LOXA 5STDA 2QEX3 1U8CB 4HM7B 4IPBA 2OTJ3 5CF2A 4CDLA 3A76A 5AIHA 3EX9A 4KFEA 5DREA 2WGQA 1Q814 1DMNA 2F99A 3D9RA 1MOLA 3KFQC 3CU3A 3JUNA 3GWRA 4H3UA 2XSOB 3IJEB 4HBRA 3BNCA 5AYRB 3MHEA 2CH9A 4OK0A 1TP6A 2QGUA 1AV4A 4FMDA 3X3YA 3GZBA 4KVHA 3Q2PA 3OV4A 3I563 3EB8A 3MG1A 4KZ1A 1W00A 1Y4KA 4I4KA 1JKGB 2HMJB 4BTYA 1O7NB 3CCV3 1QVG2 4LEHA 1KWIA 4ZM8A 3FG3A 2Z6BA 4N6OB 2GEYA 2RCDA 5AIIA 3EN1B 3X40A 5IG4A 1VQM3 2CFKA 3Q90A 3SXXA 1TU5A 2W6JH 1TFOA 2OWPA 4MEIA 2CW9A 2W2CA 1OHPA 2RFRA 1GY6A 3O8YA 3RGAA 1IV7A 4FCJA 1M904 4O2HA 5BXQA 3I0YA 3IPTA 4WHAA 1VZZA 4EV5A 3NV0A 3S28A 1ZX2A 1PFPA 3WDGB 4HM6B 1JV2B 4FCMA 5FW5A 1DYUA 4FR9A 1GS3A 1ULJB 3BNDA 1DVDA 5CXOA 1UI8A 2Z77A 1FGTA 1K734 1YGEA 2JDIH 2V1LA 3ER7A 2R4IA 3PS8A 4HJLB 3RDEA 1CQSA 2P09A 1WMOA 1IQ8A 3LMLA 1Q40B 3EE1A 3MSOA 3UNLA 5ELUA 1W6CA 2OQEA 1UI7A 3K7CA 1FGRA 4HM4B 3L0RA 1JNQA 4R4KA 5EQLA 3FLJA 5DRVA 3EBTA 3CXC2 2A15A 3LT9A 1IT7A 1WNHA 1DMMA 3BNEA 4XB5A 1IQYA 1QALA 1TIJA 3MWZA 2F86B 1HU9A 1M1XB 1LNHA 3OXAA 1WTHA 4HM8B 4XBXA 1VQP3 3GZRA 1L5GB 4NREA 1FUWA 4N6V0 4NHFA 4Q53A 4BTXA 4EV2A 4MMXB 1Z1SA 2CC3A 2QIYA 5HGRA 1OHSA 3EN8A 3LXUX 1UUWB 2JQ5A 1Q7Y4 5AYSC 4OUQA 4BTWA 2HMKB 1KD14 2E2VA 1Q824 4H61A 3AMOA 5BVBA 1W6GA 4XDVA 8CHOA 2XFSA 1UUVB 5FGOA 1GD4A 2BO9B 4AKYA 1N5PA 1GY5A 3DMCA 3KSPA 1VQL3 2CFLA 3FG1A 2HMOB 1T5YA 2D42A 3WODG 3MYTA 1VQN3 4WWUC 5LC6A 1W2ZA 5IENA 4FMAA 3WMDA 2RGQA 1IVUA 2LQVA 3G713 2OCTA 1RN7A 1IDPA 3E99A 2YX9A 2OOVC 1N9EA 3F7XA 3G0KA 1SJWA 3CCQ3 2XH9A 2CKFB 2HMLB 3H3HA 1RJOA 2M7OA 3DGOA 5JPUA 2CWVA 3NM2A 1VQ93 1W2B2 3FG4A 1AR0A 3FF0A 1G96A 1O7PB 3JUPA 3WA2X 3JUMA 3VF1A 2OTL3 1VQ63 4OVMA 2IMJA 1W6YA 1O7WB 1IT8A 5IF6A 2Z7AA 1OF5A 3GZYB 4XM4A 4PEJA 3NUVA 1VQK3 1D6YA 1LXEA 1E97A 1QMAA 3ALAA 5AIGA 3S29A 2SBLA 5IW9A 4HM1B 3N9HA 4KFDA 3J7Yd 1U5OA 5EVHA 1JN5A 1BUQA 1K41A 1EQKA 1US1A 1YJW3 3RGRA 3DGLA 3NBJA 4LMIA 3NQYA 4LGQA 2STDA 3LTCA 3SOYA 1HKXA 3NM7A 1D6UA 3UL5A 2UX0A 4N6TA 1W7CA 1K9M4 2W0QA 4WFOA 4N3VA 3GRDA 3CCE3 3UL6A 4LSOA 3OWYA 3LTBA 4AEQA 2XGNA 3I553 3BLZA 1DVCA 4WYKA 2P0XA 3FGYA 3X42A 3KSED 4R9LA 5EEOA 3FSDA 2CWUA 1STFI 1JRQA 4U13A 4O3VA 1OPYA 4KFFA 4K90B 1IVWA 4HM2B 3B4PA 3HX8A 1ISKA 1MNLA 3CMA3 2FGTA 3X41A 1IQXA 1SIIA 3CC43 1C7HA 4N6UA 1LVNA 1NB5I 4RNYA 1J2BA 2XF3A 1O7HB 1W4NA 2OQEC 5AEWB 3BB9A 2WO0A 4QWTA 2W9QA 5TGNA 1QVF2 1TUHA 1AVKA 7STDA 1YHQ3 1NJI4 1IU7A 4EXRA 3G6E3 3CNMA 3VGNA 3B4OA 1QJGA 4FMCA 3K63A 2KRTA 4ORLA 3UJMA 1VQ83 1FGQA 3LTDA 3NBBA 4LZIA 3NV0B 3NX0A 1PU4A 1VQ53 1KQS2 2E2UA 2O3OA 5IEPA 1Q864 1OCVA 3UB1A 3G16A 3CC73 3V99A 5IERA 1TFKA 3KN4A 3LOYA 4FMBA 3FKAA 1O7MB 3MKIA 3MG3A 4R9KA 3GAXA 5IG3A 1OH0A 1FA3A 2Z76A 3PZWA 3F7SA 1YVBI 2PNCA 3CPW2 3FF2A 1N8QA 3WOEB 4XDWA 1OUNA 2ZDJA 3CCU3 1NDOB 1OGZA 1VQO3 1M9GA 1SIHA 2W56A 3CCR3 3MG2A 3ECFA 3HI7A 3LT8A 3DM8A 1QAFA 1EKMA 3KE7A 2YFJB 1AVLA 5LC7A 3S27A 1YJN3 2GU1A 4HM5B 1SQWA 4K1VA 2IA7A 3OW22 4AKZA 4K61A 2YFLB 3EF8A 2KXGA 4HYZA 3T8NA 2CIUA 4N6MA 3AMOB 4MMZB 3STDA 3EQQB 1A90A 1GY7A 2BT3A 2MF7A 3T0UA 1IVXA 1N9JA 2IUJA 5D82A 3DGNA 4HM0B 4J9AA 3X3ZA 2B1XB 3HIIA 3K0ZA 1EA2A 3NQZA 4J8TA 2HMMB 3K9MC 3S67A 3NXJA 2CHCA 3CD63 4CCVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J7Y d;  2FXT A;  2CW9 A;  3QK9 A; 
#chains in the Genus database with same CATH topology
 4TX4 A;  3HK4 A;  1YIT 3;  4JF8 A;  2Y73 A;  5JBS A;  3QK9 A;  3KII A;  3V98 A;  2D1W A;  2XRX B;  2BMQ B;  1RCL A;  1ROA A;  1W5Z A;  2Y74 A;  3LZA A;  1JB4 A;  4GB5 A;  1RGE A;  1CYV A;  1BGS A;  3TDG A;  2MC8 A;  2K0M A;  3B7C A;  1MGW A;  4NPB A;  1GMQ A;  2L1S A;  4X2O A;  2GBX B;  3AHW A;  1CH0 A;  3K5T A;  1TRQ A;  3CCS 3;  1VQQ A;  5KP4 A;  1M1K 4;  1WMP A;  4G1M B;  1GMR A;  3F40 A;  4EC6 A;  3OWU A;  3AGN A;  3QRD A;  1W02 A;  3EC9 A;  2K3D A;  1BOX A;  1ULI B;  2ML5 A;  1ZO2 A;  1JB5 A;  1OF5 B;  2YFI B;  3HZP A;  3OWS A;  3U1W A;  3D3L A;  3T8U A;  1NNV A;  1R4C A;  3BNB A;  5KP3 A;  1X1W A;  3NHX A;  1GSP A;  2XFT A;  1LOW A;  3DY5 A;  3S5C A;  2ZL8 A;  2INX A;  3CNX A;  1BRS A;  4XBY A;  5G2G A;  2ML6 A;  1EEJ A;  1YJ9 3;  1JN5 B;  1S5A A;  1SAR A;  1GYB A;  2L4V A;  3FZW A;  3ROB A;  3HOH A;  1D6Z A;  3PXM A;  1N8R 4;  3SOA A;  1JKG A;  3PGB A;  1V57 A;  1BSC A;  1B2X A;  4L8P A;  5D83 A;  4CPK A;  1BSB A;  4EYC A;  3EJV A;  4RNZ A;  2ZHX B;  1RGL A;  3LTA A;  2CK3 H;  2GU3 A;  3FH1 A;  2BMR B;  2GBW B;  3H51 A;  4CJN A;  1KC8 4;  1W01 A;  3CCJ 3;  3KCH A;  3M8C A;  4WP5 A;  1BNS A;  2CG0 A;  5ELJ A;  2GEX A;  3WA3 A;  1LQG C;  4O02 B;  2KF5 A;  1JZO A;  3SLU A;  5IEO A;  2CX1 A;  1JB2 A;  2B24 B;  2KCD A;  2W9P A;  3GZX B;  1R4Y A;  4MMY B;  4WYK B;  4ILF A;  1A2K A;  1DMQ A;  3PYJ A;  2FXT A;  3MPH A;  2CFD A;  3PCS A;  2RSX A;  1LNI A;  2IUK A;  1RSN A;  3JUO A;  4O8S A;  3CME 3;  3DXO A;  4K1U A;  4R80 A;  1Q9E A;  3IMA B;  3WOF B;  4J5G A;  5CK6 A;  2BMO B;  2CFW A;  7RNT A;  2GXF A;  3SED A;  1AY7 A;  3DGM A;  6STD A;  2CG1 A;  3U97 A;  1F8N A;  1Q40 A;  1BRJ A;  2WGO A;  3CCM 3;  1M90 4;  4RBN A;  1GOU A;  4HZ9 B;  2C10 A;  1GD3 A;  1I2F A;  2O9U X;  2C11 A;  1OAC A;  3FCS B;  4N6N B;  1G0T A;  1IVV A;  2XEP A;  1RRH A;  1SPU A;  4N6L A;  4BL3 A;  4L8O A;  4HM3 B;  3CPO A;  2LYX A;  3B8L A;  1E3V A;  1RLS A;  3F8H A;  1IYY A;  1I70 A;  2XR8 B;  4EBG A;  1RKY A;  1S72 3;  1FGM A;  4BL2 A;  3N54 B;  1EG9 B;  3AGO A;  3JUQ A;  1BRG A;  1N5H A;  1NU3 A;  4HKV B;  3EBY A;  1YIJ 3;  2WOH A;  1WMN A;  3F9S A;  3PCR A;  2AAE A;  6RNT A;  3Q3F A;  3DUK A;  1FZU A;  1UW1 A;  1STD A;  2W03 A;  3LYG A;  4HZB B;  1PYL A;  1CYU A;  3SYU A;  3VSY A;  3URP A;  1JJ2 2;  1BAN A;  2F98 A;  5KP1 A;  3SX1 A;  1YI2 3;  2H0H A;  4IT7 A;  1A2V A;  1EUI C;  1O7G B;  3D79 A;  1IK3 A;  2XGL A;  1B20 A;  3KKG A;  2P0M A;  4STD A;  3Q1C A;  2PZV A;  1NB3 I;  2Q07 A;  1RRL A;  5AI1 A;  1X1Y A;  1A67 A;  2BHM A;  3RNT A;  5AEU B;  2XSH B;  2W56 B;  1CEW I;  5RNT A;  1UCL A;  1K8A 4;  1LRA A;  1KSI A;  1NO3 A;  1BNG A;  1ROV A;  1VQ7 3;  2W04 A;  5CF1 A;  4IIA A;  4GL6 A;  2FNQ A;  4MJD A;  4HVN A;  1WQL B;  5M1A A;  3OX9 A;  2P38 A;  1B2M A;  4X2H A;  4LYL B;  5IG0 A;  3HIG A;  3A5E A;  2QA4 3;  2IYJ A;  1FUT A;  1TTO A;  2P05 A;  5I97 A;  5JPP A;  3G4S 3;  3DZL A;  2F56 A;  1BIR A;  2I9W A;  1BNF A;  4R1K A;  2CFG A;  5CLK A;  5AIF A;  3CC2 3;  1MWU A;  2CWT A;  3V92 A;  3D4A A;  3EHC A;  3CCL 3;  1BRN L;  2HMN B;  2K54 A;  3DH2 A;  1V74 A;  5A0O B;  1FGO A;  1RGH A;  1Q42 A;  1NWW A;  1BRH A;  3N8B A;  4FCZ A;  3SVA A;  5IG5 A;  1RMS A;  1OGX A;  1ASK A;  1ZGX A;  3JVC A;  3F8X A;  1BRI A;  4JRF A;  4L7K A;  3G8Z A;  3GSP A;  1QAK A;  2WOF A;  2OOV A;  3F14 A;  2KF4 A;  1K28 A;  3KZT A;  2BNG A;  1RHL A;  1VQ4 3;  1IV9 A;  1E3R A;  2IY2 A;  4RZM A;  4XBT A;  1OHO A;  2E2T A;  1B27 A;  3LH4 A;  3X3X A;  1RCK A;  3NBR A;  5D81 A;  1LOX A;  5STD A;  2KF6 A;  1B21 A;  2QEX 3;  1U8C B;  4HM7 B;  1BRK A;  1RNB A;  4IPB A;  2OTJ 3;  1BSE A;  2R41 A;  1I2E A;  5CF2 A;  4CDL A;  3A76 A;  5AIH A;  3EX9 A;  4KFE A;  5DRE A;  2WGQ A;  1Q81 4;  1DMN A;  2F99 A;  3D9R A;  1MOL A;  3KFQ C;  3CU3 A;  3JUN A;  3GWR A;  4H3U A;  2XSO B;  3IJE B;  4HBR A;  6GSP A;  1PY3 A;  3BNC A;  5AYR B;  2H0G A;  1ZS7 A;  3MHE A;  3WHO A;  5HOH A;  2CH9 A;  4OK0 A;  1TP6 A;  2QGU A;  1AV4 A;  1V58 A;  4FMD A;  3X3Y A;  3GZB A;  1HYF A;  1RN4 A;  4KVH A;  3Q2P A;  3OV4 A;  3I56 3;  3EB8 A;  3MG1 A;  4KZ1 A;  1W00 A;  1Y4K A;  4I4K A;  1JKG B;  2HMJ B;  4BTY A;  1Q7H A;  1O7N B;  3CCV 3;  3D5G A;  1QVG 2;  4LEH A;  1KWI A;  4ZM8 A;  3FG3 A;  2Z6B A;  4N6O B;  2GEY A;  2RCD A;  5AII A;  3EN1 B;  3X40 A;  1X1X A;  1UGI A;  1RGF A;  5IG4 A;  1VQM 3;  2CFK A;  5M18 A;  1LOV A;  3Q90 A;  3SXX A;  1TU5 A;  1GMP A;  1BNR A;  2W6J H;  1TFO A;  2OWP A;  4MEI A;  5BU4 A;  2CW9 A;  2W2C A;  1OHP A;  4J5K A;  2RFR A;  1GY6 A;  3O8Y A;  3RGA A;  1IV7 A;  1HZ1 A;  1UCK A;  4FCJ A;  4O2H A;  1MWT A;  3WR2 A;  4EW5 A;  3I0Y A;  3IPT A;  5BXQ A;  4WHA A;  1VZZ A;  4EV5 A;  2KF3 A;  3NV0 A;  3S28 A;  1ZX2 A;  1PFP A;  3WDG B;  4HM6 B;  1JV2 B;  4FCM A;  5FW5 A;  1DYU A;  4FR9 A;  2RNT A;  1GS3 A;  1ULJ B;  3BND A;  1DVD A;  5CXO A;  1UI8 A;  2Z77 A;  1FGT A;  1K73 4;  1YGE A;  1DET A;  2JDI H;  2V1L A;  3ER7 A;  2R4I A;  3PS8 A;  4HJL B;  3RDE A;  1CQS A;  2P09 A;  1JZD A;  1FW7 A;  2BU4 A;  1WMO A;  1IQ8 A;  3LML A;  1I2G A;  1Q40 B;  3EE1 A;  3MSO A;  3UNL A;  5ELU A;  1W6C A;  2OQE A;  1UI7 A;  3D5I A;  3K7C A;  1FGR A;  4HM4 B;  3L0R A;  1JNQ A;  4R4K A;  5EQL A;  3FLJ A;  1GOV A;  1B2S A;  5DRV A;  5GSP A;  3EBT A;  3CXC 2;  2A15 A;  3LT9 A;  1IT7 A;  1RNT A;  4KT3 B;  1JBR A;  1WNH A;  1DMM A;  1MGR A;  3BNE A;  4XB5 A;  1IQY A;  1QAL A;  1TIJ A;  3MWZ A;  2F86 B;  1HU9 A;  1M1X B;  1LNH A;  3OXA A;  1WTH A;  4HM8 B;  4XBX A;  5M19 A;  1MWR A;  1VQP 3;  1C54 A;  3GZR A;  1L5G B;  4NRE A;  1FUW A;  4N6V 0;  4NHF A;  4Q53 A;  4BTX A;  4EV2 A;  4MMX B;  1Z1S A;  2CC3 A;  2QIY A;  5HGR A;  1OHS A;  2ZA4 A;  3EN8 A;  4BU4 A;  3LXU X;  1UUW B;  2JQ5 A;  3ZG5 A;  1Q7Y 4;  5AYS C;  4OUQ A;  4BTW A;  2HMK B;  1KD1 4;  2E2V A;  1Q82 4;  4H61 A;  3AMO A;  1I0V A;  5BVB A;  1W6G A;  4XDV A;  1UCI A;  8CHO A;  1BVI A;  2XFS A;  1UUV B;  5FGO A;  5G1L A;  1GD4 A;  2BO9 B;  4AKY A;  1N5P A;  1GY5 A;  3DMC A;  3KSP A;  1VQL 3;  2CFL A;  3FG1 A;  2HMO B;  1RDS A;  1T5Y A;  2D42 A;  3DGY A;  3MYT A;  3WOD G;  1VQN 3;  1AQZ A;  1FYS A;  4WWU C;  1YNV X;  1W2Z A;  5LC6 A;  5IEN A;  1BUJ A;  4FMA A;  3WMD A;  2RGQ A;  1IVU A;  2LQV A;  3G71 3;  2OCT A;  1RN7 A;  2H0I A;  1IDP A;  3E99 A;  2YX9 A;  2OOV C;  1N9E A;  3F7X A;  3G0K A;  1SJW A;  3CCQ 3;  2XH9 A;  1RGG A;  2CKF B;  2HML B;  3H3H A;  1RJO A;  2M7O A;  3DGO A;  5JPU A;  2CWV A;  3NM2 A;  4RNT A;  1VQ9 3;  1W2B 2;  3FG4 A;  1AR0 A;  4GSP A;  3FF0 A;  1BU4 A;  1UGH I;  1G96 A;  7GSP A;  1O7P B;  3JUP A;  3WA2 X;  3JUM A;  3VF1 A;  2OTL 3;  1VQ6 3;  4OVM A;  4HOH A;  2IMJ A;  1W6Y A;  1O7W B;  1IT8 A;  1UUG B;  1BSD A;  3ZG0 A;  5IF6 A;  2Z7A A;  1OF5 A;  1T2H A;  2J8X B;  2UGI A;  3GZY B;  4XM4 A;  4PEJ A;  3NUV A;  1VQK 3;  2CX0 A;  1D6Y A;  1G02 A;  1E97 A;  1LXE A;  1QMA A;  1BSA A;  8RNT A;  3ALA A;  1B2U A;  5AIG A;  3S29 A;  2SBL A;  5IW9 A;  4HM1 B;  3N9H A;  4KFD A;  3J7Y d;  1U5O A;  5EVH A;  1JN5 A;  1BUQ A;  1K41 A;  1EQK A;  1US1 A;  1YJW 3;  3RGR A;  3DGL A;  3NBJ A;  1TJD A;  4LMI A;  2F5M A;  3NQY A;  4LGQ A;  2STD A;  1FUS A;  1YGW A;  3LTC A;  3SOY A;  1HKX A;  1RGC A;  1RGK A;  1B2Z A;  3NM7 A;  1D6U A;  3UL5 A;  2UX0 A;  4N6T A;  1RGA A;  1W7C A;  1K9M 4;  2W0Q A;  4WFO A;  3BIR A;  3GRD A;  4N3V A;  1JBS A;  3CCE 3;  3UL6 A;  4LSO A;  5G1K A;  3OWY A;  3LTB A;  4HAA A;  2XGN A;  4AEQ A;  3I55 3;  3BLZ A;  2UUG C;  1DVC A;  4WYK A;  2P0X A;  3FGY A;  3X42 A;  1YVS A;  3KSE D;  4R9L A;  5EEO A;  3FSD A;  2CWU A;  1STF I;  1JRQ A;  1UCJ A;  4U13 A;  4O3V A;  1OPY A;  2F5W A;  4KFF A;  4K90 B;  1IVW A;  1GOY A;  4HM2 B;  4GHO A;  3B4P A;  3HX8 A;  1ISK A;  1MNL A;  3CMA 3;  2SAR A;  2FGT A;  5BIR A;  3X41 A;  1IQX A;  1SII A;  3CC4 3;  1C7H A;  4N6U A;  1LVN A;  1NB5 I;  4RNY A;  1J2B A;  2XF3 A;  1O7H B;  1W4N A;  2OQE C;  5AEW B;  3BB9 A;  2WO0 A;  4QWT A;  2W9Q A;  5TGN A;  1QVF 2;  1TUH A;  1BAO A;  2BIR A;  1AVK A;  7STD A;  1MWS A;  1YHQ 3;  1NJI 4;  1IU7 A;  4EXR A;  3G6E 3;  3BU4 A;  3CNM A;  3VGN A;  3B4O A;  1QJG A;  4FMC A;  3K63 A;  2KRT A;  2GSP A;  4ORL A;  3UJM A;  1T3B A;  1VQ8 3;  1FGQ A;  2AAD A;  3LTD A;  3NBB A;  1BNE A;  1BNI A;  3NV0 B;  3NX0 A;  4LZI A;  3ZFZ A;  4BIR A;  1PU4 A;  1VQ5 3;  1KQS 2;  1T2I A;  2F4Y A;  1RN1 A;  2E2U A;  2O3O A;  1A2P A;  5IEP A;  1Q86 4;  1OCV A;  3UB1 A;  3G16 A;  4DKI A;  1B3S A;  3CC7 3;  1TRP A;  3V99 A;  5IER A;  1I3F A;  1TFK A;  3KN4 A;  3LOY A;  4FMB A;  3FKA A;  1O7M B;  3MKI A;  1DE3 A;  3MG3 A;  4R9K A;  3GAX A;  5IG3 A;  4I5Q A;  1OH0 A;  1FA3 A;  2Z76 A;  1I0X A;  3AHS A;  3PZW A;  3F7S A;  1YVB I;  1LOY A;  1BNJ A;  2PNC A;  3CPW 2;  1I3I A;  3FF2 A;  1N8Q A;  3WOE B;  4XDW A;  1LQM B;  1OUN A;  2ZDJ A;  2RBI A;  1NDO B;  3CCU 3;  1OGZ A;  1VQO 3;  2C4B A;  1M9G A;  1SIH A;  2W56 A;  3CCR 3;  3MG2 A;  3ECF A;  3HI7 A;  3LT8 A;  1I8V A;  1QAF A;  1EKM A;  3DM8 A;  3KE7 A;  2YFJ B;  1AVL A;  1X1U A;  5LC7 A;  3S27 A;  1YJN 3;  2GU1 A;  4HM5 B;  1JBT A;  1RTU A;  1SQW A;  4K1V A;  2IA7 A;  3OW2 2;  4AKZ A;  4K61 A;  2YFL B;  2KAA A;  9RNT A;  3EF8 A;  2KXG A;  4HYZ A;  3T8N A;  2CIU A;  4N6M A;  3AMO B;  4MMZ B;  3STD A;  3EQQ B;  1A90 A;  1GY7 A;  2BT3 A;  2MF7 A;  3T0U A;  1IVX A;  1N9J A;  2IUJ A;  5D82 A;  3DGN A;  4HM0 B;  4J9A A;  3X3Z A;  2B1X B;  3HII A;  2HOH A;  1EA2 A;  3K0Z A;  3NQZ A;  4J8T A;  2HMM B;  3K9M C;  3S67 A;  3NXJ A;  2CHC A;  3CD6 3;  4CCV A;  1UDI I; 
#chains in the Genus database with same CATH homology
 4TX4 A;  3HK4 A;  1YIT 3;  4JF8 A;  2Y73 A;  5JBS A;  3QK9 A;  3KII A;  3V98 A;  2D1W A;  2XRX B;  2BMQ B;  4GB5 A;  1ROA A;  1W5Z A;  2Y74 A;  3LZA A;  1JB4 A;  3TDG A;  1CYV A;  2MC8 A;  2K0M A;  3B7C A;  4X2O A;  2GBX B;  3K5T A;  3CCS 3;  5KP4 A;  1M1K 4;  1WMP A;  4G1M B;  3F40 A;  4EC6 A;  3OWU A;  3QRD A;  1W02 A;  3EC9 A;  1ULI B;  2ML5 A;  1ZO2 A;  1JB5 A;  1OF5 B;  2YFI B;  3HZP A;  3OWS A;  3U1W A;  3D3L A;  3T8U A;  1R4C A;  5KP3 A;  3BNB A;  3NHX A;  3S5C A;  2XFT A;  3DY5 A;  2ZL8 A;  2INX A;  3CNX A;  4XBY A;  5G2G A;  2ML6 A;  1YJ9 3;  1JN5 B;  1S5A A;  3ROB A;  1GYB A;  2L4V A;  3FZW A;  1D6Z A;  3PXM A;  1N8R 4;  3SOA A;  1JKG A;  3PGB A;  5D83 A;  4L8P A;  4EYC A;  3EJV A;  4RNZ A;  3LTA A;  2CK3 H;  2GU3 A;  3FH1 A;  2BMR B;  2GBW B;  3H51 A;  1KC8 4;  1W01 A;  3CCJ 3;  3M8C A;  4WP5 A;  2CG0 A;  5ELJ A;  2GEX A;  3WA3 A;  4O02 B;  3SLU A;  5IEO A;  1JB2 A;  2B24 B;  2KCD A;  2W9P A;  3GZX B;  4MMY B;  4WYK B;  1A2K A;  1DMQ A;  3PYJ A;  2FXT A;  3MPH A;  2CFD A;  3PCS A;  2RSX A;  2IUK A;  3JUO A;  4O8S A;  3CME 3;  3DXO A;  4K1U A;  4R80 A;  3IMA B;  3WOF B;  5CK6 A;  2BMO B;  2CFW A;  2GXF A;  3SED A;  3DGM A;  6STD A;  2CG1 A;  3U97 A;  1F8N A;  1Q40 A;  2WGO A;  3CCM 3;  4RBN A;  4HZ9 B;  2C10 A;  1GD3 A;  2O9U X;  2C11 A;  1OAC A;  3FCS B;  4N6N B;  1IVV A;  2XEP A;  1RRH A;  1SPU A;  4N6L A;  4L8O A;  4HM3 B;  3CPO A;  2LYX A;  3B8L A;  1E3V A;  3F8H A;  2XR8 B;  4EBG A;  1RKY A;  1S72 3;  1FGM A;  3N54 B;  1EG9 B;  3JUQ A;  1N5H A;  1NU3 A;  4HKV B;  3EBY A;  1YIJ 3;  2WOH A;  1WMN A;  3F9S A;  3PCR A;  3DUK A;  2W03 A;  1UW1 A;  1STD A;  3LYG A;  4HZB B;  1CYU A;  3VSY A;  1JJ2 2;  2F98 A;  5KP1 A;  3SX1 A;  1YI2 3;  4IT7 A;  1A2V A;  1O7G B;  1IK3 A;  2XGL A;  3KKG A;  2P0M A;  4STD A;  3Q1C A;  2PZV A;  1NB3 I;  2Q07 A;  1RRL A;  5AI1 A;  1A67 A;  2BHM A;  5AEU B;  2XSH B;  2W56 B;  1CEW I;  1K8A 4;  1KSI A;  1NO3 A;  1ROV A;  1VQ7 3;  2W04 A;  5CF1 A;  4IIA A;  4GL6 A;  2FNQ A;  4MJD A;  4HVN A;  1WQL B;  3OX9 A;  2P38 A;  4X2H A;  5IG0 A;  3HIG A;  2QA4 3;  5I97 A;  2P05 A;  5JPP A;  3G4S 3;  3DZL A;  2I9W A;  4R1K A;  5CLK A;  2CFG A;  5AIF A;  3CC2 3;  2CWT A;  3V92 A;  3EHC A;  3CCL 3;  2HMN B;  2K54 A;  1V74 A;  5A0O B;  1FGO A;  1Q42 A;  1NWW A;  3N8B A;  4FCZ A;  3SVA A;  5IG5 A;  1OGX A;  1ASK A;  3JVC A;  3F8X A;  4JRF A;  4L7K A;  3G8Z A;  1QAK A;  2WOF A;  2OOV A;  3F14 A;  1K28 A;  3KZT A;  2BNG A;  1VQ4 3;  1IV9 A;  1E3R A;  4RZM A;  4XBT A;  1OHO A;  2E2T A;  3LH4 A;  3X3X A;  3NBR A;  5D81 A;  1LOX A;  5STD A;  2QEX 3;  1U8C B;  4HM7 B;  4IPB A;  2OTJ 3;  5CF2 A;  4CDL A;  3A76 A;  5AIH A;  3EX9 A;  4KFE A;  5DRE A;  2WGQ A;  1Q81 4;  1DMN A;  2F99 A;  3D9R A;  1MOL A;  3KFQ C;  3CU3 A;  3JUN A;  3GWR A;  4H3U A;  2XSO B;  3IJE B;  4HBR A;  3BNC A;  5AYR B;  3MHE A;  2CH9 A;  4OK0 A;  1TP6 A;  2QGU A;  1AV4 A;  4FMD A;  3X3Y A;  3GZB A;  4KVH A;  3Q2P A;  3OV4 A;  3I56 3;  3EB8 A;  3MG1 A;  4KZ1 A;  1W00 A;  1Y4K A;  4I4K A;  1JKG B;  2HMJ B;  4BTY A;  1O7N B;  3CCV 3;  1QVG 2;  4LEH A;  1KWI A;  4ZM8 A;  3FG3 A;  2Z6B A;  4N6O B;  2GEY A;  2RCD A;  5AII A;  3EN1 B;  3X40 A;  5IG4 A;  1VQM 3;  2CFK A;  3Q90 A;  3SXX A;  1TU5 A;  2W6J H;  1TFO A;  2OWP A;  4MEI A;  2CW9 A;  2W2C A;  1OHP A;  2RFR A;  1GY6 A;  3O8Y A;  3RGA A;  1IV7 A;  4FCJ A;  1M90 4;  4O2H A;  5BXQ A;  3I0Y A;  3IPT A;  4WHA A;  1VZZ A;  4EV5 A;  3NV0 A;  3S28 A;  1ZX2 A;  1PFP A;  3WDG B;  4HM6 B;  1JV2 B;  4FCM A;  5FW5 A;  1DYU A;  4FR9 A;  1GS3 A;  1ULJ B;  3BND A;  1DVD A;  5CXO A;  1UI8 A;  2Z77 A;  1FGT A;  1K73 4;  1YGE A;  2JDI H;  2V1L A;  3ER7 A;  2R4I A;  3PS8 A;  4HJL B;  3RDE A;  1CQS A;  2P09 A;  1WMO A;  1IQ8 A;  3LML A;  1Q40 B;  3EE1 A;  3MSO A;  3UNL A;  5ELU A;  1W6C A;  2OQE A;  1UI7 A;  3K7C A;  1FGR A;  4HM4 B;  3L0R A;  1JNQ A;  4R4K A;  5EQL A;  3FLJ A;  5DRV A;  3EBT A;  3CXC 2;  2A15 A;  3LT9 A;  1IT7 A;  1WNH A;  1DMM A;  3BNE A;  4XB5 A;  1IQY A;  1QAL A;  1TIJ A;  3MWZ A;  2F86 B;  1HU9 A;  1M1X B;  1LNH A;  3OXA A;  1WTH A;  4HM8 B;  4XBX A;  1VQP 3;  3GZR A;  1L5G B;  4NRE A;  1FUW A;  4N6V 0;  4NHF A;  4Q53 A;  4BTX A;  4EV2 A;  4MMX B;  1Z1S A;  2CC3 A;  2QIY A;  5HGR A;  1OHS A;  3EN8 A;  3LXU X;  1UUW B;  2JQ5 A;  1Q7Y 4;  5AYS C;  4OUQ A;  4BTW A;  2HMK B;  1KD1 4;  2E2V A;  1Q82 4;  4H61 A;  3AMO A;  5BVB A;  1W6G A;  4XDV A;  8CHO A;  2XFS A;  1UUV B;  5FGO A;  1GD4 A;  2BO9 B;  4AKY A;  1N5P A;  1GY5 A;  3DMC A;  3KSP A;  1VQL 3;  2CFL A;  3FG1 A;  2HMO B;  1T5Y A;  2D42 A;  3WOD G;  3MYT A;  1VQN 3;  4WWU C;  5LC6 A;  1W2Z A;  5IEN A;  4FMA A;  3WMD A;  2RGQ A;  1IVU A;  2LQV A;  3G71 3;  2OCT A;  1RN7 A;  1IDP A;  3E99 A;  2YX9 A;  2OOV C;  1N9E A;  3F7X A;  3G0K A;  1SJW A;  3CCQ 3;  2XH9 A;  2CKF B;  2HML B;  3H3H A;  1RJO A;  2M7O A;  3DGO A;  5JPU A;  2CWV A;  3NM2 A;  1VQ9 3;  1W2B 2;  3FG4 A;  1AR0 A;  3FF0 A;  1G96 A;  1O7P B;  3JUP A;  3WA2 X;  3JUM A;  3VF1 A;  2OTL 3;  1VQ6 3;  4OVM A;  2IMJ A;  1W6Y A;  1O7W B;  1IT8 A;  5IF6 A;  2Z7A A;  1OF5 A;  3GZY B;  4XM4 A;  4PEJ A;  3NUV A;  1VQK 3;  1D6Y A;  1LXE A;  1E97 A;  1QMA A;  3ALA A;  5AIG A;  3S29 A;  2SBL A;  5IW9 A;  4HM1 B;  3N9H A;  4KFD A;  3J7Y d;  1U5O A;  5EVH A;  1JN5 A;  1BUQ A;  1K41 A;  1EQK A;  1US1 A;  1YJW 3;  3RGR A;  3DGL A;  3NBJ A;  4LMI A;  3NQY A;  4LGQ A;  2STD A;  3LTC A;  3SOY A;  1HKX A;  3NM7 A;  1D6U A;  3UL5 A;  2UX0 A;  4N6T A;  1W7C A;  1K9M 4;  2W0Q A;  4WFO A;  4N3V A;  3GRD A;  3CCE 3;  3UL6 A;  4LSO A;  3OWY A;  3LTB A;  4AEQ A;  2XGN A;  3I55 3;  3BLZ A;  1DVC A;  4WYK A;  2P0X A;  3FGY A;  3X42 A;  3KSE D;  4R9L A;  5EEO A;  3FSD A;  2CWU A;  1STF I;  1JRQ A;  4U13 A;  4O3V A;  1OPY A;  4KFF A;  4K90 B;  1IVW A;  4HM2 B;  3B4P A;  3HX8 A;  1ISK A;  1MNL A;  3CMA 3;  2FGT A;  3X41 A;  1IQX A;  1SII A;  3CC4 3;  1C7H A;  4N6U A;  1LVN A;  1NB5 I;  4RNY A;  1J2B A;  2XF3 A;  1O7H B;  1W4N A;  2OQE C;  5AEW B;  3BB9 A;  2WO0 A;  4QWT A;  2W9Q A;  5TGN A;  1QVF 2;  1TUH A;  1AVK A;  7STD A;  1YHQ 3;  1NJI 4;  1IU7 A;  4EXR A;  3G6E 3;  3CNM A;  3VGN A;  3B4O A;  1QJG A;  4FMC A;  3K63 A;  2KRT A;  4ORL A;  3UJM A;  1VQ8 3;  1FGQ A;  3LTD A;  3NBB A;  4LZI A;  3NV0 B;  3NX0 A;  1PU4 A;  1VQ5 3;  1KQS 2;  2E2U A;  2O3O A;  5IEP A;  1Q86 4;  1OCV A;  3UB1 A;  3G16 A;  3CC7 3;  3V99 A;  5IER A;  1TFK A;  3KN4 A;  3LOY A;  4FMB A;  3FKA A;  1O7M B;  3MKI A;  3MG3 A;  4R9K A;  3GAX A;  5IG3 A;  1OH0 A;  1FA3 A;  2Z76 A;  3PZW A;  3F7S A;  1YVB I;  2PNC A;  3CPW 2;  3FF2 A;  1N8Q A;  3WOE B;  4XDW A;  1OUN A;  2ZDJ A;  3CCU 3;  1NDO B;  1OGZ A;  1VQO 3;  1M9G A;  1SIH A;  2W56 A;  3CCR 3;  3MG2 A;  3ECF A;  3HI7 A;  3LT8 A;  3DM8 A;  1QAF A;  1EKM A;  3KE7 A;  2YFJ B;  1AVL A;  5LC7 A;  3S27 A;  1YJN 3;  2GU1 A;  4HM5 B;  1SQW A;  4K1V A;  2IA7 A;  3OW2 2;  4AKZ A;  4K61 A;  2YFL B;  3EF8 A;  2KXG A;  4HYZ A;  3T8N A;  2CIU A;  4N6M A;  3AMO B;  4MMZ B;  3STD A;  3EQQ B;  1A90 A;  1GY7 A;  2BT3 A;  2MF7 A;  3T0U A;  1IVX A;  1N9J A;  2IUJ A;  5D82 A;  3DGN A;  4HM0 B;  4J9A A;  3X3Z A;  2B1X B;  3HII A;  3K0Z A;  1EA2 A;  3NQZ A;  4J8T A;  2HMM B;  3K9M C;  3S67 A;  3NXJ A;  2CHC A;  3CD6 3;  4CCV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...