3QKAA

Crystal structure of enoyl-coa hydratase echa5 from mycobacterium marinum
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
233
structure length
233
Chain Sequence
b'DLVQVERNGPVTTVIINRPQARNAVNGPTAAALYSAFAEFDRDESASVAVLCGNGGTFCAGADLKAFGTAEANAVHRTGPGPMGPSRMMLSKPVIAAVSGYAVAGGLELALWCDLRVAEQDAVFGVFCRRWGVPLIDGGTVRLPRLIGHSRAMDMILTGRAVQADEALAIGLANRVVPNGQARQAAEELAAQLAALPQQCLRSDRLSALQQWGLPESAALDLEFASISRVAAE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enoyl-CoA hydratase, EchA5
publication title Increasing the structural coverage of tuberculosis drug targets.
pubmed doi rcsb
source organism Mycobacterium marinum m
molecule tags Lyase
total genus 79
structure length 233
sequence length 233
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2011-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3qkaA01
4JCTA 3BEZA 4I4ZA 3U9TB 4JFCA 4JYLA 5E0NX 3WG5A 3K8XA 4JJTA 3H81A 5JBXA 2W3PA 2UZFA 2A81A 3U9RB 3V5EA 3U9SB 5DL1A 1HNOA 5DUFA 4F47A 2F9YA 1UYSA 4KWBA 5G1QA 4FN8A 3MOYA 3GLMA 2VSSF 4JVTA 4MXIA 4U19A 4OLQA 4LK5A 3TVUA 4RYFH 3N6RB 3OMEA 1YG6A 4ZDBA 5KJPA 3H0SA 4I52A 3I47A 3SLLA 5JBWA 2D3TA 3G64A 1Y7OA 5FIFA 4K29A 3MYBA 1FC9A 2ZL2A 4B3JA 1X0UA 4MI2A 2HW5A 2CBYA 3GF7A 4ZU2A 2VSSA 2Q35A 3PZKA 3H0UA 3FDUA 4KPKA 5KDRB 1XNVA 3TVWA 5DUCA 3VIVA 4ELXA 5FUSA 2F9IB 2ZQQA 3HP0A 4U18A 2PPYA 3Q0GA 3KTHA 4Z0MA 1WDLA 2IEXA 1XNYA 1JXZA 4ZDCA 3MT6A 3LKEA 3PE8A 5DU6A 2VSUE 2FZSA 1XO6A 4JWVA 4U0HA 2X58A 4G2RA 3R6HA 1FC7A 3H0QA 1TG6A 3QK8A 4JCRA 3T88A 2C8TA 5G1RA 1ON9A 3HINA 1RJNA 5DU4A 4ELSA 5DKPA 4FZWA 3DJAA 3P2LA 3DORA 4I42A 1OD4A 2FBMA 2J5GA 3STAA 4B3HA 1SZOA 2PBPA 3BF0A 3LAOA 5DU8A 4QIJA 2PG8A 1XX4A 4U0GH 2CE3A 2F6IA 4Q1IA 5DZKA 1DCIA 4FNBA 5C9GA 1OD2A 3TRRA 4FZWC 1EY3A 4QIIA 5INIA 2J5GD 4WZ8B 2J5SA 5KDRA 4DI1A 2X24A 3OT6A 3P5MA 3KQFA 2NP9A 2F9IA 4ZDFA 4ZDEA 4IZBA 4EMPA 4JCQA 2J5IB 4IZCA 1WZ8A 4OMRA 1XNWA 3TT6A 5IKLB 3ZW9A 3PEAA 2ZL3A 4YLHA 5INFA 3TV5A 4Q0GA 1N6DA 1UIYA 1VRGA 4ZDDA 2QQ3A 3HLN1 4MOUA 1N6EA 4EMLA 2ZL0A 1PJHA 3QXZA 1WDMA 2DEOA 3M6NA 4HC8A 2VSUF 1DUBA 3QKAA 2ZL4A 3IB9A 1UYTA 3QXIA 1NZYB 5DZKH 3ISAA 2DUBA 3T8BA 3R9QA 4IZDA 3QREA 3TDCA 4RYFA 2Q34A 1FC6A 1K39A 5DTWA 4FNDA 3IBBA 3R9SA 3JU1A 4JCSA 3ZWBA 1RJMA 3Q1TA 1O8UA 1HZDA 1UYRA 2BZRA 4EMMA 5G1SA 1J7XA 3NJBA 3T89A 1K32A 1Q51A 3PGQA 3KTKA 4JSBA 1EF8A 2VSUA 4K2NA 1MJ3A 4L6WA 3GKBA 4QFEA 1EF9A 3ST9A 4WCZA 3H0JA 2EJ5A 3KTIA 4GHNA 5INGA 3M6MA 4GM2A 3R0OA 4RCNA 3KTGA 2FW2A 1YG8A 5E0SA 2J5IA 5CTBA 4FN7A 3Q7HA 1PIXA 2VSUC 4WYOB 2Q2XA 3T3WA 4ELWA 3RSIA 3L3SA 3H02A 2A7KA 1TYFA 2F9YB 3GMAA 2ZQRA 2VSSE 3QYRA 4FJWD 3NJDA 2A7SA 3P85A 4NNQA 3HRXA 3ZWCA 1SG4A 1NZYA 1FCFA 1WDKA 3RRVA 4FB8A 3ZW8A 3TLFA 4OG1A 5DTPA 3IAVA 4K3WA 1ON3A 3Q0JA 4JOTA 3R9TA 3QWDA 1UYVA 4B3IA 3V5IA 2F6QA 3TZ3A 2VREA 3SWXA 2VX2A 3QMJA 1HNUA 4HNKA 3FF6A 5CTCA 4L8KA 3RSTA 3BPPA 3ZWAA 4U0GA 4KNPA 2WTBA 3K50A 4JYJA 3TT7A 5E0SH 4KD6A 5MGBA 5C90A 3OC7A 4NEKA 4U1AA 3T8AA 4ASIA 3HE2A 1Q52A 3KTJA 2J5II 3MFMA 1W2XA 1N6FA 3GF3A 2GTRA
chains in the Genus database with same CATH superfamily
4JCTA 3BEZA 4I4ZA 3U9TB 4JFCA 4JYLA 5E0NX 3WG5A 3K8XA 4JJTA 3H81A 5JBXA 2W3PA 2UZFA 2A81A 3U9RB 4HDTA 3V5EA 3U9SB 5DL1A 1HNOA 5DUFA 4F47A 2F9YA 1UYSA 4KWBA 5G1QA 4FN8A 3MOYA 3GLMA 2VSSF 4JVTA 4MXIA 4U19A 4OLQA 4LK5A 3TVUA 4RYFH 3N6RB 3OMEA 1YG6A 4ZDBA 5KJPA 3H0SA 4I52A 3I47A 3SLLA 5JBWA 2D3TA 3G64A 1Y7OA 5FIFA 4K29A 3MYBA 1FC9A 2ZL2A 4B3JA 1X0UA 4MI2A 2HW5A 2CBYA 3GF7A 4ZU2A 2VSSA 2Q35A 3PZKA 3H0UA 3FDUA 4KPKA 5KDRB 1XNVA 3TVWA 5DUCA 3VIVA 4ELXA 5FUSA 2F9IB 2ZQQA 3HP0A 4U18A 2PPYA 3Q0GA 3KTHA 4Z0MA 1WDLA 2IEXA 1XNYA 1JXZA 4ZDCA 3MT6A 3LKEA 3PE8A 5DU6A 2VSUE 2FZSA 1XO6A 4JWVA 4U0HA 2X58A 4G2RA 3R6HA 1FC7A 3H0QA 1TG6A 3QK8A 4JCRA 3T88A 2C8TA 5G1RA 1ON9A 3HINA 1RJNA 5DU4A 4ELSA 5DKPA 4FZWA 3DJAA 3P2LA 3DORA 4I42A 1OD4A 2FBMA 2J5GA 3STAA 4B3HA 1SZOA 2PBPA 3BF0A 3LAOA 5DU8A 4QIJA 2PG8A 1XX4A 4U0GH 2CE3A 3BPTA 2F6IA 4Q1IA 5DZKA 1DCIA 4FNBA 5C9GA 1OD2A 3TRRA 4FZWC 1EY3A 4QIIA 5INIA 2J5GD 4WZ8B 2J5SA 5KDRA 4DI1A 2X24A 3OT6A 3P5MA 3KQFA 2NP9A 2F9IA 4ZDFA 4ZDEA 4IZBA 4EMPA 4JCQA 2J5IB 4IZCA 1WZ8A 4OMRA 1XNWA 3TT6A 5IKLB 3ZW9A 3PEAA 2ZL3A 4YLHA 5INFA 3TV5A 4Q0GA 1N6DA 1UIYA 1VRGA 4ZDDA 2QQ3A 3HLN1 4MOUA 1N6EA 4EMLA 2ZL0A 1PJHA 3QXZA 1WDMA 2DEOA 3M6NA 4HC8A 2VSUF 1DUBA 3QKAA 2ZL4A 3IB9A 1UYTA 3QXIA 1NZYB 5DZKH 3ISAA 2DUBA 3T8BA 3R9QA 4IZDA 3QREA 3TDCA 4RYFA 2Q34A 1FC6A 1K39A 5DTWA 4FNDA 3IBBA 4NARA 3R9SA 3JU1A 4JCSA 3ZWBA 1RJMA 3Q1TA 1O8UA 1HZDA 1UYRA 2BZRA 4EMMA 5G1SA 1J7XA 3NJBA 3T89A 1K32A 1Q51A 3PGQA 3KTKA 4JSBA 1EF8A 2VSUA 4K2NA 1MJ3A 4L6WA 5HUQA 3GKBA 4QFEA 1EF9A 3ST9A 4WCZA 3H0JA 2EJ5A 3KTIA 4GHNA 5INGA 3M6MA 4GM2A 3R0OA 4RCNA 3KTGA 2FW2A 1YG8A 2YJGA 5E0SA 2J5IA 5CTBA 4FN7A 3Q7HA 1PIXA 2VSUC 4WYOB 2Q2XA 3T3WA 4ELWA 3RSIA 3L3SA 3H02A 2A7KA 1TYFA 2F9YB 3GMAA 2ZQRA 2VSSE 3QYRA 4FJWD 3NJDA 2A7SA 3P85A 4NNQA 3HRXA 3ZWCA 1SG4A 1NZYA 1FCFA 1WDKA 3RRVA 4FB8A 3ZW8A 3TLFA 4OG1A 5DTPA 3IAVA 4K3WA 1ON3A 3Q0JA 4JOTA 3R9TA 3QWDA 1UYVA 4B3IA 3V5IA 2F6QA 3TZ3A 2VREA 3SWXA 2VX2A 3QMJA 1HNUA 4HNKA 3FF6A 5CTCA 4L8KA 3RSTA 3BPPA 3ZWAA 4U0GA 4KNPA 2WTBA 3K50A 4JYJA 3TT7A 5E0SH 4KD6A 5MGBA 5C90A 3OC7A 4NEKA 4U1AA 3T8AA 4J2UA 4ASIA 3HE2A 1Q52A 3KTJA 2J5II 3MFMA 1W2XA 1N6FA 3GF3A 2GTRA
chains in the Genus database with same CATH topology
4JCTA 3BEZA 4I4ZA 3U9TB 4JFCA 4JYLA 5E0NX 3WG5A 3K8XA 4JJTA 3H81A 5JBXA 2W3PA 2UZFA 2A81A 3U9RB 4HDTA 3V5EA 3U9SB 5DL1A 1HNOA 5DUFA 4F47A 2F9YA 1UYSA 4KWBA 5G1QA 4FN8A 3MOYA 3GLMA 2VSSF 4JVTA 4MXIA 4U19A 4OLQA 4LK5A 3TVUA 4RYFH 3N6RB 3OMEA 1YG6A 4ZDBA 5KJPA 3H0SA 4I52A 3I47A 3SLLA 5JBWA 2D3TA 3G64A 1Y7OA 5FIFA 4K29A 3MYBA 1FC9A 2ZL2A 4B3JA 1X0UA 4MI2A 2HW5A 2CBYA 3GF7A 4ZU2A 2VSSA 2Q35A 3PZKA 3H0UA 3FDUA 4KPKA 5KDRB 1XNVA 3TVWA 5DUCA 3VIVA 4ELXA 5FUSA 2F9IB 2ZQQA 3HP0A 4U18A 2PPYA 3Q0GA 3KTHA 4Z0MA 1WDLA 2IEXA 1XNYA 1JXZA 4ZDCA 3MT6A 3LKEA 3PE8A 5DU6A 2VSUE 2FZSA 1XO6A 4JWVA 4U0HA 2X58A 4G2RA 3R6HA 1FC7A 3H0QA 1TG6A 3QK8A 4JCRA 3T88A 2C8TA 5G1RA 1ON9A 3HINA 1RJNA 5DU4A 4ELSA 5DKPA 4FZWA 3DJAA 3P2LA 3DORA 4I42A 1OD4A 2FBMA 2J5GA 3STAA 4B3HA 1SZOA 2PBPA 3BF0A 3LAOA 5DU8A 4QIJA 2PG8A 1XX4A 4U0GH 2CE3A 3BPTA 2F6IA 4Q1IA 5DZKA 1DCIA 4FNBA 5C9GA 1OD2A 3TRRA 4FZWC 1EY3A 4QIIA 5INIA 2J5GD 4WZ8B 2J5SA 5KDRA 4DI1A 2X24A 3OT6A 3P5MA 3KQFA 2NP9A 2F9IA 4ZDFA 4ZDEA 4IZBA 4EMPA 4JCQA 2J5IB 4IZCA 1WZ8A 4OMRA 1XNWA 3TT6A 5IKLB 3ZW9A 3PEAA 2ZL3A 4YLHA 5INFA 3TV5A 4Q0GA 1N6DA 1UIYA 1VRGA 4ZDDA 2QQ3A 3HLN1 4MOUA 1N6EA 4EMLA 2ZL0A 1PJHA 3QXZA 1WDMA 2DEOA 3M6NA 4HC8A 2VSUF 1DUBA 3QKAA 2ZL4A 3IB9A 1UYTA 3QXIA 1NZYB 5DZKH 3ISAA 2DUBA 3T8BA 3R9QA 4IZDA 3QREA 3TDCA 4RYFA 2Q34A 1FC6A 1K39A 5DTWA 4FNDA 3IBBA 4NARA 3R9SA 3JU1A 4JCSA 3ZWBA 1RJMA 3Q1TA 1O8UA 1HZDA 1UYRA 2BZRA 4EMMA 5G1SA 1J7XA 3NJBA 3T89A 1K32A 1Q51A 3PGQA 3KTKA 4JSBA 1EF8A 2VSUA 4K2NA 1MJ3A 4L6WA 5HUQA 3GKBA 4QFEA 1EF9A 3ST9A 4WCZA 3H0JA 2EJ5A 3KTIA 4GHNA 5INGA 3M6MA 4GM2A 3R0OA 4RCNA 3KTGA 2FW2A 1YG8A 2YJGA 5E0SA 2J5IA 5CTBA 4FN7A 3Q7HA 1PIXA 2VSUC 4WYOB 2Q2XA 3T3WA 4ELWA 3RSIA 3L3SA 3H02A 2A7KA 1TYFA 2F9YB 3GMAA 2ZQRA 2VSSE 3QYRA 4FJWD 3NJDA 2A7SA 3P85A 4NNQA 3HRXA 3ZWCA 1SG4A 1NZYA 1FCFA 1WDKA 3RRVA 4FB8A 3ZW8A 3TLFA 4OG1A 5DTPA 3IAVA 4K3WA 1ON3A 3Q0JA 4JOTA 3R9TA 3QWDA 1UYVA 4B3IA 3V5IA 2F6QA 3TZ3A 2VREA 3SWXA 2VX2A 3QMJA 1HNUA 4HNKA 3FF6A 5CTCA 4L8KA 3RSTA 3BPPA 3ZWAA 4U0GA 4KNPA 2WTBA 3K50A 4JYJA 3TT7A 5E0SH 4KD6A 5MGBA 5C90A 3OC7A 4NEKA 4U1AA 3T8AA 4J2UA 4ASIA 3HE2A 1Q52A 3KTJA 2J5II 3MFMA 1W2XA 1N6FA 3GF3A 2GTRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JCT A;  3BEZ A;  4I4Z A;  3U9T B;  4JFC A;  4JYL A;  5E0N X;  3WG5 A;  3K8X A;  4JJT A;  3H81 A;  5JBX A;  2W3P A;  2UZF A;  2A81 A;  3U9R B;  3V5E A;  3U9S B;  5DL1 A;  1HNO A;  5DUF A;  4F47 A;  2F9Y A;  1UYS A;  4KWB A;  5G1Q A;  4FN8 A;  3MOY A;  3GLM A;  2VSS F;  4JVT A;  4MXI A;  4U19 A;  4OLQ A;  4LK5 A;  3TVU A;  4RYF H;  3N6R B;  3OME A;  1YG6 A;  4ZDB A;  5KJP A;  3H0S A;  4I52 A;  3I47 A;  3SLL A;  5JBW A;  2D3T A;  3G64 A;  1Y7O A;  5FIF A;  4K29 A;  3MYB A;  1FC9 A;  2ZL2 A;  4B3J A;  1X0U A;  4MI2 A;  2HW5 A;  2CBY A;  3GF7 A;  4ZU2 A;  2VSS A;  2Q35 A;  3PZK A;  3H0U A;  3FDU A;  4KPK A;  5KDR B;  1XNV A;  3TVW A;  5DUC A;  3VIV A;  4ELX A;  5FUS A;  2F9I B;  2ZQQ A;  3HP0 A;  4U18 A;  2PPY A;  3Q0G A;  3KTH A;  4Z0M A;  1WDL A;  2IEX A;  1XNY A;  1JXZ A;  4ZDC A;  3MT6 A;  3LKE A;  3PE8 A;  5DU6 A;  2VSU E;  2FZS A;  1XO6 A;  4JWV A;  4U0H A;  2X58 A;  4G2R A;  3R6H A;  1FC7 A;  3H0Q A;  1TG6 A;  3QK8 A;  4JCR A;  3T88 A;  2C8T A;  5G1R A;  1ON9 A;  3HIN A;  1RJN A;  5DU4 A;  4ELS A;  5DKP A;  4FZW A;  3DJA A;  3P2L A;  3DOR A;  4I42 A;  1OD4 A;  2FBM A;  2J5G A;  3STA A;  4B3H A;  1SZO A;  2PBP A;  3BF0 A;  3LAO A;  5DU8 A;  4QIJ A;  2PG8 A;  1XX4 A;  4U0G H;  2CE3 A;  2F6I A;  4Q1I A;  5DZK A;  1DCI A;  4FNB A;  5C9G A;  1OD2 A;  3TRR A;  4FZW C;  1EY3 A;  4QII A;  5INI A;  2J5G D;  4WZ8 B;  2J5S A;  5KDR A;  4DI1 A;  2X24 A;  3OT6 A;  3P5M A;  3KQF A;  2NP9 A;  2F9I A;  4ZDF A;  4ZDE A;  4IZB A;  4EMP A;  4JCQ A;  2J5I B;  4IZC A;  1WZ8 A;  4OMR A;  1XNW A;  3TT6 A;  5IKL B;  3ZW9 A;  3PEA A;  2ZL3 A;  4YLH A;  5INF A;  3TV5 A;  4Q0G A;  1N6D A;  1UIY A;  1VRG A;  4ZDD A;  2QQ3 A;  3HLN 1;  4MOU A;  1N6E A;  4EML A;  2ZL0 A;  1PJH A;  3QXZ A;  1WDM A;  2DEO A;  3M6N A;  4HC8 A;  2VSU F;  1DUB A;  3QKA A;  2ZL4 A;  3IB9 A;  1UYT A;  3QXI A;  1NZY B;  5DZK H;  3ISA A;  2DUB A;  3T8B A;  3R9Q A;  4IZD A;  3QRE A;  3TDC A;  4RYF A;  2Q34 A;  1FC6 A;  1K39 A;  5DTW A;  4FND A;  3IBB A;  3R9S A;  3JU1 A;  4JCS A;  3ZWB A;  1RJM A;  3Q1T A;  1O8U A;  1HZD A;  1UYR A;  2BZR A;  4EMM A;  5G1S A;  1J7X A;  3NJB A;  3T89 A;  1K32 A;  1Q51 A;  3PGQ A;  3KTK A;  4JSB A;  1EF8 A;  2VSU A;  4K2N A;  1MJ3 A;  4L6W A;  3GKB A;  4QFE A;  1EF9 A;  3ST9 A;  4WCZ A;  3H0J A;  2EJ5 A;  3KTI A;  4GHN A;  5ING A;  3M6M A;  4GM2 A;  3R0O A;  4RCN A;  3KTG A;  2FW2 A;  1YG8 A;  5E0S A;  2J5I A;  5CTB A;  4FN7 A;  3Q7H A;  1PIX A;  2VSU C;  4WYO B;  2Q2X A;  3T3W A;  4ELW A;  3RSI A;  3L3S A;  3H02 A;  2A7K A;  1TYF A;  2F9Y B;  3GMA A;  2ZQR A;  2VSS E;  3QYR A;  4FJW D;  3NJD A;  2A7S A;  3P85 A;  4NNQ A;  3HRX A;  3ZWC A;  1SG4 A;  1NZY A;  1FCF A;  1WDK A;  3RRV A;  4FB8 A;  3ZW8 A;  3TLF A;  4OG1 A;  5DTP A;  3IAV A;  4K3W A;  1ON3 A;  3Q0J A;  4JOT A;  3R9T A;  3QWD A;  1UYV A;  4B3I A;  3V5I A;  2F6Q A;  3TZ3 A;  2VRE A;  3SWX A;  2VX2 A;  3QMJ A;  1HNU A;  4HNK A;  3FF6 A;  5CTC A;  4L8K A;  3RST A;  3BPP A;  3ZWA A;  4U0G A;  4KNP A;  2WTB A;  3K50 A;  4JYJ A;  3TT7 A;  5E0S H;  4KD6 A;  5MGB A;  5C90 A;  3OC7 A;  4NEK A;  4U1A A;  3T8A A;  4ASI A;  3HE2 A;  1Q52 A;  3KTJ A;  2J5I I;  3MFM A;  1W2X A;  1N6F A;  3GF3 A;  2GTR A; 
#chains in the Genus database with same CATH topology
 4JCT A;  3BEZ A;  4I4Z A;  3U9T B;  4JFC A;  4JYL A;  5E0N X;  3WG5 A;  3K8X A;  4JJT A;  3H81 A;  5JBX A;  2W3P A;  2UZF A;  2A81 A;  3U9R B;  4HDT A;  3V5E A;  3U9S B;  5DL1 A;  1HNO A;  5DUF A;  4F47 A;  2F9Y A;  1UYS A;  4KWB A;  5G1Q A;  4FN8 A;  3MOY A;  3GLM A;  2VSS F;  4JVT A;  4MXI A;  4U19 A;  4OLQ A;  4LK5 A;  3TVU A;  4RYF H;  3N6R B;  3OME A;  1YG6 A;  4ZDB A;  5KJP A;  3H0S A;  4I52 A;  3I47 A;  3SLL A;  5JBW A;  2D3T A;  3G64 A;  1Y7O A;  5FIF A;  4K29 A;  3MYB A;  1FC9 A;  2ZL2 A;  4B3J A;  1X0U A;  4MI2 A;  2HW5 A;  2CBY A;  3GF7 A;  4ZU2 A;  2VSS A;  2Q35 A;  3PZK A;  3H0U A;  3FDU A;  4KPK A;  5KDR B;  1XNV A;  3TVW A;  5DUC A;  3VIV A;  4ELX A;  5FUS A;  2F9I B;  2ZQQ A;  3HP0 A;  4U18 A;  2PPY A;  3Q0G A;  3KTH A;  4Z0M A;  1WDL A;  2IEX A;  1XNY A;  1JXZ A;  4ZDC A;  3MT6 A;  3LKE A;  3PE8 A;  5DU6 A;  2VSU E;  2FZS A;  1XO6 A;  4JWV A;  4U0H A;  2X58 A;  4G2R A;  3R6H A;  1FC7 A;  3H0Q A;  1TG6 A;  3QK8 A;  4JCR A;  3T88 A;  2C8T A;  5G1R A;  1ON9 A;  3HIN A;  1RJN A;  5DU4 A;  4ELS A;  5DKP A;  4FZW A;  3DJA A;  3P2L A;  3DOR A;  4I42 A;  1OD4 A;  2FBM A;  2J5G A;  3STA A;  4B3H A;  1SZO A;  2PBP A;  3BF0 A;  3LAO A;  5DU8 A;  4QIJ A;  2PG8 A;  1XX4 A;  4U0G H;  2CE3 A;  3BPT A;  2F6I A;  4Q1I A;  5DZK A;  1DCI A;  4FNB A;  5C9G A;  1OD2 A;  3TRR A;  4FZW C;  1EY3 A;  4QII A;  5INI A;  2J5G D;  4WZ8 B;  2J5S A;  5KDR A;  4DI1 A;  2X24 A;  3OT6 A;  3P5M A;  3KQF A;  2NP9 A;  2F9I A;  4ZDF A;  4ZDE A;  4IZB A;  4EMP A;  4JCQ A;  2J5I B;  4IZC A;  1WZ8 A;  4OMR A;  1XNW A;  3TT6 A;  5IKL B;  3ZW9 A;  3PEA A;  2ZL3 A;  4YLH A;  5INF A;  3TV5 A;  4Q0G A;  1N6D A;  1UIY A;  1VRG A;  4ZDD A;  2QQ3 A;  3HLN 1;  4MOU A;  1N6E A;  4EML A;  2ZL0 A;  1PJH A;  3QXZ A;  1WDM A;  2DEO A;  3M6N A;  4HC8 A;  2VSU F;  1DUB A;  3QKA A;  2ZL4 A;  3IB9 A;  1UYT A;  3QXI A;  1NZY B;  5DZK H;  3ISA A;  2DUB A;  3T8B A;  3R9Q A;  4IZD A;  3QRE A;  3TDC A;  4RYF A;  2Q34 A;  1FC6 A;  1K39 A;  5DTW A;  4FND A;  3IBB A;  4NAR A;  3R9S A;  3JU1 A;  4JCS A;  3ZWB A;  1RJM A;  3Q1T A;  1O8U A;  1HZD A;  1UYR A;  2BZR A;  4EMM A;  5G1S A;  1J7X A;  3NJB A;  3T89 A;  1K32 A;  1Q51 A;  3PGQ A;  3KTK A;  4JSB A;  1EF8 A;  2VSU A;  4K2N A;  1MJ3 A;  4L6W A;  5HUQ A;  3GKB A;  4QFE A;  1EF9 A;  3ST9 A;  4WCZ A;  3H0J A;  2EJ5 A;  3KTI A;  4GHN A;  5ING A;  3M6M A;  4GM2 A;  3R0O A;  4RCN A;  3KTG A;  2FW2 A;  1YG8 A;  2YJG A;  5E0S A;  2J5I A;  5CTB A;  4FN7 A;  3Q7H A;  1PIX A;  2VSU C;  4WYO B;  2Q2X A;  3T3W A;  4ELW A;  3RSI A;  3L3S A;  3H02 A;  2A7K A;  1TYF A;  2F9Y B;  3GMA A;  2ZQR A;  2VSS E;  3QYR A;  4FJW D;  3NJD A;  2A7S A;  3P85 A;  4NNQ A;  3HRX A;  3ZWC A;  1SG4 A;  1NZY A;  1FCF A;  1WDK A;  3RRV A;  4FB8 A;  3ZW8 A;  3TLF A;  4OG1 A;  5DTP A;  3IAV A;  4K3W A;  1ON3 A;  3Q0J A;  4JOT A;  3R9T A;  3QWD A;  1UYV A;  4B3I A;  3V5I A;  2F6Q A;  3TZ3 A;  2VRE A;  3SWX A;  2VX2 A;  3QMJ A;  1HNU A;  4HNK A;  3FF6 A;  5CTC A;  4L8K A;  3RST A;  3BPP A;  3ZWA A;  4U0G A;  4KNP A;  2WTB A;  3K50 A;  4JYJ A;  3TT7 A;  5E0S H;  4KD6 A;  5MGB A;  5C90 A;  3OC7 A;  4NEK A;  4U1A A;  3T8A A;  4J2U A;  4ASI A;  3HE2 A;  1Q52 A;  3KTJ A;  2J5I I;  3MFM A;  1W2X A;  1N6F A;  3GF3 A;  2GTR A; 
#chains in the Genus database with same CATH homology
 4JCT A;  3BEZ A;  4I4Z A;  3U9T B;  4JFC A;  4JYL A;  5E0N X;  3WG5 A;  3K8X A;  4JJT A;  3H81 A;  5JBX A;  2W3P A;  2UZF A;  2A81 A;  3U9R B;  4HDT A;  3V5E A;  3U9S B;  5DL1 A;  1HNO A;  5DUF A;  4F47 A;  2F9Y A;  1UYS A;  4KWB A;  5G1Q A;  4FN8 A;  3MOY A;  3GLM A;  2VSS F;  4JVT A;  4MXI A;  4U19 A;  4OLQ A;  4LK5 A;  3TVU A;  4RYF H;  3N6R B;  3OME A;  1YG6 A;  4ZDB A;  5KJP A;  3H0S A;  4I52 A;  3I47 A;  3SLL A;  5JBW A;  2D3T A;  3G64 A;  1Y7O A;  5FIF A;  4K29 A;  3MYB A;  1FC9 A;  2ZL2 A;  4B3J A;  1X0U A;  4MI2 A;  2HW5 A;  2CBY A;  3GF7 A;  4ZU2 A;  2VSS A;  2Q35 A;  3PZK A;  3H0U A;  3FDU A;  4KPK A;  5KDR B;  1XNV A;  3TVW A;  5DUC A;  3VIV A;  4ELX A;  5FUS A;  2F9I B;  2ZQQ A;  3HP0 A;  4U18 A;  2PPY A;  3Q0G A;  3KTH A;  4Z0M A;  1WDL A;  2IEX A;  1XNY A;  1JXZ A;  4ZDC A;  3MT6 A;  3LKE A;  3PE8 A;  5DU6 A;  2VSU E;  2FZS A;  1XO6 A;  4JWV A;  4U0H A;  2X58 A;  4G2R A;  3R6H A;  1FC7 A;  3H0Q A;  1TG6 A;  3QK8 A;  4JCR A;  3T88 A;  2C8T A;  5G1R A;  1ON9 A;  3HIN A;  1RJN A;  5DU4 A;  4ELS A;  5DKP A;  4FZW A;  3DJA A;  3P2L A;  3DOR A;  4I42 A;  1OD4 A;  2FBM A;  2J5G A;  3STA A;  4B3H A;  1SZO A;  2PBP A;  3BF0 A;  3LAO A;  5DU8 A;  4QIJ A;  2PG8 A;  1XX4 A;  4U0G H;  2CE3 A;  3BPT A;  2F6I A;  4Q1I A;  5DZK A;  1DCI A;  4FNB A;  5C9G A;  1OD2 A;  3TRR A;  4FZW C;  1EY3 A;  4QII A;  5INI A;  2J5G D;  4WZ8 B;  2J5S A;  5KDR A;  4DI1 A;  2X24 A;  3OT6 A;  3P5M A;  3KQF A;  2NP9 A;  2F9I A;  4ZDF A;  4ZDE A;  4IZB A;  4EMP A;  4JCQ A;  2J5I B;  4IZC A;  1WZ8 A;  4OMR A;  1XNW A;  3TT6 A;  5IKL B;  3ZW9 A;  3PEA A;  2ZL3 A;  4YLH A;  5INF A;  3TV5 A;  4Q0G A;  1N6D A;  1UIY A;  1VRG A;  4ZDD A;  2QQ3 A;  3HLN 1;  4MOU A;  1N6E A;  4EML A;  2ZL0 A;  1PJH A;  3QXZ A;  1WDM A;  2DEO A;  3M6N A;  4HC8 A;  2VSU F;  1DUB A;  3QKA A;  2ZL4 A;  3IB9 A;  1UYT A;  3QXI A;  1NZY B;  5DZK H;  3ISA A;  2DUB A;  3T8B A;  3R9Q A;  4IZD A;  3QRE A;  3TDC A;  4RYF A;  2Q34 A;  1FC6 A;  1K39 A;  5DTW A;  4FND A;  3IBB A;  4NAR A;  3R9S A;  3JU1 A;  4JCS A;  3ZWB A;  1RJM A;  3Q1T A;  1O8U A;  1HZD A;  1UYR A;  2BZR A;  4EMM A;  5G1S A;  1J7X A;  3NJB A;  3T89 A;  1K32 A;  1Q51 A;  3PGQ A;  3KTK A;  4JSB A;  1EF8 A;  2VSU A;  4K2N A;  1MJ3 A;  4L6W A;  5HUQ A;  3GKB A;  4QFE A;  1EF9 A;  3ST9 A;  4WCZ A;  3H0J A;  2EJ5 A;  3KTI A;  4GHN A;  5ING A;  3M6M A;  4GM2 A;  3R0O A;  4RCN A;  3KTG A;  2FW2 A;  1YG8 A;  2YJG A;  5E0S A;  2J5I A;  5CTB A;  4FN7 A;  3Q7H A;  1PIX A;  2VSU C;  4WYO B;  2Q2X A;  3T3W A;  4ELW A;  3RSI A;  3L3S A;  3H02 A;  2A7K A;  1TYF A;  2F9Y B;  3GMA A;  2ZQR A;  2VSS E;  3QYR A;  4FJW D;  3NJD A;  2A7S A;  3P85 A;  4NNQ A;  3HRX A;  3ZWC A;  1SG4 A;  1NZY A;  1FCF A;  1WDK A;  3RRV A;  4FB8 A;  3ZW8 A;  3TLF A;  4OG1 A;  5DTP A;  3IAV A;  4K3W A;  1ON3 A;  3Q0J A;  4JOT A;  3R9T A;  3QWD A;  1UYV A;  4B3I A;  3V5I A;  2F6Q A;  3TZ3 A;  2VRE A;  3SWX A;  2VX2 A;  3QMJ A;  1HNU A;  4HNK A;  3FF6 A;  5CTC A;  4L8K A;  3RST A;  3BPP A;  3ZWA A;  4U0G A;  4KNP A;  2WTB A;  3K50 A;  4JYJ A;  3TT7 A;  5E0S H;  4KD6 A;  5MGB A;  5C90 A;  3OC7 A;  4NEK A;  4U1A A;  3T8A A;  4J2U A;  4ASI A;  3HE2 A;  1Q52 A;  3KTJ A;  2J5I I;  3MFM A;  1W2X A;  1N6F A;  3GF3 A;  2GTR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...