3QKZA

Crystal structure of mutant his269arg akr1b14
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
315
structure length
315
Chain Sequence
TTFVKLRTKAKMPLVGLGTWKSPPGQVKEAVKAAIDAGYRHFDCAYVYQNESEVGEAIQEKIKEKAVRREDLFIVSKLWSTFFEKSLMKEAFQKTLSDLKLDYLDLYLIHWPQGLQAGKEFLPKDSQGKVLMSKSTFLDAWEGMEELVDQGLVKALGVSNFNHFQIERLLNKPGLKHKPVTNQVECHPYLTQEKLIQYCHSKGIAVIAYSPLGSPDRPYAKPEDPVVLEIPKIKEIAAKHKKTIAQVLIRFHVQRNVAVIPKSVTLSRIKENIQVFDFQLSEEDMAAILSLNRNWRACGLFVTSDEEDFPFHEEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldo-keto reductase family 1, member B7
publication title Structure of the His269Arg mutant of the rat aldose reductase-like protein AKR1B14 complexed with NADPH.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase
total genus 102
structure length 315
sequence length 315
chains with identical sequence B
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2011-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3qkzA00
4QR6A 5DANA 3S3GA 4WDUA 4HBKA 2PD5A 3UYIA 4FA3A 2PDXA 1EF3A 2PDGA 3CAQA 3RX4A 1YE6A 3GHSA 1US0A 3UGRA 2F2KA 3V0SA 1AZ1A 2CLPA 2PDLA 4JTQA 4RPQA 4PUWA 5C7HA 4PRRA 3T42A 1UR3M 4DBUA 3MB9A 2DV0A 2VDGA 2WZMA 2IPFA 4FALA 3F7JA 4LB3A 5LIWX 2IPJA 4GCAA 5LIUX 4GQ0A 3RX2A 4YVXA 3WBXA 2IQ0A 1PZ0A 4XZIA 3QKZA 3G5EA 3CAVA 4JIRA 1M9HA 1ZGDA 4XZLX 2BGQA 3DOPA 2ACUA 2ALRA 2PD9A 3EB3A 2IPGA 3DN5A 1RALA 4WEVX 2WZTA 2QXWA 1EL3A 4GIEA 2AGTA 3GHTA 1JEZA 3FJNA 3ONCA 5LIXX 2DUZA 2HVOA 3RX3A 3LZ3A 4JQ3A 2PDPA 1LQAA 4ICCX 4XVEA 3COTA 3MC5A 4IGSA 3R7MA 4JTDA 1IEIA 5M2FX 4YS1A 2R9RA 4XO6A 3CV6A 4NKCA 1Z3NA 4PR4A 2PF8A 2P5NA 3LQGA 1X96A 4QXIA 4WDTA 3M4HA 4H8NA 2PDCA 2FGBA 4IJCA 2HE5A 4JIHA 4JIIX 1EXBA 5AZ0A 4WDWA 3LEPA 2F38A 4XAPA 3WBWA 1YNPA 3CV7A 3NTYA 2IKHA 2PDWA 2FZDA 2NVCA 3UG8A 1S2AA 3Q65A 1T41A 3C3UA 4XK2A 3GHRA 3WBYA 1Q5MA 1MI3A 1XGDA 1FRBA 4JTRA 3V0TA 2HDJA 3D3FA 4HMNA 3H4GA 3H7UA 4QBXA 2I17A 2ISFA 3M0IA 3UZWA 4L1XA 4WDXA 4WRHA 2PDKA 3LD5A 4GQGA 4LAUA 2PDBA 3BV7A 4GABA 1AH4A 3WG6A 3BUVA 4Q7BA 4H7CA 4LBRA 2PDIA 1VBJA 4XZMX 3KRBA 2HEJA 2PDJA 3BURA 1MZRA 4L1WA 3LN3A 1MRQA 1S1RA 1AH3A 4R9OA 4QX4A 3R8GA 2A79A 1RY0A 1S1PA 4GA8A 3H7RA 1ZSXA 3R94A 3R58A 1VP5A 4JQ2A 4F40A 2FZ8A 1ZQ5A 4AUBA 3GHUA 3P2VA 2PDUA 2ACSA 1PWLA 3R8HA 4MHBA 4FAMA 5LIKX 2PDFA 2I16A 4DZ5A 4ASTA 3V0UA 3CMFA 4JQAA 1GVEA 4EXAA 5JH1A 1XF0A 4JTCA 4YVVA 4DBWA 2PEVA 1QWKA 5JH2A 3UZZA 4XO7A 2PDNA 3EAUA 5KETA 3R6IA 3N6QA 3LUTA 2HV5A 3LBOA 2PDHA 2HE8A 2BP1A 3UZYA 1S2CA 2FVLA 1PYFA 4LAZA 2DUXA 3UFYA 4IJRA 3V36A 2IS7A 3LQLA 3LZ5A 3EB4A 3ONBA 2IKGA 4EXBA 2FZBA 1AFSA 4JQ1A 2PZNA 1K8CA 1OG6A 1RY8A 3LNMA 1IHIA 1HQTA 2J8TA 2R24A 4GACA 4XVDA 3O0KA 2FZ9A 1PWMA 3Q67A 2HVNA 5HNUA 1LWIA 2IQDA 1PZ1A 2INZA 1T40A 2IKJA 2PDMA 4I5XA 1HW6A 4WGHA 2PDQA 4JQ4A 1YE4A 1EKOA 3CASA 3N2TA 1AZ2A 4JTAA 5LIYX 4G5DA 3UP8A 1Z9AA 1ZUAX 1X98A 4YVPA 1C9WA 3BCJA 3GUGA 1Z89A 3VXGA 2ACQA 4LB4A 2ACRA 5HNTA 1QRQA 5HA7A 2IKIA 3O3RA 1R38A 3FX4A 3WCZA 1SM9A 2PDYA 2BGSA 2INEA 4DBSA 2C91A 2NVDA 1Q13A 4YU1A 4LBSA 3LENA 4PRTA 4XZHA 4PUUA 4OTKA 4Q3MA 3B3DA 5AZ1A 3G1RA 2IPWA 3U2CA 3M64A 1YNQA 1X97A 1XJBA 4PMJA 1J96A 3R43A 4FZIA 3UZXA 1AH0A 3UWEA 4XZNX 2PFHA 1ADSA 4ZFCA 3ERPA 1Z8AA 3V35A 1A80A
chains in the Genus database with same CATH superfamily
4DZHA 2OLSA 2B7OA 3ZVHA 1QPKA 2V2CA 1JF5A 1NSJA 3Q58A 2PDGA 3M0VA 4JIQA 2E28A 2ZRZA 1P6BA 5D38A 1XLEA 1YQ2A 4ZXLA 1S3TC 1DHKA 4NVTA 2V69A 3KBWA 1BVWA 4G7EA 2GZXA 4LRSA 1YKWA 3K8MA 1H41A 3CK5A 1Q65A 5D9MA 2YZ5A 5BCAA 1TSIA 4AWEA 4I6KA 4JIRA 2ZRWA 4ROPA 5A8PA 2W66A 2XGIA 1XPGA 5B7YA 3KVMA 4BCEA 3DN5A 1XRSA 4HMDA 5CPSA 1QNPA 3NGFA 3CZEA 5FI8A 1UR9A 2CNCA 4MUZA 3E12A 3THAA 1JQXA 3SBFA 4O16A 4Z0SA 1PV8A 3QKEA 3AAMA 2VX6A 4X2RA 2HVOA 2JALA 3VGHA 4GQQA 4ZVJA 3VNIA 2QUUA 3LX9A 2Y7EA 1L2QA 1XIIA 1YDVA 5CGMA 2QUNA 2A3HA 2NWSA 4NAFA 3H55A 2I9EA 3GTIA 3POHA 1OT2A 3AXXA 4J3ZA 4XO6A 3RR4A 2NQZA 1I2QA 3BXWA 3C8FA 1GQJA 1QTWA 2A7NA 3UJ2A 3DG6A 3QR1A 1R3SA 2C0HA 2VT0A 3G1AA 1TELA 1U2YA 1MMFA 3LB0A 1R2TA 3PZNA 2ZZ6A 1GTEA 4MTVA 3EPMA 4RV8A 2JQXA 3B9NA 3THDA 4LH8A 5EBUA 2JEPA 4EIVA 3TYCA 1J0YA 4F0MA 3LDVA 4H4IA 4LEFA 4LWWA 2XIIA 2ISWA 2ZX6A 5GVJA 3LLFA 1DP0A 3F4DA 4D6HA 3VKDA 1XKJA 1KQZA 1ITXA 1HKKA 2VZOA 1EJXC 5CJNA 3QMRA 4Q8UA 1NIUA 2VZUA 4UWMA 3CUJA 3BG3A 3CEUA 1XGDA 5LA0A 1VLWA 3MJMA 3M7SA 3QR3A 3EGJA 1X6LA 4RLIA 4Y9AA 4EK7A 3EDEA 3AS2A 4N2YA 4BF7A 3CZGA 3RPTA 3CV2A 1E40A 2CFFA 3TWAA 1FY6A 2VOTA 1TQXA 3W7HA 1XIJA 2C6QA 1R47A 1UKPA 4D8ZA 2W5FA 4O18A 1UKSA 1H60A 3LS9A 1H1ZA 1VBRA 3AI0A 3PZVA 2DSZA 3LRLA 2B31A 4KEMA 1QXLA 1FA2A 3FSTA 4QIUA 4C6FA 2WMHA 2DZAA 2VURA 1B1YA 4I7VA 2GGIA 3OW1A 3TN4A 2ZUSA 4B5VA 4CN4A 2WBKA 3FGCA 1AJ2A 3MKVA 3N2OA 3VGDA 3PF3A 1H49A 2CHRA 3GH4A 1UQZA 2DPEA 4ZB2A 2BY3A 4QHRA 3P74A 1S1PA 3N6HA 3W88A 3EPOA 3UZJA 3TJIA 5F4SA 4ZE4A 3GVVA 3H54A 1ODUA 3LV6A 3BVJA 1DE6A 4WGXA 3DFPA 5A6BA 4O1CA 5AYZA 3KL3A 2V8ZA 4JHOA 3TMLA 2ICSA 4FLQA 1WDRA 1N8IA 2E6YA 2HWGA 4HHLA 1RPXA 1CGWA 4JBRA 1RPKA 1JAKA 2CLIA 4JQAA 4GUHA 3R10A 3O63A 4LYRA 1R3VA 3M5VA 5HATA 3T8LA 3LI0A 4LTSA 5KETA 2FDSA 1E4IA 4JGDA 2GJLA 3A4JA 3FK4A 1DE5A 1EJWC 3QZAA 4OOUA 1QR7A 1C7TA 5C9XA 1PYFA 4DPPA 3FCPA 4EKJA 4HK6A 1J2BA 2B7QA 2V2DA 2PI6A 3PG9A 4X0NA 3MBFA 1BWVA 2IS7A 3LQLA 3VKAA 2ZYFA 4A8RA 1VFUA 3M5YA 4TUFA 1ISWA 1UC5A 2D23A 1HIZA 1PJ9A 1UYQA 4BWLC 4DF1A 2XIMA 1IT8A 1HX0A 2BXZA 5K9DA 3ABQA 4DJDD 3KBJA 4IPNB 3KXQA 1NOFA 3CH9A 4US5D 4MYAA 2AOSA 1XIDA 2OKOA 4Y90A 4RCXA 3U8GA 3VOIA 4OGZA 3TXVA 1JYVA 3R4IA 4HMEA 3CLWA 3IIPA 1NARA 1W5OA 5AHNA 4CQ8A 3U48A 1SQ7A 4JTAA 2CLOA 3CMJA 3SCSA 1FWJC 5HMSA 3EPNA 5IDZA 4KIEA 3ABOA 3VXGA 5I3IA 1T8XA 4PMZA 4YYCA 1GK8A 1DOSA 1TMQA 4DNHA 3T9PA 3N04A 1QRQA 2XSAA 2VCCA 2OT0A 2PAJA 3FX4A 2YCIX 1G1YA 4K8HA 2V5KA 3T2PA 1XYBA 1JD7A 1R46A 4PMQA 2YL8A 3GQYA 3ZR4A 1QI0A 1K1DA 4MPKA 1M6JA 3WUBA 5AECA 2AGKA 1FUYA 4NNCA 1CCWB 3CM4A 1SO4A 5JUVA 4UR9A 3O6CA 4JKMA 3UCCA 1EBHA 4PUKA 2ZFAA 1HL8A 3WBEA 1WUEA 3DFSA 4LGXA 1GQLA 1V4YA 2E8YA 2OXNA 3I6RA 3L4WA 5CH9A 5EMKA 2OKTA 3VNMA 3RDKA 1OM0A 2PCEA 3N4EA 4AIEA 4REQA 3PPGA 4DYJA 5HR7A 3NO5A 1DXFA 3GNXA 1EGVA 1XGEA 2C13A 4N4PA 1E6QM 3OGSA 3OPSA 5CPQA 1H3GA 4GQRA 4JTQA 2FGLA 1R3WA 3VNKA 3MB9A 3NNTA 1RSCA 2RDUA 1GZJA 3IVUA 2JBMA 5E1QA 4B3ZA 1BAGA 1TZZA 4GI8A 6ALDA 3B8VA 3GVRA 1H7PA 5KMYA 3BCFA 2FVKA 1K3UA 4JNMA 4BQ5A 3BAXA 4NZ4A 1LRQA 5I3GA 5K2ZA 2ZUWA 3W6YA 2OVLA 2D22A 2BHUA 1QI4A 5FIPA 3UJRA 3GG1A 1L8NA 4M7TA 3N2XA 1LT7A 4HJFA 4XBJA 1UWRA 4BHYA 3BW2A 1P5BA 3QW3A 3QQ0A 5J5DA 1LQAA 1TX2A 1DWGM 1V03A 5H91A 3H53A 5DCEA 4DYKA 1TPC1 4ADUA 1P1XA 2TODA 3R7MA 1TTJA 3ANUA 4L6DA 3B0XA 1HN1A 4J3XA 1KBLA 4PMNA 2NQ5A 2YR1A 4S3CA 2OODA 3LQGA 1U30A 1E43A 3W38A 4O28A 3PBWA 1E5NA 2HRWA 1F3EA 4JIHA 2NZLA 3EXSA 1RJQA 2ZZ3A 4KEUA 4J40A 1TPFA 2D3NA 5GJPA 4KCWA 3HMJG 5AC6A 2PTZA 4NZ1A 4V33A 4I9AA 2FZDA 4O0ZA 2WW5A 3IAQA 2PP0A 4L65A 3NDZA 4D6EA 1M5WA 1CLVA 2PC8A 1J8VA 2V6AA 4Q8NA 3KBSA 4MJMA 2GUBA 2Y7GA 3AMKA 3K1GA 4NZ5A 3ALFA 4DWDA 3LK6A 2E3ZA 1LUCA 4JTRA 1IEVA 3E5PA 4XUYA 3OZPA 4POCA 4XD3A 1XIMA 1Q6CA 2TRSA 2VC9A 3F4CA 4JHMA 2I17A 5EMMA 1KM2A 1GCYA 2JKAA 5A6KA 4CNTA 1CXHA 2VOMA 5CZSA 5I23A 2GK1B 4WRHA 3LLDA 5HBFA 2XZ9A 4LAUA 2PDBA 5DRIA 3BV7A 4DY1A 3BUVA 4S3KA 1WXZA 5H6HA 4H9XA 1N7KA 4HB7A 4ZGYA 4AIOA 4IISA 2EPMX 4M6VA 4D6DA 1UB3A 1O5KA 1SGJA 3UVIA 1S46A 5JBEA 1WOAA 1VS1A 3PFRA 3WQOA 4F40A 1EZWA 1KFKA 3OQ8A 2X09A 4PMOA 4HNLA 3LXBA 3OBEA 3SJ3A 2QYGA 4AZ5A 3TAOA 2BY1A 2EKCA 4MHBA 4K37A 3RLUA 3RYSA 4B2DA 1OVDA 1XLGA 4QP0A 4E6MA 3MUIA 5CLWA 1KFBA 4AX7A 3EYPA 4GI4A 3MMWA 2VCAA 1D7FA 1QNRA 1DWIM 3K4DA 4J27A 3BW4A 3QLDA 1JCJA 3GAYA 3QMTA 4N9CA 2PDNA 3R6IA 3II1A 1FP8A 1BFNA 1Y5XA 4RE0A 2HV5A 5BRPA 3LBOA 3U9IA 3BH4A 2PLCA 2POTA 3KFTA 2P8CA 2Y24A 2D2HA 4ATLA 4IJBA 3IJLA 5HQEA 1NFBA 3G77A 2BTMA 1EA0A 3GU9A 5M5DA 4QQUA 3L4UA 4N9EA 5LA2A 3VDBA 4I9JA 3PZMA 1MRAA 4P7OA 1ZBKA 3WUFA 4FR1A 4MGGA 2VGBA 2WJDA 4JXCA 3DFQA 1YYAA 4HNNA 1IIHA 3TTOA 1CBGA 3WK3A 1PWMA 2EGZA 3M16A 1UWQA 4GWEA 1B9ZA 4K6AA 3NZQA 4WLCA 2PWUA 4O1FA 4G56A 2G97A 2VGIA 3B06A 1FH7A 3IVSA 5ABFA 1HL9A 4Z1DA 4PTNA 3W01A 2WM1A 5CXPA 3W4RA 2P50A 3AU6A 4GMEA 5DMLA 3TCEA 3R89A 3FJ4A 1IIGA 1GHSA 1TA3A 1DVJA 1X98A 1K9TA 3BCJA 1H1NA 4S38A 1R3TA 1X8CA 2OEMA 1UR2A 2DU2A 3FS2A 3MPGA 4S3BA 3GYEA 1FCUA 1J01A 2P8BA 3V4BA 4Q4MA 3HIJA 3USZA 4HYWA 4K7VA 3SUVA 3WN6A 4GH3A 4MAZA 5A2CA 3LENA 2CBJA 4XZHA 4OTKA 1W9VA 4QFUA 2WVVA 2J6XA 4UTFA 3B0YA 2WSYA 2QCDA 3RU6A 4RX0A 4L1GA 3M64A 4AD0A 4PMUA 3W74A 1XJBA 3LGGA 2VFHA 2DQXA 1DPMA 2OT1A 1GW9A 1RJPA 2PWHA 3L9CA 3HO8A 3W53A 4B5UA 2ZZ7A 3ZLHA 1W6TA 1JXJA 5CGQA 1BVZA 1UD3A 1WUFA 4FX7A 3GH7A 4HPXA 4YN5A 1EA9C 2B0MA 4J3VA 2F2KA 4W8BA 2CLPA 4P8VA 1VFLA 3CYVA 2H6RA 3LI1A 4M5PA 4KFPA 1BD0A 2Q6ZA 3GIYA 5FJUA 4GBDA 2WPGA 3EZ4A 3NDOA 3SJNA 4MKVA 3PZUA 1HGWA 3UU0A 4C5YA 3E0IA 3S6TA 3WNOA 1ITCA 1S2TA 4Q8QA 2CLMA 5AC5A 1TRDA 2E9LA 1BG9A 2TAAA 1OCBA 2KAUC 4JFUA 4QLKA 1XGZA 3KTSA 3QY7A 2XFWA 1GQKA 1I2RA 1TIMA 3IJDA 3A5VA 2FHFA 3S1GA 2WVUA 2J75A 2AGTA 4FK9A 2PODA 1CXKA 4A35A 1E6XM 5BMWA 4IQJA 1ZJIA 3ME3A 4DQWA 4QTGA 2B4GA 3T7VA 1YBQB 3S1XA 4J2MA 4WOZA 3SCNA 1R7AA 1RLCL 7ENLA 3NQFA 1W3HA 5M2FX 1UD4A 1V7AA 4IXHA 1TJRA 1O5XA 1E0UA 3MA8A 1EWDA 1V3LA 3KCJA 5FACA 4NKCA 1W9UA 4BFAA 3DFNA 1C8QA 5LYRA 2R82A 5AVHA 1PPIA 1TFVA 4XAFA 5CC7A 3NOYA 5E09A 2OYLA 1E9LA 5GJMA 2FGBA 4YWSA 1UJQA 3W9ZA 1R85A 2ZXDA 1Q7QA 4HQVA 1JDDA 3L5MA 1ODZA 1A4MA 1F61A 2FH8A 4WDWA 5TIMA 5DY2A 2QV4A 3U57A 3LHWA 2QVHA 1KTNA 2YYTA 5T8GA 4HN8A 3CIVA 3WK2A 5F2GA 3Q65A 3N14A 2HXUA 3VX0A 3SAZA 2YDRA 4UFKA 3WQEA 2YW3A 1DJNA 3L12A 3NQ7A 4ZB0A 3PZGA 3W2KA 1VFTA 4UOJA 4JNZA 3S0CA 1CW2A 3I4KA 4JEJA 1SW3A 3PZ9A 1EP1A 4JTUA 3NG3A 2H8XA 1DWHM 3EXRA 4A21A 4X3ZA 2DT0A 4NQ1A 4YJ5A 3EB2A 4TTGA 1B2YA 3SCOA 3UWWA 4UTMA 1MW3A 3H7UA 2Q09A 3BL3A 1N8FA 4R33A 1V79A 3FJLA 1BSIA 5FESA 1W0MA 3OLIA 1YMYA 5GQBA 1XCWA 1FDJA 3VINA 4R53A 1S5MA 1W9BM 1DORA 4QJ4B 2OYMA 4UIOA 1FCQA 3CAWA 3U4AA 2QJMA 3BMWA 5T9CE 3LXAA 1EP3A 4MNKA 4IH3A 1P48A 3UCQA 4TVUA 3W75A 3KBNA 3OGRA 1O68A 4JTTA 4CNSA 2GDQA 1XIEA 1W37A 4OKDA 3RRAA 5CZTA 1HGYA 3MDWA 1A5MC 4QJ3B 4AAJA 1FWGC 4F0HA 4MVAA 2H9AB 1QMLA 1XPYA 3B0UX 4XBSA 1WV2A 3WNPA 4H6QA 4M56A 9RUBA 1VIZA 2VUNA 2L5HA 3BLOA 4C6EA 3NUKA 3WZ0E 4EWJA 5DBUA 4MNMA 1XF0A 1GJUA 2A3EA 3AYSA 5D2WA 3B05A 1SZNA 1S5WA 5M03A 2O4QA 3GTFA 4INFA 4KS0A 2YJQA 3LUTA 5EPDA 1K6WA 1UMLA 3OYXA 1BRLB 4TMCA 1EUAA 5ECVA 1KM5A 4H6EA 3TQPA 1WA3A 3SRHA 3UWZA 3OO2A 4RXFA 1H50A 4CD7A 2XIBA 1CENA 2X8RA 3JVAA 1XLJA 4FNSA 1TR9A 4W93A 3PUEA 4HNCA 5F1UA 1E0TA 2FZBA 1AFSA 4JQ1A 2DT3A 4P2VA 4RDYA 4XVDA 3HPZA 4LVGA 1ONWA 2UY4A 1DHPA 3OA5A 3HURA 9XIAA 2ABAA 1EJ7L 2IKJA 2PDMA 5REQA 4LEQA 1UBSA 2CHNA 1W3LA 3V7PA 4CD6A 2WANA 3GLCA 3U2OA 1LL4A 4L5ZA 4JQ4A 2FKPA 4CCCA 3ZJ8A 3L23A 4GY7A 3N1AA 3ZJ7A 1D3CA 3VA8A 3SCVA 3DYMA 3IAPA 4CN6A 1HP4A 1VFFA 3W7NA 1W3IA 4PMRA 3P5ZA 4IP4A 3BE7A 1XLAA 4AY1A 5JU6A 1QT1A 5U4NA 2V5DA 3R0UA 3T78A 2UBPC 2C19A 3W86A 4F79A 5FEPA 4F0RA 9CGTA 3EOLA 2PDYA 4JTFA 3NSXA 4JPGA 4X61A 2XSXA 1MDRA 3GW3A 1U1UA 2NX3A 2WMGA 2PU0A 1FCBA 5D2VA 1TQJA 3C2YA 1HJUA 2OX4A 5G2HA 2D2OA 2GUUA 2E68A 5I5RA 3WIJA 1OEPA 4A8NA 1DWAM 4JKKA 1ZP3A 5DXYA 2VP8A 2G3FA 4LNYA 2PD5A 1ONEA 4BI5A 1EWEA 3UGVA 4H9YA 3T0CA 2PBOA 1HKVA 3ZWTA 2F6XA 2VD8A 4J2PA 3TP4A 4GC3A 1AUSL 4S2CA 5FF3A 1W8GA 1FWDC 2AQOA 3LYEA 4V15A 2DZVA 4RKAA 2ZRUA 2VDGA 4FX8A 3RAOA 4GXWA 2VD9A 3QQ1A 3F7JA 3NSNA 3A3HA 4LC8A 2XH0A 3L2IA 1EO7A 3NPUA 1Q7ZA 4XTIA 4YMZA 1EYWA 3WBXA 2QVNA 4KWSA 3QKZA 3WMLA 1UR1A 5I3HA 1GVRA 4M19A 1S2WA 4U33A 2OEKA 3F4VA 5LHFA 4LVFA 1OT1A 3LXCA 1K7EA 2BV9A 3IUHA 4IQEA 2O55A 1OD0A 2DH2A 2YCLB 3PBYA 3ARWA 1HVXA 1PKNA 2C0AA 1JEZA 2GQ9A 3BQ6A 3E0WA 1XLKA 3QSTA 2XGZA 1XBYA 1M41A 3QHMA 5GPRA 5D02A 3BLEA 7XIMA 1EDTA 4PGLA 2VENA 3DC8A 4UNLA 3VOHA 3BSHA 1CTNA 2R9RA 3AS1A 3SEPA 4WXYA 2RJGA 3CV6A 4JX6A 1Z3NA 2RH9A 1SFTA 3S1UA 3R2GA 3VFLA 4U31A 4LT9A 4A8IA 4F0SA 2FFIA 1T96A 5JMUA 4AVOA 3KTCA 4PA8A 4QDPA 4AH7A 4LV4A 2BASA 4NZFA 2QJNA 2PP1A 4AVFA 3WLHA 1PDYA 2HS6A 1RD6A 5BZAA 1EQPA 4GO9A 3IGXA 2F2HA 2WMIB 4DO7A 4JL2A 3HV9A 4GIYA 4AQLA 3A64A 3V5CA 1JFXA 1KFLA 2WCAA 3OVGA 2J7BA 3B0VC 2HDJA 3O6YX 2BXYA 3WJSA 3KRUA 4HSNA 3AS3A 1KV8A 3KUMA 1I1WA 1SUXA 1XH0A 2YXOA 1L6WA 2Z00A 1CGYA 5E9AA 3EWYA 4XG1A 3KWSA 4FSAA 2VRKA 4KETA 4W88A 1P1MA 1KRBC 1HJXA 3TYDA 4WXZA 4WF7A 3E0FA 4ADSA 1A3WA 3VE9A 2P76A 3GNRA 1M7OA 2EPOA 4BA0A 4CD8A 3FA5A 3TYUA 1A4LA 1F9CA 3U6WA 2PDIA 1BHGA 2RFGA 5EY5A 2X1TA 3C3NA 2NQHA 4O1BA 1AH3A 4NG3A 3G24A 5HQMA 3QGKC 1S38A 3C0QA 1RY0A 1K7FA 2GVGA 4GUJA 1YIXA 1GOIA 5HXMA 3WMBA 3H21A 1W56A 1C3FA 1VD6A 3XIMA 4L6OA 1OBAA 4DZIA 3LOTA 4TQTA 3TIMA 1SJBA 3ARUA 4O17A 3WUEA 3TFXA 3RMEA 1XQLA 3WLPA 5C7VA 3C61A 3PFMA 2ACSA 2PUZA 2CBVA 1GEQA 1ITQA 2Z0IA 2VQTA 4TU1A 4IG2B 5AC4A 1XRTA 2BX7A 1R2SA 1XV8A 4KF1A 5BWAA 3NO3A 2DGAA 3P80A 5TD4A 3WFAA 4AZHA 4DBWA 4YCOA 3VU2A 1OFBA 3EX2A 2XH2A 3M44A 1ISYA 1WKFA 4CQAA 1X7FA 3QEZA 4JX5A 4E2OA 1J18A 3OB8A 1ALDA 2XN2A 1NF7A 1PS9A 5HAOA 4N42A 4I7UA 4DXXA 3RG6A 2DUXA 2XVPA 3IVTA 1WZAA 3M5XA 1PO9A 3RGTA 3GO2A 2QDEA 2P88A 3G1HA 2E6DA 1W91A 4OT7A 4XIMA 1VYPX 3GB6A 1GJWA 1TV4A 3BW3A 2Y4SA 2WJFA 3OTRA 4NJIA 4B91A 1SFJA 3VD3A 4H3DA 1XICA 3IS4A 3QFWA 1XCXA 3O0KA 4KESA 1UR8A 4NJGA 1EO5A 1LP6A 1VFOA 2A3CA 3TSMA 1ICPA 2I14A 4G2DA 3CGTA 1K03A 2F6KA 3ISIX 1Q7MA 2G50A 4NJJA 3R1ZA 2BFGA 4FXRA 1KCLA 4AEOA 3TW6A 1GOOA 3CIXA 1OZQA 1RP9A 5GNXA 4Z2JA 2J7EA 3QLLA 3WLLA 4PB3A 1JQVA 4DZAA 4MNLA 4G5DA 2QDGA 2D73A 2ZDSA 1G4EA 1PIGA 3UT0A 1IWAA 4U2YA 2VI0A 3S42A 4A3HA 1J2WA 4IXXA 5T26A 3W7QA 1YNYA 4C6LA 4Y8EA 4JYEA 4UTWA 4MKNA 2VDHA 3PANA 3W2MA 1TV3A 4UZSA 1SO3A 4XKMA 1A47A 5B80A 1BG4A 3M0XA 3O05A 1QNVA 1XYFA 1BKHA 1M7JA 1ZAIA 1OYBA 1XRFA 3C4UA 2X7WA 3ANYA 4IUOA 2JEQA 3R43A 4FZIA 2OTDA 2E9MA 3RR1A 5HPOA 3W07A 2PFHA 1L6SA 4ZFCA 4AXNA 5HJYA 3WELA 3VCCA 1X1ZA 4JTJA 5HANA 3S3GA 3UYCA 2QJJA 4WZHA 3I7SA 3CB3A 4FA3A 4YTUA 3WSUA 1E71M 3PBUA 2PDXA 3CAQA 3G1XA 4MADA 1JYWA 1US0A 3SB0A 1JUKA 3CZLA 3IPWA 3LTYA 4X2PA 1S5TA 2HBXA 3GK0A 3T0TA 1AD1A 3PTQA 3MUXA 5L9FA 1KCXA 4E8CA 1OADA 3IACA 1UR3M 3WEOA 4EF9A 1FWAC 2CW6A 4HNTA 1W5PA 4PFHA 1UR0A 1VJSA 4LY4A 3W1PA 1VIWA 3IRDA 1XW8A 3K13A 1WXJA 1YRRA 1LWJA 3NA8A 1GVOA 1VGAA 5AN7A 5BU9A 5D4YA 1P4CA 3E02A 3VZZA 1EHNA 3P84A 3G0UA 4GOAA 2JF7A 3H8AA 1DL3A 4XZWA 4ATWA 1O66A 4GIRA 4ML4A 3VDCA 3Q45A 1I4NA 1PUDA 3QZ6A 5ABEA 5C54A 2I9UA 5JXQA 3LZ3A 4NRRA 5A69A 3N9KA 1WAUA 1CECA 1Y5WA 3GC4A 1XLCA 1W1YA 4KFOA 3UPMA 3QYQA 1W3JA 3C8NA 1VEPA 4AZGA 5XINA 3R8RA 3OLDA 4D6CA 4NHVA 1THFD 2OQHA 1LLZA 3WDRA 2UV8G 3FA4A 4WDTA 4Y2WA 3HGSA 3E96A 5AZ0A 1DWFM 4V1XA 6TIMA 5A6LA 3W37A 4L56A 1HKJA 3S83A 3GDMA 4LPCA 1UHVA 2V3DA 1IF2A 2Y89A 2VX7A 1B5TA 4N0RA 1NAL1 4RZ6A 3U2ZA 3GFXA 3GHRA 3EX3A 2R1PA 3M0JA 4Z1CA 4XSMA 2VNCA 1BRLA 3N11A 4ZA0A 1ZJAA 2V2HA 1QJWA 5LGZA 2E7FA 3RM9A 4ZO8A 1ELSA 1YTKA 1UIPA 2CLKA 4U4MA 1F76A 2RDXA 4KCTA 1GPWA 2REQB 1FWCC 3Q37A 4MB5A 1HNYA 3WH8A 1M68A 4WDXA 4IGHA 1QPRA 1T7LA 2NQLA 5FJRA 3EMCA 2ADAA 4K39A 4GABA 1YTDA 1UH2A 4L61A 1MDLA 5BRBA 4WK9A 2F9RA 1AQFA 2WHLA 2VMFA 2G3NA 3LHTA 1TB3A 1EIXA 4IMGA 3NDYA 2E5BA 2QT3A 5DEZA 1C93A 2FFCA 4CLMA 4DPQA 5I24A 3JZUA 3ITCA 1ZBCA 2GOKA 2QF8A 4UTJA 4AX6A 4A05A 4TMBA 3KTXA 1XD0A 3CZ8A 5DLCA 3I6EA 4GXMA 2DORA 1KFCA 4GYKA 3M43A 3P2VA 3UZ5A 3BK0A 3DESA 3UPBA 5LZLA 1H7NA 4JEQA 3WD4A 5KZMA 3WJWA 4FXJA 1WDSA 1ZTVA 5CQ1A 4F9JA 2Z7GA 4E0CA 1QOXA 3OZMA 1O7AA 3WF1A 5CG7A 1QATA 4QG9A 3EAUA 2ANUA 3G18A 3QC0A 4LUIA 4KIRA 1OABA 3LCIA 2VTFA 1H2JA 5HJLA 3TH6A 2IW0A 5A3HA 4GLEA 1P6WA 2BMBA 3AUJA 3UXKA 4C6PA 2Y88A 2R94A 2CZEA 4E3TA 2YBTA 4UR7A 4H9TA 3KWXA 3ZO9A 4AD2A 1OC5A 3QVQA 3TMQA 3WQFA 3VAVA 1A53A 3KP0A 5J5RA 1JPDX 4HOZA 4KCVA 4M51A 1JZ7A 4QSFA 1TWWA 3VIFA 1TJ1A 4QGCA 2J8TA 3LERA 3ANVA 4MDOA 1MEWA 5CPTA 4O10A 3JS3A 3EOUA 4ES4A 3NYZA 3N13A 1XWYA 2O9PA 1V0NA 4WGHA 4GC4A 4BF5A 2PDQA 3FW6A 4GXPA 1QO5A 2ZRXA 1PIIA 1JPKA 1VFMA 3CASA 1I60A 4EPEC 1TMHA 3G1YA 1H1YA 1HFBA 3VUSA 3QFEA 5ABGA 4RXGA 3ZR6A 5CLTA 1SZRA 3DERA 4YCPA 2YCLA 2A0NA 1O1ZA 2GSJA 3FXGA 3V1HA 5HA7A 1XUUA 1H7XA 2VELA 3HA1A 3O3RA 2DT2A 4KPLA 4L4MA 4WY0A 3A47A 4IM4A 4F4RA 3GDLA 4W87A 2Z27A 4CN1A 4LBSA 3EDDA 3T0AA 4OUEA 1DEDA 2BNJA 2WC7A 5FEWA 4DUOA 4UTLA 1LZOA 4ZTYA 4JDYA 2WQPA 4DWSC 4XAYA 1E4LA 1YLVA 3LRKA 4GI6A 4B2DD 3AROA 4FF5A 1W17A 4AWUA 3UWEA 1SPQA 2EBNA 3WKZA 3VGGA 3TC6A 5JBDA 3Q4DA 1OGBA 4EANA 3LCLA 2ZWYA 3SN4A 3VI2A 3LCWA 2F8QA 3ZS4A 1VKFA 3KP1A 4C7DA 3TZFA 1PHWA 1EF3A 3I3DA 1QPNA 2PZ0A 2YDQA 3GVWA 4XX6A 3AXHA 4R34A 5HUOA 3VCNA 1W1TA 1PBGA 4ORIA 1YADA 4HK5A 4D9PA 3P62A 1W3NA 1L0PA 4M1RA 4X9YA 3W2NA 1U22A 5CJ5A 5IHRA 1UH3A 2QCNA 1DV7A 3M5ZA 4Z2LA 3SURA 1FWFC 4K8EA 4YVXA 5BOEA 1G6CA 1PZ0A 1V3JA 2JF6A 5EMLA 2A6LA 3G5EA 3KZSA 4O15A 4FF7A 4A29A 2XVLA 4DUVA 5C2GA 3O16A 1V5XA 1TVNA 3A3WA 2NUWA 3SY5A 2E40A 5JIPA 1D8WA 4W4QA 2H3DA 2QLYA 2VC7A 1BPLB 1S2UA 5DRCA 1H7RA 1F74A 2C18A 5A6SA 2X0SA 1ZNNA 4E8DA 3RX3A 4W8AA 2ZXAA 2X1SA 2XYLA 3STPA 3BAYA 5EYWA 3RO8A 5ENLA 3MC5A 3ZWSA 3AJXA 1FDZA 5I6SA 3T2OA 1W54A 3HQPA 1OG0A 1EC7A 1G69A 2ZKMX 4AWTA 1C7SA 2C1HA 3MVTA 4AU0A 3NZGA 3W29A 3RLHA 4BR1A 3VPLA 3TK7A 1LJYA 2WWDA 2DT1A 4Q32A 1KTBA 5E93A 4AG0A 1V93A 4RW3A 4IG2A 3TOYA 7REQA 8RUCA 4RV3A 2B7NA 2F38A 4HK7A 4LFYA 1RBAA 2O56A 1XDLA 4WKFA 4HCDA 4Q8PA 1RA0A 3URNA 4CU7A 5BMXA 1UKTA 3W7LA 4AHPA 2CCRA 4M8UA 3DUGA 1ZCOA 2GYIA 4HNUA 4KKXA 1TPUA 3MMUA 2INFA 6REQB 3ES7A 3VO0A 3EDKA 1D2KA 4CNPA 1FBAA 3GS6A 3W87A 1Q45A 3UG5A 3V0TA 3W7IA 4QE5A 2VEIA 2XHYA 3GAKA 1TO3A 3OU8A 3D3FA 4HMNA 2Y8KA 5G1MA 4MMWA 3N12A 4L80A 4HNOA 4U5IA 5HNRA 2RAGA 1PHQA 2GGJA 4XIAA 1LORA 1UD5A 3MW7A 4UOQA 3EWBX 3OIXA 4UQAA 3TJXA 3WG6A 1TG7A 3R79A 4TXEA 2V67A 2I56A 3IIOA 4QJ1A 5I7GA 4GVIA 3W2UA 3CL8A 3KRBA 4WVXA 4R3UA 3G8RA 2FVMA 4Z42C 3VX1A 4F2TA 5FD0A 1W5QA 1LBFA 3LMYA 4F2BA 1MWOA 4EVZA 4OVXA 1E51A 1WNOA 3W72A 4PB5A 2A3LA 3AYVA 4UTWC 2WNQA 4GYJA 3W1NA 4IIEA 3R12A 2AQVA 3GFZA 3WNMA 3DDMA 3T1GA 1FH9A 1SJDA 4X9SA 1PWLA 1O94A 3UJEA 2QJGA 2CZVA 3I7RA 3B40A 4FAMA 1SO5A 3GFYA 4JTIA 3SECA 1IXPA 4DZ5A 5EB8A 3ABRA 4DF2A 4B90A 2ZX8A 3DAQA 3BLKA 2OWXA 2ALDA 3UZZA 3DHDA 4XWUA 1HVQA 5JBFA 1MSSA 4QM1A 4TX8A 1XIBA 3L0NA 3ID7A 2HE8A 3LG3A 4MWAB 2WHMA 3BWWA 4WR3A 3AFBA 3CQKA 1XH2A 3HGRA 4O50A 1UWIA 1GUVA 5HUPA 1NTHA 3PHAA 3V36A 3PJUA 3ZOAA 4QISA 3UR2A 1Z48A 1REQB 2VM8A 4KEZA 2DY3A 3TTYA 3N17A 1AK5A 1H51A 3GVQA 5CBJA 4Q4SA 1UA7A 2J24A 4CEXC 4B5WA 1U5HA 2DZUA 2INZA 1QAPA 1V3KA 3S2MA 1E1FA 4HOWA 4QEEA 2BBFA 2XSBA 1US3A 3A12A 4DO4A 4Y7EA 2RUSA 1E72M 4W84A 4NF7A 5FL0A 5J8LA 2V81A 3VD7A 4K68A 1FQ0A 3FKKA 7TIMA 4Q22A 3QYSA 5C2CA 2AAAA 4QNWA 1AZ2A 3GKFA 2GPTA 4DI9A 5AC7A 1U5VA 4A3UA 3N9SA 3NZRA 4L4LA 5MHBA 4DM1A 1C9WA 4PSRA 1X38A 3CWOX 1V3IA 3CLMA 2VHLA 1GZ1A 4XTDA 2NQJA 2Z26A 5D2XA 4RE3A 1QOPA 2BOGX 2C3ZA 3DCPA 3VMPA 4ECLA 4HGXA 3A4XA 4JN7A 3FFSA 3W85A 3NPWA 1EEPA 1L6YA 3LM3A 2WK2A 3DG3A 3W27A 3GU1A 4IFOA 5E0KA 4IUGA 1W1VA 3T0DA 1SO6A 4U10A 5E5CA 4B3KA 1LWHA 4UQ9A 3DC0A 2CESA 3ITYA 1T6MA 2ZIDA 2E77A 3H22A 2FJKA 4XV0A 4EAYA 5E70A 4E4PA 4DRSA 4MKSA 1VFSA 2AKZA 3H2CA 4I3GA 3KW3A 1I6NA 1LRTA 4K8GA 5IOBA 1B3ZA 4KBXA 1E9YB 2BHYA 1ME8A 4WQ6A 4KWOA 3VMNA 3R0KA 5XIAA 2GDVA 3E0VA 5F2LA 5DANA 3QOMA 1F8MA 1WX0A 5HPCA 2QMKA 1ZY9A 3CQIA 1P0BA 4XAZA 3KOFA 3WFZA 2X05A 1SMAA 4ERIA 3VC5A 2NXHA 1QK0A 4YLWA 1JUBA 1B3XA 3WLRA 3AHYA 2H90A 4GH1A 5LGXA 3VZYA 4PUWA 4R7WA 3CUHA 3G3DA 5DFAA 1AJZA 4RL3A 4Y9MA 3BSGA 3PZQA 1NWRA 2IPFA 3F4WA 4V1YA 4ZO9A 2Z28A 2OG9A 4NU7A 1IEWA 3G6LA 2VYOA 1QI3A 2G4JA 3L65A 3SCQA 4GQ0A 4OV4A 2OSWA 1YX1A 2CITA 4JTGA 4V28A 5IRPA 1NM9A 1UZDA 1XX1A 1FWBC 3CAVA 4GNKB 5LNVA 4L6HA 3DOPA 3QV6A 5U7SA 2IPGA 1K6AA 5BU6A 1V0KA 4GIEA 4PTVA 4ZQRA 5E0FA 4A3YA 2Q3RA 1DXIA 1NH6A 3M0ZA 4J1OA 3AIEA 3SCPA 3RXZA 3UXAA 4ICCX 3PPCA 3H2MA 3IGSA 1RZMA 2FMOA 1QNSA 3MHUA 3CZKA 3GC5A 3RCYA 4LUYA 3VVGA 1OJXA 2P5NA 4G7FA 4QXIA 4DLMA 1DJQA 3W81A 1C91A 3WNLA 2OGJA 3PS7A 4Q8VA 4ZE5A 4V27A 1UP0A 3TTEA 1JNEA 1G0CA 1JVNA 1JDEA 1UBPC 3CPUA 1DYSA 2BOEX 1QVBA 3LCHA 4KCUA 3IJIA 4EF8A 3T40A 8XIMA 3NZ1A 2JIWA 2BVTA 2UY2A 1AQ0A 2FTPA 1KM3A 4UFMA 4PL2A 1F3WA 2RDWA 2JK2A 4O52A 4DJFA 3L5AA 1OWQA 1JG9A 1GVIA 2R14A 3FAXA 1FRBA 3PWIA 2V5JA 3ZXWA 2HNHA 1AVAA 2DZXA 3LCXA 4LOCA 4DYEA 1R3QA 5F4WA 2V38A 8A3HA 1KD0A 4PEKA 1CB7B 2ISFA 2IUZA 3WF3A 2AMXA 4M24A 3RU8X 3STEA 1FWHC 1H62A 3U0HA 2O7SA 2CBIA 3H12A 2NV2A 1XYCA 3UR8A 4GFSA 3BLDA 4LNCA 2G0WA 5KEZA 2YX0A 4H00A 3TU9A 1SVDA 2GL5A 3QMSA 1V3MA 5A6TC 4NAEB 4MOZA 4IX0A 2VDIA 4FLRA 2KX9A 2VEGA 3V75A 2PDJA 2AAMA 2KZHA 3OOQA 4H2CA 3AC0A 2YYUA 5D05A 1GHRA 4LF2A 4HYVA 5A5WA 1IWBA 5I78A 5FEZA 3W76A 2CERA 1MXDA 1OFQA 3SM0A 3VC6A 3BJFA 1OQFA 2WKLA 1KGUA 3SSZA 1TTPA 2Z6JA 3DGRA 3QM3A 4P61A 4IMCA 3AS0A 4LS1A 1J6PA 1Q6DA 1OK6A 2HPIA 4PUMA 3FVDA 4P8XA 3W73A 4UTUA 4PCNA 4WJ8A 4FXSA 4EOUA 1E0VA 1B3WA 4JCLA 1P43A 1A49A 2POZA 2XN0A 3VKCA 3SI9A 5CCZA 3UCDA 4ASTA 4IFRA 3W71A 3MV01 5JVLA 4C6CA 1VHCA 4P7RA 3V16A 1SMDA 5A8NA 3VD4A 3A9IA 3W1TA 2Q71A 2DJXA 2BP1A 4TX9A 2E5CA 3N4AA 2FIQA 1P7TB 4ZENA 3P3BA 3TKFA 3EOOA 3KCLA 4UFHA 3LHZA 1LBMA 4XB3A 2G3JA 1AODA 5IFTA 2IXVA 2V5CA 3Q2DA 1IHIA 3KOWA 2QR6A 3G1FA 3UVAA 3WH5A 3T05A 2FZ9A 4H8VA 2HROA 6TAAA 1EHAA 4C6NA 2DSKA 3CWHA 4RE2A 1HW6A 1LG1A 2R1NA 4PBGA 4EE9A 3NVTA 3HQ1A 4B5TA 2WPBA 2Y70A 1T5AA 1W2VA 3SCUA 1IQ8A 4HZ6A 2X0YA 1EOKA 3LTPA 3S5OA 2NLYA 2ZWZA 1LQ2A 1GKRA 3BZGA 3BOFA 1XYAA 4X0VA 3QTGA 4UQEA 3SUSA 1B3YA 1K70A 2BZNA 3OVPA 1XLIA 5G2IA 2ACRA 4AYGA 3U5YA 3WQVA 1TCDA 2HNEA 1KM4A 3QGVA 4KRUA 5CSUA 4B5XA 3KLLA 1IZKA 3M9YA 3PPHA 4M6QA 4D6FA 2OLAA 4X63A 2W6RA 2YLAA 5IDIA 1V02E 3ARZA 3AU2A 1F6KA 3MHGA 2C79A 3C86A 2NVDA 1GW1A 1OGSA 4M0XA 1MZHA 3W1QA 1CT5A 3BZJA 2Z29A 1PZ3A 2H3BA 5FCZA 3XINA 4Z0JA 3WLKX 2EF9A 2HTMA 4H41A 1TWZA 2OQYA 1MFUA 1FVPA 4J3WA 5FAGA 1NELA 3UZXA 3KCOA 1ADSA 3GTXA 2HCVA 2ZC8A 4UCFA 3CQHA 4HBKA 4GG9A 3T08A 1GORA 4MJ2A 1LYXA 1ZALA 3P5YA 5M1TA 2QIIA 2Z2UA 3QPZA 2CC0A 3QY6A 4RPPA 3MUZ1 1AZ1A 4RPQA 3SGUA 3VIKA 2PWGA 2W27A 3MQTA 2VZVA 3W1MA 5BYWA 3UBPC 1CWYA 2WZMA 3NJ3A 1UD6A 2NXIA 3PAOA 1VQTA 2X1UA 1Y8BA 4GCAA 4ACYA 4CD5A 3W1RA 4JFSA 3E2SA 4XZIA 2QEZA 3VDGA 3TOPA 1WXYA 4HHHA 1JUEA 2HVMA 3KBVA 3L5LA 2NLIA 2O0TA 3GNNA 4WSHA 1QK2A 4B5SA 2WZTA 2C14A 3ITOA 4U3CA 1KKOA 2PWVA 4XD5A 3DI1A 1ICQA 4EWND 1RUSA 4S2BA 3F5LA 3WLNA 1OFDA 2Y7DA 5CKSA 3VTRA 2DP3A 3WH6A 4CKQA 3CTTA 1HP5A 5AOUA 4AC7C 1J5TA 2A2IA 3VIHA 3VNYA 3UETA 3VK5A 2D0GA 3DU0A 1K7XA 4GISA 3WLJA 1LL7A 4KW2A 4Z1AA 3LPPA 1HKIA 3HG2A 3LTSA 4RZBA 4XISA 1NWUA 2I5GA 3BTNA 3D0CA 3GR8A 3ITLA 3HM7A 2O7QA 4XZ9A 3CYJA 2CETA 1OFPA 5IXEA 2PA6A 1KKRA 3JW7A 3SQLA 1UMYA 4XAPA 4LAOA 3GXMA 4FOUA 3MMDA 2VQUA 1UASA 3RHGA 1HKWA 1Q6OA 3TSBA 3ZZ1A 3CEPA 7CGTA 4JFTA 4LUSB 4QQ3A 3V18A 4GNVA 1ADOA 4RNIA 3R5EA 4XK2A 3E38A 4LUTA 4GVFA 2D0FA 4IIGA 4DN1A 1AW2A 2GJXB 4MWAA 4N4QA 1GEHA 2ZZ1A 1FWWA 3U7BA 1POKA 4CUCA 1MW0A 3IARA 5BRQA 3D47A 1W2PA 2HZGA 1QI2A 1C8VA 5G4EA 4ZOEA 2PWDA 4QBXA 3PNUA 1MXSA 3NVDA 3G3MA 1Q63A 3B4UA 2YLLA 1IR1A 3MS8A 1Y65A 4D1IA 1EDQA 1REQA 2PDKA 4GY0A 3KHJA 1WZLA 5AHIA 4L7ZA 2NV9A 4IPLA 1VJIA 4OE7A 4AFYA 1TVPA 3H70A 2X42A 3SN0A 3DBNA 4K7YA 3BURA 3DBPA 3KVKA 7ODCA 4FOJA 4RK8A 3MO4A 3RITA 3BJSA 1YPFA 3BPWA 3GTHA 3MO7A 4I7WA 3VKJA 3UA4A 2QUMA 1JD9A 3CH0A 4GUGA 5A8MA 2QMJA 1J10A 5I03A 3GBDA 3S2CA 2D3LA 5T9BG 5FF7A 3NFUA 2ZXQA 4TR9A 3GHUA 2J7CA 2CKRA 4IPJA 3NYDA 2C16A 3DH7A 2QUVA 2DSWA 4AVNA 4ACZB 3AXIA 1SZFA 3NR0A 1E55A 3BLPX 1T0OA 2D2GA 2PF0A 3UD6A 2WZIA 2QAPA 4QLLA 5DCDA 1F3TA 4H19A 1EGMA 1XFCA 3UXLA 2WKGA 6PTDA 2VVSA 4PUDA 1LOLA 2FVLA 1UIOA 1BTMA 3CUGA 4MUPA 4A22A 4G7EB 3WDJA 2Z7KA 1DJIA 3DX5A 3GIQA 2WSRA 3TC7A 5LKYA 4J35A 2Y62A 2CZDA 3N6JA 5I07A 2EAWA 2FB3A 3LZ5A 3MT1A 4F3HA 3HJZA 3IWPA 4ZSUA 4FNUA 4FLOA 2GGGA 5BXSA 2OELA 2PZNA 4O57A 2DFAA 3W1AA 1OF8A 4GACA 4FNTA 3D3AA 4MLJA 4BK9A 1HG3A 2QS8A 1C29A 2VWTA 3T44A 1OY0A 1VPQA 4I8YA 4TVCA 1RLDA 3GBEA 3H2EA 3NOEA 1RV8A 5D8WA 4N6FA 3WK0A 2E67A 1J0KA 4HN4A 3RUBL 3LV5A 4RE4A 4V2XA 4QROA 2O92A 1AL7A 3HQOA 1EX1A 1TPDA 1GYLA 3GUGA 1BLIA 1DJGA 5TBOA 3TDFA 4CVUA 4DBEA 2V30A 4ZQCA 2GUYA 1LBLA 2VZSA 3FSUA 1E70M 1O12A 4HA1A 3BC9A 2J9YA 1G4PA 1US2A 1WKEA 3M46A 1TE1A 2WMJA 4HOXA 1QBAA 3S5ZA 1QPQA 2VVNA 4PRTA 3CL7A 2XM2A 1A5BA 3HPAA 3AIUA 2FHBA 1HF6A 4AZCB 1D3GA 3KZPA 2FPTA 2ZVIA 1WKDA 3BLLA 2YIHA 1GOQA 5I02A 5TF0A 3W6MA 4AD3A 1OC6A 1E1CB 2X1RA 5H8PA 4XQ6A 1V77A 1B57A 1JJKA 1HXJA 2EO7A 2ZQ0A 4H7ZA 5C9WA 1TZ9A 2CIPA 1TPH1 5DELA 1BYBA 1VEMA 4PZVA 3B8SA 4DXKA 3TN5A 2O9RA 3NL2A 3DFTA 4DJFC 1UP3A 1KBJA 2Z2AA 4ALDA 3TV8A 2DDXA 3W7CA 2XVNA 4JTEA 3BANA 1UKOA 3I10A 1EIBA 4NIRA 3UWVA 2EJ1A 1Q66A 3EA2A 1XC4A 2UY3A 4WIWA 1H5YA 4LS0A 3DG7A 2ALRA 2J78A 1RALA 1CXFA 1R9YA 3B04A 1T99A 1GG1A 1FKWA 2QXWA 4BZYA 1GQNA 1EL3A 4NZJA 4JR5A 1EYEA 3ITTA 3U3HA 3VOFA 4I9TA 3GHTA 1R0MA 1TTQA 1IXQA 1I2PA 3WD3A 4NAEA 5I00A 1R2RA 2FJUB 1SW7A 1S2VA 8TIMA 2VC5A 2UWFA 4G6CA 2QCLA 3VFCA 4YWIA 3L68A 1JF6A 1XINA 1B30A 4D1JA 4YS1A 3S9ZA 4IFKB 3GR7A 3MCMA 4JDBA 3RJYA 4CGTA 1VF8A 1AW5A 2PF8A 3L4ZA 3ORWA 2A21A 4PULA 2R1LA 1F7BA 2D2JA 1DTUA 2EHHA 3M4HA 4W5UA 4D71A 1JI1A 1G67A 1UUMA 3WUGA 3ZLGA 3GXTA 2FHCA 4PMXA 3F2CA 2DQWA 4OFCA 5CSYA 4BKNA 2GGHA 3FOKA 4DEFA 3NTYA 4LCRA 1D7KA 2QF7A 3PJWA 4ONVA 4IX2A 3WQ6A 4ZO7A 4C5ZA 4AF0B 1MQPA 1ZBVA 3ZYZA 2BY0A 2DW6A 5C71A 3ZIZA 4DNMA 4UMAA 4JN8A 5AYIA 5G4WA 3EA1A 3IGHX 3UY8A 4LYPA 2ABBA 1P7TA 2YL9A 4HZ7A 4XKYB 5SWUA 4LYQA 3CT2A 4PTXA 4YHGA 4WKAA 4CU8A 5EU9A 2Z6IA 2ZX9A 1Q6FA 2J27A 3WD0A 2WC3A 3HV8A 3UZWA 2W79A 1KTCA 3LBCA 3SW6A 1PAMA 4HPNA 1L2UA 4RNJA 4NP7A 3OYZA 4FOKA 4GQGA 3ZMRA 4LY8A 3DEQA 2TMDA 1FH8A 4PH6A 1RCOB 1SU5A 2Z2BA 3W7OA 4OJYA 1KR0A 3U2EA 2YPIA 3WQ4A 5EMUA 1J79A 1IE7C 1V02A 1W8SA 2G96A 4OHQA 4PSPA 4Z1BA 3GXIA 4LU0A 1UR4A 2VEPA 2XWEA 1QUMA 2J9ZA 2PDUA 1FP9A 5CEWA 2A7RA 1GVYA 2E9BA 2NVAA 2V0TA 4GVHA 4M1BA 4QE1A 3R8HA 1YPIA 5K4XA 3A21A 2C7FA 4O8AA 4ILSA 3TQVA 1L9WA 3M1ZA 3AISA 3R13A 2GQAA 2NQ9A 1KM0A 1PX4A 3SQMA 4L4OA 5JH1A 5KINA 2YL6A 2VFFA 1LDCA 3CV1A 3OA3A 1PVNA 3GDRA 2F61A 4C65A 3E6EA 3N19B 3HPXA 2W91A 2V3EA 1KXTA 2VUYA 1KLYA 4H04A 3UZYA 3UPWA 2E5DA 4Q4KA 1ZENA 2X7VA 1W32A 1B3VA 4DAIA 4BJHA 2NT0A 1P0KA 1D9EA 1GJPA 3QY8A 4P8WA 2ZA1A 2OPJA 3OEXA 4Q8MA 1B9BA 3CZJA 3EB4A 4S23A 3S5NA 3I3EA 3KLKA 1EP2A 3N29A 1UZ1A 1EDGA 4ZQOA 2GWNA 3LGDA 4QS6A 5RUBA 1RR2A 1J0IA 3GWQA 1LWIA 4GPNA 3SRKA 3NCOA 1J4EA 1XLBA 3HF3A 4JS3A 3LHUA 1SSDA 2WSPA 1DIDA 4B92A 3PN8A 3IEBA 1MVYA 3NQGA 3HFYA 5A1AA 1PKLA 4AHQA 5TQLA 1F2JA 3VNDA 4XBKA 1RVKA 1N8WA 3G2GA 1PEZA 3VGFA 4ZFMA 1WDWA 5DCBA 4F0LA 5I79A 4LB4A 4C1NB 3URQA 1TE6A 3WDIA 2ZC1A 3JU2A 2EJAA 2Y5JA 2Z1BA 2FGZA 1GPFA 4C6MA 4O11A 1VCFA 4ZODA 2WCGA 2YFOA 3EX4A 3MSGA 1UPPA 3PM6A 4M80A 4HTBA 5CZKA 1BWKA 2OO0A 4YU1A 1RAKA 1U33A 4QAWA 2JGYA 5EFFA 5KZDA 1JCLA 2EPLX 1NY1A 3SGGA 3U2CA 2ZZ5A 2OR2A 5A6JA 4ZQMA 2EG8A 1LLOA 1X8FA 3EX6A 1YNQA 3W24A 3GG0A 1PDZA 2DVTA 4PUEA 1M03A 4R7JA 2GFTA 5LHEA 5E9XA 1V6YA 1ZJHA 2ZUVA 1LUCB 4EPKA 4MAVA 2W61A 3NL5A 3W00A 3H2AA 1LOQA 3AYTA 1IXOA 2YZRA 4WX2A 1JGMA 1CPUA 4HSOA 1XG3A 4LUSA 6CGTA 1R3RA 2PDLA 3P0XA 3FHQA 4MWAC 1O60A 4AHOA 1XYLA 3HG3A 4IMAA 3K8KA 3NZPA 3L4TA 4A8LA 1DBTA 2H8ZA 2VXNA 2DZSA 1VPYA 3CHCA 1JRBA 1RQEA 2A4AA 3K4WA 3MYPA 2OYKA 1W3TA 1NU5A 1V6TA 4EX4A 4IIDA 1KB3A 1YDYA 2NV1A 3AZTA 3ATYA 3N9RA 5A2BA 3KDOA 3J7HA 1UOKA 1GVSA 3PSVA 3DXIA 1UC4A 4DVOA 1NF0A 2J8GA 2Y85A 3FLUA 5CAHA 3O8AA 3HG5A 3IUDA 4IL0A 4P7LA 2ZTKA 5G1TA 1EX5A 1W1PA 4RJEA 4UFJA 2NSOA 1AMKA 1M1BA 1QPOA 1UWTA 1JCXA 4F66A 4JTDA 4P7QA 1G4TA 1UKQA 1JDAA 3UNDA 4NSBA 3TJLA 1BVNP 2QPSA 4DX3A 5BOOA 1MFVA 3G1SA 4PTDA 2OOGA 3TLQA 3QF0A 1H09A 1R86A 1Q4WA 2CPUA 3KE0A 3KOYA 1MXGA 2J79A 3MI2A 1YTEA 4XZBA 4UR8A 2WJZA 1JDCA 1PSCA 1IYXA 4ERAA 2J9XA 1A0EA 1EXBA 3BGGA 3UEQA 1UD2A 1ISZA 5CBIA 1EB3A 2AL2B 4K3ZA 3WBWA 2P3ZA 1R87A 1TR1A 4L64A 5TAOA 1ZPTA 2Y1HA 3H23A 1LL6A 4AEFA 1M53A 5E0CA 4W5ZA 1TPWA 1VFHA 2ISSA 3POCA 3BV4A 3JRKA 4D8LA 1P0NA 5D09A 2G37A 4WY0F 1PIFA 3UWUA 3QQWA 9XIMA 3GRIA 4YTTA 4C6BA 1JPHA 2C15A 2OB3A 3W7RA 3WH7A 5ABFB 5JIWA 1JZ2A 4AD1A 2ZZ2A 4L1XA 2CLFA 4CNNA 3WJYA 3V1PA 5D9PA 3CHVA 5GNYA 3BCDA 5G4HC 1TA3B 4P7NA 4Q7BA 3OZYA 4K1GA 4UBPC 1OCQA 3NQDA 2J6VA 4GX8A 1R9XA 1JGIA 1GKPA 3F4NA 1C92A 1Q6EA 1RD5A 1J0ZA 1GKQA 1MZRA 2AQWA 4CNOA 4IIBA 3RM8A 1MRQA 3E49A 1BYCA 4NT0A 4R9OA 3PSWA 4AB4A 4FB7A 3GNDA 1M3UA 3IJQA 2XFYA 4MZ1A 3FN9A 5A95A 5DF0A 4QSHA 2WVVB 3KAOA 3NQ8A 4JQ2A 3ITXA 2GJPA 5ECUA 3S6OA 4CQDA 2QCDB 4OUIA 1K8XA 1RBOB 1RBLA 5BNKA 4Q6XA 3GNOA 2OEJA 3TZNA 4BQ4A 3EWCA 3PWAA 2E0PA 3H4XA 2C71A 1A0CA 3C2FA 3QGAC 4NL1A 3MI3A 1GG0A 1JCMP 3AIBA 1CDGA 3W2LA 2OSYA 1W1ZA 2PPGA 4HPGA 3FJ6A 2VEFA 2WC4A 3LSBA 5IFPA 4KEVA 2R6OA 4PCPA 3N3TA 3RM4A 3T4WA 3L67A 1ITUA 4MJ4A 3QBUA 1F3XA 2I1OA 5AHEA 4HU0A 1JCTA 1ONXA 3P8JA 2CYGA 2Z1XA 4AZCA 1A5KC 1KXHA 3GE7A 4Y8FA 4ZL1A 1BEUA 1XDMA 3AOFA 1OF6A 4EPDC 3BOLA 3TUUA 4N9DA 4FPSA 3BG5A 4IJRA 1E1CA 2X40A 2PLMA 3KX6A 5D04C 3TNOA 2EG7A 1V7YA 3P8IA 3SO7A 1G01A 4HSHA 2GQ3A 1HKMA 4OQVA 4US6A 3ENLA 1WZKA 4DJFD 4OBRA 1J9YA 1TCMA 1JFHA 3S6DA 3WLQA 2FQIA 4R9XA 1RK6A 3M0MA 3RLVA 1OSEA 1FTXA 3AXKA 4LV9A 4BS0A 3O2LA 4CCEA 4Q7IA 1EGZA 4HU3A 4UTHA 1JPMA 5ABTA 4H7VA 1A3HA 1GYMA 4LVDA 3TYZA 1R5YA 1LLWA 2A7PA 1EKOA 2GK1A 3CBWA 5DO8A 3W7GA 3W84A 2WLZA 5LNRA 2DJLA 4PYSA 4TV5A 4NZ3A 4DO6A 4NXSA 1W1B1 4YVPA 4PE8A 1OFAA 1H5VA 4QCFA 5HWMA 4O53A 1A5CA 1DIKA 1EUNA 3TC3A 1SYTA 3HBLA 1E15A 3T4CA 3ZT6A 4BEUA 3SUWA 3IJ7A 1K8YA 3FY1A 3K4AA 3WCZA 4FIQA 2XUCA 1AQMA 3VIIA 1SM9A 1DIEA 1O4UA 2INEA 3WEZA 5LNUA 3WDPP 3APYA 2CWNA 2R1MA 2HSAA 1A3XA 1IWPA 4IFKA 2TYSA 2Q02A 1B3OA 5C2XA 2P53A 2HK0A 4GVGA 2VL4A 5AKQA 1V08A 2XIJA 4KQNA 3O6DA 2DEPA 3P82A 3VILA 4FNPA 4MJZA 3DHPA 2PMQA 5LXEA 5FJOA 3CJPA 5BWFA 4B9ZA 5D37A 4MSSA 4WDUA 1JZ6A 2XU2A 1JAEA 4J9JA 1S5NA 4MY8A 1CEOA 3PK7A 1UH4A 3AZSA 3V0SA 2IMRA 2QJIA 3LLXA 4MIMA 4AF0A 1DQXA 4IGNA 3GW0A 3AMCA 2ZUTA 3PBGA 4PCTA 3HMCA 4GGBA 1FX6A 3P14A 3S9IA 5C9UA 2VR4A 2DV0A 4UUIA 4PMVA 1LCOA 4HTYA 4XKYA 2G8ZA 5HNNA 4B3LA 1VYRA 4LB3A 2YDSA 3L0KA 2FZMA 5EMYA 3OVQA 1M01A 2QUTA 5HR6A 5LIUX 4JCMA 3KOZA 3PZTA 1V3HA 1U5JA 1IZJA 3NL3A 4NJHA 2RDTA 1VEOA 3IIXA 1OX5A 3MTWA 4UB9A 3DIPA 3K1DA 3BAIA 1NQ6A 1J6OA 4XZLX 3EA3A 5A94A 4RR4A 2CBUA 3CUIA 4HD5A 3CQ0A 2JKPA 4PCSA 4ORMA 3IJ6A 3AIWA 3GDBA 3LPFA 3VOCA 3ONCA 2GGEA 1QHOA 2GDUA 3TE9A 2QDHA 1NQKA 3VIPA 2YCKX 3VE7A 1B90A 1CXEA 5DMNA 3FYOA 1E6SM 2NX1A 2ZADA 1IXNA 2PB1A 5D8ZA 2V82A 4Q6JA 4XD4A 3GY1A 3STFA 1JNDA 2MUCA 3BDKA 1QI5A 3MVIA 3WL1A 1JPIA 4Y9NA 8XIAA 3C0SA 4M6UA 1WCGA 3EWDA 5MF5A 2I5QA 2BY2A 4TOQA 1TV5A 1EEXA 1XQKA 2Q8ZA 3QXBA 1CNVA 1BXCA 3EWXA 5AFDA 2GVJA 4AD5A 1V6WA 4UMBA 3C5QA 4LBUA 3MZNA 2FDMA 3WNKA 1S39A 3VOJA 2PBGA 4NNAA 1IGSA 2B81A 1AQHA 3LHVA 1EJRC 1QOQA 3KDNA 5DXXA 1Q5MA 1MI3A 3QZEA 2EXOA 3CXOA 4S3AA 3SRDA 3SUTA 3AJ7A 1SJCA 5H8UA 3WLTA 5REQB 5DMMA 3NIYA 4Z17A 3PNZA 1S5VA 2X2GA 1Q6GA 1P6CA 3AUOA 5FJJA 3VKKA 3RPDA 4H9ZA 4I9MA 3VM7A 4N6EA 2BB0A 1DIOA 5F2MA 3HPSA 3AO0A 4WUIA 3W23A 3KS5A 1TUXA 3M6YA 4Q4PA 1UROA 4LJ3A 4GUIA 1T8QA 4H7CA 2CLLA 2W67A 1H0IA 3HG4A 4ZTXA 3ALGA 5C9ZA 1UZ4A 2HEJA 4U28A 3RILA 2XZ7A 4W89A 3HU7A 4CCDA 2FB2A 3VIMA 1R9ZA 4PFMA 4UTIA 1BKSA 3TQ0A 1WDPA 5CC5A 5EBAA 4QX4A 3R8GA 4GZJA 2YXXA 4F8XA 1LG2A 4D6IA 1X1OA 3W7JA 2VJXA 4GZ7A 4HIBA 3HGJA 2JGQA 3K5XA 3DENA 1ZQ5A 4C1NA 1P0EA 4O1AA 1XXXA 2P0OA 4ZCWA 3KVJA 1YBQA 1KFEA 3FYYA 2ODOA 3PJTA 3ICJA 3VNJA 1J0HA 2ZCGA 3V5OA 2PGWA 4EXAA 3CHEA 1RQHA 4KERA 4YVVA 3R0DA 2PEVA 3MBDA 4JTLA 5JH2A 1S3HA 3FA3A 3P60A 2F7FA 3H2FA 4IGMA 1TJ0A 4QRNA 1EXPA 1QW7A 4IT1A 2AMGA 4IWWA 4K36A 3MZ2A 3SY8A 3E1F1 4AZ7A 1S2CA 3GVGA 1TRIA 4M6PA 4MZYA 1ECQA 3O07A 1PL9A 5B7ZA 2A1YA 3R11A 4LAZA 1ISXA 1OFRA 4W9TA 2PRHA 3OJGA 3CHFA 2XJ7A 1OD8A 1MYRA 2QW5A 3UJFA 2ATSA 4HP5A 4OV9A 3ONBA 2DW7A 3ZFHA 3I6TA 3EMZA 2WM0A 4MWAD 1SSGA 3GUWA 3TCSA 2YKKA 4GGHA 1J93A 1JYNA 1WZMA 4C1KA 3SN1A 2XH4A 2IQDA 1PKMA 1B4KA 1FOBA 3OBKA 1NEYA 2FPVA 1MW2A 1CYGA 4RDVA 4MYXA 2GSEA 1WQ5A 2J7HA 3MU7A 3DKJA 3ITVA 2J47A 3P61A 3MP3A 1AL8A 2VR5A 1R30A 3N2TA 3LMZA 3RO6A 4FXFA 2PWEA 4YYFA 3ZJKA 3PZOA 4NI8A 1I1XA 5FF0A 3VYLA 1FCVA 1NDWA 4FNRA 3RFAA 3B97A 4ZSTA 1XL9A 5I2UA 2RKXA 1V0LA 3OP2A 1PZ2A 3PTKA 1I8JA 1XRVA 1ECEA 6XIAA 2Z1SA 4DWSB 1U1HA 3TYEA 1RA5A 4XSLA 4GX9A 4W7UA 1WYIA 4EACA 4LC6A 2WZHA 4H83A 4LS2A 3SADA 1NVMA 4HMCA 5D2TA 2E4TA 2ZDRA 2A6NA 3WMSA 1L8PA 1SR9A 2GSHA 1ESWA 2H9AA 5DBTA 4Q8TA 2TPSA 4ATDA 4GQBA 1CIUA 2W0UA 4D6JA 3ZJ6A 1DJZA 2WNWA 2WB5A 3G0SA 3CNYA 1AH0A 1SR0A 2DVXA 1XSIA 1VYSX 1KRAC 3GXFA 2IQTA 3VIJA 5FJIA 2X41A 1Z8AA 1IR2A 1ENUA 1YXCA 4GY1A 4M81A 1A80A 3MWAA 1RVGA 2AL2A 4QR6A 3CUZA 4P5UA 2J88A 1WBHA 1W5NA 4JY9A 4PTMA 3H6OA 1ZZMA 2DIKA 3JZEA 3UGRA 1KV5A 2YOCA 1VH7A 1JRCA 3AMDA 1EC9A 1CXIA 3T42A 2E8ZA 4I5RA 1K02A 2I57A 3A13A 3GXNA 4PODA 1UQYA 4BI7A 1ONRA 3PUDA 4W8LA 5LIWX 3MKCA 3MYOA 1TPVA 1OCJA 4AY8A 1VB9A 5LSMA 4RNHA 3P67A 5CSRA 1KBBA 1ZGDA 4C6IA 5L6UA 1YXYA 3W7DA 3WLIA 2WBGA 1JDFA 3RNDA 1OFEA 3QH2A 3T2QA 5CJMA 5TNVA 2VCBA 3WLOA 2X2YA 3N15A 1G94A 1HZYA 1B31A 3NSMA 3KM8A 2GVEA 2MANA 4AZIA 3A3XA 4JQ3A 1U1JA 2PGEA 3PULA 3WQGA 4IMFA 4IGSA 1FHLA 2BG5A 1HTIA 5H1WA 2WQDA 1I45A 3OGVA 1CGXA 3S1WA 4HZMA 2WAGA 4W7VA 3B8WA 7PTDA 3KVLA 2G3IA 4FX6M 3S8HA 3HFTA 3WD2A 2EG6A 3L0GA 3WL0A 5T91A 4S3DA 3TQKA 3N25A 5HMFA 1KRMA 3RCMA 3WNNA 2BSLA 4MZ8A 1M04A 4IL2A 4GRSA 3O1NA 4JNYA 4WJXA 1I2OA 3NQAA 3A5FA 1CXLA 1GOMA 3LPGA 5DN1A 3TXZA 3R25A 3DYPA 3CV7A 3CU2A 3SIZA 4I5UA 1S2AA 3AIVA 4S3EA 4ZQPA 5BROA 4JN6A 4H9VA 1R3YA 3QOKA 3KOXA 3TA9A 3WBYA 4JYFA 2E6AA 3UNTA 2HISA 1R7OA 3TFCA 2WSKA 1TVLA 1OIFA 2RJHA 3UESA 3Q94A 1R6WA 4R85A 2G5WA 2XVGA 3QR0A 4U5KA 3T0BA 1Q2RA 4DO5A 4IIFA 3SR7A 3VGEA 3W22A 4AISA 3UW6A 3BARA 4QG8A 3P6LA 4Q4QA 3OHMB 3TYBA 3N2BA 1XP3A 2PLJA 3HTWA 1KA9F 2B7PA 1YDNA 3OLEA 3QV8A 5D2YA 1I9CB 3LM7A 3GTNA 3TR9A 1KQYA 5KZ6A 4GK8A 1RXOB 3B8UA 5FOOA 4ROQA 1VBJA 2NWRA 5EA9A 4BI6A 1XR2A 1RHCA 4AWSA 1MQRA 3G22A 1TREA 5EFDA 4DUXA 5KZEA 1XKYA 1PB0A 2WNZA 1OX6A 1W9XA 5D30A 1LROA 1X1NA 4GBUA 2O9TA 2RGLA 4H6KA 3CS2A 4GA8A 4QCEA 3H7RA 4MB3A 5AHLA 1TV8A 3NQMA 3L2MA 2YGYA 4E5TA 3IUIA 1DWJM 3C6CA 3NXLA 2J7FA 4E2VA 1WB0A 3LRMA 3PTDA 2YSWA 3TVAA 2Z1VA 1Q6LA 2D69A 4B9YA 2VEKA 3TA6A 3YPIA 1RP8A 4L9ZA 1L6GA 3W7KA 5A8OA 1NDZA 3LCGA 2EPHA 2XIQA 3UF9A 3W7MA 3ABZA 5EGRA 4JY8A 1LM1A 4PN2A 4XO7A 1FWIC 2VC6A 4G8TA 2WO5A 3C56A 4HKPA 3WBAA 3MSRA 1EJSC 1C9DA 1OB0A 3A4WA 4HPHA 3PY2A 5PTDA 2FZNA 4O1DA 5IBXA 3NO1A 1F05A 3OODA 3GYCA 5FEXA 3CUXA 1UUQA 1IGWA 3NGJA 1KWGA 1VBUA 1KXVA 2WSQA 1B0IA 4A3RA 1N82A 1ZJBA 3EBVA 4FLSA 1XIGA 1ME9A 3W82A 4EP8C 4A6GA 2IKGA 4EXBA 2WMIA 2EKGA 1E0XA 1K8CA 1SFLA 3LNMA 2R24A 1NFGA 3G6MA 4AZ6A 1KCZA 3A22A 4UMCA 1SZEA 2YFNA 5FJPA 3URAA 4ICMA 3WD1A 3MSDA 1C8YA 4FNQA 1UOZA 3GG7A 3S5SA 4TIMA 3DI0A 5BW6A 1XIHA 1GQIA 3WEMA 3DFHA 2GOUA 3NPXA 1IT7A 1BWLA 1G7UA 3RN6A 5LIYX 4DLFA 3ARTA 3DYOA 3K30A 1IEQA 3M41A 4JKLA 3WQCA 4AD4A 3SQSA 4YTSA 2WHJA 4CCZA 1I0DA 2XG9A 4EXQA 1W1A1 1U83A 1GOXA 3AHTA 1MQQA 2V3GA 3WO8A 1FWSA 2VRQA 2HS8A 4GHRA 3RF9A 3WQ8A 4MB1A 2BGSA 1W1IE 1BF6A 4O12A 2FTWA 2C91A 2YA2A 2NUYA 5I77A 5HWNA 3HQNA 1EJTC 1CB2A 2XN1A 1FWTA 1ZL1A 3A4AA 3B3DA 5AZ1A 4DHGA 3BSMA 4AW7A 3MUY1 2CZ5A 2Z1KA 5K3VA 4HA3A 1TV7A 2QZRA 4N02A 2PCQA 1I0BA 4O19A 1OYCA 3UXDA 4NX5A 4QAIA 3RRXA 4Z2HA 4NI3A 3ERPA 1Z41A 4LW7A 1GT8A 1WO2A 2ZUMA 2O9OA 1K4HA 4O4VA 3TJ4A 1PKYA 5JQ9A 3GH5A 3QV9A 4FP1A 1XLFA 2YB1A 2BS9A 2BVWA 1G9HA 5LXXA 3MWCA 4CU6A 5IM51 5G5IA 3E2RA 1WE5A 5C0QA 4PL1A 5C7HA 4PRRA 2RGMA 2OZ0A 3BJTA 2AKMA 4DBUA 1NDVA 2PRLA 4W86A 3ARXA 4AMCA 4PBEA 4X60A 3UY7A 1XYZA 4GO8A 1JCNA 4DBDA 1NWSA 7TAAA 2CU0A 3VABA 3W1XA 4OZOA 1M7PA 1LQ0A 1XFBA 2QAFA 3BO9A 2A3BA 1E5JA 4GKLA 3S2LA 3TTSA 3FHAA 3B9EA 4LAKA 2PD9A 1OINA 3WY1A 1R8LA 4WEVX 3OZOA 5D32A 3I7QA 5HMEA 2QCHA 4IPIA 4DJEA 3OG2A 3GIPA 1XD1A 2J7DA 4KFNA 2VR2A 3NAVA 1FHDA 3NPVA 1TV2A 2UZ9A 3THCA 3PBMA 1NJJA 3K8LA 5CC6A 3COTA 2NW0A 1PTGA 1KBIA 3VIGA 3B9DA 1F4HA 4OOZA 4NASA 3GC2A 1RCXB 3SSJA 1GTHA 2Q01A 4UQDA 3L2LA 5CG0A 5LNSA 4UNKA 4PR4A 4MY1A 1NP2A 1PX8A 1QWGA 4AC1X 3MUAA 2OZ8A 3BAJA 2W3ZA 4C90A 1H7WA 2I7GA 2LLEA 1EFZA 1KFJA 1UP2A 4WHBA 4UOZA 3NQ6A 3FAWA 4UFIA 1JYXA 1RK5A 4A3QA 1O5QA 2BDQA 3SCTA 1CX9A 1EZ2A 3GG8A 4PCFA 4BY3A 2OCZA 3UR5A 2NVCA 3AHXA 3B9AA 3N2MA 5I3JA 1UJPA 1T41A 2PURA 1E3ZA 2CLEA 4BQ3A 3G1VA 4KWUA 1EBGA 1XI3A 2PTDA 4YL2A 3FKRA 3NEVA 5I3FA 1XLMA 1DJHA 3I3BA 1EPVA 1QU4A 2XTKA 3FEMA 3P0WA 8CGTA 5D9NA 3EKGA 1FWRA 5I09A 2JKEA 1RJRA 2QCMA 1E9IA 4RDWA 4S1FA 1KGWA 1F6PA 5BXRA 1DXEA 1SFSA 1MNZA 4I6VA 4CD4A 4OECA 1ZRQA 4QDWA 4JZ5A 1AH4A 3HJEA 1CI1A 1EC8A 5HDRA 3GSMA 1XBVA 4IIHA 2YA0A 4A2SA 1KWKA 4ZO6A 3XISA 2VX4A 3W1LA 3SIMA 4D72A 4UC5A 2OQLA 3W02A 1JR1A 3M0KA 1J12A 1Z44A 3F03K 3A9BA 4PEEA 1GOKA 5D9OA 3LN3A 3A23A 4WY0B 4ERGA 4NRSA 3L4XA 3WH9A 2NX9A 3H2NA 3B8DA 5KSWA 3MCOA 5XIMA 2W92A 1D8CA 2WMFA 1KM6A 2FZ8A 3DECA 4MFEA 4RNFA 4LF1A 4R88A 5J04A 4TX6A 1FXPA 4ZQNA 3NQEA 4L9YA 1SJAA 1FWEC 4IHCA 3VOGA 5AVNA 1AMYA 4DWSA 2E09A 3W0KA 2CLHA 2FTYA 1F6YA 2I16A 3S9YA 1YHTA 4NUWA 3VZXA 1JZ4A 3HN3A 1V6VA 5H8MA 4LSBA 2PWFA 2CEQA 3WF0A 3S46A 2PTYA 4NYUA 3FNDA 3W2JA 1F4AA 1JI2A 4MFDA 3N6QA 2OWCA 2Z1WA 3V5FA 4C60A 3NQ2A 1FWNA 2XIOA 1NP0A 3FYPA 4RDZA 1XC6A 1XISA 2P3EA 2ZICA 3WLMA 3UFYA 1VLIA 4JD4A 2BXVA 3UG4A 3APGA 2DZBA 4JL1A 1UZHA 2FMNA 3S47A 3CWNA 3MDUA 4K2SA 3N3MA 1XM3A 1RCQA 3DKLA 4K38A 3S4TA 1OIMA 1HJVA 3CTLA 1W31A 2QCGA 4S3GA 4FEZA 1QBBA 3T8QA 3TYAA 3EEGA 4I5XA 4Q8WA 1IT0A 5LNWA 2REQA 2BHZA 2OMAA 3WFLA 4HVXA 3WQPA 3PBVA 1QDSA 1XLDA 1YE4A 3KL0A 3G0XA 5E6YA 3AWOA 3HGOA 2PGRA 3VGBA 4S3FA 3FDGA 4JYDA 5HULA 3UP8A 1Z9AA 1E0WA 2GVYA 5FJTA 4J28A 4FO4A 3H4WA 5FA5A 3M47A 4R5EA 3TAKA 4ZZ9A 3IIZA 3O0FA 1PCKA 2E1DA 3JR2A 4QNEA 1R38A 2XFFA 4IZGA 1O6IA 4O14A 1VRDA 1TPEA 2BWGA 4IMDA 4J3UA 4DBSA 4KWVA 3UJSA 3W7EA 1Q13A 4D6GA 2PRMA 7REQB 3NXFA 3U7VA 3UXIA 1B4EA 1G5AA 4HNVA 4YTQA 3CC1A 1WDQA 2X30A 1KLZA 3OBAA 3F2DA 4DF0A 1YPXA 1QHZA 4MDPA 2J7GA 2YCJA 1X97A 3GDKA 4PMJA 1J96A 3QC3A 5DX7A 5F4XA 3O7UA 3N18A 4E4UA 1TWSA 3M6DA 3UG3A 3ARRA 4KGJA 1SZGA 3T6CA 4JTSA 1G7VA 3E0LA 4AIBA 3P7YA 1K9DA 3ITGA 1F07A 3L4VA 5G1YA 4S3JA 4HU8A 1YE6A 3GHSA 1PXGA 3MI6A 1Q4NX 3KEHA 3TX9A 1HUVA 3CB8A 4C6DA 3TWBA 3MMTA 4F48A 3TROA 3UQNA 3AICA 1RH9A 4FALA 2GJNA 3S2NA 3WJXA 3A6OA 5C9RA 2YBVA 2ISVA 3EDJA 4ZBCA 3W25A 2IPJA 1QNQA 3W70A 3KS6A 3N34A 3V3WA 3E2VA 3KL5A 5M17A 2Y5SA 3C2EA 4B16A 5AHMA 2BGQA 2G4FA 4IOTA 2ACUA 4J7RA 4JHZA 3ECQA 2GWGA 4C1LA 4LQ1A 1KW1A 1Q6QA 1TJ2A 4JTKA 3PUOA 3SRFA 5LIXX 1OC7A 3REQB 1ZAHA 5CSSA 3CPRA 5BXTA 5DQPA 3B4YA 4JICA 3DHUA 4E3VA 2PDPA 2HBVA 5C55A 1MO0A 3PWGA 2Y61A 1YW1A 2Z25A 3MY9A 3MUCA 3CMGA 2Q8LA 4OBSA 4Y9OA 3NM3A 2ZUNA 1V6UA 1VZWA 3W26A 1XYMA 3MJYA 5HOSA 1KR1A 5MKGB 4D8AA 3NURA 3N73A 5A6BD 4FS9A 1OFOA 2HE5A 5A8QA 5AYBA 4JIIX 1HL2A 1AA1B 3MP5A 2V3FA 2FH6A 3T07A 3LEPA 2ISDA 1UUOA 3QHOA 4EPBC 1QW9A 3AHVA 1E3XA 5HK4A 3BICA 2IKHA 2QHAA 2PDWA 3RMJA 2C1IA 5CZ0A 4M82A 3WF4A 3VCRA 2BVYA 1VC4A 3KHDA 5C8BB 1KRCC 5EMJA 1OX4B 1JIBA 3T81A 3FEQA 3BLFA 3W6LA 1X7IA 3AYRA 5IBXC 3ELFA 4OWGA 3NQBA 4NJKA 2NXGA 4DJDA 4US5A 1DJYA 2GJRA 3IRSA 3M0IA 4GYPA 4JAWA 3VD5A 3LHYA 1LRNA 3EWUA 5EL1A 4YNGA 3IJ9A 3LD5A 1ADDA 4KT2A 3EWZA 2YCEA 2BOFX 1XBXA 2WXDM 3CO8A 1KM1A 1CGUA 3AQUA 3ZR5A 1JZ5A 1WOBA 4XZMX 1BQCA 4K1WA 4LANA 4X22A 1DQWA 2D24A 1XHGA 5I3DA 1DTNA 4JX4A 1FKXA 5K9XA 4O13A 1H11A 2R91A 1S1RA 2Y5EA 1EOMA 4GJIA 2TSYA 1MUWA 4CQCA 3O6AA 4QITA 1BYDA 2WVSA 1BQGA 4LX4A 4AIUA 4NZCA 1M65A 1WBJA 1VBGA 1ZSXA 2MNRA 4AYSA 5AC8A 1UWAA 4U2ZA 3BGJA 1VCGA 3AMGA 1QHPA 2IXUA 1FFRA 4JTHA 1KC7A 3K2GA 3PPFA 1E6ZA 2XM1A 4PRWA 2WYSA 2NSXA 3QHNA 3STGA 2PDFA 4HT3A 3PVFA 2HPMA 1XSJA 1ICSA 2J13A 3V0UA 3WQ5A 4GD0A 1K4GA 1PX3A 3LU2A 4UTKA 3B8TA 1MNSA 3SUUA 2ZXBA 5FSDC 1OGGA 5A6MA 1AG1O 1ZAJA 4I90A 3HPFA 2E1WA 2XH7A 3QJAA 3MANA 2QQ6A 4BF9A 3LNPA 4IPPA 3ARYA 3TNBA 3CUFA 4D2JA 1OYAA 2G95A 2BODX 1I2NA 3EOSA 4FMVA 1EJVC 2XPKA 1W5MA 1WKYA 2W4XA 4DXVA 3DHFA 6REQA 5FAJA 3MSYA 1XLHA 4ADTA 2PGFA 1ML1A 1PYMA 3H7VA 1Q8AA 2WNNA 3GZAA 5FKYA 4NNBA 3JUGA 2HVNA 5HNUA 2GQ8A 4CQBA 1T40A 3TR2A 2V5BA 1K9FA 1UD8A 2OZ3A 3I68A 4MF4A 3QV7A 2SFPA 2Y7FA 1TUFA 4H01A 4FI4A 1F73A 3D5HA 4ENLA 6XIMA 5K9CA 3CPGA 4IP7A 3M0YA 1XS2A 3EKLA 4F0KA 3B0PA 1VPXA 1ZUAX 4GNJA 2O4MA 4GIAA 4ZMGA 3E74A 1Z89A 2WCSA 4DJEC 2PP3A 4W85A 2ACQA 5HNTA 1MUMA 1WAWA 2IKIA 3NQCA 1C8XA 3TEVA 3UERA 1JZ8A 1Q85A 3FIGA 5A2AA 2WWCA 3GKAA 2OO6A 2A85A 4LRTA 1CLKA 4IICA 3SFKA 2EEXA 1ZB5A 4EAMA 3HZ3A 1UG6A 3S5YA 3C2OA 2DZPA 1TKKA 1XSKA 2ASHA 3NQVA 3CL6A 4S39A 3RJXA 2W9MA 1QFEA 5E6ZA 4URIA 3W28A 3MCNA 4G9PA 1KGXA 2GVLA 1A5SA 1HJWA 3IANA 4QS5A 4BEQA 3LSCA 3C2RA 2JIEA 4MNJA 4Q3MA 4DB7A 3L7RA 1TPB1 1A5LC 3WLSA 3BAWA 3GD6A 2JE8A 2HXTA 4GJ1A 3WYZA 2DSVA 1GYNA 4ZOCA 2JFEX 4H9UA 2WVTA 5GNZA 3A24A 3OHIA 2DUAA 1WP6A 3B8IA 4N9BA 1HT6A 3O9NA 2J77A 1A5AA 2ZX7A 5A6AA 1ZBWA 2ZOXA 1TMLA 1G4SA 1H7OA 3GNPA 1ZHAA 1YDOA 1RQBA 4ZEPA 3RX2A 2ZRYA 4PTWA 4UTTA 4QJ5B 1Y5VA 3BMVA 3RK8A 1E6NA 3IIVA 4ZB5A 2BVDA 2G3MA 1EF2A 3EB3A 4MPQA 3WK1A 2EQDA 1OHLA 2XINA 1CZ1A 1E4MM 1BYAA 4PMYA 3NWRA 4WSJA 1NDYA 2OLHA 1V8EA 3L21A 2R8WA 3F5KA 3SCRA 1VAHA 2W62A 5EKYA 3DFYA 1GWJA 1CLXA 4HHPA 3QRHA 2G41A 1Z7AA 3E9AA 1TYGA 2A5HA 3GXDA 2HK1A 3HB9A 5CPLA