3QKZA

Crystal structure of mutant his269arg akr1b14
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
315
structure length
315
Chain Sequence
TTFVKLRTKAKMPLVGLGTWKSPPGQVKEAVKAAIDAGYRHFDCAYVYQNESEVGEAIQEKIKEKAVRREDLFIVSKLWSTFFEKSLMKEAFQKTLSDLKLDYLDLYLIHWPQGLQAGKEFLPKDSQGKVLMSKSTFLDAWEGMEELVDQGLVKALGVSNFNHFQIERLLNKPGLKHKPVTNQVECHPYLTQEKLIQYCHSKGIAVIAYSPLGSPDRPYAKPEDPVVLEIPKIKEIAAKHKKTIAQVLIRFHVQRNVAVIPKSVTLSRIKENIQVFDFQLSEEDMAAILSLNRNWRACGLFVTSDEEDFPFHEEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the His269Arg mutant of the rat aldose reductase-like protein AKR1B14 complexed with NADPH.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase
molecule keywords Aldo-keto reductase family 1, member B7
total genus 102
structure length 315
sequence length 315
chains with identical sequence B
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2011-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3qkzA00
3M0IA 4LB4A 2PDWA 4HMNA 4PR4A 4WGHA 4JTRA 2PDMA 1PZ1A 1Z8AA 2ACQA 4DBUA 4QR6A 2PD5A 1JEZA 3CV7A 3C3UA 4WEVX 1AH0A 4LAZA 3O3RA 3LD5A 4JTAA 3GHRA 3UGRA 3LZ5A 5DANA 5JH2A 2DV0A 5HNTA 3T42A 1YE6A 2A79A 4WDTA 3LUTA 4L1XA 1RALA 1QWKA 4HBKA 3R8GA 3G5EA 3GUGA 2IPGA 4FALA 2DUXA 2PF8A 3CAVA 4XO6A 1ZSXA 2FZBA 4XAPA 2F38A 2FZDA 2PEVA 3R58A 2IKIA 4GA8A 3MC5A 2PDNA 1QRQA 3ONCA 2PDIA 4QXIA 1XJBA 1X98A 1EF3A 2INZA 3LZ3A 4LBRA 1T41A 1ZUAX 4YVVA 2IPJA 4NKCA 3H4GA 4JQ3A 5LIKX 3M64A 3R43A 5M2FX 3GHSA 2IKHA 1Z9AA 4PRRA 5JH1A 2PDLA 3NTYA 3QKZA 1EKOA 5LIUX 3F7JA 4GACA 4Q3MA 2PDPA 4XZIA 4WRHA 4XK2A 2HVOA 1T40A 1Q13A 1AH3A 4XZMX 2IPFA 4GCAA 1PZ0A 4DBWA 4YVPA 2WZTA 3KRBA 1M9HA 1UR3M 1ZGDA 4H8NA 4JQ1A 3WG6A 2FGBA 3CASA 1FRBA 1MI3A 3D3FA 4YVXA 3LBOA 4PMJA 3U2CA 4H7CA 1AZ2A 2ACUA 2PDKA 4IGSA 3S3GA 3LQLA 2F2KA 3WBYA 2FZ8A 3VXGA 3EB3A 2FVLA 3BV7A 2ACSA 3FJNA 2INEA 1C9WA 3UWEA 2P5NA 3V0TA 2PFHA 4JIHA 2PDFA 1AFSA 3CMFA 2PDBA 3ONBA 4LAUA 3UZZA 2ACRA 3WCZA 4XVEA 1US0A 4JIRA 2PDCA 1S1RA 3DOPA 2IQDA 2PDGA 3R94A 3LENA 2VDGA 3UFYA 1AZ1A 1PWLA 1VP5A 3EAUA 1IHIA 4R9OA 4XZHA 3V35A 2PDYA 4FZIA 4ASTA 1X97A 3M4HA 4JTDA 2PDQA 1Z3NA 3WBWA 1PYFA 4WDXA 2I17A 2CLPA 1IEIA 3UZYA 2IKGA 4GQ0A 2ALRA 2I16A 2NVCA 5HA7A 4XZLX 5LIWX 1YE4A 4WDWA 3FX4A 2PDJA 4JIIX 1HQTA 4PUUA 1R38A 4AUBA 3EB4A 4Q7BA 4GIEA 3N6QA 5AZ0A 2IKJA 3UP8A 4LBSA 3RX2A 1ADSA 1RY8A 1OG6A 2R24A 2ISFA 3G1RA 1RY0A 4XO7A 2AGTA 1K8CA 4JTCA 3MB9A 4JQAA 1Q5MA 4JTQA 5C7HA 4ICCX 2PD9A 4IJRA 4WDUA 1Z89A 2NVDA 2HVNA 1EL3A 3P2VA 1XF0A 5LIYX 2R9RA 3R6IA 4QX4A 1SM9A 3H7UA 4JQ4A 4L1WA 2J8TA 3ERPA 4GABA 3UZXA 2PDUA 1MRQA 2HV5A 3UG8A 4YS1A 2PDXA 4FA3A 3BCJA 3LQGA 3COTA 2HE5A 5LIXX 1GVEA 2PZNA 1J96A 1S2CA 1YNPA 3LNMA 3V0UA 2HE8A 4G5DA 4F40A 4YU1A 3B3DA 2C91A 3R8HA 2HDJA 4PRTA 2IPWA 1PWMA 1VBJA 4EXBA 1S1PA 3RX3A 4XZNX 3GHUA 4LB3A 3WBXA 2FZ9A 2DUZA 2BP1A 3RX4A 1MZRA 3H7RA 2BGSA 2HEJA 4JQ2A 2IQ0A 4DZ5A 5KETA 3GHTA 4QBXA 3V36A 3UZWA 3LN3A 3N2TA 3Q67A 3BUVA 1HW6A 4I5XA 3V0SA 3CV6A 3Q65A 4FAMA 2WZMA 3DN5A 4EXAA 3BURA 4IJCA 1AH4A 4GQGA 3R7MA 4RPQA 1LWIA 1XGDA 4ZFCA 4MHBA 4XVDA 2IS7A 2QXWA 1YNQA 1X96A 3UYIA 1ZQ5A 3CAQA 4DBSA 1LQAA 2PDHA 1EXBA 4OTKA 5AZ1A 5HNUA 1A80A 3LEPA 2BGQA 1S2AA 3O0KA 4PUWA
chains in the Genus database with same CATH superfamily
3T09A 2Z1VA 4UUIA 4MY1A 2BVWA 4Z2IA 2PB1A 4JTRA 3PFMA 1GQKA 1R2SA 1UASA 1W1PA 4LS1A 1H4PA 3CQKA 3KVJA 3HFTA 4IQJA 3CV7A 3ELFA 3TYDA 3ENLA 5E6YA 4AFYA 5EBAA 4LRSA 5TQLA 3PWIA 1E70M 4HNOA 1H5VA 3PSWA 3MI3A 5HNTA 3FDKA 4OZOA 2PU1A 4A3RA 3BH4A 4XD4A 2Z1XA 2PCEA 1R7AA 4IMAA 3AZSA 1YNYA 2XG9A 1VBUA 4AWSA 4M81A 3UA4A 4DWSD 3HG3A 1O60A 3NQEA 3ES7A 3R58A 2VGIA 2QUMA 1I0BA 4KT2A 3KHJA 4P5UA 3BARA 2GVLA 4C1KA 3GVQA 1VZWA 2V6AA 3LZ3A 4LCQA 3VKAA 1X1OA 2VFGA 5M2FX 4UFIA 3ARUA 2W91A 3M07A 3N11A 3W7PA 2PDLA 3GG0A 3H24A 3BJFA 3TQ0A 1FHVA 4MOZA 3AIBA 4XZIA 4F9JA 5D38A 2PODA 1JDFA 3N2OA 4CQDA 1I8JA 5LNRA 1E9LA 1AH3A 3ANUA 4HT3A 5DFAA 3RLGA 1OX5A 1BG9A 4F0KA 4PCFA 3ARRA 3N9SA 5JQ9A 3VGBA 4HQVA 2CLLA 3C2FA 2WZTA 4KW2A 5D8WA 3DFOA 1EUAA 3PFRA 4Z17A 2NXGA 4H8NA 4ATWA 4KWUA 3BZGA 3EPOA 3HQNA 4H2HA 1TMLA 1OFEA 3CASA 3J7HA 5DMMA 1DJGA 4EWND 4PMOA 1Q63A 1VH7A 4H01A 1PX4A 3UR8A 4IGSA 4ACZA 1AJ2A 3W2LA 4M29A 2V3FA 1R8LA 2XGZA 1PUDA 1RXOB 2Y0FA 4Q8PA 2NLYA 4HYVA 4ZQOA 1E4LA 5ABHA 2P5NA 3PZTA 4RW3A 5BXPA 2YXXA 2YYTA 3CMFA 4CCZA 3UY7A 5HDRA 2ACRA 1Z32X 4HGXA 2O9TA 3ITTA 4NAFB 4W7WA 3STPA 3PZQA 4RNIA 4NI8A 3SRKA 4U5KA 4L7ZA 1EYEA 3EAUA 4N4QA 3I3BA 4L9YA 5E09A 3CHFA 4LNYA 2CHNA 4GGHA 4RXFA 3QQ0A 5DMLA 3BLLA 4G7EA 4P8VA 4PFMA 4EE9A 1ITCA 1E6RA 2UBPC 1CENA 2G3FA 4O14A 1KR1A 2E25A 4B9ZA 2DT0A 1FA2A 2J7DA 1CGYA 1L2UA 5HWJA 1ZB5A 1WDRA 3NUKA 3GR7A 3CBWA 4EK7A 2W9MA 5A3HA 5KSWA 1KGUA 1HJQA 5FSEC 2RJHA 4Z2KA 3U48A 1S5MA 2E5CA 3CL6A 5AFDA 4MF4A 2OJPA 5IXEA 1QNRA 2Z6IA 2OGYA 3SADA 1SFSA 3AIVA 2X0YA 3UP8A 4LBSA 3RX2A 1BQCA 4OBSA 4Q33A 3LHTA 3IJ6A 4W93A 3GU1A 5TNVA 1KGWA 3SCOA 1TIWA 3RPTA 1V79A 4C1NB 1VFTA 2EHHA 2GQ8A 2X41A 3NQ7A 3O9NA 2VRKA 5GJNA 4L4MA 4C6EA 4H19A 1RCXB 4HHPA 4WSKA 4WDUA 4KFOA 2PWGA 2WW5A 3TTSA 3FAXA 4O0QA 2HS6A 1EQCA 1OZQA 4FS9A 2GJRA 4ZL1A 2OEJA 1ZBCA 3PJTA 4ATDA 1J6PA 1CB7B 2PBGA 1MRQA 1RJPA 3SJNA 1W8SA 4QE4A 3MZ2A 4D9PA 3ZVIA 4I9AA 3C6CA 4JYFA 1SZGA 1HO4A 1TKKA 1H5YA 1E5NA 4BQ4A 3BJTA 3PVFA 4I6KA 1A5UA 1V3HA 2V69A 4CEXC 3G18A 1YADA 2C91A 1Y5VA 3UXIA 1S39A 2AL1A 1P48A 1XSJA 3LGGA 3C3NA 3W53A 4D6FA 2VHLA 2ASHA 2D20A 2O9RA 4M1BA 4GPNA 3UXDA 4EX4A 3VNJA 1E1CB 3GHUA 2V0TA 1Z7AA 1KCLA 2W27A 1X6NA 4LRTA 1YQ2A 3MV11 5FEPA 3SB0A 1Q6RA 1Y7VA 2OWWA 3WNPA 2QPXA 1A50A 1PKLA 3T6CA 1ZJHA 1TV2A 1MZHA 3UNTA 4D6DA 3IGSA 1WP6A 2ZBTA 3LYEA 2ABAA 3CV6A 3Q65A 1NH6A 3MHGA 1T7LA 4R53A 8XIMA 2BHZA 3UWWA 2XPKA 3H2CA 4PGLA 3LXCA 3RO8A 4C6FA 5MHBA 4L65A 2ZE3A 5EL1A 3BZJA 6PTDA 1CEOA 3CAWA 2NV9A 2P88A 3WK2A 3VPLA 1NEYA 4AF0A 4GNJA 2DORA 4JKLA 5I24A 1FKXA 1UKQA 1XX1A 5C7VA 3IWPA 1F2JA 3KVMA 4Y9AA 4C6KA 4DO4A 1JYXA 5IHRA 1XG4A 2J9YA 4IQEA 1XS2A 3RM8A 3KOWA 4N42A 4WGHA 4R27A 4Z0SA 2PDMA 5BW6A 2ZUSA 4HK6A 2QF8A 2FJUB 3IJDA 3WL1A 1LBMA 2GPTA 1L8PA 4PE8A 5KZ6A 2NUXA 3QV6A 3KRUA 3HQPA 1KRBC 3PPFA 3LI0A 4B4HA 1GVOA 1QCWA 2Z1BA 1I0DA 2Z7GA 3A3HA 3H23A 3RMJA 2I14A 1UJPA 1GEHA 2VZVA 3LUTA 4MB4A 4WVXA 4M6VA 3TQVA 1BTMA 3QC0A 4C6BA 1EXPA 3WDHA 3CPUA 4LUYA 3AIUA 1MEWA 3MY9A 1VQTA 1DJWA 2YL5A 3PZUA 1AW1A 3TN5A 4QXIA 2KX9A 2VR2A 4W88A 3H54A 5E93A 2QW5A 3FKKA 2J75A 3WUBA 2E68A 2XH2A 1X39A 3OQEA 3PZ9A 3AS2A 2HWGA 3WY1A 1AD4A 1BF6A 1O5KA 2BVTA 1TB3A 4DY1A 3KTCA 1UZ4A 4OVXA 3BDKA 1CBGA 2CWNA 1Q66A 4AXNA 4XD5A 2NQLA 1CLKA 4XK2A 1FWHC 1GVYA 1LRTA 2EPKX 3ITYA 2E0PA 4GX9A 1FWEC 3W00A 1KTBA 2YW3A 3M0VA 4J1OA 1P1XA 3SCVA 3AU6A 3FA3A 1A5SA 3BXWA 4QLLA 2NX3A 4D6JA 3NJ3A 5BMWA 4H6QA 3VYLA 3E0IA 4C7DA 4ZQRA 3M0KA 3G3MA 2D2GA 2HBXA 3GYEA 1RQHA 3A4XA 1VKFA 1D3GA 3TFXA 3GAYA 2WSKA 1KFWA 1PIFA 1IE7C 3N3MA 4DELA 1J01A 2CESA 2GSEA 4M3PA 2AQWA 2CLFA 1NDZA 3SY5A 1CI1A 1PE1A 1TV4A 1SJCA 1BWVA 2GGIA 3Q94A 3BSGA 3NQ8A 4JTJA 4IOTA 4HZ7A 4PMUA 3RO6A 3DGRA 3TJIA 1PCWA 3DYOA 2BOGX 2R8WA 2X1TA 3CV2A 4QCFA 4Q32A 4Q8QA 4GO9A 4AZCB 1TTIA 2ZWZA 3KTSA 5BXRA 4R9OA 1VD6A 1XG3A 3KWXA 2A2IA 3FYYA 5ENLA 4YHEA 1JD7A 3W28A 5A6BD 1VLIA 2F84A 4UNLA 3ZLGA 1QK2A 2IUZA 1Q6DA 2WC3A 1E6QM 3M4HA 3OLGA 1XQLA 1GVQA 3GFYA 1F61A 3UZYA 1G7UA 1OF8A 2EG6A 4ZO6A 3PM6A 3I3DA 2PDJA 4GMEA 2XJ7A 1OD8A 5CPLA 3JW7A 4YWIA 3N6HA 3B0XA 3GXFA 2BTMA 3H70A 1ZAHA 2EJ1A 3WLOA 2CW6A 1TPEA 3STEA 4EACA 1TUXA 3WNNA 2GYIA 3QY8A 1GOXA 2V81A 1XBYA 1VBHA 3IVSA 2EG8A 4PMQA 1OY0A 2I1OA 3SY8A 3L0KA 3U6WA 4H9TA 4DJDA 3T2PA 4JKKA 4NASA 1WZAA 2BBFA 4ICMA 1Z89A 2XVKA 2YW4A 5IM51 3AROA 1LWJA 4KCUA 5FA5A 2FVKA 1EDQA 2E9LA 3WD1A 4IIDA 4L6HA 3C0JA 4JTTA 3WJXA 4PC8A 3UZXA 4DPPA 4UMAA 3N3TA 3W07A 3CPRA 3TIMA 4FHAA 2PDXA 3ZT7A 3HF3A 2OFJA 3BLKA 1CZ1A 2RGMA 2OT0A 3QSTA 4P61A 3LCGA 2VEIA 1P5BA 2C15A 2OODA 3NWRA 3WLHA 4AYGA 4QRNA 1E3XA 4K8HA 4C6LA 4DZIA 1XLDA 2BV9A 2AKMA 1OFDA 4LF1A 3AJ7A 1FXQA 4DJDD 5CBJA 4FR6A 1GONA 2YFNA 2E6FA 4HK7A 2XN0A 4UFLA 3VU2A 3URQA 3P93A 5REQA 4C5YA 1P0EA 5D32A 1W1VA 4OUIA 1SO3A 1IGWA 5I23A 1X7IA 3GIYA 1VFMA 1CXLA 3ITCA 2ZXQA 2FDMA 5KITA 4KRUA 3UZWA 4C90A 4AAJA 5GNYA 3QYSA 1JPDX 2W3ZA 3S5OA 4J35A 4F66A 4PEEA 2A1YA 1VGAA 3LXBA 1W5QA 4W86A 4UR7A 2VX7A 1EYWA 1CW2A 4GXMA 1J18A 2VZUA 2F61A 4DNHA 4XKYA 1KM1A 4IMGA 3WLSA 1NWUA 1VAHA 1X1NA 5ABGA 4TO8A 1R3QA 4Z1BA 3TMQA 3VNMA 3RDKA 2PGWA 2YGYA 1WDWA 2ATSA 3H8AA 1KGXA 2X2GA 1SUXA 3T0AA 1ZU8A 2YSWA 2J8FA 5MKGA 1Z48A 3N4FA 4HSNA 1K4GA 2P50A 4FPSA 4WIWA 3PWGA 3KRSA 4PN2A 4PUEA 2D1ZA 3N2MA 3DI0A 1IEQA 4GINA 3HPZA 3MU7A 1YPIA 1VBRA 2ZRXA 3O6CA 3W1UA 3UGRA 1ZAIA 1EJSC 1V3MA 4POCA 4KCVA 5T9CE 4DF0A 3S2NA 4LGXA 4XAFA 4L1XA 1MXDA 3TLQA 3M1ZA 3R5EA 3D0CA 5BU6A 3WENA 2VGGA 4B5UA 3W74A 1EX1A 1LLWA 2CBIA 3DZ1A 1F05A 1RD5A 4KEVA 1KA9F 2YDAA 5E0FA 3TTQA 3NDYA 4CQAA 3PS7A 1LBLA 4XD3A 1W1B1 4EWJA 1GWJA 3QW4B 4AC1X 2UWFA 3LI1A 2AL2A 1X98A 2VZSA 4LC6A 3BTNA 4JX5A 1ADDA 4GJ1A 3GHSA 1PIGA 3E0FA 3UJFA 4PRRA 3TYAA 2QCEA 4MNLA 1ZJAA 2GVJA 1QWGA 4GACA 4CNUA 9CGTA 1EBGA 1NFPA 3L67A 4X63A 4H8HA 3TJ4A 1WCGA 1GTEA 3HN3A 2GOKA 2GK1B 2IPFA 4PMZA 4H9UA 1IXQA 3W38A 4JZ5A 1J10A 4PBGA 3IAQA 3O6YX 5I02A 3KP0A 4HHMA 4B5XA 3E0VA 5JBFA 4GNVA 3SRFA 3GIQA 4NL1A 5AHNA 2P10A 4WHBA 3KTXA 1XICA 4HPHA 4LAKA 4ZFMA 2FJKA 4BR1A 4TMBA 3U2EA 4XSLA 1FWIC 2HK0A 4X60A 2PGEA 3SO7A 5C71A 4UTTC 1BAGA 2F2KA 5AC5A 2F6UA 4IG2B 5T26A 1IWAA 5CC7A 3ZO9A 1AL7A 3WQFA 4YN5A 3WZ0E 1W17A 4ML4A 4IL0A 4PCSA 1EA0A 3K8KA 1JYNA 2DZTA 2G3NA 3ONBA 1KV5A 4IGNA 5LNUA 4LV4A 4ECLA 2Y7EA 3KVLA 4D8LA 5A5WA 4TOQA 1VENA 4AY8A 3MS8A 3TR2A 3KZSA 3KS5A 1VCVA 3LHVA 4DLMA 3G1DA 3WQGA 3FKRA 3FW6A 1RAKA 1NDVA 2DVXA 4O50A 2YYUA 1UMLA 2ZTKA 3G0XA 1HL2A 2BNJA 3M44A 4PBFA 4M51A 1XIJA 3QC3A 2OLAA 3QMRA 3CUFA 1I9CB 5D9MA 5HUPA 3VDBA 4IG2A 4RDVA 3NIYA 2DVUA 4O28A 4FNRA 1W32A 1PYFA 4WDXA 2I17A 4X0NA 5A6KA 2V3GA 3IIPA 2PF0A 3GR8A 5FACA 1WV2A 2I16A 2DP3A 4S3CA 4LUJA 4C1LA 4M1RA 3W2KA 5HK4A 4D1IA 3KOFA 4LYPA 1HKVA 1OT1A 4WXZA 4IISA 3WEZA 1EHAA 4CD7A 1VC4A 4GVHA 5J04A 2YIHA 3P8IA 1ZS2A 5HQLA 3PJUA 4EF9A 3MCMA 3NCOA 3V4BA 2Y24A 7TIMA 2WB5A 1ADSA 1AJZA 4MGGA 3IARA 3OU8A 3ABZA 4JNYA 1PS9A 2PUZA 2E28A 2PC4A 4XKMA 3CUXA 2TAAA 5CPNA 5D09A 1RP9A 4DJFA 1XD0A 1W5NA 1LG2A 4LVFA 1O5QA 2F6KA 3CC1A 4B5SA 1XLJA 3M47A 1F3EA 2XHYA 2PD9A 4AC7C 4RDZA 4I5UA 3GTIA 3QJAA 5I06A 1PKYA 2JIEA 5G1MA 4HA4A 3W7LA 5LIYX 3JR2A 1IQ8A 2WNNA 4AZBA 4LC8A 1IIHA 4O11A 1YRRA 4C6CA 3ERPA 2XFRA 8A3HA 1UQZA 1UD4A 3UG8A 3WQCA 1TJPA 2QUUA 3PZVA 4GYFA 4KERA 3TWAA 5AYXA 3CL8A 2ZZ5A 1B4KA 4NNBA 5KINA 1GOQA 4IGHA 1QI0A 5LIXX 3GTFA 4N9EA 2YZRA 5D2TA 2VEPA 4JEQA 3CIVA 3FJ6A 3LNMA 1QPQA 3TYEA 5LHEA 1YBQA 3WLIA 4BF5A 4LF2A 2J7EA 3SDOA 4Q8VA 4HA3A 2PSNA 1XKJA 4ZA0A 4ZEPA 3O07A 2ZUVA 1EA9C 1RK6A 4L6OA 4J40A 3RU6A 1M03A 3ARYA 1KXVA 4QSHA 2BASA 8TIMA 1TELA 1J5SA 2DZWA 4FLQA 2QJHA 1B3XA 3FV9A 4FNUA 4NNCA 1N8WA 1YDVA 4EVZA 4U28A 1UHVA 4GY1A 3NSXA 2BXZA 4JYEA 3QMSA 1OADA 4N2YA 3VOFA 2YXOA 1E6SM 4E38A 4O8AA 5CAKA 3VDHA 1E1FA 1Q45A 1TJ1A 2BFGA 1C3FA 1U30A 3B97A 3SQLA 2GDUA 3H2OA 2GUUA 3GZ3A 3ZR4A 4HTYA 2RDXA 1Z41A 2OYLA 2HROA 4W7UA 1XBZA 4MYAA 5BXSA 1AUSL 1MEHA 1XDMA 4LX4A 2PAJA 2R82A 4YXGA 5HNUA 4G1NA 3EWUA 3ABQA 3M0YA 3A9BA 1PYMA 1L6SA 2XH7A 4V33A 4PTWA 1TG7A 1FHDA 4KKXA 3GXIA 3ZFHA 4H1ZA 4KRZA 1OZMA 3ZVHA 3U7VA 1RVGA 4DBUA 2OKOA 2REQB 2VWSA 4GISA 3TQPA 5C2GA 1R86A 3KUMA 1VFFA 1JJKA 2Y70A 3AMGA 1KBKA 4H9MA 4O17A 4NYYA 3WDQA 4HA1A 3WLKX 1BGAA 3NM3A 1RD6A 4K39A 1RV8A 2PLMA 3ZS4A 3NQFA 1JDEA 4QM1A 5D8ZA 3OA5A 2EG7A 1K9DA 4AYSA 3IIXA 4NZJA 3TZFA 4I7WA 2E6YA 3P5ZA 3ZIZA 3BAXA 4IMFA 2ZZ7A 2PWHA 3U2OA 5CSSA 2XDFA 2PF8A 2AGKA 2FZDA 2VD8A 1DJXA 3UCQA 4KIEA 1VEOA 2PWDA 1GKPA 3ZLHA 3GW3A 3JVAA 3LMYA 4PTDA 2VGBA 3VIPA 2PDIA 3TA9A 3SAZA 3R2GA 2VOTA 4B3LA 4YVVA 1UP0A 2OTDA 3TSMA 4DZAA 3G77A 1NIUA 2X0HA 1O94A 2O9OA 2IKHA 5FL1A 4DYJA 1RR2A 3EXSA 3C56A 4QS5A 4R7WA 1W0MA 4PRWA 2TRSA 1Q4WA 2RKXA 4QROA 3W1TA 2BY3A 3BLDA 1FCVA 2GQ9A 4WD0A 1T5AA 1OX6A 4JY9A 3AALA 4W89A 4MADA 1R87A 3NL3A 1H1YA 2DW6A 4DO6A 4DHGA 3AO0A 2ADAA 3IRDA 4KEZA 1H7RA 1B9ZA 4XD6A 1KCZA 3L21A 1HKMA 1FDYA 2VJXA 5FAGA 1G6CA 2VQUA 3LRKA 2Q3OA 3GRIA 3MSGA 2MANA 4JQ1A 3B05A 4S1FA 1MI3A 3R1ZA 2BXYA 1CLXA 3CK5A 3D3FA 4YVXA 3JUGA 5D2YA 4NZFA 4NAEB 3KE0A 1XIFA 3LNPA 2J7CA 2C71A 1BPLB 4FNPA 3AXHA 3WBYA 4TIMA 2VC9A 4REQA 3N2CA 2CETA 4QIUA 2OKTA 1POKA 1YHTA 3VZYA 4QQ3A 4J7RA 2X30A 3PZOA 2INEA 4DBDA 5HWNA 3UJRA 5HXMA 1KM0A 3H7VA 3M7WA 2XIBA 3M0LA 1AMYA 1SW3A 1VYRA 3AXXA 5A6SA 3WFAA 1S1RA 4W5ZA 3DOPA 5I3GA 1A5MC 2J7GA 2VC5A 1X38A 2VEFA 5D9NA 1UP3A 3W1PA 1TPFA 3UR7A 1IHIA 2V30A 3DERA 3WK0A 2VEKA 2Y62A 4W85A 5GPRA 1EH9A 4FF5A 4UIOA 3AIEA 4ASTA 1A4MA 3RITA 3TYZA 3WQDA 3KS6A 4FIRA 1DQUA 1XXXA 4PSPA 4PB5A 4KWVA 1NQ6A 1LOQA 3GVGA 4Y9PA 3FX4A 1GG1A 4YPJA 3LU2A 1UB3A 1C7SA 3UBPC 4IIEA 4YCOA 4PUJA 1HG3A 2WANA 3VABA 3S47A 1JNDA 1POJA 4DWDA 2RDTA 1E5JA 2J7FA 3AYSA 1EC7A 1M3UA 2V2HA 3ATZA 3GC5A 2P0IA 4EKJA 2DUAA 5CC6A 4K1GA 3S4TA 2XIOA 1A5OC 3MB9A 3MYOA 3VOGA 4DZHA 1KCXA 5G2IA 3DYPA 2RDWA 3DG3A 4IIHA 1DXFA 2XUCA 1WKDA 1JYWA 4MNJA 1DV7A 3OPSA 2HVNA 3WDPP 4D8AA 1K77A 3BLOA 1R2TA 5FJUA 4Y8EA 1K4HA 4IPLA 4MFEA 4Y9OA 2FTWA 3S6OA 2VOMA 1Y8BA 1RA5A 4D1JA 2XVLA 4C60A 3HPSA 2PZ0A 4Q4PA 3CAKA 3T4WA 5DXXA 4MB3A 1DL3A 1EJVC 2ZXDA 4KESA 3F5KA 4WJXA 3UXKA 3RJYA 3RU8X 4Q8WA 5I00A 1KBBA 3R4IA 1OIFA 3TROA 2OXNA 5GQBA 2PRHA 3EPMA 4B2DD 4GLEA 1V6XA 1GOOA 2R91A 4L64A 3XINA 4JFWA 1V0KA 3CWNA 1GOKA 2PWVA 1ZPTA 5I3HA 3AZTA 3P8JA 5F4WA 3HGJA 4IF2A 1XLGA 1UD2A 4IX2A 3VUSA 1MXGA 1QNVA 2ZUNA 3P6LA 4Q8UA 1X7FA 4BHYA 2ZIDA 3TX9A 1O4UA 1QW7A 3W7DA 2A3HA 4PUKA 3VGGA 3M0ZA 4S2BA 2UY2A 2E3ZA 1IEWA 1GJUA 2X42A 3ZR6A 3H6OA 4IIBA 3CMGA 4DZ5A 1HP5A 4CD8A 1UWUA 4D6EA 4QBXA 3OTRA 4U2ZA 1X6LA 2D69A 1DWFM 3URAA 4XZWA 3RM9A 1OFOA 1HW6A 4JYDA 2Y61A 4J2PA 2XWDA 4Q6XA 1A5LC 4AZ5A 3CV1A 4J3VA 2UY3A 1HF6A 1ONWA 4L56A 1CXFA 1PL9A 1PJ9A 1QAPA 5D02A 1TUFA 1TV5A 1E71M 4GQGA 3BQ6A 3LY0A 3R7MA 1GQJA 1B2YA 4KEMA 3ZXWA 4C6MA 3DFTA 1EC9A 1TPVA 1ZQ5A 1ONRA 4MVAA 2FMOA 3P3BA 2O4MA 4GC3A 4PMDA 5L9FA 4ZOEA 1XFCA 4LU0A 3WUFA 4W8LA 3CIWA 3ABXA 1IR2A 1W9BM 1ZNNA 1LRNA 2OQYA 4GBUA 4X2RA 2VFFA 4QR6A 2PD5A 2BGNE 2GGGA 1DJYA 2OCZA 3MANA 3YPIA 4RLIA 1QOPA 4WY0F 3MJYA 4Z1CA 3H2MA 2GQ3A 1IR1A 4JHMA 3SCRA 2QHAA 3EMCA 2I57A 3EKZA 4HJWA 5C9XA 1H1ZA 2J62A 2H90A 2OEKA 4Z2HA 4IICA 3IV8A 2ZX8A 4NI3A 2VD9A 3B40A 3W6YA 1WOBA 3NQDA 4OT7A 4AW7A 3QOMA 1ZCCA 1ZSXA 1GKQA 4C91A 4OOUA 3NYDA 5LXEA 3N34A 1SVDA 3VGDA 1UWSA 4J3WA 3T81A 3S6DA 1HL9A 2OPJA 1UR4A 3EKLA 1TX0A 3TTYA 1VRXA 4JX4A 4US5D 1NOWA 3L4WA 1MFUA 3LV5A 2WCSA 2FPYA 4GYPC 1GGOA 2CZVA 3F5JA 3SQMA 3GX9A 1U1JA 1SFLA 4OBRA 3TC7A 2QKFA 4LPCA 1C8QA 4QJ5B 4CEUC 5CQ1A 5EMMA 2KZHA 2VGFA 1OFBA 2V5KA 4GIAA 2DJLA 1MYRA 1QPRA 1Z69A 2HVOA 4XUYA 1Q8AA 4O13A 1K70A 2Q3RA 4NT0A 1FHLA 1E43A 2XN1A 5M17A 4GCAA 2EXOA 3SJ3A 1TE1A 2G3JA 1NDYA 1B3ZA 1DJNA 4YVPA 1KC7A 2X1IA 2INFA 2D73A 4GI8A 4E5TA 3P81A 1ISYA 1O95A 2J78A 3RFAA 1BKHA 1FH7A 2QCCA 3HQOA 4BI6A 3FOKA 3T08A 1UR0A 4DN1A 5FCZA 1CIUA 2QPSA 3UNDA 4BS0A 2YXGA 4K38A 4HN4A 4GX8A 3NQVA 2Y85A 1E55A 4O1EA 1H7XA 2P3EA 5E9AA 1CGWA 4LNCA 1VB9A 4IPPA 2QMJA 4XISA 4V28A 2D0HA 1Y5WA 4QNWA 1M6JA 3GXPA 2Q8XA 4F3HA 4LALA 1NM9A 3NZGA 4DI8A 2ZX7A 4GJJA 4MSSA 1ZBWA 4UC5A 2OX1A 4O0KA 4MY8A 3UZZA 4AG0A 1TJ0A 1UCWA 1W1A1 4XX6A 1LT7A 1XIIA 4Z08A 3V5OA 5DELA 2CZDA 4RK8A 1O12A 1LDCA 3L7RA 3OGVA 2HTMA 1VP5A 1KKRA 1QI5A 4JTSA 2G37A 2X7WA 3N29A 1FWWA 4UTHA 5CZJA 3T4CA 3TH6A 1XISA 2QCFA 4DWSB 1E3ZA 2YCLB 5JBEA 2NX9A 1B57A 5IOBA 4S39A 4C7FA 4FZIA 5AYBA 2UZ9A 1X97A 3PZMA 1KLZA 3FDGA 4IP7A 2PDQA 3W7NA 5FD0A 3OIXA 4URIA 3WBWA 1F73A 1XIBA 1YYAA 3A24A 1W1ZA 2IKGA 2UY5A 2HPMA 3A5VA 3VKBA 3RPDA 1ISXA 1JIBA 2NQHA 3KBNA 4PTNA 3GBEA 1HKJA 4XBSA 1T96A 1EJXC 2WXDM 1V93A 2FPVA 3MUIA 1Z6KA 7TAAA 1ZJIA 1KNWA 2E1DA 4IUGA 4D2JA 2XM2A 4PSRA 2QZRA 2VZOA 4ZSTA 2X0SA 1LLZA 1ZTVA 1R3WA 3AFBA 4CKQA 1HX0A 2QGHA 3RUBL 2SFPA 4DO5A 3NQ6A 3ZSTA 1IGSA 3MVIA 3MKCA 4MLJA 2E4TA 1QHZA 4O53A 5EMKA 4FXRA 3GLCA 3USBA 3GNDA 4GD0A 4G7EB 1QTWA 5LZLA 2WHJA 3AHVA 1UOKA 5EA9A 3GD6A 1KM2A 3M5YA 4N9BA 3RNDA 3NOYA 4DJEA 3N25A 5B80A 1OFQA 3H7UA 3IGXA 3QW3A 1Q6EA 1XIDA 4R85A 1W1TA 1EC8A 2HJPA 2W66A 1C8VA 1QO5A 1WZKA 3BSMA 3F4DA 3LLFA 3CM4A 1VFUA 1UOZA 1Z44A 2G4JA 3BCJA 4KWWA 3GNXA 4CGTA 3LQGA 1MO0A 3U4FA 2PZNA 3SN0A 5CG7A 5HR7A 5LHFA 1YNPA 1Q2SA 4G5DA 3AHTA 3WUEA 2XSXA 3LK6A 4UQ9A 4F79A 2VDHA 3QV9A 1QW8A 2FFIA 4G8TA 4HSOA 4EXBA 2V38A 1KBJA 3MQTA 4Q7IA 2ZRWA 3HA1A 3B0YA 1WO2A 1C7TA 4GH1A 4EPKA 1V7YA 3ATYA 1WX0A 5CSRA 3DGBA 4F2BA 3LCLA 3ORWA 1UZ1A 5F2LA 1S2VA 2ZX5A 3GHTA 2C19A 5F2MA 5CCZA 3G8EA 4I6VA 3V36A 3G0UA 1I1XA 2RAGA 1Y0EA 2BOEX 2EF9A 2WSPA 5CZTA 4ACYA 1P6BA 1G94A 4FNSA 2Y8VA 4U33A 2XVGA 3CPGA 4W8AA 3M43A 1AH4A 3GTHA 3MUY1 4A4AA 1F6KA 3K8MA 5FEWA 7PTDA 4RPQA 2I9EA 4LJ3A 2R14A 5HMDA 3TMLA 2XYLA 1OYAA 1OFAA 2DPEA 3W1MA 4DBSA 1F07A 1FWNA 3M6DA 1UR2A 3M0JA 1BLIA 3TXZA 2VYOA 5C70A 4W8BA 3PAOA 3M0IA 5LYRA 3QGKC 1LL6A 3GYCA 3RM4A 3EX3A 5E1QA 3KCLA 4RNJA 4GHRA 3CNYA 3DIPA 4JGDA 1A47A 3SIZA 2X1UA 1SJAA 2B31A 1P0BA 3D47A 2PLJA 1KWKA 3MYPA 3TKFA 5REQB 3O3RA 3W22A 4RX0A 3LD5A 4O19A 3TAOA 3LZ5A 1ML1A 4S3KA 2YLLA 1YE6A 1ISZA 2A79A 4QFUA 2QDGA 4GC4A 3MSRA 3FA4A 3W7OA 3WDIA 2OLHA 1REQA 3WQWA 3M6YA 3U5YA 4UTUA 3R12A 5A2CA 4UTMA 2ZFAA 1XLFA 3PTQA 2IKIA 3JS3A 3C2YA 3A5FA 6CGTA 7CGTA 1V7AA 3GB6A 3SCNA 4RUBA 1YXDA 4LYKA 1M68A 2J77A 1Q6CA 2WMIA 3NEHA 4J9JA 1ONXA 1QNSA 1T41A 4OU1A 3CZGA 4PL1A 3LERA 3B9EA 4OIFA 2IPJA 4JQ3A 5LIKX 1GPWA 4JL2A 2YCJA 3E74A 2D2OA 4JN7A 3WN6A 1NFBA 3KBSA 3M5VA 1GVIA 1C29A 3VK5A 3KXQA 1Z42A 2CWXA 4MAZA 1JRBA 2VFIA 1UWTA 5IFPA 1KD0A 1MEIA 4WRHA 2OYMA 1H61A 1DJIA 4XZMX 3VGFA 4TX8A 3GNRA 1WUFA 4P7OA 2LLEA 2W67A 2FDSA 5DLCA 4W7VA 4HZ8A 4B5VA 3IPWA 1SZRA 1G7VA 1A5KC 4DUWA 4XTIA 1WZMA 4PYSA 4JD4A 2QUTA 2C0HA 5EBUA 5HJXA 3O2LA 1TWZA 4Y9NA 1H50A 4GZ7A 2BVYA 5HNNA 1U83A 1UD6A 1XYMA 4A22A 4BQ3A 1PX3A 2J66A 2QAFA 2QCHA 4TX9A 1R3YA 1XIMA 4MM1A 3RCNA 4C6OA 1E0VA 1V6WA 1J11A 1GKRA 2V5JA 1WXYA 4ENLA 1ODZA 3H2NA 5DMYA 2TMDA 3ZJ6A 3O6DA 4GO8A 4OECA 1JFHA 4IMEA 3SCUA 4BF9A 1AFSA 3W25A 5I03A 4GBDA 2VKZG 4Q8TA 3BSHA 5E5CA 3NM1A 3EYPA 3R0DA 1YTKA 4GK8A 1DWJM 1JZ7A 4FX8A 4MNKA 1DJQA 4XZHA 4LBUA 1CGVA 4JY8A 5DCEA 3ALGA 3CTTA 1O1ZA 3DFHA 1JCXA 5IHSA 2H3DA 2OQHA 1FWAC 2NT1A 2PDYA 3TONA 2Y5JA 3DI1A 4RE2A 2X09A 2E7FA 3BMVA 4ICNA 4IPIA 2CLPA 3UG4A 4NP7A 4G56A 3QY6A 2BLEA 3KOZA 1ISWA 3MKVA 2PGFA 3TU9A 4DLFA 2JFEX 2ZE0A 1FWCC 2X2YA 4O1CA 2Q09A 4AUBA 3EB4A 3CUJA 3MMDA 4DUOA 2W61A 4PEKA 2E5BA 2IKJA 3SN4A 3UF9A 4CN6A 2B81A 3DFNA 1AL8A 4MDOA 1DIOA 1GJWA 3UG3A 4QG6A 1EP3A 4L4PA 3W84A 2G3MA 3F4CA 4PMRA 2PTZA 1MW3A 1OK6A 1K8CA 2PLCA 3BPWA 3L5AA 1OT2A 3OBEA 1P7TB 3LB0A 3GH5A 4LCRA 4ICCX 4UOQA 3ZVHB 3OBKA 3NQAA 3P2VA 3EA1A 4G9PA 3CEPA 4R33A 1UROA 3WQ4A 3E38A 1DHKA 2XINA 1W9XA 4JFVA 5A94A 2EPLX 1MRAA 1OHLA 2C0AA 4ALDA 2I56A 4Q8NA 3SEPA 3CB8A 3TR9A 1FH8A 5CZKA 4B15A 4JTGA 5FJTA 1YKWA 3GG1A 5D2WA 3UVAA 4LVDA 2PRLA 2Y6ZA 3WF2A 3L68A 4WXYA 4DB7A 4BA0A 3LOTA 5BYWA 1W3LA 1KV8A 4ZO8A 4MWAD 3VCRA 2AQOA 4H3DA 3M41A 4ZBCA 1I6NA 2YCLA 1S1PA 2WSYA 1ZP3A 3HJZA 3TSDA 2C79A 4IH3A 1UWAA 4MTVA 3BMXA 3F4WA 3VA8A 3QZEA 4AZ7A 3ZMRA 3TFCA 3BLPX 4I90A 1E40A 1SQ7A 1EP1A 1VHNA 1NELA 4XSMA 3KFTA 4YTUA 4YL2A 1NSJA 1IWBA 3THCA 1E1EA 2ZWYA 3WEOA 2DQWA 3HTWA 1YPFA 2DIJA 4XBJA 4GJIA 1PIIA 1OFRA 3UCCA 2YJQA 3ITGA 4F0HA 1C92A 5D2XA 1TTJA 1JZ2A 1LJYA 3WKZA 3K4WA 3IUHA 2GJXB 2WBKA 3II1A 3ZSSA 1QR7A 4QG8A 3NOEA 3TYUA 2VCBA 3RCYA 1YNQA 3O16A 1UUOA 3A23A 1W6TA 3MP5A 5BOOA 1T6MA 4AWUA 1GCYA 2E40A 2ZQ0A 4UFMA 4H6RA 1A80A 3LEPA 5A95A 2NW0A 3TOPA 3L2LA 4PUWA 1H3GA 3S1XA 1LZOA 3GDKA 3PR2A 3S1UA 3C0LA 4L1GA 2V5DA 1RCOB 1OSEA 1H63A 3OHMB 1C93A 1A0CA 3AMKA 3WJYA 1JEZA 3VIOA 3E49A 3IGUA 2QQ6A 4P7NA 4KMQA 4XUGA 3V7PA 2EPNA 5KZMA 4Z42C 5EMLA 4GFSA 1BWLA 4Z2LA 3QF0A 3QQ1A 1DXEA 5F1VA 4O54A 3GDTA 3B0PA 2OYKA 3D46A 4WDTA 4JHZA 2VR5A 4IMCA 4HMCA 3NO1A 3WL0A 1QWKA 2TPSA 1HO1A 1RJQA 3LDVA 2I5IA 1VHCA 4JIEA 2QF7A 4AY1A 2ZZ4A 3GK0A 5CXPA 2GDVA 3FJ4A 3VMPA 5FF2A 1WBHA 5AHEA 2NZLA 2CBVA 4NJKA 4NXKA 1FH9A 3T1GA 1W54A 3NQBA 2FHCA 6XIMA 3B0UX 1U5VA 1RCQA 2OWCA 2ZZ1A 5M3WA 2BY0A 1OCBA 1R3SA 2Y88A 1GQIA 4QLKA 1EJTC 2YL6A 1WQ5A 1WPCA 3WJSA 3NPUA 4RE3A 5HINA 5K9CA 3G1HA 3VO0A 4HU4A 4DWSC 2CXEA 3ICJA 3RLHA 3WFLA 2PDPA 4XB3A 3W2MA 2PGRA 1T40A 3ITVA 3O06A 4Q8MA 2Z28A 4C1NA 3PNZA 4I9MA 4GCXA 4AMAA 2Z24A 2YCIX 4O12A 5IRPA 4D71A 1FY6A 3BAYA 2CLKA 5BOFA 3HGSA 1JFXA 5DMNA 7REQB 2PTYA 3P67A 1ZGDA 9XIMA 2Z6JA 1Q2RA 3SUTA 3T55A 1DTUA 4NY2A 1WA3A 2ZZ6A 4L4OA 3W1XA 4EXQA 1ECQA 2VCCA 1RVKA 3U2CA 5AC8A 1K7XA 1G69A 2JBMA 4H7CA 1DQXA 3MDUA 4LY4A 3QV7A 1E73M 1FDZA 2ZZ2A 1UKSA 2FZ8A 3EB3A 3QFEA 3LCXA 1KR0A 1AK5A 2NT0A 3BG9A 3CT7A 1Q6GA 4GUJA 4NJGA 1XLKA 2P3ZA 4N6FA 3QPEA 3PF3A 3AUOA 2ZRYA 3M16A 3KLLA 1ZENA 3TOYA 4EANA 2Z2UA 3DENA 3TN6A 1EHNA 2GDQA 4DM2A 3UFYA 1UA3A 1EFZA 2DZPA 4BI7A 3R13A 5LNSA 4HU3A 1YEYA 4YIWA 2Y4SA 4JIPA 4H9ZA 2WMFA 1U1HA 3WK3A 2ISSA 4ZE4A 2E9MA 4MUPA 4QAIA 1BXNA 2A4AA 3N2BA 3U0HA 3B9DA 1RA0A 1GVSA 1UWRA 4AZGA 3QH2A 3UGVA 3W24A 1DIKA 1DVJA 4DM1A 1DPMA 3GXNA 2ZDRA 4MWAE 1BVZA 4A3UA 1H7PA 4C7GA 3CZKA 2X8RA 4MB1A 1Q65A 3A3XA 3BCDA 3VCCA 1HNYA 4NZ5A 4GUGA 2GWGA 4Q7BA 3UYCA 4GIEA 4ZQPA 3QTPA 3OGSA 3W7CA 5EFDA 3MMWA 3EEZA 5DRCA 3W1LA 3E12A 1DXIA 1A3XA 5AHLA 3CZEA 4JTQA 2J7BA 2WSQA 2Z26A 4AXKA 3CB3A 2DSKA 3T7VA 2RGLA 3PN8A 4YLWA 2JKEA 2I7GA 5ABFB 2WZIA 2V82A 2WLYA 5DEZA 1KRAC 1VBGA 3GW0A 1YW1A 3E2VA 4CCCA 3C52A 1KFKA 3WK1A 3VIMA 1W3HA 4BWLA 2QR6A 5BMXA 3GNPA 3FAWA 2D2JA 1OFPA 3M5XA 1J0HA 3CUHA 4O1AA 4N9DA 3SSZA 5A6LA 3N73A 2QJMA 4QDPA 1BG4A 2FYMA 1FOBA 2BVDA 2YA2A 3VVGA 1CT5A 4NNAA 1ZLPA 4S23A 5CPMA 2JGQA 2Z27A 3W1NA 3MBFA 2OZ8A 1OYBA 4YU1A 3VD7A 3FHAA 4MJ4A 5HPOA 2NX1A 3IV3A 2YLAA 3ABOA 1EEXA 4PRTA 4WZHA 5HANA 5I3JA 3S1GA 4KWSA 2D3LA 2VX5A 5GJPA 1M65A 4JXCA 1ZBVA 1EZWA 1PV8A 5U4NA 1FWJC 5D2VA 1VF8A 5C9WA 3OQ8A 4AISA 2DSVA 1EGZA 2C18A 3S1VA 5BRBA 1N8FA 2G97A 4JQ2A 3AYRA 1EDGA 2GJLA 1R3TA 3BGAA 3OVGA 4NU7A 3K30A 3KL0A 3SFWA 4AHPA 1XRFA 1AQ0A 4UTKA 4GY7A 4LUTB 4H6EA 1SW7A 4GUFA 5CGMA 3DBPA 3GR4A 3Q67A 3BUVA 3SCTA 3V3WA 3OVQA 1B3YA 4AZ6A 3QPYA 2EQDA 5G2WA 4RZBA 3VNDA 3A4JA 4EXAA 5E70A 2QYGA 3H12A 4DUXA 1JUBA 1PO9A 1VR6A 4PB4A 3CWOX 1RK5A 4LV9A 1B3VA 4R34A 2A21A 3A3WA 2GWNA 1WE5A 1FWFC 1XLBA 1V4YA 1FWDC 2YA1A 1CPUA 4AMCA 5DF0A 2P53A 4OTKA 5AZ1A 3ES8A 3NFUA 5CC3A 6XIAA 1XYLA 2HNHA 3O0KA 3NGFA 1JZ3A 4K8GA 2XGBA 3SRDA 2HK1A 3TJLA 2G5WA 3T07A 1PZ1A 3IIVA 1IT7A 4KCTA 3WQ8A 5A2BA 5D30A 4OOZA 1WDPA 4WEVX 4HPJA 2VI0A 5HR6A 3HG4A 4WCJA 3TVAA 2EPOA 1M41A 2WNQA 3MMUA 3N4EA 5DANA 1G5AA 2XIJA 1A5NC 3QFWA 1S2TA 2GJNA 3BICA 3BW3A 3IEBA 4UFKA 4MWAC 1QPKA 4HBKA 2WWDA 4AZHA 3DAQA 2ZICA 3DECA 5H8MA 5HAOA 2Y63A 2XSAA 2WVTA 3WQOA 2Z7KA 4PUNA 2PEVA 1I2PA 3PANA 5HQEA 3UWVA 3THAA 3B8SA 4G2DA 2AAAA 2WMKA 4X2PA 4W87A 5AHIA 5CH9A 1TTPA 4AIOA 1V3KA 3I68A 4OBTA 2YL8A 1JCLA 4CUCA 4F9DA 5DCDA 3EDEA 2FQIA 2PP0A 2Z0IA 4CNNA 1Z9AA 5JH1A 3QMTA 4J3ZA 3C0SA 1QDSA 3LPOA 3QLLA 3VNLA 3CZ8A 4S3BA 3HGRA 4AB4A 3UCDA 1Q13A 4FXFA 4B3KA 2D3NA 3I4EA 3TN3A 1ENUA 3VINA 1JULA 2PPGA 4EPEC 1R5YA 3MI2A 2NLIA 4S3GA 1KTNA 4CCDA 3DEQA 3AHXA 1HGYA 5E6ZA 2QV5A 5AYYA 1V51A 1W3NA 4NXSA 4MZ8A 2YKKA 4NVTA 3MMTA 3LBMA 1JI2A 2CCRA 1LP6A 1OB0A 2CLEA 2J6XA 3GSMA 5FJOA 4GFIA 1SSGA 1MUCA 1AVAA 2FHBA 3I6TA 8XIAA 1AG1O 2O9PA 2IXVA 4ZCWA 2IW0A 1CGTA 1HGWA 1QPOA 3N1AA 4RNFA 1ZP4A 4IT1A 1K7EA 2ACSA 2GSHA 2YBVA 1J6OA 3W7KA 3EEGA 3WMBA 3I6RA 3LBCA 3KOYA 4J28A 4JIHA 2PDFA 2ZRVA 1F3TA 1XV8A 2JEQA 5GJMA 4CQCA 3I7RA 1FVPA 3NQ2A 4DIAA 3U7BA 5FOOA 3G1XA 2J27A 4AD3A 4ZOAA 1AZ1A 4K7YA 4IP5A 3W37A 4A05A 1H0IA 8RUCA 1OWQA 3S5YA 3C8FA 3VMOA 4KIRA 1OIMA 1XC4A 4RV3A 4MJMA 4ZENA 4FLSA 3THDA 3EXRA 4C5ZA 4CN1A 3TTEA 4CD4A 2QJJA 4WF7A 1V6TA 7ENLA 2QMKA 3TJXA 4GE8A 3JRKA 4H7VA 4PMYA 3B4YA 4YMZA 5LIWX 1E9YB 5CPSA 3UZJA 5CSYA 2CHOA 4BQ2A 2CBUA 3WLJA 1I45A 4JIIX 1HJWA 4JEJA 4UOZA 3GC4A 4PUUA 1BXBA 1R38A 3H53A 2QCLA 4FX7A 1LM1A 4CVWA 3NDOA 3MHFA 2HMCA 4RDYA 1X6UA 5ABTA 2P0OA 1DWGM 1J8VA 4GWEA 2F6XA 1OG6A 2ISFA 1IZKA 1SMAA 5CPQA 2DJXA 2QPUA 3I7SA 1D8CA 1QJWA 3OO2A 4G6CA 3TC6A 4WOZA 4HOWA 3NAVA 5C5YA 4I7VA 3E0LA 2L5HA 2ZA3A 2WOQA 5JIWA 4A8NA 1WDQA 2HXUA 2QCNA 4E4FA 3A47A 1WDDA 3PG8A 2R9RA 3TXVA 2VVNA 1KW1A 3HMJG 3QHOA 3SBFA 4GZJA 4L1WA 4YCPA 5FF7A 1SPQA 3MBDA 1UBPC 4Y9MA 2C6QA 1RQEA 3ARSA 4K37A 1P1MA 3LM7A 3MA8A 4FA3A 5H91A 5C55A 4MKSA 4O1BA 5G5IA 2HVMA 4GI6A 1GVEA 3E2QA 4GUHA 5XIMA 2XTKA 2QVNA 1OG0A 4CD6A 1LUCB 1QBBA 1TRDA 5HULA 1BFNA 2GOUA 2J8GA 3S5NA 4ZTXA 5D05A 3ANVA 2CYGA 3L0NA 2QCMA 4XZNX 4JFTA 3VNIA 3O6AA 4E2DA 1FCQA 4NF7A 4S3FA 5J8LA 2FVMA 1WXZA 2BP1A 2Z2BA 3OLIA 5CLTA 4HNUA 4HD5A 4W5UA 1EIXA 3EX1A 2WNZA 2PBOA 3KWSA 4K7VA 2ZX6A 4MUZA 1THFD 5MF5A 1PBGA 3V18A 3W73A 3IGHX 4ILSA 1F8IA 3STFA 2YBTA 3V0SA 4HU8A 2G95A 3EX6A 4FAMA 5BWAA 3DN5A 2OWXA 3A13A 4DYEA 1JYVA 2ZXBA 2VRQA 2V63A 3BO9A 3LXAA 4M24A 3SR7A 4QDMA 2CITA 3WELA 3G6LA 4E2OA 4NYUA 2OLSA 4IXHA 8CGTA 1A0DA 3BGGA 2WMIB 1PVNA 2NQ9A 1JPKA 3L4ZA 3ZZ1A 1XLIA 2QIWA 3PUEA 3M9YA 1G1YA 4AD5A 3D5HA 3UEQA 4BJHA 5HBFA 2HCVA 4N6EA 3LCHA 4HMDA 3UVIA 4HIBA 4PMVA 3LHUA 3VNZA 1EO7A 3C86A 4B5TA 3QR3A 2OO0A 4Q4MA 3W7IA 3ZWTA 3C3UA 2WJDA 3N14A 4ZODA 4MAVA 4ML9A 5EPDA 3KEHA 1J0JA 3W7HA 3HURA 2QULA 4O16A 3WF0A 1U5JA 2X1RA 3H22A 3RR4A 2WYSA 4AZCA 2QCGA 1IIGA 2ZXAA 4J3TA 3N4AA 3RXZA 2YL9A 3LMZA 3FXGA 4A3QA 2NV1A 3W0KA 5JU6A 5HJYA 3PBWA 1SU5A 1DWIM 3R8GA 2V68A 3G5EA 1K02A 1XPGA 1R9XA 1NF7A 7A3HA 2F7FA 4XZBA 2FZBA 1HZYA 1XLMA 2WKGA 4IQDA 2NQJA 3VILA 3KHDA 1XR2A 4GA8A 3MC5A 4R5EA 1QRQA 4OV9A 3QSRA 4HNLA 1QMLA 4BEUA 1ITXA 3GFZA 1XJBA 1XCFA 3SURA 3W7JA 5H8PA 1LRQA 3AXIA 3FK4A 3QKEA 4FIQA 2GL5A 4EF8A 4S3AA 5BNKA 4TUFA 4NKCA 2FFCA 2FHFA 3CU2A 3VDAA 3WLMA 1KBLA 3O0FA 4LTSA 2OGJA 1EO5A 3URBA 2NVAA 4U3AA 5M1TA 5A8MA 1Q7QA 4IFKB 2YA0A 3C2RA 3DKLA 1UWQA 4K1WA 3GO2A 1OGSA 3PJXA 2X40A 3RRXA 3N15A 3STGA 1OBAA 4DBWA 4V27A 4UBPC 1P6CA 1M9HA 3VIIA 4B3ZA 2YOCA 3BK0A 3R10A 5F4XA 3LCIA 1CTNA 3VIGA 1XBVA 4JPGA 4HPNA 4H8VA 3APTA 4M82A 4WJ8A 3VI2A 3LBOA 1B31A 3CIXA 2ALDA 4N02A 2JKAA 4N4PA 2XISA 1CCWB 1DBTA 1PTDA 1GG0A 3KBMA 1D3CA 1A49A 1MQPA 1V8EA 2QIIA 3WLTA 4ZR8A 1VJSA 4RJEA 3GXTA 1OGBA 3W76A 1XDJA 3GIPA 5LXXA 1JPIA 1R46A 5FESA 3B4UA 4XVEA 3FXYA 5FSDC 4HYRA 3VIKA 3PPHA 3EDKA 4WX2A 2AAMA 2PS2A 1WB0A 4JFUA 2XU2A 2WVSA 2ZTJA 5K9XA 2XZ7A 1V6YA 1D9EA 1UH3A 1BYDA 1BSLA 1XSKA 2CKRA 1X8CA 1YDNA 4PTMA 3OG2A 4N7QA 4MDPA 4HZ6A 2PE4A 3HGOA 3EOOA 1FWRA 1KKOA 3KDOA 1IEIA 1KRCC 2H6RA 4DUVA 2A3BA 1JDCA 4ZB2A 1F3WA 2REQA 1TWSA 1FFRA 4B16A 4WDWA 3UJSA 3FVDA 4UTWC 3R89A 1E6PA 2VTFA 2RFGA 4XIMA 4B2DA 1UR8A 2OB3A 1BXCA 2J13A 3S2LA 3PY2A 1QASA 3RHGA 1J79A 1I2OA 4GZIA 2WJZA 3GS6A 4D6GA 3EWDA 4QDWA 3UETA 1XSIA 1NF0A 1VEPA 4DJFD 4E4UA 3MUZ1 3CL7A 3FEQA 2JK2A 5DX7A 4QE5A 3ARPA 2P76A 3HG2A 1UKOA 5AKQA 1UP2A 2AGTA 2DQXA 3DKJA 5I6SA 2POZA 4ZMGA 1OC7A 3EWYA 4MFDA 1V6VA 4A2RA 4TV5A 4LCSA 5HUOA 3W7RA 4ERAA 3HFYA 3WQEA 3F1QA 1DORA 1GZJA 1V08A 3GU2A 3EDJA 5FIPA 1XHGA 2W0UA 3PB2A 2VCAA 4QLJA 4GABA 1CDGA 1LF1A 3GXDA 3P14A 3S42A 3TUUA 3ARXA 3BVJA 3SRHA 3HV8A 4PUDA 3TYBA 5HMEA 3WEMA 1LCOA 3LRLA 3R25A 1PZ3A 3W1RA 4Q4KA 4TXEA 2V3EA 1EF2A 3G1VA 1UC4A 4WR3A 4WSJA 3SGZA 2VELA 3TLLA 1TR9A 1FUYA 1PKMA 4Q4SA 1TA3A 2WM1A 4C6JA 1VPXA 1I2NA 1OJXA 5HQMA 3EWWA 1J0KA 2B7NA 4U2YA 3P0WA 2ZUWA 4JL1A 4LANA 3IS4A 2BWGA 3AUJA 5D9OA 4XV0A 1WAUA 3CGTA 3GBDA 1LOSA 2D22A 2V5CA 1WYIA 3O7UA 2ZOXA 3LLDA 6REQA 4P8WA 1BYAA 5CG0A 2HEJA 4IFRA 5BRQA 1VEMA 2IQ0A 1QBAA 3MDWA 3WNKA 4QP0A 1XCXA 4MIMA 1RJRA 2W6RA 2VFHA 1W9VA 1TVNA 2YX0A 1ZBKA 2ZA1A 5G4WA 1JCNA 3ARTA 1Y65A 1IEXA 3W26A 1TCDA 3APYA 2R1PA 4IXXA 3NQMA 1XLHA 5FEZA 3T8LA 3W2JA 4LAOA 3NR0A 3QGVA 3V1HA 1MSSA 1WKYA 5AHFA 1GZ1A 2PTDA 1XD1A 2CEQA 3G1FA 1FFQA 4LFYA 3AS3A 1MDRA 4X9SA 4J3XA 2DU2A 4AY7A 1AA1B 5G1TA 3M7SA 3QRHA 3FYOA 4D6CA 1GK8A 1XYZA 3AICA 4NAEA 4F2UA 1O5XA 1OGGA 3W23A 2FH6A 1PSCA 2XSBA 4XZ9A 2P8CA 3B8UA 1Z8AA 2E8YA 2WC7A 2WMJA 1U2YA 1A5CA 4HCLA 3NVDA 3WD4A 4NJHA 4XAGA 4WKAA 2XWEA 3EA2A 5FJJA 2C16A 2A3LA 1LL7A 3EDFA 2DZSA 2DV0A 4KF1A 2Q8LA 2PTWA 5AVNA 1IZCA 1YDYA 5CJNA 2OR2A 3T42A 3AYVA 2EJAA 1K3UA 4NAFA 3CXOA 4N0RA 2BB0A 3EWBX 4GYJA 2A85A 1G67A 3GUGA 1F6YA 2CLHA 1SSDA 7REQA 1G4TA 2G4FA 3IK4A 1E0WA 3GNNA 2O7QA 4NX5A 4F0MA 5JBDA 4W4QA 1VYSX 1GHSA 5DO8A 3LPPA 4JNZA 4FOJA 1E72M 4NJJA 1EJRC 1T0OA 2C13A 2FTYA 3GDBA 3RG6A 4J3SA 4Y90A 5XINA 5E0CA 5DRIA 3M5ZA 4BK9A 4UOJA 1RBLA 4OV4A 1UIPA 1KBIA 1W31A 4QEHA 1HVXA 4NIRA 4HNNA 1TSIA 5A6JA 1UJQA 1EKOA 2ESCA 3EXTA 3F7JA 3QY7A 3WLPA 4Q3MA 4O0ZA 4MY9A 2AMGA 3LCWA 2XZ9A 1CX9A 1CGXA 3E96A 3TQKA 3WH7A 4UTTA 1E6NA 3WD2A 4UTIA 5I3DA 3FVMA 1PZ0A 3M0MA 1T8QA 3I10A 3TE9A 4IFOA 4Y6GA 4MMWA 4HSHA 1NVMA 2VL4A 1EPXA 3VOIA 3FY1A 3KCOA 2PA6A 4AF0B 3KL5A 1KXTA 4RR4A 4AEOA 4ZO7A 5FKYA 1KFEA 4DAFA 3CQ0A 1O5RA 4QHRA 2WLZA 1TMQA 5FI8A 4PMJA 2VRJA 4JBRA 5TIMA 1TV7A 1Q8JA 2WO5A 1XLLA 3FSUA 2HSAA 3P62A 4M7TA 1QXLA 4FSAA 3HQ1A 4GQBA 5DY2A 3WQ6A 3QTGA 3AIWA 9RUBA 2DSWA 3NZPA 4H04A 1PDYA 1BD0A 1C91A 3BAJA 1HP4A 1FQ0A 2PDBA 5IDIA 4CNPA 3NO5A 2Y7GA 1FCBA 4RL3A 2FZMA 2O0TA 3ANYA 1HFBA 3WCZA 1US0A 4RDWA 5TF0A 3DHUA 2A7PA 4QNEA 4BF7A 3HIJA 4HP5A 4YJ5A 1PWLA 3SW6A 3IACA 1L6FA 4HJFA 1IWPA 6TIMA 5TAOA 3U9IA 1B3OA 2DZAA 5KZDA 1ADOA 4DAIA 3V35A 1TZ7A 3DUGA 4B92A 1LBFA 3GVVA 3PG9A 1G0CA 3E9AA 1Z3NA 2CC0A 2UY4A 3OZPA 3KX6A 3W1QA 1TX2A 4ZOCA 3EX4A 2NVCA 4AIEA 3ZYZA 2NUYA 3HO8A 4DJFC 3P0XA 4I9TA 1XDLA 2BODX 1R47A 1HQTA 1HIZA 4UTFA 3STCA 3C4UA 2H3BA 3NQGA 4AD1A 4M19A 2FPTA 4H9YA 1XGZA 4Z0JA 3DFPA 2J25A 2R24A 2C7FA 3VE7A 1BHGA 1UUMA 1SR9A 1KQZA 1RY0A 5TD4A 5BXTA 5HPCA 4JICA 1S5NA 5I7GA 5CJ5A 1Q5MA 1W3IA 3RAOA 1RLDA 2BHUA 5U7SA 3TCEA 3E2SA 4AWTA 5C0QA 6REQB 5C9UA 3UD6A 1CWYA 1VJIA 3VNYA 3BL3A 3R6IA 1BVNP 1M7OA 3RGTA 3KDNA 2WV8A 4K2SA 3HPAA 2WHLA 4JOMA 4DBEA 1TA3B 1V6UA 2DIEA 5JUVA 4O1FA 1A5BA 4CLMA 4A35A 2HE5A 2Q71A 4ROPA 4ATLA 1S2CA 3GG8A 3FHQA 2AQVA 1K7FA 2Z1SA 3IUIA 1D2KA 3E5PA 1P7TA 2R1MA 4AQLA 4Y2WA 1F76A 1B3WA 4K36A 1F74A 2IXUA 2EO7A 2D0GA 2HDJA 2VR4A 4GQQA 3N9RA 2WKJA 4S3EA 4BWLC 4HB7A 1V3LA 5C6MA 2BZNA 1UW9A 2GK1A 3CLWA 4ZVJA 4Q6JA 3LHYA 3AAMA 3RX4A 3NXFA 4ZZ9A 1A53A 1TYGA 3BG3A 4CNSA 3AQUA 1HUVA 2VQTA 1EJWC 1HJVA 1TPUA 3DU0A 4O4WA 4GZEA 3GE7A 4Z1DA 2QVHA 2VM8A 4GGBA 4H00A 1NFGA 1ME9A 2E6AA 3JU2A 2GSJA 2NQ5A 2OMAA 3LN3A 1PZ2A 1QHPA 1NOFA 4IZGA 5DBUA 4M5PA 1G01A 3NQCA 1KCKA 2GZXA 5A69A 3BURA 4MNMA 1ZY9A 3RYSA 4FOKA 3OODA 4JTHA 4L6DA 4NHVA 3RPMA 3HV9A 1F3XA 4P2VA 4XVDA 3WQ5A 2QJGA 1ITUA 2YBUA 4IIFA 2PWUA 2B7PA 3L12A 3CAQA 3OA3A 1BQGA 5BOEA 1R85A 3W2UA 4WOQA 1XP3A 3DC8A 1S2AA 2BGQA 1ONEA 4JN6A 4CU7A 3O1NA 4KEUA 4UMCA 1TMHA 1D3HA 4IIGA 3H4WA 3K2GA 4IL2A 4DPQA 2GQAA 2ZADA 4AVFA 5HMSA 3VCNA 2BMBA 3K5XA 2AOSA 3L4YA 1FKWA 3BOFA 5ABFA 3WLNA 1JCTA 1LTDA 1RP8A 2Z25A 3N12A 4WKFA 1MDLA 4GYKA 4HYWA 1AH0A 1DYSA 4JTIA 3S2MA 1EQPA 5I0DA 4MZYA 3VOJA 4E2VA 2CIPA 5BRPA 1HT6A 3SY1A 3HM7A 1UWIA 1KXHA 2DZVA 2WBGA 3SI9A 4R7JA 1M53A 1RALA 4AD0A 1QO2A 3PUDA 5JVLA 3B06A 3N2XA 4WSHA 5AC6A 1QI2A 2PWEA 4D8ZA 4HNTA 1QK0A 3WDJA 3KZPA 3QZAA 2DW7A 3SGGA 3NURA 2NUWA 1M7PA 4Y7EA 2JF7A 2PC8A 4ACZB 2OZTA 3OOQA 1LORA 2DVTA 3E02A 3EZ4A 4U3CA 1UR1A 3VZZA 3TP4A 3RIKA 3MZNA 4NZ1A 4GVGA 4A3HA 2VEMA 1W5OA 1TV8A 1CGUA 3IJIA 3M0HA 5IDZA 5K4ZA 5FL0A 3DESA 5J5DA 5HOSA 3UU0A 3TA6A 1KM4A 3R79A 1KTCA 3DC0A 3OVRA 1A0EA 3MCOA 1XINA 3NL6A 3NPXA 1JAKA 2VX6A 1GTHA 3TSBA 1DJHA 3F4VA 5H2ZA 3P5YA 1QT1A 3S1WA 5T9BG 1P0NA 3ZQ9A 2J24A 2J79A 3VC6A 1P0DA 1B0IA 1AZ2A 2V8ZA 2YZ5A 3BV4A 1UC5A 3LQLA 5CBIA 1H62A 1ODUA 3AWNA 4RE4A 3U3HA 2VNCA 2XFFA 2J74A 3L4XA 1TQJA 4AD2A 1ITQA 3FJNA 4A29A 4DX3A 3KBWA 1W1IE 4YWSA 1K9EA 4BFAA 1LYXA 1F6PA 5PTDA 5HMFA 4LAUA 2F9RA 4XAZA 3CO8A 1JXKA 2ZUMA 4MB5A 3GM8A 2IQDA 2ZX9A 4BQ5A 3DG7A 5EMJA 1E6ZA 3WX7A 3OGRA 4UFJA 1W2PA 3A12A 4CU8A 1LWHA 1E6XM 1AQFA 1H49A 3PTDA 4P7RA 4QITA 3WDRA 5CGTA 2E8ZA 2A6NA 3ITOA 3G6MA 1FX6A 2VWTA 3GDMA 1PAMA 2VXNA 2J9XA 4TTUA 1LOLA 2W63A 3SUSA 2ATMA 2WCGA 2WMGA 4LS2A 5C9ZA 1A5AA 3N18A 2NXIA 4LWWA 1FBAA 4XZLX 4EIVA 2Z2AA 1JGMA 4REQB 1N7KA 4O52A 5A6TC 5FJPA 3EWZA 1QNQA 2FGZA 2OQLA 3S9ZA 4LUSA 3F2BA 3VIHA 3EOLA 5I07A 5KMYA 3U5UA 1Q85A 3MUXA 3A4WA 2E67A 4IP4A 4GKTA 4O1DA 1E0UA 3VMNA 5SWUA 1ICQA 2JEPA 3VIFA 3V16A 2GVGA 2G8ZA 3G1RA 3UESA 2G41A 2HZGA 4FMVA 1VS1A 3VGHA 1XL9A 1XPYA 1T8XA 1NWTA 1AQMA 3R8RA 2GUYA 3S2CA 1LG1A 2DH2A 2JKPA 3UPMA 4JNMA 5GVJA 3MW7A 3NGJA 5C7HA 3UZ5A 2OOFA 1WZLA 2QJNA 4V1XA 2PWFA 3ID7A 5E9XA 3T78A 4INFA 2FGLA 5I2UA 3PTMA 2OOGA 3ZM8A 3W9ZA 2GGJA 3N19B 4YHGA 1B5TA 3UWZA 4PCPA 3PB0A 2OZ0A 1MWOA 4IHCA 3BMWA 3G0SA 3O15A 4H4IA 3CQIA 1HKIA 2QUVA 2G50A 2DZXA 3L0GA 3AMDA 1J96A 2DGAA 1ME8A 3AS0A 1NWSA 5CBBA 1B1YA 3PBUA 1G9HA 4PTVA 2VT0A 3B3DA 3WQVA 1KRMA 3EDDA 3VKJA 3VFLA 1XLAA 2C1IA 2DSZA 1QHOA 4UQCA 1SJDA 1BTCA 4FB7A 1RZMA 3PUGA 4MKNA 4U31A 1YTDA 5D37A 1LT8A 1KFLA 3WBXA 4U5IA 1UYQA 1D7KA 2BY2A 4UQAA 3IAPA 3QEZA 4NZCA 1TO3A 3CYVA 1CXEA 3LRMA 3ZJKA 2HISA 4GOAA 1OVDA 1L2QA 4XIAA 3OLDA 3FA5A 3I4KA 3RLUA 3EOUA 4NILA 2G3IA 2J4GA 3QYQA 3AZRA 3BLIA 3EOSA 1ZRQA 2R1NA 4RPPA 2EPMX 1FCUA 3TW7A 4AEEA 1XH2A 4RNHA 4MHBA 3L65A 4O15A 3POHA 4A8IA 2OX4A 1MW1A 2QXWA 3MJMA 1XRSA 3AI0A 3MCNA 3UJEA 1OCJA 1UQYA 1QI3A 1D8WA 2ON3A 2ZVRA 1VJZA 4PH6A 5A6AA 1RH9A 4AZIA 1SO6A 3GY1A 4QTGA 3E1F1 4FO4A 1YPXA 3T0BA 3MP4A 4X3ZA 5AYIA 3UW6A 3H4XA 4I3GA 1GUVA 4QJ4B 2Z00A 3GAKA 2J7HA 2ONEA 4KFNA 2VUYA 5CKSA 2HPIA 2QAPA 5CC5A 4XQ6A 3DYMA 5CPOA 3LX9A 3OP2A 1OX4B 3L5MA 5AN7A 2DDXA 4Q7NA 4H2CA 2V67A 1TV3A 3U2ZA 1HJXA 3BLFA 3EPNA 4CNOA 2IPGA 5MKGB 1HXJA 1SO4A 1US3A 1FWSA 4XO6A 3CAVA 3W75A 3GKAA 4PTXA 4Q4QA 3VNKA 5HWMA 2CZEA 5FF4A 3W01A 2QGYA 3LHZA 2X16A 1KLYA 3HJEA 3AMCA 1I1WA 5AY7A 4EAMA 1RPXA 1ALDA 5AC7A 1E4MM 1ECEA 4KWOA 6TAAA 2YCEA 4ES4A 4OWGA 1GPFA 3B04A 1C90A 2F2HA 3DHDA 3EB2A 3VIJA 2BOFX 3NTYA 1BF2A 2Y5SA 4I7UA 1VCGA 1VFSA 3B9NA 2OSWA 2PP1A 5LIUX 4E6MA 3GXMA 5C2CA 4MKVA 3C2EA 4L9ZA 1JAEA 1QPNA 3K1DA 5JXQA 4H7ZA 1J0ZA 4MG4A 3FGCB 3OG3A 1JL8A 4IPNB 1S38A 3DHPA 4P8XA 4W9TA 3VOCA 1DIEA 5I5RA 5FAJA 1VFOA 2BDQA 3P61A 3L4TA 1XUZA 3S3GA 3BLEA 2HRWA 1WKFA 3OVPA 1JCYA 3LS9A 1NY1A 3RK8A 3TV8A 1L6YA 1X8FA 3ARWA 1O1HA 3F2DA 1N82A 4TTGA 1DHPA 4S38A 4XWUA 4K8EA 5B7YA 3S9IA 4LUTA 2A3EA 5F1UA 2XFWA 5F2IA 2P1FA 2Z1WA 1E15A 3K4DA 2YDSA 4KFPA 3CZLA 3T2OA 1GQNA 4S3DA 1CYGA 4QE1A 3LENA 4F8XA 5EMYA 4PZVA 3SCPA 3K8LA 5C8BB 3VM5A 2J47A 4AU0A 3ZWSA 3PHAA 1D7FA 1FP8A 5A8OA 4A6GA 3DHFA 3S83A 1I75A 2BY1A 1YXCA 4DNMA 3IRSA 4TV6A 2OELA 4RZ5A 2CLOA 4C65A 3CEUA 5C9RA 4I9JA 4XG1A 1E9ZB 3NZQA 3SUUA 4GQ0A 4JFSA 5I3FA 3WH9A 5D33A 3GQYA 2FLIA 4GH3A 3F2CA 4PULA 4WLCA 4A3YA 4HOXA 4ZO9A 4WJEA 3PC0A 1EJ7L 1MFVA 1YDOA 1LUCA 2GLKA 1SZEA 1FWGC 1IXPA 1TJRA 1W37A 3N6QA 1WXJA 2VX4A 3QBUA 1KWGA 4BY3A 4AHQA 1S3TC 5DXYA 4XO7A 4TQTA 2PLKA 2YCKX 3PTKA 4NRSA 2NWSA 3CUGA 5CJMA 3QV8A 4KPLA 1L9WA 3O8AA 2ZRUA 4HVXA 1V0NA 1BKSA 3LTSA 2PMQA 4EPBC 3B8DA 4C6IA 3QM3A 1MNZA 4AEFA 1XCWA 2ZC1A 3GNOA 4RZ6A 5H8UA 1MVYA 2QLYA 3U57A 3SCWA 4QX4A 4L61A 1EPVA 3WJZA 1HJUA 3Q45A 1GVFA 1YXYA 4GXWA 4O4VA 4CVUA 4MWAA 3EKGA 1E56A 2QUNA 3IJ7A 4LUIA 4RKAA 1S5WA 3SN1A 1JF5A 1H1NA 1JXJA 1VYPX 3NG3A 2VDIA 1BSIA 1TQXA 1JDAA 4KBXA 1B9BA 3IJ8A 2XVNA 3PZIA 3CJPA 4WQ6A 4Z2JA 4CU6A 3EMQA 4ZQCA 2WJEA 5AOUA 1PTAA 3VGEA 2Y8UA 4FP1A 4DF2A 3R8HA 4IGMA 4M0XA 2ABBA 1TWWA 1PWMA 1FDJA 1KM3A 3DH7A 3HMCA 3S5ZA 2EPHA 5CLWA 3KM8A 3QOKA 3LHWA 4US6A 3ZJ8A 4O18A 4UNIA 3VE9A 2DUZA 2DFAA 3Q4DA 1CECA 2R1LA 2XFYA 2QCDB 2YDRA 1SGJA 1PHQA 4PFHA 3W71A 4KCWA 3NPWA 5D04C 2ZDSA 4A21A 3L4UA 4GKLA 1KFCA 2DZUA 2Q02A 3CS2A 3LTYA 2YDQA 2V9DA 1J0IA 3SCQA 1AODA 3SZ8A 5IBXC 3Q58A 3H26A 3GWQA 1RBOB 4AVOA 1XIGA 3WQPA 1FXPA 1U1UA 2AL2B 3TN4A 1R2RA 3FS2A 3GDRA 4JTKA 3UPWA 1W3JA 5CPTA 3TNOA 3LA4A 3WIJA 4F0SA 1K8YA 2PDWA 3G22A 3Q2DA 3SQSA 4IM4A 2E09A 1DKWA 1VIWA 3PK7A 1OF6A 4TU1A 2Q6ZA 1OC5A 4TR9A 1UPPA 3GG7A 4LVAA 4ZSUA 4QGCA 3W3OA 2GJPA 1XQKA 4HPXA 1E9IA 4IMDA 4DVOA 5DCBA 4GQRA 4Q4OA 3NO3A 4NSBA 2QCDA 1JF6A 1JZ8A 1C9DA 1V3IA 3ZJ7A 3TWBA 3D3AA 1OQFA 1Q7MA 1YTEA 3AC0A 3L23A 4QSFA 3ABRA 3DCPA 2PP3A 2B0MA 3JZEA 1GVRA 1MQQA 3UXLA 3NSMA 3BWWA 4CCEA 3B8VA 3ONCA 3E5BA 3FCPA 1G4EA 1OABA 1H7OA 3W7GA 1UA7A 4YTSA 2A7NA 1VIZA 4OE7A 2EEXA 5CAHA 4R88A 1VRDA 2INZA 2E6DA 4HZMA 3T44A 2OZ3A 1V0MA 1CXKA 2DH3A 3H4GA 4OUEA 1V02E 4A8LA 3CH0A 1MMFA 4LEFA 2KAUC 3BG5A 3QLDA 4WY0A 3DFYA 2VENA 2EKCA 4LY8A 1QUMA 4X22A 1HL8A 2MUCA 1V3JA 3QKZA 3B0VC 3L4VA 3MVTA 1P43A 4DJDC 4N9CA 1H0GA 1TPB1 4AVNA 3H2FA 1X1ZA 5DT7A 3LG3A 3WFZA 4Y8FA 2YB4A 1O6IA 5EY5A 3KBJA 3AMLA 4RCXA 2OU4A 1L6GA 1PHWA 4DJED 4PCNA 4LXFA 5DBTA 2HNEA 1PB0A 3H55A 4LOCA 3WYZA 2ISWA 2WAGA 2PCQA 3PBMA 5FEXA 2VC6A 1AMKA 3ALFA 4D72A 3SGUA 2HQAA 5G2HA 2D24A 1F8MA 2RJGA 3W02A 4ZXLA 2FGBA 4J5NA 4LYQA 1E1CA 3VX0A 1H09A 1SMDA 1GW9A 1L8NA 3MHUA 2YFOA 1JG9A 3CMJA 2Y1HA 3P74A 2ZUUA 1S2WA 4TX6A 3QN3A 2TYSA 3BV7A 3BCFA 5A6BA 3Q37A 2H8ZA 4F4RA 1J2BA 4HU0A 1IZJA 1N8IA 4KH2A 4AWEA 5K7JA 3MV01 1VCFA 3BJSA 2CXGA 4IPJA 1LQ2A 2PDCA 4PL2A 3CZJA 1AJ0A 1JVNA 1BWKA 3WNMA 3TYCA 2C14A 3LPFA 1R6WA 5L6UA 3MSYA 2G96A 5A8PA 3L66A 2R6OA 1V02A 4HHLA 4AH7A 3DX5A 2BX7A 2ZA2A 1I60A 3LLXA 1FWTA 1JZ4A 1KB3A 3QPZA 2FKPA 4QG9A 5I79A 1DP0A 4CQ8A 4UB9A 3BAIA 1U33A 2Y7FA 3W7MA 4ERIA 4S3JA 1PDZA 2ALRA 5HA7A 3ISIX 1KM5A 1R30A 4GY0A 2XH4A 1H2JA 5JIPA 2CZFA 1JRCA 3KLKA 3CWHA 3AISA 1Q6OA 5C54A 3UWUA 5EFFA 3CH9A 5ABEA 4FNTA 2WVVB 2HS8A 1XH0A 3QVQA 2VURA 4Q4RA 1P4CA 3WJWA 4C6QA 3C2OA 1RY8A 2POTA 4GNKB 4YYCA 4JKMA 5LA0A 3VD4A 2Y7DA 1UMYA 4DXXA 3ARQA 4KRTA 3POCA 1VFLA 3PBYA 1S5TA 1REQB 4CN4A 2V3DA 4ZE5A 3UXAA 3T8QA 1XIHA 1EX5A 2J9ZA 3CHVA 1ME7A 1G4SA 4B90A 4JHOA 1EL3A 1XF0A 2O92A 1EBHA 1DJZA 1W3TA 4B5NA 2B7OA 4FEZA 3PBGA 5ECVA 2W62A 2H9AB 4FI4A 4UTJA 3H2EA 3URNA 4OFCA 4PMXA 3S46A 2GVEA 3IIZA 3OLEA 1KXQA 1NWRA 3BOLA 3HOJA 1UZDA 4HHHA 1BRLB 3FN9A 1K1DA 1ESWA 3REQA 2HE8A 4MPKA 1TZZA 2IQTA 4LT9A 1S5VA 3OZMA 2ISDA 5AECA 1J9YA 2E9BA 3CHEA 4TVCA 1UIOA 2JGYA 1UBSA 1E51A 3WLLA 1DEDA 3W6MA 2DIKA 5BZAA 1RUSA 5BU9A 3TDFA 1EWEA 2XN2A 4CD5A 3F4NA 3S2JA 1U22A 6ENLA 3VD3A 3CUIA 3W86A 2WQPA 2FB3A 4V1YA 3S9YA 1H7NA 2X7VA 1H41A 1YLVA 3E6EA 3ZLFA 3MTWA 1JPMA 3DFSA 4HTBA 1JD9A 1CLVA 3N2TA 3C5QA 4TMCA 3GVWA 3R11A 4Z2GA 4RZ4A 4IJCA 1TREA 2H8XA 1TPWA 4PBEA 4HN8A 3RRAA 3EWCA 3IANA 3CT2A 4Y96A 3FGCA 4KGLA 1OD0A 2VMFA 2IS7A 2ZC8A 2CZ5A 4Q22A 1SFTA 4JX6A 2PTXA 4WK9A 3XIMA 2PDHA 1F4HA 1EXBA 1W3KA 2DT3A 3R0KA 3T9PA 4HMNA 3AHZA 2YR1A 3CQJA 5I3KA 1S3HA 2OO6A 1HVQA 2BS9A 1R9YA 3MUAA 3N9KA 4JIQA 1J0YA 5G1YA 4B4FA 3UWYA 2WNWA 3I7QA 3B03A 3SIMA 3PSVA 1H51A 5XIAA 4LAZA 5FF0A 1QNOA 2UV8G 4RE0A 5A8NA 3EMZA 3GHRA 5J5RA 2CERA 2V5LA 3GC2A 1UD5A 3ABSA 1XYCA 3R0UA 1JQVA 2GVYA 3S8HA 3F03K 2NSOA 1MW0A 3UG5A 1Q7ZA 4PUMA 1DE5A 3NL5A 4FALA 3B9OA 4HPGA 1V77A 4ONVA 4FNQA 1RQBA 1P6WA 3FSTA 1OX4A 2PDNA 4E8DA 2JQXA 2QV4A 4HA0A 2J88A 3QQWA 3ZR5A 1WKEA 5H1WA 4NRRA 3K1GA 4LYRA 4FK9A 3DG6A 3QHNA 3ME3A 3A4AA 2CLIA 1M1BA 4PODA 4JCLA 3OHIA 3K4AA 1R3VA 1CNVA 5DT5A 1GNXA 4R3UA 4K68A 4YNGA 3BQ5A 4L80A 1TVPA 4EOUA 3UERA 3QZ6A 3VM7A 4BEQA 1XRTA 2QDEA 2HXTA 5T8GA 3WMLA 4GYPA 2EBNA 3EWXA 2XIQA 4AHOA 3WH6A 4ZOBA 4UQBA 1SW0A 1GYNA 4M80A 3WG6A 1E0TA 4L4LA 5T91A 3TNBA 3FEMA 1EB3A 3G1SA 4MLRA 1XH1A 4H9VA 2PDKA 4ZGYA 2A0NA 3ECQA 1K9TA 5K3VA 1I2RA 2FH8A 5G4HC 2HBVA 4OJYA 5A2AA 3SM0A 1RPKA 1JR1A 3PP7A 4LW7A 1KO0A 3F5LA 1BYBA 3BOXA 3T2QA 2I5QA 3TW9A 3IJQA 3V0TA 1MNSA 2PFHA 1P0KA 1NARA 4UNKA 2J6VA 1F9CA 3QR0A 2Y8KA 5CZ0A 5E0KA 4JIRA 3CO4A 1K9FA 1XI3A 5LSMA 2PDGA 2DT2A 4GVIA 5LNWA 4XKYB 1PKNA 1YIXA 3OIHA 2OSYA 4LSBA 4DF1A 2WKLA 1SZFA 3VZXA 3ITXA 1TZ9A 4JAWA 5F2GA 3NVTA 5FJRA 1EJUC 1US2A 5GNZA 4C6PA 4NG3A 3BAWA 3HU7A 4P7QA 2Z29A 3MKKA 4E0CA 4E2BA 3A22A 4NJIA 5IFTA 1KFBA 3B8WA 4DEFA 2WPBA 3FFSA 1OYCA 1B54A 1PCKA 2WMHA 3N13A 3UR2A 3BW4A 4HKPA 1XRVA 1GYLA 1S2UA 3NEVA 3NZ1A 3W70A 1GT8A 4PCTA 1UKPA 4D6IA 3NDZA 4FXSA 1CB2A 3WBEA 2WCAA 2ISVA 4PMNA 4L9XA 1ZZMA 1WUEA 4GIYA 4EP8C 7XIMA 3W87A 3IVTA 3VKCA 1VPQA 3DDMA 3OEXA 1EDTA 3W72A 4ROQA 3OB8A 1QVBA 3MWCA 3AJXA 2B7QA 4GIRA 1WNOA 2ZUTA 3T0DA 3N17A 4YTRA 3EOEA 1BEUA 1GOWA 4MJ2A 3TCSA 3WUGA 4HNVA 2FMNA 1GOMA 2VVSA 3W6LA 3AHYA 4K3ZA 3M46A 2QDHA 3MSDA 2E5DA 4BZYA 1XIEA 1UKTA 4NZ3A 3AIQA 2WQDA 3COTA 4LAMA 1V03A 1ICPA 3UT0A 4Z1YA 5F4SA 1OCQA 2VO5A 4B9YA 3HPFA 1NOUA 3A21A 3DXIA 4DJEC 4AD4A 2Q01A 1JGIA 4E8CA 5LGXA 1TTQA 3ZOAA 5EMUA 1VBJA 3WNOA 3WMSA 1EGVA 4F2TA 4E8GA 4WKHA 3GVRA 3WBAA 4JS3A 3O63A 4UR8A 3H7RA 2I9UA 1PEZA 4HK5A 4OKDA 1TR1A 3LCFA 5A1AA 4DO7A 5KTLA 1WDSA 1XYFA 2GGHA 4JN8A 3N6JA 2RUSA 1R0MA 4QJ1A 1JCJA 4LVBA 3ZT6A 4IFKA 3LSCA 1Q6QA 1SO5A 3UQNA 4QQUA 1NU5A 1TCMA 1N2VA 2F8QA 4A2SA 2JE8A 4W84A 2A3AA 1CXIA 1JZ6A 2ANUA 3AXKA 4R9XA 1TIMA 4M6PA 4EPDC 3UWQA 4H8UA 2WVVA 4JTFA 4UTWA 1W1YA 3VFCA 1HN1A 3W83A 1W5PA 3SFKA 5JMUA 1UZHA 3FIGA 1XGDA 1GOIA 1F4AA 3MWAA 2IMRA 3MO7A 1HKKA 1X96A 5DQPA 2RHGA 1J4EA 1BYCA 2JIWA 1LQ0A 5K4XA 4ZTYA 1AW5A 3PWAA 4I8YA 1DWHM 3GUWA 3WH8A 4LB4A 1L0PA 5AC4A 1ELSA 3I6EA 4ZQNA 2DZBA 2PI6A 1XYBA 4I5RA 2BG5A 2V5BA 4HOZA 3AIRA 3P7YA 3FNDA 4NX0A 3OYZA 4KGJA 1ZALA 1NP2A 4J3UA 3NXLA 1HJSA 2NWRA 4UZUA 3MT1A 3QHM