3QLDA

Structure of probable mandelate racemase (aalaa1draft_2112) from alicyclobacillus acidocaldarius
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
383
structure length
383
Chain Sequence
SLQTCVLHRLSLPLKFPMRTAHGHIREKQAILVQLVDADGIEGWSECVALAEPTYTEECTDTAWVMLVHHLVPRFARWLRAASQDQDVDPRTVCEALRDVRGNRMSVAAIEMAVWDWYAARTGQPLVGLLGGGRDRVEVSATLGMSESLDVLIQSVDAAVEQGFRRVKLKIAPGRDRAAIKAVRLRYPDLAIAADANGSYRPEDAPVLRQLDAYDLQFIEQPLPEDDWFDLAKLQASLRTPVCLDESVRSVRELKLTARLGAARVLNVKPGRLGGFGATLRALDVAGEAGMAAWVGGMYETGVGRVHGLIAAALPLMRYATDLGPSDRYFEQDVLKEPIAFVEPGVIQVPQCAGVADWVDRDAVRRFSTATWSVDLRTLEGHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mandelate racemase/muconate lactonizing protein
publication title Structure of Probable Mandelate Racemase (AaLAA1DRAFT_2112) from Alicyclobacillus Acidocaldarius
rcsb
source organism Alicyclobacillus acidocaldarius laa1
molecule tags Isomerase
total genus 117
structure length 383
sequence length 383
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3qldA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3qldA01
2PTWA 2P88A 3R10A 4YWSA 2I5QA 2XH7A 3FJ4A 1TZZA 2OQHA 3NXLA 4ZCWA 3MY9A 5FJTA 2OKTA 3FVDA 2AKMA 2HZGA 3RCYA 2XH0A 4X2PA 3OZYA 3TWBA 2PODA 4E6MA 3QLDA 3EKGA 3BJSA 3CT2A 2QGYA 2P8BA 3TWAA 2GGJA 3D46A 4JN8A 1PDZA 2PCEA 4GGBA 4F4RA 3IJQA 3B97A 3IJIA 1KKOA 2PA6A 3R0UA 5FJRA 5FJPA 2OZTA 3VC6A 2POZA 3NO1A 3OPSA 3ZVHA 1R6WA 4E4FA 3RGTA 1FHUA 5ENLA 4G7FA 1TKKA 3H70A 3FV9A 2FYMA 3NZGA 3NFUA 3DGBA 3R0KA 2HXUA 3TJIA 3ZLFA 3H12A 1OEPA 3QPEA 4IHCA 3N6JA 3D47A 2NQLA 1ECQA 3DEQA 2ZADA 3N6HA 2PMQA 2XH4A 4GYPC 1R0MA 3CYJA 3S5SA 2OVLA 1KD0A 4IZGA 4H19A 4A35A 2OLAA 3TTEA 3UXLA 4E5TA 3HPFA 3UGVA 3JVAA 4MGGA 3RRAA 4HPNA 1F9CA 3QKEA 3TQPA 3UJEA 4IP5A 3THUA 4JN7A 4GMEA 3MZNA 2QJNA 3JZUA 2PU1A 4IL0A 2QVHA 1IYXA 4GGHA 2PGEA 3FYYA 4E8GA 4E4UA 2DW6A 3UJSA 1JDFA 4KT2A 4H2HA 3RO6A 3S47A 4K1WA 4HCDA 3CB3A 3PWIA 4IL2A 4DX3A 1WUFA 3P3BA 3SN4A 1EBGA 3GY1A 3OW1A 4GISA 3MQTA 3SSZA 3QN3A 2PSNA 2GGIA 2PGWA 3ZLGA 2AKZA 2MNRA 3I6EA 3K1GA 2P0IA 4Z1YA 3SQSA 2GGEA 4K8GA 1MRAA 4A6GA 2OFJA 3EEZA 2OX4A 1MUCA 2AL2B 3P93A 3H7VA 2HNEA 3V5FA 3N4FA 3SN1A 1EC7A 3P0WA 3RR1A 3N4EA 1JPDX 2HXTA 4HCHA 2XSXA 4HCLA 5BOEA 4HN8A 3ES8A 4GIRA 4H83A 4ROPA 1XPYA 1ONEA 3T4WA 1MNSA 4MMWA 3ENLA 1JCTA 4MKSA 4ZA0A 2GL5A 4DYEA 4DWDA 1FHVA 4KWSA 4JHMA 3UJRA 2FKPA 1P43A 3MKCA 2OZ3A 2AL2A 4HNLA 4EWJA 4J3ZA 2QQ6A 2GGGA 3T8QA 3PFRA 3CAWA 2PS2A 4KPLA 6ENLA 4DXKA 4J1OA 3FXGA 3DESA 1L8PA 3DG7A 3VA8A 1MDRA 3SN0A 3TCSA 2PPGA 2P3ZA 2MUCA 3GC2A 3UJ2A 2O56A 3VCNA 3DERA 4Z17A 3VDGA 3H8AA 4HYRA 3TOYA 3DG3A 2PTZA 2P8CA 3JW7A 3R25A 3QTPA 7ENLA 3V4BA 2PU0A 3OTRA 3R11A 4IP4A 3TJ4A 3OZMA 3BOXA 3I6TA 4HNCA 3I4KA 1EC9A 4FI4A 1RVKA 3PWGA 2GGHA 2ONEA 4FP1A 4GYPA 2OZ8A 3R1ZA 2OPJA 5FJUA 2PTXA 3RITA 2OG9A 3VFCA 3BSMA 3DG6A 5BOFA 3MSYA 3UJFA 1DTNA 3UXKA 2CHRA 1KKRA 1SJCA 2RDXA 2XGZA 4IT1A 1XS2A 4G8TA 1W6TA 3ES7A 3MUCA 3CXOA 3DIPA 2PP3A 5FJOA 1YEYA 3IJLA 3ZVIA 3TW9A 3VCCA 3ZLHA 1BQGA 2PP0A 2DW7A 3PK7A 1TE6A 1ELSA 2AL1A 3IK4A 1NU5A 3T6CA 5J04A 3UCCA 1WUEA 2PTYA 3SBFA 3SJNA 3UCDA 3MWCA 4DN1A 2GDQA 1EC8A 2XH2A 3DFYA 4H1ZA 3GO2A 2GSHA 2QDDA 4A3RA 3U4FA 3OP2A 3V3WA 4K2SA 4KEMA 3KUMA 1EBHA 3GD6A 4GFIA 1PDYA 1SJBA 3V5CA 1MDLA 2ZC8A 3Q45A 3T9PA 3Q4DA 3DDMA 4M0XA 4ENLA 1BKHA 1E9IA 3FCPA 3CK5A 2PP1A 3U9IA 2OO6A 2QJJA 2QJMA 1SJDA 3VC5A 1NELA 3DFHA 1P48A 5EU9A 4M6UA 1JPMA 5IDZA 1SJAA 4DHGA 2OQYA 3STPA 1KCZA 2QDEA 3ZVHB
chains in the Genus database with same CATH superfamily
3E0IA 2VCBA 1RALA 1FFVC 4RNFA 4YWSA 2ZRXA 1VYRA 4YS1A 2H9AA 3F4NA 5HXMA 5LSMA 4LANA 2WNZA 2W63A 5I02A 3WLMA 3O6YX 2ZRWA 4B2DD 3VNKA 1FKWA 4C7FA 1UR0A 1H41A 2QAEA 3W83A 5A95A 3WBYA 4D71A 4CNPA 4H9YA 5A8NA 3OVGA 1XLDA 2BVDA 4IJBA 2Y0FA 3A24A 5AZ1A 2HDJA 5I78A 3SFWA 1M6JA 4F9JA 1Z6KA 3CH0A 1SZEA 3LNMA 2ZKMX 5JBDA 5K9DA 5FJPA 3LCHA 4AIUA 3ID7A 4ZQRA 3B8WA 1GVQA 2IKHA 3S1GA 4FXRA 3TC7A 3WLHA 3PPCA 4ATDA 3CUHA 4IICA 3XINA 3THAA 4ZFMA 2AGTA 4G7FA 3NFUA 3PUGA 7TAAA 2EKCA 3BLOA 1F3EA 4MB4A 1OVDA 5D4YA 1MQPA 4A4AA 1YLVA 2YCLA 3S1VA 2IKGA 4QDMA 1SM9A 1GXFA 2RUSA 3WH6A 4Q6XA 3F5JA 4H19A 1JXKA 2ZXQA 3TTEA 4NG3A 2DH2A 3USZA 1YDYA 4LUJA 3JVAA 1IR2A 1R85A 3E49A 1QPNA 3GR7A 2V3FA 1TV3A 1V93A 3P6LA 2WPFA 4CU8A 1IIGA 1VQZA 2QJNA 4JTTA 1HF6A 3AI0A 4PCNA 4YHEA 3ZO9A 1BVZA 4F79A 4UTJA 4IQJA 4EPDC 3D9XA 3BVJA 4NEWA 5C5YA 3WL0A 1NHPA 4RW3A 3N2TA 1L6GA 3G1RA 5AC7A 1VYSX 3GH5A 3MJMA 3DXIA 4DZIA 4NHVA 3OO2A 5HQMA 4AX6A 1SUXA 3KWXA 4MZYA 4OV4A 5DCBA 1UPMB 2Y5EA 3R5EA 1QATA 3SN4A 1PIGA 2DZBA 3N17A 4XZ9A 4AC7C 4R88A 4W7UA 2X30A 2YDRA 4O14A 3MDUA 3IUIA 4QNWA 2Z2BA 3A6OA 3BG3A 4DXXA 4C6EA 2OX4A 1EP3A 2V3GA 2VC9A 5C7HA 3WIJA 1CIUA 1PZ1A 1TG7A 1FA2A 4XBJA 3NVZB 3RR1A 1GRTA 2CKRA 1SVDA 2X42A 1N61C 1UIPA 3XIMA 5EL1A 3SQMA 4S3JA 2YBTA 3CMGA 4GOAA 1E1CA 2X16A 1HGWA 3P60A 1PX4A 1MI3A 5HMDA 5LGZA 2A21A 4CD4A 2G3MA 3ARTA 1EP1A 1BKSA 1K7EA 1KRMA 5EBAA 4PA8A 3M43A 2F2KA 2UWFA 1CEOA 1W5QA 1FWJC 1TPVA 3VABA 1XBZA 4HNOA 1XLGA 5IHSA 2XYLA 3EXSA 1JF6A 1GOQA 4R9XA 4B5NA 1I2QA 2ZZ2A 4JTAA 4XQ6A 2XIMA 3G8RA 1XCFA 3L4ZA 4O1FA 3BL3A 2W27A 4RX0A 2DSZA 5D9OA 1W1B1 4Y9NA 4P7LA 4PUUA 4GYJA 2OSWA 4M6VA 1WYGA 3MUZ1 1WXYA 5FIPA 2RHGA 5ECVA 1NWTA 4MJZA 2I16A 3W2UA 1GPWA 4JIHA 1IWAA 3B9AA 1IEVA 1ZMCA 1LCOA 2P8CA 2BZNA 2PDLA 2WZEA 2DZPA 3P62A 2AMGA 1VFOA 3GFXA 3ZJKA 1RK5A 1TR1A 3B40A 1FUYA 4C5ZA 5H2ZA 4DNAA 4CQAA 3T09A 5EYWA 3W1XA 1DXLA 1MYRA 5LXEA 4AZIA 5JXQA 1LJYA 4LYPA 2WANA 3QLLA 2CC0A 1Q8JA 3PTQA 4AYGA 2A3HA 3B0UX 1QI4A 3BZJA 1YQZA 2QXWA 4XAGA 2GPTA 4UR7A 4AWUA 1TSIA 2EQ7A 3KVKA 2G97A 2RDXA 5DY2A 4FLQA 4YTUA 1QCWA 3O9NA 2ON3A 3QHNA 2PD5A 1KFLA 4J56A 4NAFB 4JIQA 2PP0A 3PK7A 3UWYA 1FP9A 3P81A 3CH9A 4BWLC 5A5WA 4KWUA 4IIGA 3KRBA 3UXIA 3G1VA 3UCDA 2YYUA 2WO5A 1I0BA 3G3DA 1F3WA 1P6BA 2QDDA 2Z6JA 1BYAA 2L5HA 3QKZA 4GBDA 1H09A 3IUDA 2FTYA 4M1RA 1E9ZB 2DUAA 2FDMA 4DELA 5LGXA 1VBGA 4O12A 1YMYA 2WHLA 4ACZB 1B4KA 1MDLA 1JDCA 1VCVA 2ZE3A 1O1ZA 3GVVA 4GJJA 4QSHA 4BV6A 3ZMRA 1M03A 1UROA 2ZFAA 4Z0JA 3RF9A 3AMLA 1PTDA 1UA3A 4DAFA 3PUDA 3U2OA 5A2AA 5DRCA 2C19A 1VQTA 2QJMA 3VZXA 3UR7A 1F3PA 2E5DA 4D6GA 3L5OA 4ERIA 3K30A 5D32A 3YPIA 1TO3A 4LCSA 3DC0A 9XIMA 1DXFA 4AXNA 3PB0A 4JNZA 3FIGA 1XSIA 2NXGA 1W17A 4KRZA 4AD0A 4AF0A 1XRSA 3VCRA 2CLHA 3U48A 1IWPA 1FBAA 1F7BA 2CLIA 1OGBA 3FKRA 2GJXA 2J7FA 3MANA 2OSYA 4XAZA 2O9OA 4GK8A 3FJNA 3NR0A 2J47A 5CJ5A 4YMZA 3TVAA 2J3NA 2QGYA 1L9WA 3D6NA 2BLEA 3DI1A 2XFYA 3NVDA 3ITXA 3TWAA 4AH7A 3LUTA 3P7YA 1CXIA 2C3ZA 2J6XA 1XGZA 2TYSA 4MSSA 2A1YA 1KCKA 4H8HA 1I2RA 3IJIA 3CTTA 1CGUA 3ISIX 1S7MA 4O1BA 3CB8A 1R7AA 3NYDA 1C91A 3H7RA 5T8GA 1WKEA 2X40A 2WZTA 4AB4A 1PWMA 3IUHA 4H4YA 2E3ZA 2YA1A 3NDOA 5C9WA 3L8KA 3WUBA 3V36A 3KLJA 3LCGA 2SFPA 3NGFA 3LGDA 1EGZA 3GNOA 4R7JA 1KD0A 1VHNA 5XIAA 1OBAA 4IGHA 3O8AA 3E9AA 1WV2A 4EQXA 1KLZA 1SZFA 4KRUA 5I00A 3B9JB 1FQ0A 1OSEA 4JTDA 3AM9A 1EYEA 2C79A 3HQ1A 4UQDA 1V6YA 2ZOXA 1RUSA 3HJEA 5AHIA 5D9MA 3BWWA 4X0NA 1RQEA 2ZYFA 2FPTA 4W7VA 2YVJA 2WOQA 2HSAA 1LQ2A 2BY2A 2IUZA 1D9EA 4LEQA 4DO5A 3NPXA 3HGOA 4DM1A 4XIAA 2J6VA 4MAZA 5CC3A 1KCLA 2J7CA 3VTRA 3WX7A 4L4OA 1EYWA 1N63C 2C18A 2Z29A 3HG3A 5A6JA 2ACRA 4B5TA 3DAQA 3H6OA 3IJ8A 3G0SA 4JX4A 2F38A 4Q4RA 1O5XA 2O9TA 1D3CA 4BA0A 1Z3NA 1UC5A 3L5MA 3AMKA 4PE8A 2J9ZA 1LF1A 1T6MA 1Z9AA 1IZCA 3OZPA 1B3WA 1Q6EA 3TTQA 3A47A 3TA9A 3EDEA 3PNZA 4AZCA 3P93A 2JF7A 1W0MA 3WMSA 3M5YA 4AYSA 1EGMA 4ADWA 3S6TA 2CKSA 2DVUA 4I5XA 4KEVA 3W84A 1OADA 3GXIA 3IIVA 1NARA 3VPLA 1T40A 3HB9A 4KWVA 2DQWA 1AD1A 1AJZA 4GIRA 5F2GA 1EB3A 4XZIA 3STFA 3VKDA 1EJVC 3AIUA 3W07A 3ARYA 3RM4A 1ZALA 4L6OA 1JDDA 1E6XM 3L0GA 1A5MC 4R7OA 3KRZA 1RHCA 4NXKA 3AIWA 1XH0A 1UG6A 2YA0A 1OINA 5HDRA 2BGSA 1K4QA 4NJHA 4HNLA 3UF9A 1K1DA 1UWIA 2CLOA 3AXXA 4ZO8A 3BLLA 3QM3A 1PHWA 4CQDA 2X0YA 1XRTA 5CJNA 2NVAA 3LPPA 3DG7A 3UZWA 1GNXA 2ZZ6A 3H7UA 3MSDA 2R1KA 1Q1RA 1ME9A 1XIJA 3UJ2A 1CLVA 3QOMA 2PZNA 5AHLA 4GC3A 3GKFA 1RD5A 3W29A 4HNVA 2J9XA 5JIPA 4OBRA 4UQEA 3DGRA 3TDFA 1TWWA 1CENA 2GUUA 1NHRA 1VCFA 1B0IA 3BOLA 2V3BA 1NP0A 5CPNA 3IS4A 4DQWA 4KCVA 2VGGA 4ZO7A 1E6PA 2J7EA 4C1NB 5ER0A 2FDSA 5AZ0A 3W85A 4C6CA 2BC0A 1XYMA 2PBGA 4JHOA 2CBIA 4OUIA 1XP3A 4WGHA 1QI5A 1BXCA 1EL3A 3TTYA 4UFKA 3EXRA 3H54A 3DK9A 3MHFA 2XIIA 4FR6A 3OG2A 4G7EA 1W1IE 1LBFA 3UXKA 3EAUA 1KM2A 3S5ZA 3GTXA 1HJVA 4WSKA 1ZGDA 2VX6A 1JYNA 3W1RA 5FJOA 4H7ZA 4CLMA 1XHGA 1T96A 3UA3A 1C92A 4LUIA 1ZENA 4WOQA 2ZA2A 4UTFA 2PD9A 1UMYA 3R7MA 1NU5A 5IRPA 2YBUA 4CCDA 4C6LA 3LTSA 5F4SA 3SJNA 5BYWA 3LS9A 3O0KA 1T99A 1HL9A 1OX4B 4ORIA 3VMOA 2QMKA 3AHTA 4L9YA 1TV5A 6XIMA 1B3VA 2EEXA 3M6DA 1R2TA 1E4LA 3TKFA 1ONWA 4C6MA 3CHVA 3ABRA 2G5WA 5H6HA 3IIZA 3PF3A 1QASA 1WBJA 1QR7A 2ZRZA 1W3KA 2YDAA 1LM1A 1HKWA 1V7YA 3FCPA 3JZEA 3VUPA 4UIOA 4HTYA 4OU1A 4PEEA 4LC8A 3LSCA 3NTYA 1FH9A 2ALDA 5HWMA 2NQZA 1G7UA 4IH3A 2QDEA 3ZVHB 3BDKA 1P0EA 1WXZA 1Q65A 4X60A 5CZJA 3EPNA 3UETA 4JKMA 5GNXA 3PZOA 4N7QA 3WLPA 2QJGA 4WKHA 3W1MA 1QJWA 3WLTA 1POJA 1CPUA 1JXJA 5JH1A 3FVDA 3H2NA 4Q4KA 3LHVA 1O94A 4G5DA 3ZZ1A 5KZ6A 3NCOA 2TPRA 4IPJA 1G4TA 3BJSA 4EM4A 2QAFA 3S8HA 1AG1O 3W7RA 3GDRA 1DJYA 3URAA 1V77A 3NL2A 3WF2A 5I79A 4L56A 1LRNA 5DX7A 1ENUA 3UR5A 1SO6A 2X09A 1O1HA 4M6PA 1KM3A 3NA8A 2ZUNA 3VINA 4NQ1A 4IIEA 3R0KA 4U5IA 1M3UA 1VRXA 1P1MA 4PB5A 3PULA 1B3YA 1VFSA 1L2QA 2ZUUA 5LNUA 3MPGA 1Y8BA 5DT7A 3EX2A 3K4AA 4MKVA 3ZOAA 3LD5A 4MWAB 1CGVA 2YW3A 1FEBA 1GSNA 5E70A 1TA3A 4E3VA 4E2OA 1FXQA 4UUIA 3OGVA 4WY0A 5T91A 3EOUA 1J96A 2QIWA 5C9ZA 3GVQA 3SGGA 4W89A 2IKIA 3QV8A 2QHAA 3H2FA 4AZ7A 4HJWA 4D6FA 3APGA 4IIFA 1R3QA 3WK3A 4N6EA 5I3FA 1O66A 1DQWA 2YCIX 4YNGA 1RY8A 1KA9F 4G1NA 2XIBA 3A3XA 1F6YA 1PKLA 1NVMA 1I9CB 3LMZA 1JDFA 1TCDA 1S5NA 2YCJA 3M64A 4WD0A 1X8FA 1S2TA 3CB3A 1MWOA 1RVGA 5ABFA 4UOZA 4JDRA 1ZB5A 3P3BA 4TO8A 2EXOA 4LV9A 3AJXA 2YCEA 1HJXA 1S3HA 4LBRA 3PG6A 4HTBA 4GO9A 3LK6A 2XN2A 2KAUC 2R1MA 5HAOA 1QHPA 2AKZA 4AWTA 4TQTA 1NP2A 2JFEX 2UBPC 1NDVA 1W8SA 4C7GA 1VPQA 1H5YA 1JYVA 2Y4SA 1QPRA 3D0CA 3OBAA 3TUUA 1OX5A 3IJ9A 3UQNA 5AN7A 3WQ4A 3AIRA 4IMDA 4H7VA 3W9ZA 4C6QA 2DEPA 1TUFA 3O0FA 4XZMX 3STEA 1NM9A 4GJIA 3FS2A 4Z2KA 2R94A 3PBUA 4MF4A 4WSJA 3ENLA 1GOWA 3PPFA 3EWDA 3MCNA 3HV9A 1PKNA 1GOIA 1X38A 3B8IA 3IWPA 1F4HA 4C7DA 1YADA 3CGDA 2ZZ7A 1GTHA 1QI0A 3KLKA 1K4GA 4UTHA 3BG9A 4L6DA 3ARQA 1X2GA 4HK5A 4AQLA 3CZGA 1RP9A 4KWWA 4ZFCA 3N34A 1YTKA 3I7RA 3USBA 1UIOA 3OYXA 5PTDA 3T8QA 1XLBA 2B4GA 4XO6A 2X99A 3VIKA 1DV7A 1OT2A 2OGJA 1PZ2A 3CUZA 4IIBA 2FPYA 5DANA 3PZQA 3UZ5A 4HVXA 3I68A 4DI9A 5JBEA 3QRHA 3B05A 4JIEA 2BG5A 2MUCA 4LNYA 4UR9A 3VXGA 5FOOA 5HPCA 3L4YA 1XC6A 3A9BA 3IJ7A 2F6XA 1H7XA 1JRCA 3H4XA 1Z89A 1WQ5A 5HNUA 4JXCA 3SUSA 2ZXBA 2DJXA 1PCWA 3DG3A 1T5AA 3NYZA 4H7CA 3AYTA 2ZZBA 2BBFA 3LLXA 5LKYA 1W3HA 4DF1A 2V5KA 3CUGA 1GVYA 4DWSC 7CGTA 5DMLA 8A3HA 3WDPP 4HNCA 3I4KA 1PKMA 4XKYA 4KCWA 1EO5A 4J3VA 3N13A 1RY0A 4JR5A 1UUQA 1YTDA 2E68A 3WKZA 4OTKA 2OPJA 1HNYA 1PTAA 2EKGA 1WDSA 2JALA 4Q8OA 2ZRUA 2ZZCA 3GAYA 2VUYA 3PSWA 5BMXA 3FFSA 5BOFA 1U33A 3V35A 1OF6A 4YWIA 4H4TA 2CHRA 3VD3A 2PWDA 3FYPA 1KCXA 3OQ8A 1TE1A 5IFTA 2O9RA 3OHIA 1LG2A 3TA6A 4H9VA 1GORA 3IJLA 2PWHA 3ZXWA 2GVGA 4UOJA 5D02A 3VGHA 1NDWA 1XIIA 4S1FA 4FNRA 3VNDA 3UNTA 5J04A 1QNVA 5E9AA 1ZU8A 4HOXA 2FZ8A 4LJ3A 3WEZA 4H8UA 2WQDA 5MF5A 4H1ZA 4A8NA 2VGFA 3MSRA 4RDYA 5ABEA 4DM2A 1QFEA 2GWNA 3BJTA 3F7JA 4KEMA 1XJBA 2A4AA 1TWDA 4AG0A 3H2AA 4JTRA 3N11A 2DT2A 1D7FA 1EBHA 3CQKA 1BSLA 5DMMA 3FG2P 1WDDA 3SRDA 1JROA 3AS2A 1DORA 1GEQA 2YA2A 2VKZG 2D69A 5JRBA 5A6AA 3IGSA 1PX8A 1WDPA 1AFSA 3CYVA 4J3SA 1A4MA 1OZMA 3LXCA 3WNLA 1PCKA 1HJUA 3DFHA 3ELFA 4QEEA 3RXZA 4K37A 2C1HA 3STCA 5HMEA 1JPMA 2E8ZA 3LENA 2FVLA 1TFVA 3T0TA 1P6CA 5I3HA 5E09A 2BHZA 4PMVA 4GD0A 3RLGA 4QLKA 4GUJA 3WMCA 2HPMA 2GDUA 2PTDA 1DJIA 4WKAA 1J0IA 3ZWTA 1XLIA 3WNKA 1C29A 1MEIA 2WMKA 5M2FX 3GDLA 4JIIX 2FB2A 2RFGA 3TWBA 3FEQA 3OZOA 2HK0A 4TVCA 1AQ0A 2ASHA 1GQLA 3GC4A 1Q7MA 1YDNA 3UWZA 2TPSA 3UU0A 2JQXA 4A3HA 4HYVA 5I24A 2PLMA 4JQ1A 3DN5A 1DQXA 1QT1A 2F84A 3PJUA 2VENA 3W82A 2E77A 2FTPA 4N0RA 4BEQA 3QMRA 2D24A 4G56A 4JDYA 3TXVA 1DJHA 1GHSA 1UJPA 4IFKA 1ZZMA 2QR6A 3T2OA 1NSJA 1PIIA 5KETA 2V6AA 2C3CA 2DSVA 2XVNA 4DLFA 4NJKA 1TV2A 1DHKA 4C6PA 3LEPA 1U1JA 3D47A 3CGEA 1GYMA 4Z2LA 1ODZA 3WJXA 4LB4A 1UR2A 1PL9A 4J40A 3ZIZA 1TJ0A 3A64A 3BGJA 3K46A 2ZE0A 1KXTA 4LVBA 1XIHA 4F2UA 1QVBA 1FVPA 4WR3A 4IF2A 4TV6A 5I09A 3RRAA 3IVSA 4K8HA 3A21A 1GG1A 3GG7A 1FWEC 2ZRVA 4X63A 1S2VA 2V5LA 4D2JA 3KBSA 3UWQA 1HXJA 4JFTA 3T2QA 5KVHA 3GC5A 5I3DA 3AHVA 1KLYA 1GJWA 2QS8A 2PDJA 1E6RA 4K38A 3AIBA 3FYYA 2HPIA 2ZTJA 1FDZA 1E4IA 4ECLA 4LH8A 1SO5A 3NM1A 4HU0A 4IIDA 1SZNA 3M0JA 2QUUA 3PANA 3E5BA 3G1HA 1EBGA 1CCWB 1R8LA 1V0MA 2QF7A 4PYSA 3LN3A 1PX3A 5AYXA 3S2CA 2REQA 4LS1A 3T0CA 3RFAA 1N8IA 4R85A 3WENA 4MG4A 2CEQA 2BFGA 3ATYA 2BY1A 3C0QA 2WBAA 4P7NA 2E9BA 4ERAA 1ISZA 3V18A 4GQ0A 4F0SA 3PAOA 3CTLA 4RZ4A 4HCLA 2QCNA 4AHOA 2ODOA 3MMDA 1H3GA 1CLKA 2EBNA 2ZUTA 3DGZA 4GIAA 1F76A 2YDQA 1L0PA 5DRIA 1V4YA 3UR2A 1UWQA 3SUVA 1X96A 4H4WA 3VGDA 1Z41A 1GVEA 1DIOA 1ITUA 4O52A 4HU8A 5FF3A 2AQVA 2FKPA 4OECA 2AL2A 1JRPA 1BLIA 3WO8A 4PMNA 4H50A 5C9XA 3QQWA 2V63A 4D6CA 1ZXIC 1EIBA 3LGGA 2ISWA 1YNQA 1RBLA 1A5BA 4MM1A 1E72M 3AUJA 4W8LA 3WD3A 4E4PA 1AQMA 3NAVA 2WP6A 3L65A 2HRWA 2VEFA 4H41A 3WBEA 5DFAA 1H4PA 4UWMA 5IM51 4W86A 1Q6GA 2AAAA 4ALDA 4HA1A 4HMCA 5D2TA 3VDGA 1FFQA 3PTMA 3U7VA 3T0BA 1U1HA 1XSKA 1IIHA 2X8RA 3R25A 1TIWA 1N8WA 1KFBA 3EBVA 2CDUA 1Q6OA 2PWVA 3W75A 4IP4A 2VX7A 3C56A 4YPJA 1GONA 1JULA 3AS0A 4QG6A 1XI3A 4HP5A 1G5AA 3VOGA 4REQA 3NQFA 3RLUA 2PRLA 5CSRA 3APTA 2A3BA 1VIZA 2GZXA 5I06A 1UP2A 3IAPA 3QTGA 3FSTA 5CZKA 2NX1A 3O16A 3WD1A 1EQPA 2DU2A 4J3XA 4N2YA 1KFJA 3R8RA 4ACYA 3CL7A 2BHYA 3WNPA 1GW9A 1YTEA 1LVLA 2Y8UA 4ZB2A 1DVJA 1TA3B 3NOYA 2VWSA 4XWUA 5LYRA 4FNPA 2BGQA 3IVTA 1ZY8A 1J10A 3PC0A 3FLUA 5BXTA 4PMZA 5EKYA 4TIMA 4JIPA 1YNYA 4I6KA 2CLMA 5D03A 1YDOA 4JFVA 4DN1A 1TZ9A 3DGHA 2NZLA 1E0VA 2XH2A 1J2BA 3GXFA 2PDYA 3TN3A 2CLPA 4WX2A 3LBMA 3VMPA 4JYEA 3PJTA 4M24A 8CGTA 2PUZA 1FWGC 5AOUA 3XISA 5CAHA 4O28A 4WJXA 4JTSA 1XPGA 4MJ4A 3MB9A 3V5CA 2J7GA 2JKPA 3OA3A 4PBFA 1V3LA 3B3DA 4PC8A 5HJXA 4ENLA 2OLHA 1JGIA 3GR8A 2PWGA 3GTIA 2JK6A 1HP4A 3I6RA 2YBVA 1EWEA 3EPMA 4UB9A 4W9TA 1RPXA 4ERGA 1JAKA 3HFTA 4LF1A 2VRJA 2V0TA 5C6MA 4JFSA 1MUMA 4NYUA 3VYLA 1GK8A 5LIKX 1MQQA 4MDPA 1VJSA 2UY5A 3UYCA 3E96A 1RD6A 1GZJA 1KCZA 4L1WA 2DQXA 2ZUSA 3FK4A 3LGEA 3IJ6A 3R10A 1DYSA 2Y63A 1XH1A 3KBJA 2XVPA 2D1ZA 3PB2A 1NFPA 1TV8A 3W2LA 2GRTA 4EXBA 1XYAA 4MB5A 1GRGA 2CHNA 3KBVA 4DIAA 2TMDA 4FNQA 1DXIA 1M7JA 2JIEA 3N6QA 1A80A 1JRBA 2XH0A 2HJPA 3WF1A 3I7SA 3SIZA 1WZLA 3GG8A 2A0NA 1R2SA 3TFCA 3W7LA 3EB4A 3CT2A 9RUBA 1JGMA 5C0QA 3ABQA 3L4UA 5HULA 1FHLA 3WNOA 2WQPA 1FP8A 1ZJIA 3CIVA 5LIUX 1NQKA 3OPSA 2KX9A 3TMLA 2RH9A 2Y8VA 3GNDA 3EX4A 5ENLA 3RCNA 1TKKA 3FV9A 3LHZA 3NZGA 2WMIB 4YHGA 4M81A 2A85A 3TH6A 2XN0A 3ABXA 3G1XA 4O1EA 4RL3A 3VM7A 2VR5A 3P80A 3KAOA 3KP1A 2J79A 4JTFA 1EWDA 4LYKA 3HOJA 3S0CA 4HZ8A 1QI2A 4HYWA 1SW0A 1VYPX 3NS1B 2P5NA 2F9RA 4G2DA 3LHUA 3MDWA 1FWFC 4Y8EA 4BQ5A 3WF4A 1AVAA 5HUOA 4AVFA 3EXTA 2JGQA 2WK2A 3N2BA 3NZRA 1VCGA 3WLIA 1FIQB 4CD8A 2VM8A 3LPOA 1VLIA 3Q67A 1TMQA 1B90A 4ZSTA 4XBSA 2XTKA 4XUGA 1W9UA 1BWLA 3NPUA 2Z4GA 4TVWA 2R82A 4HK6A 3GH7A 1SZGA 1MOKA 4QCEA 1UKQA 4TOQA 2WNNA 4QS6A 4DF0A 4MAVA 2E6DA 4OVXA 1ZTVA 5CC5A 3L4VA 3OA5A 1IEIA 2LLEA 1I1XA 3GY1A 4GXMA 3OVRA 2D0FA 3RPTA 2ZZ4A 3BTNA 2PSNA 3VX1A 3N3TA 4B15A 3ZYZA 4KFNA 3VIIA 1YX1A 1ME8A 1GVRA 5CGQA 2F6KA 4JBRA 2MANA 4YTTA 2WMJA 1AL8A 1A3XA 1TPH1 2PDMA 4M56A 4HU3A 1PB0A 1N5WC 1BRLB 3TR2A 5IHRA 4HOWA 3N18A 2HEJA 4K7ZA 1XLLA 1SU5A 2H8XA 3EX3A 2HS6A 1GYLA 1FOBA 2A2IA 2DVTA 1ZFJA 1G9HA 4JYFA 1W1A1 4M8UA 3TK7A 1GJPA 1JCTA 3W81A 2QUTA 1YE6A 3AS1A 4AIEA 5K9CA 3TEVA 5F1UA 1TPB1 4C6KA 1K8YA 2Z27A 4H4IA 2OELA 1TPUA 4FXFA 2J8FA 5HR7A 1D3GA 5A6MA 1EUAA 2WPBA 4WXZA 4E3TA 3WJZA 2W61A 3S5NA 2HK1A 3B8VA 4F0KA 3PFRA 1VFHA 3W7JA 5FCZA 1XCXA 3FX4A 4I5RA 3LV6A 3BANA 3H21A 3OGRA 1UKOA 2BSLA 1REQB 4IFOA 3GC2A 5C7VA 1TMHA 1SW7A 4P7QA 3VCNA 3NPWA 5FD0A 1V03A 3W88A 5CC7A 4TMCA 1HKJA 5GNZA 1YDVA 1EXBA 4HYRA 2Y2WA 2PTZA 5D30A 3JW7A 3BG5A 1VJZA 2E25A 3DFQA 2CW6A 5I0DA 3TONA 4P61A 1XDIA 2A5HA 5D9PA 5AC6A 2EPOA 5GJMA 3BW4A 2XJ7A 3SY1A 3KHDA 4RE0A 1JL8A 2GGHA 1HUVA 3H26A 4FP1A 3INPA 3O6AA 3TV8A 4YXGA 3O6DA 1I0DA 2NVCA 2EJ1A 4FX6M 4TMBA 1DTNA 4W5ZA 3M6YA 1K70A 2W54A 3GRTA 3G77A 3A3WA 3R13A 3A4XA 2Q02A 3CO4A 3FNDA 2XVGA 1YRRA 3HFYA 5JMUA 2J4GA 1VLWA 4NZ5A 2EQDA 1RLCL 1DIDA 1DTUA 5KZEA 4WGXA 3U7BA 3ZQ9A 3DFOA 3C5QA 3T6CA 1GOXA 2QPXA 5DCDA 1M7OA 4A8IA 2ZZ5A 1XICA 3ALGA 4UOQA 1OD8A 1UKPA 4Q6JA 5EA9A 1ZNNA 2QJHA 4K2SA 3UPWA 1F61A 4FALA 4ZE5A 4CN1A 3SURA 3QFBA 3VIGA 4LEFA 1LL7A 3F03K 3RX2A 3B0YA 3UT0A 2AAMA 5JCKA 3Q45A 1D7YA 2IQ0A 4JX5A 5JCNA 2BS9A 1WKFA 3T9PA 4NRSA 4MTVA 4G6CA 3ONBA 3O0HA 3UXDA 3NQCA 2GK1B 3ITYA 3MC5A 5CGTA 1VPYA 4C60A 3S6DA 2REQB 3TYCA 3TAOA 2Z7GA 4RJEA 5LNVA 3RDKA 2GVEA 1W1PA 4GQQA 4AY7A 3HPZA 3VGGA 2BCPA 3MI2A 2ANUA 4UTMA 4GI4A 1WNOA 1JFHA 3CPRA 3VKKA 1G1YA 1XC4A 2JEQA 4GFSA 5CSYA 3WELA 3B8TA 2OQHA 4MNKA 3TC6A 4DPPA 3EAOA 4AUBA 2BGNE 4ZCWA 3ABSA 3MY9A 4GRTA 5K7JA 4RV8A 9XIAA 1SYTA 1FWWA 1GZ1A 5K9XA 1JVNA 2HV5A 1WKYA 2YAUA 2PDQA 3FYOA 1PS9A 3SRFA 1OYCA 3FSUA 3A9IA 1CBGA 3GG0A 2BX7A 4JTGA 4QLLA 1X6UA 3UZJA 1FEAA 1GERA 4BF9A 4ILSA 2Y6ZA 4GO8A 3M07A 3GH4A 4RNJA 1K3UA 1K6WA 1LBLA 2PI6A 2XSBA 3CM4A 2CXGA 2EPKX 3JRKA 2ZX8A 4UFMA 5M17A 4DJEC 4AD1A 2FQIA 1KWKA 1GREA 4AXKA 1O5QA 5EMYA 5M1TA 1K8ZA 2W3RA 3IV3A 4ES4A 3O7UA 3V7PA 4QG8A 5KSWA 2R14A 3VNZA 5MKGB 3LOTA 1K4HA 3TXZA 3VNYA 4BZYA 3NQ2A 1T3QC 4JICA 2D22A 2NWSA 2A3AA 3U2EA 2W62A 2RGLA 2VQUA 4IZGA 1NHQA 3WY1A 3W73A 3C3NA 3L5LA 3AXMA 2INEA 2RJGA 4M3PA 4GI9A 3E0VA 2JIWA 3W1NA 4GCXA 3CV7A 2OU4A 2YPIA 4REQB 5E5CA 4WJ8A 2NSXA 5CQ1A 1J0YA 4AEEA 1E1FA 5B7YA 2WKJA 1UHVA 1GUVA 5CC6A 2ZDRA 5FA5A 1S2UA 1GGOA 3VD9A 4O11A 1Z48A 5FJIA 1IV8A 1JCMP 1PYFA 1UB3A 4EE9A 1HO4A 4O1DA 4GINA 3N2CA 4H6EA 4QR6A 5JBFA 4H2HA 5JCLA 1TVPA 2C8NA 3RO6A 4I7VA 1KR1A 9CGTA 1FCBA 1V6WA 3TFXA 4WDXA 3KX6A 4FOKA 1XQKA 3BOFA 4IL2A 4TVUA 3N19B 4HHHA 3GNPA 2QT3A 2G37A 5BRPA 4GISA 3SSZA 2TSYA 2VDIA 4EP8C 2IXUA 2FVKA 4RZ6A 4M7SA 1AJ0A 2Y8KA 3NQVA 1MRAA 1DJWA 3COTA 3P14A 1I2OA 4GX9A 3KBWA 2PWUA 1RJPA 1EX1A 2OWCA 3SQPA 3Q65A 5DELA 3VGFA 1RBOB 1DQUA 3GTHA 1EQCA 1KXHA 3NM3A 4PMDA 5LNSA 4BF7A 3TE9A 1POKA 1XXXA 1IXOA 2HS8A 4HPXA 4LB3A 1GVIA 3VO0A 4DBUA 4HCHA 1E0UA 2XSXA 1B9ZA 3DKJA 1BVNP 3NQEA 1CI1A 1ADDA 4N9DA 4F3HA 1STZA 4LWWA 2AMXA 1OY0A 2O0TA 2BDQA 4ZBCA 2WJZA 4DWDA 3A12A 1XR2A 1LLWA 1BPLB 1V8EA 3W2NA 5G1MA 5CBIA 2E28A 4CQBA 3ABOA 1EUNA 1P43A 2NT0A 2OWWA 1UWTA 2W0HA 3QGAC 3JUGA 3LHYA 1TTPA 3WMBA 3ZT7A 2QULA 4PMUA 1NAL1 4BS0A 4C6JA 2GR2A 1OK4A 3DESA 4I9JA 1TRIA 3MKVA 4RV3A 2PPGA 2ZDSA 3MUXA 4MNMA 4DJFA 4PUNA 3WLQA 3AO0A 3LXBA 4ZGYA 1UMLA 3UG4A 5FL1A 4UTKA 1MXSA 4D6IA 4UTUA 1SGJA 4EF9A 1G0CA 3W72A 1A53A 3UCQA 4H6KA 4TU1A 4HIBA 4LTSA 1ZCCA 3EDDA 3W7CA 1RLDA 2BWGA 2XUCA 2WVVA 3OLGA 4DB7A 3OVPA 1ZAHA 4FI4A 2AOSA 5HMFA 2OOGA 1FWNA 1JQXA 1S2CA 1AZ1A 2A7NA 3HQPA 3LPFA 2Z1XA 2BOEX 3R1ZA 3IIOA 1IE7C 1WX0A 4OQVA 1ZL1A 2NT1A 4IQEA 3Q37A 4DWSB 5K4XA 4KIEA 1R46A 1XL9A 3M0LA 1MO9A 4C90A 4LY8A 5LXXA 2B81A 3UVAA 1KKRA 3N15A 3ECQA 1OX6A 1TTQA 4MJ2A 4QDWA 3SRKA 1EFZA 4XX6A 5F2LA 3CGTA 4I3GA 4MY9A 1KB3A 6PTDA 3ZLHA 2DW7A 3REQB 1ELSA 1UWRA 2BMBA 3E2VA 1E5NA 1T8QA 2ZVIA 1V97A 5A69A 1LL6A 5C2CA 1AL7A 1H2JA 2WSPA 4YL2A 3RMJA 3C6CA 2QCFA 1HGYA 3EOOA 3BLKA 2GSHA 5A8OA 3GTNA 3RRXA 3G1AA 1GVFA 1KM0A 3O05A 1I8JA 5A6KA 3LY0A 1A5SA 3GHUA 1U5VA 3VIOA 3ITVA 4GUIA 1DL3A 2ACQA 4GFIA 1UR9A 3BW3A 3B8SA 1J5TA 1G69A 5A8MA 3IARA 3CS2A 4X9YA 1BKHA 2PDXA 4S39A 3UZYA 3EDJA 3A5VA 1LORA 3FDKA 4NAFA 3RM8A 1TUXA 5KTLA 3E0FA 5C70A 1SJDA 4FPSA 1E9YB 3GHRA 4ZQNA 3W7KA 1VRDA 2YJQA 1BGGA 1VFFA 4M6UA 1WDWA 1HKIA 1SR0A 4FMVA 5D9NA 4AY8A 3QYSA 1UCWA 4I8YA 2WJDA 1S5MA 3STPA 3HRDC 4GXPA 3EA3A 3G3MA 2CLFA 3AWOA 5JH2A 2WMGA 4S3EA 4F0RA 5A2BA 2P3EA 3G1DA 1TTJA 2R91A 4LYQA 5FF4A 1XUUA 1Q13A 1W3IA 3E0WA 5DCEA 1EKOA 1VS1A 5CZTA 1UKSA 3PBVA 4ACZA 3AMCA 5BW6A 2WZMA 3N73A 2HVMA 4P7OA 5LA2A 3VE7A 1WCGA 1OG0A 3ARSA 2X2YA 1OM0A 1PDZA 2R9RA 3WK0A 4AIBA 4PTNA 1YHTA 2Q8ZA 1PXGA 3CLWA 3W7IA 4LBUA 1KKOA 1WZAA 1H1NA 2INZA 5CLTA 3BE7A 4BI6A 3WD2A 3QEZA 3B8UA 3PUEA 1EF3A 5T26A 2R6OA 2POZA 2XPKA 1A5OC 3A3HA 1HKVA 1QBBA 1W1VA 3TSMA 1S46A 4L80A 1FHUA 1Z7AA 3SEPA 2QCHA 4CVUA 6CGTA 3KDOA 4S3GA 4GHRA 4MNLA 3W71A 4JCLA 3WYZA 1THFD 1JPIA 3M44A 3K8MA 1RQHA 4IHCA 1OGGA 1XF0A 2OTDA 2CZEA 4AY1A 5FEXA 1PE1A 3VIFA 1OWQA 1W91A 1G67A 4LYRA 4F8XA 3EOEA 3ITGA 2PMQA 6TAAA 2WC7A 4GYPC 2W9MA 3KM8A 3OOQA 3RIKA 4JQ4A 4AHQA 5TIMA 3CV2A 3PNUA 1BF6A 4RDZA 1LWJA 3CLMA 1C8YA 4MGGA 4Y90A 4H4SA 1PVNA 1F9CA 1GRHA 3NXFA 3WFZA 4EXQA 4H4ZA 4IP5A 4V1XA 2IMRA 1K9DA 3FA5A 4K8EA 3ZR4A 3UR8A 1RQBA 1UUMA 2EF9A 1KBKA 5IDIA 2W5FA 3WMLA 2X7VA 4D6EA 2CZDA 4AD3A 4UQBA 1R3WA 4IG2B 3DKLA 1LRQA 2X1IA 4NI8A 4ASTA 3M9YA 1ITXA 2A79A 1FWTA 1KXVA 3NO5A 1BHGA 3T0DA 5U1OA 2J77A 2Z00A 3NVYB 4AD5A 4HB7A 1Q66A 2NXHA 4QNEA 1EOKA 5C54A 3S83A 4KETA 1C9WA 4EF8A 3WQ5A 2MNRA 4Q8NA 3K1GA 1SW3A 3AROA 3SQSA 1MEWA 1ISYA 2QUMA 4XD5A 2H6RA 4IOTA 1HW6A 5BZAA 2VRKA 2YVGA 2W55A 4NZ1A 2C13A 3ORWA 5EY5A 1EC7A 4GNJA 1JZ2A 1TWZA 3GB6A 3R8HA 4DJDC 1M04A 3UWWA 3RILA 3N4EA 1ECEA 3GXMA 4AD4A 2OZ0A 4FAMA 4IPPA 3A4JA 4PRWA 3H2EA 3W87A 3B9OA 4JTHA 3TOPA 2BTMA 3BQ5A 4CNUA 3WQFA 3BH4A 3ARWA 5BWAA 3M0IA 3RG6A 2PDPA 3DJGX 4MMWA 1UOZA 3PTDA 3E12A 3W4RA 3OIHA 3T40A 5HPOA 4IM4A 3UVIA 2GL5A 1KR0A 1A3HA 2QV4A 2E67A 2V38A 1JNEA 4GABA 5T9CE 2QDGA 2PF8A 5G2WA 1IZKA 5GVJA 1CDGA 2NX9A 4PRTA 3TTOA 2JE8A 2PDHA 3M46A 1R87A 1L6FA 1GYNA 3FXGA 1OK6A 2W92A 1D7KA 1ZJAA 3QXBA 4BQ3A 3W00A 1E40A 4IXXA 3QHMA 4UC5A 3Q94A 3P84A 1UH2A 3C0JA 2V81A 4LY4A 1K77A 1K9TA 4JTJA 3LM3A 1ZX9A 1MNZA 1SZRA 1JEHA 3C0LA 2PDFA 1GRFA 4LV4A 3QSTA 4EANA 1NOWA 5EBUA 4TX9A 2XVKA 4PUWA 3NEHA 2DZAA 4DJEA 1ADSA 3NQ6A 2VP8A 1KXQA 4FSAA 1JCYA 3C3UA 3SQLA 3OTRA 4ZQCA 3R11A 1XYCA 4CD6A 2X1RA 3AWNA 1KV8A 1X6LA 7TIMA 2KZHA 4G1KA 4ZZ9A 4H6QA 3E2RA 2FMOA 1B5TA 4QAWA 4OHQA 2XFWA 1KNWA 4U3AA 1CXHA 3AYRA 1VJIA 3BLIA 2J27A 2QPSA 5D33A 1R3TA 3W1AA 2YL5A 4PMYA 2J62A 1XBXA 2O55A 4C1KA 4LPCA 2NQ9A 2W66A 3MSYA 3RLVA 2VUNA 3LMYA 1FWIC 1K7XA 3ZS4A 2G96A 3UG5A 4G8TA 1LOLA 1JYWA 2WCAA 1UZHA 3ZT5A 3KTXA 3N2XA 1LLOA 5JUVA 3SGZA 4HPGA 3I7QA 3IAQA 2AL1A 4B5SA 5AC4A 3LYEA 2ZX6A 2GUYA 4M80A 4C1NA 1UZDA 3PSVA 1R2RA 3EA1A 4RDVA 5A6LA 1R3YA 3GBDA 1IF2A 3WFAA 2P0OA 4DYJA 2CLLA 3F4WA 4HPJA 4ICMA 5G4HC 3MWAA 3VNIA 1Z69A 1AQFA 1JCNA 2GQAA 2PDBA 1P0BA 5H1WA 2JKEA 2FZDA 1JOAA 4UCFA 2E5CA 3H24A 4QSFA 1NPXA 3NZ1A 3U9IA 2QF8A 2DH3A 1SMAA 2OO6A 2P53A 3T42A 1BG4A 3PG8A 2E0PA 2GOKA 2WKLA 1OC5A 4LX4A 3GBEA 4KFPA 5EU9A 1V3HA 3W1UA 3BJFA 1SJAA 1OX4A 4K68A 3KOXA 4OJYA 1T0OA 3H4GA 1ZCOA 3C8FA 2P88A 4GZJA 3W7DA 2QVNA 5CKSA 1WPCA 1GOKA 1Q7QA 4HNUA 3QY8A 4OBTA 4QEHA 3WDIA 4LUYA 4PCFA 3U3HA 3QFAA 3M5ZA 4D1JA 2G95A 2QCLA 2CWXA 1QRQA 1VFMA 3CUJA 1HN1A 3U2CA 1E4MM 2HZGA 2OCZA 3RCYA 3G1YA 5C2GA 4PMJA 2IPWA 3BO9A 2J88A 4GH3A 4XVDA 3B9NA 2QYGA 2GJNA 3MV01 3FY1A 4A21A 1O5KA 3HMJG 1EOMA 1ITCA 3LDVA 2PCEA 2VQTA 3QGVA 2YR1A 1KBIA 3ERPA 1E1EA 3F1QA 1JI1A 4W7WA 5JCMA 4NZCA 3LZ3A 1MSSA 3I3EA 3ZVHA 2VT0A 3S5OA 3HG5A 3S9YA 3BMWA 2FLIA 4IMGA 3HTWA 3M7SA 1U1UA 1AK5A 3U4AA 3MUIA 3MVTA 4IX0A 3ZLFA 5TNVA 2JKAA 3GSMA 3NSNA 2WBGA 3AIEA 3LNPA 3MCOA 1J79A 3WQDA 4GX8A 2A7RA 1EDQA 1E70M 3TYDA 4I90A 1FWDC 5IFPA 4EX4A 1B4EA 3HPXA 1H0IA 3UFYA 1WOAA 1P7TB 1BEUA 4RE4A 3DBNA 1A5UA 3IRSA 5ABHA 3CUFA 1VEPA 5G4WA 4PMOA 3DHDA 3SCWA 3HPFA 3UGVA 1HJQA 3CAQA 2DT3A 3SW6A 2WVVB 1KQYA 3G0XA 2WLYA 3V1PA 2I7GA 1VF8A 3L2MA 2OO0A 4C6OA 1W1TA 4IUOA 1W1ZA 4ZSUA 1KQZA 1P0DA 3UNDA 2C16A 1OFOA 3LXAA 3VKAA 3ZM8A 4C65A 5A3HA 3B0PA 6REQB 1M1BA 4RW5A 3CGCA 4H4RA 3NG3A 4E4UA 5FF0A 4NSBA 5AYZA 1LTDA 3RJYA 1LP6A 2ISFA 3UZXA 1RXOB 4AMCA 3WQ6A 1X7IA 1CT5A 1JIBA 4D9PA 1GRAA 1MZRA 4ZL1A 2CBUA 3EYPA 3KVMA 1PSCA 3WQEA 4MWAA 1ONXA 5FF7A 3AU6A 3LV5A 4ZXLA 3FKKA 3QN3A 2VFFA 4MB3A 2WM1A 4FF5A 3BPWA 1EA0A 2FZNA 2WZIA 3GR4A 3QF0A 1RCOB 4LUSA 3WQOA 4K8GA 3F2BA 4NZFA 2GR3A 1D8WA 5M03A 4Q7BA 3HQOA 2WMHA 4PL1A 2CBVA 3IPWA 3N4FA 3PVFA 4Z1DA 1GVOA 4ZMGA 4DEFA 4Z1BA 3DCPA 4MUZA 1JPDX 2HXTA 5D2VA 1GW1A 1NF7A 3H2OA 4EQWA 1SSDA 1RPKA 3PM6A 1O60A 1H11A 1EXPA 1MNSA 4HHPA 4J9JA 4WKFA 2A6LA 2EPHA 3MVIA 2QUNA 1XG3A 3EMQA 4W93A 1RJRA 1ICPA 3TW6A 3EMCA 1VC4A 4JHMA 2J66A 3QJAA 1W5OA 2V2CA 4JHZA 4AEFA 4ML4A 5F4WA 5H8MA 2GGGA 5D8WA 4PFHA 3CMFA 3K4WA 3KL5A 3VZYA 3GQYA 3APYA 2DZTA 1W1YA 1Z32X 4EXAA 5LIWX 1Z8AA 2Y5SA 4C1LA 3LI1A 2XN1A 5REQB 2QEZA 2FGLA 1WBHA 3LU2A 2QW5A 1BD0A 1UQYA 3W6YA 1PWLA 2VVNA 5DN1A 3VVGA 4YVVA 1A5NC 2ZUVA 1H7WA 1J93A 4V27A 4GVFA 3P0XA 2INFA 5F7UA 2FFCA 3GNNA 2OYKA 1QDSA 4WDTA 3P2VA 1FTXA 3V4BA 3BAJA 3QHOA 4FA3A 4XB3A 2BVYA 4J28A 2ZX5A 3EWWA 1E6QM 1V02E 2NV1A 1TX2A 5G5GB 1JYXA 1X1NA 4IGNA 4ML9A 1DXEA 1EH9A 3CL8A 2ZA3A 1SQ7A 4D8LA 3W2JA 4GYPA 2OZ8A 1B2YA 3TNBA 1VBRA 1EA9C 3U0HA 3ETRB 2NWRA 3EB2A 1GG0A 1VFUA 5B7ZA 3C4UA 4BFAA 3P5ZA 4RK8A 2WVSA 3CBWA 5L6UA 1YXDA 5EFDA 2VRQA 2ZICA 5E1QA 4Q8VA 4EQSA 3ARZA 4IT1A 3S4TA 2WHKA 3ZT6A 2IPFA 4DPQA 2R9ZA 5CPTA 3MUCA 1Q4NX 2PP3A 4YCOA 4OOZA 2OMAA 1J8VA 1MW1A 3BURA 2IXVA 4E8DA 4HPHA 1FH8A 1OFPA 1AW2A 2FVMA 3MUAA 1GEUA 4GZIA 5HWJA 4X3ZA 3W37A 4WDUA 4QIUA 1KO0A 1DWFM 3KP0A 5AC8A 5TR3A 4LALA 3I4EA 4W88A 4J3WA 4IPIA 3GIPA 1QWKA 3SSJA 4WUIA 4H9XA 3U5UA 1JJKA 4K8DA 2VD8A 3UPMA 7PTDA 2ISSA 2FZBA 1RK6A 5CCZA 1QOXA 1GCYA 4DAIA 2EJAA 4MZ1A 1SJBA 4MJMA 1F3XA 4B4HA 3DENA 2YGYA 1NWRA 2D2OA 3I3BA 2R1PA 3A7UA 4MYAA 1TPC1 4QITA 3FEMA 1KV5A 3SR6B 3B03A 1JUBA 3NIYA 3W1TA 1HKMA 3M5VA 2QMJA 4M1BA 1OB0A 2Z1KA 4HMDA 1SPQA 4NJGA 1VAHA 5EMJA 3A22A 3G0UA 3VOJA 1H60A 4KRTA 4DJDA 3OLEA 1PAMA 3THDA 4UZSA 4GCAA 5IDZA 3N12A 3B8DA 1VIWA 4XIMA 4Y6GA 4JDBA 3QVQA 3CMJA 5AHFA 3SCUA 3NPVA 2CXEA 2CYGA 3GAKA 4XZWA 2NSOA 1XBVA 3LCWA 1AW5A 1OCJA 1A47A 1TPWA 4FNSA 1TELA 2G3FA 3GU2A 5D37A 1N7KA 2PDCA 4JFUA 2B31A 3V5OA 3DK8A 3MA8A 2Y5JA 5H8UA 3W23A 2V8ZA 2C1GA 4JTQA 2QZRA 4AZ6A 4N02A 3WZ0E 3OZYA 2PWEA 3TIMA 3QLDA 1XYZA 3NWRA 1XDMA 1MMFA 4C6FA 3MS8A 3ALFA 1EJRC 3WLOA 2Z1SA 1QI3A 3CUIA 3NDYA 4PTDA 1E5JA 4U5KA 3EUB3 2PA6A 5AYIA 4B9YA 4IX2A 2DFAA 2NQHA 2XWEA 4QRNA 5DO8A 2O92A 4U2ZA 1V3MA 4UZUA 2VVSA 4JFWA 2P1FA 3GWQA 2WSQA 2XIJA 5JU6A 2OX1A 4TX8A 3DOPA 2VNCA 3DHFA 4IFRA 1U83A 1QU4A 3QR1A 1TV4A 1JZ3A 1CB2A 4N42A 3SCSA 3U6WA 4X61A 3C2EA 3A5FA 1T7LA 5J5DA 3S2LA 1Y5VA 3NL5A 1OFAA 1AQHA 2QIIA 4YVXA 4E0CA 3CQHA 3MJYA 1Q8AA 4F66A 3SZ8A 2V5DA 3GRIA 5MHBA 3MZNA 4Q8MA 4S3KA 3OBKA 4IJRA 2PU1A 4TUFA 1OF8A 4QHRA 4LIIA 1SFLA 1CXEA 1W9PA 1L6YA 3DFNA 4B5XA 2V2DA 3SUTA 4NI3A 1DJGA 4KESA 1NF0A 1ODUA 3T7VA 4QJ1A 1IEQA 1W3LA 1DWHM 3HPSA 4ONVA 4H9UA 4A22A 2WXDM 4M6QA 4K1WA 3HG4A 3PZIA 3SGUA 3PWIA 3MMUA 4R3UA 1KGUA 5GNYA 3H2MA 3OW1A 3MQTA 2E5AA 5IBXC 1HKKA 3GYEA 3RU8X 1GWJA 4TR9A 3VOHA 1ZJHA 1G4EA 2GGEA 4EOUA 3MW7A 1R86A 4NL1A 5AVHA 2C14A 1E6NA 3GNRA 4XZNX 2WOVA 5KVIA 1E6ZA 2XDFA 3SN1A 1K9FA 5I77A 4ZQOA 3D3AA 3HA1A 2EPMX 1Q6DA 3B06A 1W3TA 1US0A 5BWFA 2VD9A 1LLZA 1J2WA 1BTCA 1DBTA 3NJ3A 1QHZA 5L9FA 2Z6IA 2Z28A 1RV8A 3S2JA 4C5YA 3W1LA 4ZQPA 4ROPA 4AZHA 2PLJA 3II1A 1UD4A 4PSRA 2WMFA 3MU7A 3VIPA 2WNWA 5EB8A 1GHRA 3WBXA 3S42A 1ONRA 3MYOA 3LHWA 2ZBTA 3UG3A 4ROQA 1WKDA 1K03A 3V0UA 4KKXA 4S2BA 3P67A 5AYYA 4IJCA 3KL3A 1PUDA 3ARPA 4W8BA 4W84A 4U28A 2VHLA 1FFUC 1PV8A 1G7VA 1LWHA 2CLEA 4LUTB 1A0CA 1IHIA 2PS2A 4PODA 1DKWA 1EGVA 1MDRA 3AALA 3MZ2A 2UY3A 1MUWA 4XD6A 1BWCA 2YKKA 1J0ZA 1PKYA 2G50A 3K8LA 1LRTA 1A5LC 5DBTA 1XIGA 3VI2A 6XIAA 3S9IA 3PBMA 3CHCA 3FXYA 5EMKA 3URQA 2Z24A 4U10A 5E0KA 4UNIA 4ZVJA 4J4KA 4H9MA 4PUEA 3VE9A 4DZAA 4AX7A 1QAPA 2FHFA 1MFUA 3H23A 5EGRA 3KS6A 4WF7A 4QJ5B 4FX7A 1PIFA 4LAZA 4C6BA 3G6LA 4DBDA 3LBOA 3O1NA 1P0KA 1IQ8A 1XGDA 3PWGA 2DGAA 1W9BM 4UNKA 1ZBKA 5FJUA 1KN0A 2O9PA 1XIEA 4ZTXA 1N82A 4UXDA 1KGWA 3UJFA 1ZS2A 1LUCA 1NJJA 3RAOA 4J7RA 3GUGA 3TN6A 2XGZA 2XFRA 4L4PA 3DC8A 2XM2A 2GSEA 4R33A 1JDEA 1XANA 1UD5A 3LPGA 5LZLA 2VX4A 1ESWA 4Q33A 1BG9A 1FWBC 2J25A 1SO3A 2PDGA 3IVUA 4V15A 4Q7IA 3KZSA 3GTFA 3O07A 2WOWA 4YTRA 4XKMA 4JKKA 3R79A 3IJDA 5CBJA 2PTYA 4MNJA 2WPEA 3ITOA 4D72A 2Y24A 2DORA 4PTVA 2UV8G 1XWYA 4OUEA 4XTIA 4L7ZA 1S5TA 1FDYA 3C2RA 4FOJA 2EQ6A 3AYVA 4FHAA 5LIXX 3SRHA 1JD9A 3SO7A 2Z2UA 4O8AA 3AUOA 3S1WA 4PZVA 3WQVA 1R9XA 2NV2A 3ZR6A 2VEKA 4ZTYA 2FB3A 3CZ8A 2HBVA 2ISVA 2YB1A 4IP7A 1W2PA 1UASA 5LIYX 3PPHA 3K5XA 1ZPTA 1EJWC 3WD0A 5EMLA 3FOKA 4LUSB 5FACA 3QSRA 2BB0A 2DJLA 2IQDA 4O57A 1ITQA 3H4WA 2V68A 2NXIA 3KEHA 3DI0A 3KBMA 4Q8WA 2GJPA 2PZ0A 4GKTA 2HVOA 4HU4A 5EMUA 1NOFA 3ARVA 4Q4OA 2I5QA 2J13A 1NWSA 2PWFA 3E38A 1TZZA 2OXNA 2J75A 1BXBA 1ICSA 1Q5MA 3RPDA 2WP5A 3LCLA 2FGBA 3PWAA 3EB3A 3F4CA 3KLLA 2YDSA 2XU2A 4BWLA 4ZOEA 4CNNA 1JAEA 5HJLA 1FWSA 1E0XA 1MVYA 4WY0F 2BODX 4PRRA 2XM1A 4EMWA 4HZ7A 1M68A 3DUGA 2DIKA 2PE4A 3DYPA 4BI5A 2X41A 3GDKA 4JN8A 1A5CA 1XG4A 3UGRA 3VD5A 3LCFA 2CU0A 2YFNA 2WC4A 4FOUA 4C6IA 1GPFA 1ISVA 1F8MA 3B04A 4E2BA 1QO5A 4CD7A 4INFA 3PZNA 1OFBA 3NO1A 3LERA 5ABTA 3CWOX 4E4FA 3RGTA 1JZ7A 2C0HA 2WZHA 4QCFA 2WCGA 1M5WA 1FWRA 4NY2A 3W25A 3IK2A 2WOIA 5A6SA 3HO8A 4NRRA 1J6OA 4NU7A 1UBPC 1OEPA 2YYTA 4KPRA 5A1AA 1XBYA 2VYOA 5FEZA 3N6JA 2VI0A 2VX5A 2TAAA 3NQ7A 3W7HA 2YQUA 2D2HA 4WSHA 3N6HA 2XH4A 4E38A 4HHMA 4J57A 1UUOA 3M0HA 5KEZA 3WLLA 1NDAA 3K8KA 4A35A 4FLRA 3GRSA 1D2KA 7REQB 3TZNA 1JCLA 2UZ9A 4QGCA 3HGSA 1GKPA 1UA7A 2I14A 2ISDA 2ZWYA 1XIDA 3AXKA 4E2DA 4KERA 3EOSA 4DJFD 4X0VA 2WMIA 3EANA 3P5YA 1IYXA 2B0MA 3OODA 4C91A 4UTTC 1F6PA 2B7OA 1BWKA 1IXQA 3FGCB 1XISA 4HKPA 2Q3RA 4LF2A 2VEPA 3O06A 3NSMA 4TV5A 2BHUA 3ZFHA 3UY8A 1UZ1A 4P8VA 4L61A 1Q4WA 1XKJA 1B31A 2ALRA 3FDGA 2GSJA 1UD8A 4XAPA 3QBUA 1S2WA 3TP4A 2D2JA 3DYOA 4KMQA 4XAFA 3W7GA 3GW0A 2VCCA 2GYIA 3HGRA 3SUUA 4JX6A 1GOMA 3SCTA 1CXKA 5D05A 4HSHA 2HNEA 1VGAA 4P8XA 4GUHA 3PBWA 3A7RA 4IMEA 2O4MA 4AZBA 1VFLA 4ICCX 4EVZA 3CGBA 1LDCA 1XLJA 1UR4A 1XX1A 2CCRA 2HVNA 1GRBA 5FMHA 3N2OA 1V6TA 4KIRA 1ZAIA 3UWVA 1O6IA 4MKSA 1LQAA 4ZA0A 2DDXA 1QOPA 2VXNA 3EF6A 1DIKA 1KBBA 1EO7A 1TIMA 3TYBA 5HOSA 4ZOAA 1FHVA 5CBBA 3MYPA 3M16A 3MKCA 3N29A 4AZGA 1LL4A 3L9CA 3IV8A 3RJXA 1TYPA 3VZZA 1OCNA 3L2IA 1BRLA 4HHLA 1K9EA 1Q2SA 3P82A 2GQ8A 1Q3NA 4PBGA 5AYBA 1NDZA 3WQPA 4QM1A 1XDLA 3VA8A 1XD1A 4OKDA 4J5NA 3SN0A 4QFUA 4GVHA 4L9XA 2YFOA 4H8NA 4NAEB 1W2VA 1Q6RA 3KOFA 4BQ4A 1K8CA 4G9PA 5FKYA 1PBGA 4FX9A 2ADAA 4Q22A 4BF5A 3TSDA 3F4DA 5CXPA 4ICNA 1EJUC 2PB1A 3SM0A 1KTBA 4NIRA 4V1YA 2OR2A 2V67A 5BXPA 2PU0A 3NNTA 2W3SA 3TJ4A 1XIMA 4HA0A 3BAIA 4ZR8A 1G94A 4XAYA 4CNOA 2EG7A 4RLIA 1EX5A 1RVKA 1LOQA 1RP8A 2IPJA 2Y88A 2CESA 3CUXA 3R2GA 2RDWA 3OBEA 2YSWA 4R7WA 3WLKX 4H00A 1REQA 2Z7KA 4F40A 1QUMA 2CETA 2GQ3A 1PZ0A 1LG1A 3GXDA 3WBAA 2FZMA 1NFBA 4PMQA 3VKCA 1GEHA 4W85A 3U2ZA 1DE5A 4LVFA 5XIMA 3WLJA 1VBHA 5I3IA 1S5WA 1XS2A 3BMVA 4MIMA 3CHDA 5G4EA 1HT6A 4UNLA 1OIMA 3VCCA 3E2SA 4PB3A 1OABA 2D73A 2E1DA 1WUEA 2VFEA 3SBFA 3V16A 4R9OA 1O68A 3IACA 3WDHA 4Q7NA 3QV6A 3C2YA 4DBWA 3L21A 3EWUA 2X1SA 3DJJA 2ZX7A 1M53A 3N2MA 5C55A 2Y7DA 4A3RA 3U4FA 3OP2A 2HMCA 2DZWA 3CU2A 5A8GA 1JR1A 3URBA 2V3EA 3CPUA 5IBXA 2ZIDA 1IT0A 1V51A 5BCAA 3R89A 2PC4A 1R9ZA 2W6RA 3N9SA 4J35A 1M7PA 3AZRA 4M82A 2C91A 3RUBL 3L67A 2OT1A 2FTWA 2ZUMA 4CNSA 2Q09A 3DECA 3JR2A 2X8CA 4NZ3A 3W1QA 3CEPA 3WEOA 1V3JA 3EEGA 3CV6A 2YZ5A 3TMQA 1QPKA 1T41A 2I1OA 2XGBA 3BC9A 4KW2A 2ZTKA 1WZMA 3QY6A 1YXYA 2W67A 1S1PA 1JCXA 3LCXA 4HD5A 5KITA 3EZ4A 2FHCA 1ISWA 4N9BA 3SECA 3QGKC 3OEXA 1E56A 3CV1A 4JOMA 4JCMA 2YXXA 5U25A 3NXLA 1AUSL 1BQCA 3KDNA 2PBOA 5CG7A 2G0WA 4PSPA 2GVLA 1R7OA 4RXGA 1GOOA 3AZTA 4E6MA 2GK1A 2YXGA 1MZHA 1MW0A 1ISXA 2A7PA 2E6FA 3P8IA 3SIMA 4UFJA 4XK2A 3LHTA 3N3MA 4F4RA 4UBPC 2ATSA 4I7UA 4UQCA 5AB3A 2R1NA 1QW9A 4PGLA 1H0GA 3SCOA 2PRMA 4V28A 4GG9A 3VOFA 1KFKA 3KVLA 3ONCA 4MLRA 4B4FA 1K6AA 3HJZA 8TIMA 4DY1A 4HNTA 4US5A 1YPFA 3S9ZA 1H6VA 2WM0A 3B9EA 2GFTA 3BGAA 1BWVA 1MFVA 1UWUA 1R30A 3TNOA 3BLEA 1XLKA 2PDUA 3MT1A 2XZ9A 4PMXA 3TJIA 4JYDA 1OD0A 2VR2A 4CN4A 4W5UA 3NL6A 1WO2A 4JPGA 4DUWA 2E4TA 1ZRQA 4H8VA 4N9CA 1KTNA 1OYBA 3LA4A 3BAWA 3AN1A 4B9ZA 2ZADA 5BU9A 3CYJA 1P6WA 1VPXA 3GU9A 2VZTA 1Q85A 4L1GA 5FSDC 1EEXA 3M0VA 3O63A 3B0VC 1F3TA 1XLMA 1NQ6A 1H1ZA 2EO7A 4LW7A 1LQ0A 5AHMA 1WOBA 3UJEA 3WUEA 2WVUA 3BLPX 3T07A 3THUA 1GQJA 8XIMA 3OYZA 4O16A 1AH3A 1WXJA 4NASA 3POHA 4KGJA 3UEQA 1QNSA 3PY2A 1ZBVA 3M5XA 2X8HA 4JGDA 5CG0A 2F7FA 2JGYA 2DP3A 4PBEA 2WLZA 1J01A 3C61A 3WQCA 2QAPA 3AYSA 2VCAA 1PPIA 3R0DA 4JEJA 5MKGA 1LUCB 4Y9MA 1G4SA 4DJED 3HW2A 4D8ZA 2R24A 3PZGA 4FK9A 1CTNA 3G24A 4H2CA 1MO0A 3N14A 3WN6A 1NDYA 2QCDB 4YU1A 1H61A 5TAOA 1AOGA 1N62C 1ZBCA 5DF0A 1XLAA 4IGSA 2V2HA 1US2A 2PGWA 4WDWA 4NF7A 1KM4A 3DZ1A 3LCIA 4WJEA 3QFEA 2W79A 2ZCGA 2P0IA 1E51A 4Q8TA 1S38A 3LI0A 3IC9A 5BNKA 3BARA 1WA3A 5I5RA 3WQGA 3V5FA 3WEMA 4O0QA 3VUSA 3AMDA 3CIWA 3SUWA 2Y61A 1S2AA 1W54A 3WH7A 3NQMA 4B92A 3R6IA 3N9RA 4NZJA 1E15A 3FJLA 2NUXA 1B9BA 3QZAA 2WSYA 1Y0EA 4H83A 2E9LA 2RGMA 1UW9A 5LHEA 2O4QA 4GWEA 3BZGA 5CAKA 1TVLA 2VZOA 3A23A 1ICQA 4UMCA 3L4WA 5U4NA 4L1XA 2GQWA 4DYEA 2Y62A 2OYLA 2UY2A 4D6DA 1QOQA 1HG3A 4KWSA 1CNVA 3WSUA 4NNBA 4H4PA 4EK7A 1TPEA 4APNA 2OZ3A 3AU2A 1VBJA 1IGSA 4JQ2A 4JTCA 4LAKA 4J3ZA 3AOFA 2WSRA 3UG8A 1OC6A 3GKAA 3CWHA 3WBWA 1M9HA 3AHXA 6ENLA 1SO4A 4DXKA 5E0FA 2AQWA 4J1OA 2ZXAA 1KM1A 4IPLA 1V59A 2GVJA 1NEYA 4GI8A 1OCBA 3C0SA 4Y2WA 5DMNA 1EZ2A 1M7XA 3MP4A 2PDWA 2I9EA 1OZQA 2W3ZA 1VP5A 3TTSA 2E8YA 1ZLPA 4B16A 3QR0A 3FA4A 4GUFA 3EKLA 4AW7A 2E6YA 1DNCA 3K1DA 4FB7A 1YBQB 4LC6A 1JPKA 3GFYA 2H3BA 1RH9A 4YN5A 4CU7A 2J78A 3EWZA 1WYIA 3BOXA 2DT0A 1M41A 4GQGA 2VZUA 3WLRA 2YL9A 2XIOA 4ATLA 1MW3A 3WNMA 3DX5A 3CHFA 3WF3A 3RITA 1F6KA 3VFCA 3BSMA 2RAGA 1Y5WA 4PB4A 4ZQMA 1DWGM 3QYQA 4JS3A 3CIXA 3FJ6A 1K7FA 1BYBA 5IXEA 1QPQA 1SB3B 1MRQA 1UP0A 1RCXB 5I3GA 2ZUWA 1OG6A 5BXRA 2ESCA 3RPMA 3BGGA 3HURA 1A0DA 4ORMA 1BQGA 3VIJA 3SCQA 4UTTA 2VOMA 1KWGA 2GUBA 3UCCA 1EC8A 2YW4A 2NVKX 3LZ5A 4L65A 1EHAA 4UFIA 3V3WA 5JIWA 3W24A 4XSMA 1KFEA 2H9AB 1UD6A 2QGHA 3T05A 4DWSA 5TF0A 3JS3A 3M41A 1VDVA 3QPYA 2Z1VA 3AS3A 4M0XA 1D3HA 3T1GA 2NW0A 1I2PA 1C8VA 3MSGA 4LFYA 3C2VA 3GFZA 3VKJA 2V9DA 2OODA 1JDAA 3BLDA 4R27A 1QW8A 2CHOA 3REQA 3NQBA 5LA0A 4MY8A 5CZ0A 1BYCA 3WD4A 2YL8A 3GXPA 1KBJA 4ZOHB 2ZZ3A 1ZDLA 3M4HA 1E3ZA 3H4KA 1IT8A 2ZQ0A 2XFFA 3II4A 2G3NA 4O0KA 4FZIA 2V5BA 1KW1A 1OC7A 4FLOA 2HWGA 1V3IA 3HMCA 3KS5A 4MWAD 1XRFA 1UR8A 4K7YA 3C8NA 5HA7A 3W7PA 3PZTA 3ANUA 3PZUA 1G6CA 4BHYA 2YCLB 4BCEA 3CZKA 2PODA 1P0NA 4BQ2A 1SR9A 3TR9A 2XINA 4M5PA 1EIXA 5E6YA 1EJSC 2ATMA 2VDHA 4GGBA 2VFHA 1Z42A 3VNLA 3B97A 3FVMA 3EX6A 3WG6A 2XHYA 3MTWA 3PBYA 4GH1A 3UYIA 3OQEA 1C7SA 4EMIA 2X7WA 4NEVA 3WLSA 4OV9A 2VGIA 1RCQA 3KRUA 3NQ8A 2PF0A 2F8QA 3BMXA 4GBUA 2HBXA 3GU1A 4Q4QA 4TTUA 3GHSA 5HNRA 4DVOA 4O54A 3O6CA 4KQNA 4N4PA 5CPQA 2Q01A 3QPEA 3M0KA 3WQWA 3GK0A 2DZUA 4E8CA 5EFFA 3P74A 1ECQA 1OQFA 4WK9A 4AC1X 5A6BA 1V0LA 1X8CA 1CXFA 4JN6A 3M7WA 1FWAC 1R0MA 2VFGA 4Z2HA 5JVLA 4ZE4A 1XDJA 2Y70A 2DV0A 1VFTA 3WQ8A 1R47A 2OLAA 3M0MA 2ZRYA 4LCRA 4Q8QA 1H62A 3UPBA 4QISA 3TQPA 4CGTA 2BASA 3GLCA 4KEZA 5FEPA 3WJSA 2GDVA 1W8GA 3KOWA 1QWGA 4GYKA 2BY3A 3VD4A 4IL0A 1KFCA 1A3WA 1JZ4A 4FXJA 2P50A 3ME3A 4U4MA 2PGEA 3QZEA 2PDKA 3QC3A 5GQBA 2A8XA 3TCEA 4QE5A 3UJSA 3GE7A 4E2VA 2R1LA 2HCVA 4HBKA 1QNPA 3L5AA 1U2YA 4L6HA 4HCDA 3G1FA 3B0XA 4RE2A 1E1CB 4LAUA 2FGZA 5J5RA 1JG9A 3AICA 2EG6A 1OFEA 3ZJ8A 4Q8PA 3QW4B 4DX3A 4Z2JA 4WIWA 4CN6A 3NVTA 1VB9A 1US3A 2GGIA 1CGXA 3IIPA 4O4VA 3EOLA 3E02A 3G18A 2PAJA 2W4XA 1MUCA 3LQGA 1JEZA 4AISA 3VILA 1AD4A 5C71A 3GDMA 5HQEA 1AZ2A 3KHJA 3VIHA 1CECA 3MMWA 4EQRA 4IG2A 4LRTA 2NPXA 4GACA 5CPOA 5AHEA 2Y1HA 4PMRA 2FJUB 1F4AA 5HJYA 1B30A 1KTCA 3EDKA 4H4XA 4UTWC 4RE3A 2JK2A 2WWCA 3O3RA 3ES8A 4GY0A 4DXVA 4BEUA 4DLMA 2J7DA 1XPYA 1ONEA 4FNTA 1HJWA 4NX5A 4GNVA 3W01A 4C6NA 2RKXA 1C7TA 3RMEA 1KBLA 1BYDA 1J5SA 1J11A 3GIQA 4QLJA 1B3XA 3VDAA 4B5WA 4BY3A 2V5CA 3DFPA 3DH9A 3DK4A 2J8TA 3R43A 4LVAA 4EWJA 2ZVRA 1CB7B 2Y7GA 4UMAA 3CZJA 3CHEA 4LVGA 4AD2A 4O53A 4ZOCA 4O19A 3SR7A 1L8PA 3EMZA 5E6ZA 1C3FA 1TJ2A 3H53A 2P3ZA 2GLKA 4L5ZA 1WDRA 4OZOA 4RNIA 2O56A 4DJDD 3AAMA 4PTWA 1W9DM 2EPLX 1HO1A 3O2LA 3G22A 1YNPA 1FWHC 3EKZA 4A3YA 4KFOA 2YLAA 3GD3A 3QY7A 4N9EA 5FS9A 1RSCA 1U5HA 3I6TA 1H7PA 5TBOA 3OU8A 3LLFA 2I9UA 4I9MA 2XWDA 2GVYA 2J8GA 3TZFA 1OFRA 1QW7A 1QHOA 3VD7A 3ARUA 2CLKA 4YWOA 2VFDA 4OWGA 1KRCC 4LAOA 2A6NA 4K3ZA 4URIA 1FY6A 1TR9A 4M19A 4DF2A 4CU6A 2J9YA 1TYGA 1SJCA 1E0TA 4ZB0A 1ZAJA 4NKCA 4BK9A 2QCMA 2B7QA 4ADSA 4F48A 4I8DA 4ADTA 1AH4A 5AHNA 1GETA 4IQDA 3THQA 4Z2IA 4B5VA 4P8WA 1QPOA 3GXTA 1GQKA 1EBDA 1W5PA 3P61A 1C8QA 1JUEA 2BOGX 3DFYA 3GO2A 4JTKA 1F73A 3RM9A 4YCPA 4AHPA 4Z42C 2FZ9A 4OGZA 2GQ9A 1M65A 1AMKA 3D3FA 1BF2A 4Y9PA 1I2NA 4MOZA 1B1YA 4AF0B 2XISA 4CEXC 3PTKA 4F9DA 5ECUA 1FCVA 5I7GA 3ITLA 4DI8A 1UC4A 1J0HA 5DQPA 1CWYA 3FA3A 3VNMA 4OFCA 3Q4DA 3DDMA 1F8WA 3A7AA 3VX0A 2GJXB 1YPXA 3Q58A 3PZMA 3STGA 5SWUA 2G8ZA 2PP1A 1OCQA 4P8UA 1S1RA 3GNXA 5CPLA 1S5VA 4GKLA 5I6SA 4NX0A 2ZA1A 4CCCA 3RLHA 1RAKA 1P5BA 2X1TA 4DHGA 2YLLA 3SCRA 2OLSA 3HPAA 1BSIA 2PTWA 3I3DA 5G5HB 1CXLA 2QUVA 3UZZA 2FFIA 1TX0A 2NQJA 4IMAA 3WDRA 2F2HA 2ZXDA 3F5LA 4MYXA 4KEUA 2OGYA 2OWXA 3V0SA 3AMZA 4QE1A 3RCMA 1XIFA 4MWAE 1FX6A 1RZMA 4GY7A 2VGBA 2YB4A 4S38A 5DLCA 3VNJA 4OBSA 1CX9A 3CZEA 5BRQA 3VMNA 3EKGA 7XIMA 2BP1A 3PZ9A 2DIJA 1HFBA 3BSHA 3D46A 5HNTA 3IJQA 2NX3A 4QP0A 4CUCA 3WUGA 5I23A 3R0UA 4J2MA 3Q6JA 4A2RA 1V5XA 4PUDA 4MLJA 3CASA 2OZTA 4GY1A 4XZHA 2C7FA 4EPBC 2O7SA 3OLDA 4H4VA 5A6TC 3CWNA 3KRSA 4K39A 5AECA 3IRDA 8RUCA 4GXWA 3KOYA 2FYMA 1XV8A 3TC3A 2OQLA 3AXIA 1LYXA 4S3DA 5CPSA 6ALDA 4GJ1A 3MV11 2V69A 3H12A 1O95A 4KF1A 3W1PA 1DJXA 5F4XA 4BURA 3SFKA 2X8GA 4GE8A 1JCJA 2H8ZA 2W91A 3QFWA 3S5SA 2XSAA 1XD0A 5XINA 5CSSA 2WWDA 2FH8A 1GQIA 1U30A 4E5TA 4QJ4B 4O17A 3HBLA 4MZ8A 4HPNA 4RXFA 5K2ZA 4MB1A 3EWYA 2NV9A 5AY7A 4GRSA 5KINA 3AJ7A 1MQRA 5HANA 1GJUA 2ZWZA 1UR3M 4AZCB 2PDNA 3JZUA 5HATA 5D09A 1HL8A 1GV4A 3ZJ6A 1W5MA 3LRMA 5HNNA 1GKQA 3GZAA 3TAKA 1UBSA 1TJPA 1IEXA 1M6IA 3URNA 1X98A 2O7QA 3ABZA 1W9VA 1TQJA 4KT2A 2XVLA 4OT7A 1V02A 4FEZA 1P7TA 4JQ9A 3QV9A 2D20A 2YL6A 1BXNA 1EHNA 3AXHA 1WUFA 4HJFA 2ZZ0A 1J18A 1XM3A 3M0YA 3DFTA 2GR0A 4B2DA 1B3OA 1NIUA 1HQTA 1MXGA 3KZPA 6A3HA 3ZLGA 2VZVA 3WLNA 2J7HA 4KS0A 3HQNA 4AEOA 1OFQA 1TVNA 4KWOA 1FFRA 3EEZA 4K36A 1DPMA 4MPKA 4FIQA 3L68A 1N5XA 4O1CA 2NUWA 1SFJA 3DH7A 3W27A 2WPGA 3P8JA 6REQA 1H1YA 3SJ3A 3MI6A 3V0TA 2WKGA 3DHUA 4FF7A 3R8GA 3MHUA 3BICA 1XIBA 4V33A 3MO4A 2QDHA 5A2CA 4US6A 1J4EA 3W7OA 3E6EA 1XQLA 4NYYA 1AA1B 1LOSA 4N4QA 3EWCA 1R5YA 3T4WA 2QNEA 3N04A 4B3KA 3BXWA 1KM5A 5JCIA 2EGZA 1PEZA 2IW0A 1RBAA 1FO4A 3D5HA 3FW6A 4HZMA 3CQJA 5AC5A 1O7AA 1NWUA 2CFFA 1NH6A 4PCPA 3CPGA 1XFCA 4ADUA 4AFYA 3PUOA 4DZHA 2DUZA 2RABA 3IANA 3UERA 3KE0A 3CEUA 3NVVB 4HOZA 1ALDA 3L4TA 5C9UA 3W3OA 1TPDA 4IXHA 3ZR5A 2I57A 3OLIA 1H7OA 2OYMA 3EWXA 1CGWA 3UESA 4H9ZA 1F2JA 2EG8A 4XUYA 2ACSA 3LRLA 3A13A 1E6SM 1ZQ5A 3TCSA 4QX4A 2E40A 3QV7A 4G7EB 4X2RA 1ME7A 2R8WA 1GTEA 4HMNA 4A8LA 2ZX9A 4Z17A 4YVPA 5BOOA 5LNWA 3BK0A 3NURA 5FAGA 7ENLA 1YKWA 3R94A 1PO9A 1CGYA 4I5UA 1IXNA 3LSBA 2WPCA 4FIRA 2DZVA 3VFLA 4M51A 1TCMA 3OZMA 4GQBA 4CKQA 1WDQA 1EJXC 1IGWA 1OYAA 2IKJA 2CBJA 1XHCA 4QDPA 2UY4A 4EM3A 2CZ5A 3L4XA 3WNNA 2VC6A 1W5NA 3HN3A 2PEVA 3GIYA 2WHMA 1P1XA 3NL3A 5FESA 5REQA 4X9SA 3F4VA 4PUMA 2PTXA 5ABGA 2W0UA 2ABAA 2DIEA 1UJQA 1I75A 3DG6A 4BJHA 4EAYA 1DJZA 4K1GA 1TJRA 1C8XA 1Q7ZA 3ITTA 3CO8A 1IXPA 2WCSA 5FEWA 5AVNA 1UR1A 2TRSA 4D1IA 4O0ZA 4KCUA 3IGHX 3L0KA 3ES7A 2QCGA 4PFMA 3MBFA 3WUFA 1DE6A 1R3VA 2D2GA 3MCMA 4WQ6A 3KCLA 3OC4A 2VEGA 1Q2RA 2WJEA 1D8CA 3NEVA 3LRKA 1BZLA 3B9DA 3W02A 2A3EA 5DMYA 5FAJA 2GDQA 3CAVA 2YX0A 1VD6A 2C6QA 1JNDA 1HVXA 4WCJA 3PP7A 2DVXA 1L8NA 4XD4A 5B80A 4LVDA 3EWBX 1H2IA 2BVTA 2FH6A 1TZ7A 2OEKA 4LBSA 4XZBA 5J8LA 3VDCA 5A8PA 4ZEPA 1C93A 1V79A 2C3DA 3UXAA 3CNYA 4UQ9A 4IQLA 2PRHA 3CQ0A 3MP5A 3KFTA 3WDJA 3F2DA 3UD6A 4JIRA 3C86A 3BAYA 3TU9A 3VC5A 1WB0A 1I6NA 5D8ZA 5FSEC 2OEJA 4GVIA 4AAJA 4RUBA 1ML1A 3BV7A 4UTWA 1UQZA 4AVNA 3TQ0A 4NUWA 4Q8UA 5G2IA 3GD4A 4MPQA 3V75A 5I3KA 4EWND 3KTCA 3W38A 3HU7A 3S1UA 3T55A 1GVSA 4DUOA 3VDHA 5DXYA 5CSUA 5KZDA 2BV9A 3U5YA 2AKMA 2B7NA 4XG1A 2BXYA 4MADA 3NSXA 2PGFA 4S2CA 3R12A 1A50A 5BXSA 5HK4A 2AGKA 3AFBA 2GGJA 3PG9A 3AZSA 2J24A 3QMSA 1DP0A 3R58A 5F2IA 1KRAC 4WY0B 1ZP3A 5FJRA 3HZ3A 4EPKA 3VC6A 5A8QA 3SDOA 3UWEA 2YXOA 4DO7A 3EGJA 3OB8A 4XBKA 3IGXA 4CQCA 3LG3A 3MKKA 3WK1A 3T44A 1RA0A 1XLFA 3DGBA 1VZWA 3FAXA 5M5DA 3FAWA 2HROA 4L64A 4QS5A 4LQ1A 1EJ7L 1QBAA 1X2HA 4WRHA 4UMBA 3W7MA 2NQLA 3E5PA 4JQAA 3LBCA 1N55A 3MMTA 3W22A 2CFYA 3KWSA 3W7NA 2OVLA 1XRVA 5ABFB 1M01A 1KM6A 4I9AA 4B3LA 2HQMA 4IISA 3N25A 3OHMB 1H50A 3GW3A 3K13A 1H7RA 4KCTA 3R4IA 3QKEA 1TWSA 4H3DA 4I7WA 4GUGA 3W28A 3W74A 3OIXA 4JN7A 1J12A 3GG1A 4LCQA 1E3XA 2V30A 4NNCA 2X0HA 4JAWA 3T08A 3OGSA 2QVHA 1IWBA 4FLSA 3QC0A 3NGJA 4GGHA 1JZ6A 4RPQA 2E9MA 2WB5A 4NJIA 3PPGA 5F2MA 1EDGA 2VC5A 3E2QA 5RUBA 4ZO6A 4Z1CA 4H01A 4Y7EA 1OIFA 3LX9A 3E74A 4JL1A 1X97A 3M0ZA 4XZLX 1F74A 2OT0A 4A2SA 3TYAA 2H90A 5CLWA 4QBXA 5FF2A 3QQ0A 3VK5A 4U33A 3TYEA 1PYMA 1E55A 2G3JA 1OFDA 4KGLA 4KH2A 1ZSXA 4DJFC 2VTFA 3H7VA 4U31A 2CWNA 1W3NA 3S1XA 5CEWA 1YW1A 3W2MA 4O18A 4RZ5A 4IIHA 3CAKA 4ZODA 1QXLA 4QTGA 1PTGA 1A5AA 3PR2A 5BOEA 4IWWA 1AMYA