3QLDA

Structure of probable mandelate racemase (aalaa1draft_2112) from alicyclobacillus acidocaldarius
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
383
structure length
383
Chain Sequence
b'SLQTCVLHRLSLPLKFPMRTAHGHIREKQAILVQLVDADGIEGWSECVALAEPTYTEECTDTAWVMLVHHLVPRFARWLRAASQDQDVDPRTVCEALRDVRGNRMSVAAIEMAVWDWYAARTGQPLVGLLGGGRDRVEVSATLGMSESLDVLIQSVDAAVEQGFRRVKLKIAPGRDRAAIKAVRLRYPDLAIAADANGSYRPEDAPVLRQLDAYDLQFIEQPLPEDDWFDLAKLQASLRTPVCLDESVRSVRELKLTARLGAARVLNVKPGRLGGFGATLRALDVAGEAGMAAWVGGMYETGVGRVHGLIAAALPLMRYATDLGPSDRYFEQDVLKEPIAFVEPGVIQVPQCAGVADWVDRDAVRRFSTATWSVDLRTLEGHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mandelate racemase/muconate lactonizing protein
publication title Structure of Probable Mandelate Racemase (AaLAA1DRAFT_2112) from Alicyclobacillus Acidocaldarius
rcsb
source organism Alicyclobacillus acidocaldarius laa1
molecule tags Isomerase
total genus 117
structure length 383
sequence length 383
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3qldA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3qldA01
3Q45A 3CYJA 4FP1A 3P3BA 3R10A 4A3RA 5J04A 4JHMA 2QQ6A 4M6UA 3TJIA 3CT2A 1WUEA 1MNSA 2ZADA 2PODA 4IP5A 1SJAA 3VC5A 1DTNA 3Q4DA 3TQPA 5BOEA 2AL2B 3GC2A 4HYRA 3V3WA 2NQLA 2PTYA 2PSNA 1EC7A 3OW1A 2QJNA 1WUFA 1EC9A 2DW6A 3BOXA 1EBGA 2PA6A 3EEZA 3DDMA 4A6GA 3IJIA 1OEPA 2OO6A 3UJFA 1EC8A 3S47A 3MQTA 1TE6A 4IL2A 5FJRA 3RR1A 1XPYA 3IJQA 3CK5A 4MMWA 3P93A 3B97A 2GGGA 3R11A 3N6JA 3D47A 2GGIA 3H70A 4HCHA 2MUCA 3D46A 3TTEA 1SJDA 3NO1A 3MKCA 3OZMA 3IJLA 4G8TA 1ELSA 3UXKA 2PP1A 4YWSA 1TKKA 3NFUA 4GMEA 4HPNA 2GGHA 5FJUA 3N4EA 2QDEA 3DESA 3SJNA 4M0XA 2PU0A 1MRAA 1TZZA 2P3ZA 3I4KA 2AKMA 3TOYA 1F9CA 2OVLA 3TW9A 2I5QA 2OKTA 2OQHA 1KD0A 4H83A 4MKSA 3KUMA 2DW7A 3MZNA 4E8GA 4MGGA 1BKHA 2XH7A 4H2HA 3GY1A 1JPMA 3P0WA 3DGBA 4HNCA 2POZA 5ENLA 2XH2A 1ECQA 4HNLA 3H8AA 3IK4A 1NU5A 1P48A 2GGJA 1FHUA 3VA8A 2AL1A 3ZVHA 4IL0A 1FHVA 3PWGA 3I6EA 3DG6A 3FYYA 3H12A 3TCSA 3K1GA 5FJPA 4Z17A 4DWDA 3SN0A 4KWSA 1JCTA 1MUCA 2ZC8A 1W6TA 2OZ8A 2CHRA 3NZGA 3RO6A 3VC6A 2HXUA 3T4WA 1BQGA 2PP0A 3QN3A 4KPLA 3TWAA 3ZLGA 4A35A 2QVHA 4H1ZA 2AKZA 3QLDA 1JPDX 2GL5A 4ZA0A 3H7VA 3RGTA 3SSZA 4E5TA 3OP2A 3ZLFA 2PTZA 1IYXA 3ZVIA 3DG3A 5EU9A 1KKOA 3HPFA 3FV9A 3UCCA 3BJSA 1L8PA 2XH0A 3TJ4A 3JZUA 2XGZA 3STPA 4G7FA 4ZCWA 3ES8A 2OX4A 3PFRA 3I6TA 1R6WA 1SJCA 2OLAA 2O56A 5FJTA 3V5CA 3UJ2A 4F4RA 2PTWA 3VCNA 4GGBA 3FCPA 2PGWA 4K8GA 3SN1A 3R0UA 4IP4A 2OZ3A 3V5FA 4GGHA 3THUA 5BOFA 1MDRA 3SBFA 2PTXA 4GFIA 4IT1A 1KKRA 3MY9A 3UCDA 3T8QA 2P88A 4IHCA 3RCYA 1ONEA 3U9IA 3U4FA 3QPEA 2PPGA 3JVAA 4E4UA 3R1ZA 1E9IA 3N6HA 4GYPC 3SQSA 2QDDA 6ENLA 2P8BA 2MNRA 3N4FA 3RITA 4E4FA 2AL2A 3OPSA 4EWJA 1P43A 2PU1A 3DIPA 3GD6A 3FJ4A 3UJSA 3MSYA 3PWIA 3S5SA 1RVKA 4IZGA 2QGYA 4J3ZA 3OTRA 3CAWA 4DN1A 3QTPA 5IDZA 4X2PA 3UXLA 3QKEA 4HN8A 2FKPA 3ZVHB 3ENLA 2XH4A 3DEQA 2GGEA 2OPJA 2PP3A 3DFYA 3CXOA 4ROPA 1JDFA 3R0KA 4K2SA 3JW7A 4Z1YA 4DXKA 1YEYA 2XSXA 4KT2A 3GO2A 1MDLA 1NELA 3BSMA 2GDQA 3ZLHA 2HXTA 2QJMA 4J1OA 4GIRA 2HNEA 4DX3A 3MWCA 2RDXA 4DHGA 4E6MA 2OFJA 4GISA 4FI4A 2PMQA 3MUCA 2OQYA 3DFHA 2ONEA 3TWBA 2HZGA 3NXLA 1SJBA 2PS2A 4K1WA 4H19A 1R0MA 3DERA 2QJJA 4JN7A 1KCZA 3VFCA 3V4BA 3OZYA 3ES7A 3T9PA 3SN4A 3FVDA 2FYMA 4JN8A 7ENLA 3CB3A 2OZTA 4ENLA 1EBHA 4KEMA 2PGEA 1PDYA 3UGVA 4HCLA 4HCDA 2PCEA 3FXGA 3RRAA 2GSHA 4GYPA 3EKGA 3DG7A 3R25A 3UJRA 1PDZA 4DYEA 5FJOA 3T6CA 2OG9A 2P0IA 1XS2A 3PK7A 3UJEA 3VDGA 3VCCA 2P8CA
chains in the Genus database with same CATH superfamily
3N9SA 4A8RA 1BEUA 1W5OA 4QSHA 3ERPA 4L4OA 4WRHA 1JZ5A 4J2MA 5DO8A 4PMXA 5DCEA 3QR3A 2BNJA 3PVFA 4X3ZA 4AX7A 1K9TA 1RM6B 2NWRA 3Q4DA 4A3UA 4YHGA 2E9LA 1FDZA 3GVGA 1QVBA 3VM5A 5FSDC 3NM1A 3R8HA 2B0MA 4Q8VA 5I3DA 5T91A 1KV8A 3OW1A 2NT0A 1CTNA 1OCJA 4GY7A 1QNPA 1JPKA 4IGSA 2BXZA 3EXRA 1TWDA 1VLWA 1V0MA 2PLJA 2DIJA 4I7UA 1LJYA 3WKZA 4MMWA 3B97A 1IIHA 2ZX7A 5LZLA 3QMRA 2PBGA 1B9BA 3K1DA 1UG6A 1KRMA 4J3UA 5M3WA 4Y6GA 3BZJA 3FAXA 2OX1A 1R9YA 2OMAA 1KFJA 2NV1A 1UP2A 3ITCA 3EKLA 3ITLA 1H5YA 2QPSA 5K3VA 2IPWA 1R3VA 4ZENA 2E67A 3WLLA 1NTHA 4P7OA 2QR6A 3HPZA 4EP8C 1O94A 3UF9A 1EYEA 3C5QA 3KL0A 4G6CA 3DAQA 2B7PA 2YBVA 1N55A 4V28A 4H9XA 6TIMA 4L5ZA 4A2RA 2GFTA 2V8ZA 3VIPA 4O0QA 4C6CA 4JIHA 1VFLA 2PE4A 1XFBA 1Y8BA 3W2MA 1OGGA 3UW6A 1K3UA 2GVYA 1CB7B 3KL5A 2JIWA 3OOQA 1W9XA 2I57A 3IIPA 3VNKA 5AYZA 2NXIA 1VEOA 1O1ZA 4AD3A 5U1OA 2PWVA 2F7FA 4GWEA 2HVOA 3GIPA 1NY1A 3WQVA 3MO4A 4ACZA 5A3HA 4S3FA 4DWDA 1S38A 3ITGA 2DIKA 2D20A 3II1A 3W73A 3P7YA 1E15A 2OZ8A 2ZZ6A 3S3GA 1YDNA 3SCUA 4B2DA 7REQB 2NLYA 2Y24A 3ONBA 4CQBA 5F4WA 3F5KA 3WFZA 2GJPA 5K9CA 2ZQ0A 3TWAA 2WCSA 2C3DA 2AKZA 3PTKA 4UZUA 5AC5A 1NPXA 2VX7A 3USBA 3W00A 1VIZA 2E09A 3OP2A 1MXDA 4NKCA 1YTKA 4KCWA 3FV9A 3VD5A 4GUGA 2D1ZA 2A7RA 2VELA 1KM3A 1LBMA 4E3VA 3REQB 1VRXA 2BOFX 2WPGA 4CN6A 1JZ7A 5F4XA 1PKMA 4CGTA 4UTKA 3SQPA 1XGEA 3M43A 2G4JA 7ODCA 2OLAA 3O63A 4BK9A 2WBAA 3BL3A 2FDMA 1Y0EA 3EXTA 4DUXA 4F4RA 1R9XA 4MY9A 2YXXA 5JRBA 5AYXA 3TN4A 1SM9A 4QLJA 4RZ6A 3MHUA 4HZ7A 5EBUA 3WEZA 1VENA 1V8EA 4CNOA 1F74A 3GUWA 5C9UA 1E9YB 3BG3A 7TAAA 4C6MA 1JCLA 3WD3A 4IP4A 2OZ3A 4OIFA 4B5UA 2ISDA 2AOSA 4PTWA 2CPUA 2WP6A 3RM9A 4TVCA 1OG0A 1TIWA 1KBBA 3S5OA 1FXPA 3AIBA 1F5ZA 4O13A 1SO5A 3BK0A 1DQUA 5BXSA 2YQUA 1JF6A 4N9CA 2ZXQA 4GYPC 4H7ZA 3CV6A 1DE5A 4S39A 2BBFA 4NZCA 3EAUA 4RX0A 2A3EA 5K7JA 1FWWA 2Y8KA 4EIVA 3QHOA 3HV8A 5A6BA 4JHZA 5AC8A 4QX4A 2QCNA 1W56A 4E2VA 1RXOB 3TC7A 1ONXA 2DIEA 4GFSA 2PDKA 3UA4A 4DBEA 4D1JA 2YXGA 2YFNA 4POCA 1XD1A 3BVJA 5TAOA 3SFKA 5BOOA 3O0KA 5DY3A 1ZLPA 3G8RA 3UZJA 3BLPX 1MW3A 3T0AA 3S1UA 4LEQA 1K02A 1GTHA 1OC5A 3QZEA 1T99A 3ZQ9A 4PL2A 4LYQA 1ZY9A 1TWIA 5F4SA 4LAZA 3W6LA 3W2KA 1Q8JA 4V2XA 1ZMCA 4BF7A 1N5XA 2FH8A 1ISYA 2A79A 2CZFA 1V02A 1KR1A 2CITA 4L64A 4O28A 4FX7A 1OBAA 1XV8A 3URAA 1Q7MA 1GOOA 1JDCA 4QP0A 2JK6A 2XSBA 3ZR5A 2EPLX 2C1HA 3KOZA 2RJGA 3DFQA 1ISVA 1TIMA 1J4EA 1I0DA 3FYOA 1R5YA 2ALDA 1FVPA 1NWUA 4MWAB 3CXBA 3NIYA 1RALA 1VEMA 2Z4GA 3LCGA 3KOFA 3NPVA 3RIKA 3E0WA 5HJLA 3RLVA 4OOZA 1XG4A 5C54A 3IACA 1E73M 4Q33A 2WJEA 1VR6A 4FXFA 4UTTC 1NFGA 3W9ZA 1K8YA 1KFEA 4ENLA 2V30A 3N12A 2W62A 1EJWC 3C0JA 4K7VA 1PZ0A 4NJGA 2BFGA 2PGRA 2P76A 3L68A 3NQMA 4KIEA 3WK0A 3DG7A 2CESA 3KLJA 3UVIA 4JFVA 2PWUA 7REQA 2RDTA 1MMFA 1TPEA 3RCMA 3GTIA 3BW3A 3UJEA 3G8EA 4YWIA 4EAYA 1SMDA 1TPWA 2IW0A 1YNYA 3KCOA 3DCPA 2GRTA 3WDHA 1POJA 4HPGA 4JTQA 4IPLA 4R27A 2G96A 3U8GA 1OCBA 4GABA 2XFRA 4H4YA 4EXBA 1FWCC 3K30A 2R24A 4ALDA 1YQ2A 1F6PA 3M0MA 2JE8A 4UTWA 3REQA 3CUGA 1XIEA 5BYWA 1IZKA 4ATLA 1M03A 3G1HA 1X39A 4AC1X 4E2DA 1H50A 2E5CA 4OU1A 3EEZA 3DDMA 5AY7A 3IJIA 1I0BA 4FEZA 3CB8A 4HK6A 3NQ6A 3S6OA 1X1OA 5HANA 1TTIA 1GV4A 4M6PA 4HCHA 4K38A 3NVWB 2YW3A 2NX9A 1XLJA 4XIMA 3W22A 5B7YA 5CCZA 1KBJA 3S2LA 2WXDM 3TYUA 4NZJA 3IJLA 3OVRA 5FOOA 3UXKA 4L1WA 1E6RA 3GW3A 4HOZA 1LWHA 2C0AA 1OADA 4Z1DA 4DJFA 5HJXA 3UXIA 1LVLA 3I4KA 4AZ7A 3NYDA 4FX6M 3SRFA 4JL2A 1OX4B 2I5QA 3LCHA 4XIAA 4MLRA 4H83A 3WUBA 3K4DA 1Q4NX 2PZNA 2J7EA 4H2HA 1AG1O 3DGBA 7A3HA 1RZMA 1U83A 2VEFA 5REQB 2VC6A 1E0WA 3TR9A 4WDXA 4NEVA 3E0IA 3A4AA 1ECQA 3H8AA 3EKZA 5MF5A 4N9DA 5ABEA 3PP7A 1EGZA 5AZ1A 4IQDA 4O0KA 3E12A 2HE5A 4IL0A 1J01A 3FX4A 2J6VA 4CNTA 4Q8WA 3UR2A 1A0DA 3DGZA 4LT9A 3S46A 1EP1A 3ZOAA 1J5TA 1TTPA 2GOUA 1GRGA 1XG3A 3QYQA 1H7PA 1Q6CA 2RGLA 3MUZ1 5G1MA 1KXHA 1IEIA 4IGMA 2KZHA 3GTXA 5JVLA 4W5ZA 2IXVA 2XZ7A 3UWVA 4ZO9A 1GONA 4PBGA 3LG3A 2J47A 1T5AA 1OIMA 1G5AA 4WJEA 1XD0A 3FJNA 3ZVIA 1JDEA 1X98A 3O1NA 1YDOA 1DJQA 2DUAA 3FK4A 4HA3A 1UZHA 1JF5A 3WNPA 5IXEA 3VE7A 1J0YA 2ADAA 2W9MA 5G4WA 4UTFA 1XWYA 3IJ8A 2AGTA 4H4TA 2EHHA 3PNUA 2OX4A 2YBTA 2VX5A 3NM3A 1C9DA 4JTHA 4B16A 4QNEA 2NQZA 4LC6A 5FS9A 3O8AA 5HMDA 2E25A 3WLOA 4KFPA 1W9UA 3HF3A 3TZFA 3VDAA 1V02E 2J79A 4KRUA 1WKEA 1QNSA 1IIGA 3CIWA 4HNTA 2Y7EA 1G1YA 4AMAA 1ZBCA 1L6WA 1OYBA 1JI2A 5F2IA 4ICNA 3SFWA 4Y2WA 1XISA 5FEPA 2WMGA 2GSEA 2IKGA 1AW2A 2O9PA 2ZCGA 1AW5A 1FP8A 5ECUA 2Z7KA 3JUGA 2VFFA 5A8OA 3A9BA 1ONEA 4GC3A 1BXBA 3U9IA 3F7JA 1WYGA 4GUIA 5GNYA 3VIJA 3WF3A 1OABA 3WQ4A 2J4GA 1E9IA 3SUWA 4H4RA 5HATA 1A3HA 5HQMA 4FXJA 3ABSA 1BG9A 3BG5A 3H7UA 3CGTA 3A3XA 3SCPA 4ONVA 1C91A 3CGCA 4EWJA 1DIEA 1KWGA 1V59A 3DIPA 4F2BA 1EWEA 2RH9A 1ZALA 3GXIA 4M1RA 1STZA 3LTSA 4Z0SA 3R7MA 3DHFA 3CAWA 2VD8A 1OB0A 3WG6A 4D9PA 2PAJA 2X7WA 3OGRA 1JYVA 4X2PA 3ARRA 1OX6A 1XSKA 3WO8A 1TRIA 1JCXA 2XN0A 1TTJA 2FJUB 3L5MA 1WV2A 4FXRA 1TX0A 3R0KA 3ARZA 4LUYA 3CZGA 2J9YA 4HPXA 1HX0A 1T6MA 1VIWA 3JR2A 3U48A 1S39A 2BVWA 1XLMA 4Y7EA 1LM1A 1WYIA 2VGGA 3GZ3A 1JI1A 3MKKA 1CDGA 3GO2A 1W3NA 2CZ5A 4G1NA 4P8VA 3LXCA 1Z44A 5LYRA 1OX4A 3GRSA 1DWAM 2GH5A 3L7RA 1LQAA 5JIWA 2EG6A 1WKFA 3GHUA 2HWGA 1WZMA 3SI9A 3PN8A 3THCA 5LGZA 3EMQA 4DUVA 3NXLA 5REQA 1TV8A 1NDVA 2DGAA 2HJPA 4YTRA 1RK5A 3BOLA 1B30A 2B31A 4OTKA 3S1VA 4EMWA 1V7AA 1FWNA 4PCNA 1R46A 2JALA 3VFCA 1E4MM 3DFSA 4E8DA 5A8NA 3SN4A 3GNPA 4AC7C 5C9RA 3EX2A 1XKYA 2X41A 4CU6A 3MJYA 1M7XA 2A7NA 3QMSA 3W1PA 3RRAA 4BI6A 2I5GA 2QVNA 1NFBA 3KRZA 4BQ3A 2OG9A 1GVOA 3WF0A 1S2AA 1DWHM 4PBEA 4MPQA 2ZUSA 3G2GA 2XZ9A 5AYYA 3EX6A 4XK2A 4ZTXA 3M7WA 3NO5A 1C90A 3CYJA 2JIEA 1UASA 4IJRA 4JFUA 1NH6A 5BXRA 3TYCA 2ZADA 4RZ4A 1ZPTA 3VMOA 2WLZA 1J6OA 1F6YA 3VC5A 5M2FX 1HVQA 4KQNA 4UTWC 1DTNA 3T40A 4KBXA 4JICA 3NQ7A 3V75A 4C90A 1ZQ5A 2VEMA 4JTRA 1XYAA 2WSRA 4HK7A 1EJUC 1UD3A 3WYZA 3MSGA 3ZXWA 3E02A 3TV8A 1WUFA 2O4QA 1CLXA 4L56A 3T07A 3CUXA 4UNLA 5C71A 3LXDA 1PYFA 4MZ8A 3BC9A 3MQTA 2A8XA 4EF8A 3N2BA 3VDCA 5JCLA 4LEFA 4ZQRA 1WDSA 4LVBA 2PDCA 2WCGA 3PSVA 3THDA 1X2HA 3HM7A 3WLPA 1W5MA 4YTUA 1CYGA 1DV7A 3U3HA 3CYVA 1RQEA 3G1AA 4HNNA 4WJ8A 2Y5JA 1J0JA 3GUGA 4LNYA 4DJFC 1HUVA 2E9MA 2ZUMA 1JJKA 2D2JA 4MWAE 3N14A 5D2XA 3SJNA 4YVXA 3ARSA 1XCWA 2VFGA 2CLMA 2QLYA 1F9CA 4U31A 4X9SA 3TTYA 1I45A 2E77A 5CZ0A 3CHEA 3RPDA 4EXQA 2C16A 3VDBA 4MSSA 2Y7FA 1YW1A 1WDQA 4E8GA 1U5VA 2XSAA 2ZX9A 3OZPA 2X1SA 4Q8QA 2PF0A 4CNUA 1NQKA 4JIPA 5CPTA 1PX4A 2H6RA 2NSXA 2DVUA 3I6RA 3N18A 3QY6A 1YHTA 1DNCA 1XCXA 2VQUA 4HNLA 2X30A 3M07A 4LS1A 3A47A 2D3LA 5DT5A 3O0HA 3GVRA 1XIDA 2J75A 1EGMA 1S2TA 2BHUA 3SAZA 1MZHA 3GVQA 2WV8A 4HMDA 1MVYA 3U5YA 3W85A 4GINA 1JYXA 1AH0A 4W88A 1TE1A 2CWXA 1QATA 2GDUA 3EOSA 5E9AA 3WLSA 4YN5A 4IFKB 1AL7A 1PKYA 3PF3A 2QULA 2YSWA 5G4HC 3BSGA 5I3HA 4NAEB 2HXUA 1YPFA 1ME9A 1WZAA 2CBIA 2Q02A 1NWSA 3I4EA 1ONFA 2CZEA 1LF1A 5E5CA 5C0QA 3H7VA 4LWWA 4MWAC 3QC3A 2YXOA 4X63A 2NQHA 4DXXA 4M8UA 1N8WA 2GQAA 2HNHA 4AG0A 4U5IA 4MZ1A 3DH7A 3L4YA 3QXBA 3CIXA 1FHDA 3W25A 4KERA 4YTTA 3LZ5A 2AAAA 1KA9F 1IR2A 1ZFJA 4JZ5A 4QE5A 1SSGA 2NLIA 5BRBA 1T96A 1GWJA 3OU8A 3O06A 4WY0F 3LV6A 1IF2A 3FHAA 1DQXA 4DY1A 1CZ1A 1I1WA 1E55A 1LP6A 3VZYA 2ABBA 2QAPA 2ZVRA 3AXXA 1QK2A 3R0UA 3AIUA 4F79A 3MY9A 2FTPA 3II4A 3ONCA 3R12A 2WHJA 1TJPA 5D09A 1O6IA 5C7VA 3VGDA 1TPFA 3MU7A 3URHA 1FH7A 4QCEA 3UG8A 3A21A 1WBJA 2DZSA 1N7KA 5MHBA 4IPPA 4OWGA 1WAUA 3RITA 2ZTJA 1WA3A 3W53A 4MJMA 2L5HA 3QF0A 4M6VA 2V82A 3NQFA 1LG1A 2YA1A 2OWXA 3SO7A 3XIMA 1O5RA 1E70M 4HNVA 4F0MA 2HQMA 3AMDA 3B40A 1H51A 4OQVA 2J88A 4J28A 3L5OA 5D2WA 2X8HA 2Q3OA 1LWJA 4IG2B 4WIWA 3QTPA 3BMXA 4HHLA 3UXLA 3MBDA 1EJTC 4A22A 2G0WA 1SFLA 3B9OA 4AAJA 2GGEA 1TPH1 3U6WA 3MYOA 4A2SA 4KWUA 3G1XA 1QI4A 4PE8A 4MB3A 3ICJA 2R9ZA 3BH4A 4RV8A 1M01A 4QLLA 1XLKA 2PF8A 1WDRA 5BNKA 1R3QA 3D5HA 1UW9A 3OYZA 5FACA 3HFTA 2WSPA 2WNZA 1G69A 4F9JA 3LY0A 3WQFA 3CQJA 4HMEA 2FZBA 4LS0A 5CBJA 4M7SA 4J1OA 2PRHA 4G9PA 3W7GA 4Q4SA 4GYKA 1K03A 3AMCA 4FI4A 3B06A 3MUCA 4XD6A 3RDKA 2NQ5A 5FSEC 4PULA 4LB4A 1L0PA 4MZYA 1UUQA 3KS5A 3TC3A 2C71A 3B0UX 4J5NA 1YKWA 3EOOA 3PJWA 4B5WA 4O1EA 3LUTA 1QJWA 3QW4B 1LOLA 3DKJA 2BX7A 2FYMA 2R1MA 2X0YA 3FA4A 5AYIA 3OVPA 1RAKA 4DYKA 3NQVA 1GEQA 3SR6B 2O0TA 1NHSA 4NHVA 4O15A 3EDDA 1E51A 3V0TA 1DJNA 4IFKA 3S5YA 3IVTA 4HJFA 1PDZA 5IHSA 3GHSA 1E72M 2GDVA 2DORA 5BRQA 4DO6A 4H9MA 4US6A 1S2VA 4C6NA 3LCWA 5F2LA 4NAEA 4C1NB 4V15A 2EQ7A 3AS0A 3RAOA 3GVWA 3U2OA 4C7DA 4ERIA 2OT1A 3GXNA 1UQZA 4C6PA 1KBLA 3W7EA 4LBRA 8XIMA 1IWBA 2EG8A 2O7QA 4Q8MA 3VIMA 2CBVA 4IICA 1F2JA 3WMCA 1V7YA 3QPZA 3PHAA 4L9ZA 5FF2A 4DVOA 4PMUA 3ZO9A 1CXKA 2WMKA 1HVXA 5H2ZA 5DRIA 4XD4A 1J2BA 3KFTA 3VX0A 4QQ3A 3B8VA 2XIMA 3CLWA 3ZM8A 4TVDA 2FPTA 5H91A 3EOEA 1M3UA 3OGVA 1Y65A 3UJFA 2E5DA 4NX5A 4XWUA 2XIQA 1YXYA 1DXLA 4FDCB 4FLRA 3N19B 4XTIA 2W0UA 2GUBA 1MRQA 3M5XA 4KWWA 2ZX8A 3WBYA 3PY2A 4U5KA 3HB9A 3UU0A 1ME7A 2OGYA 3R58A 3SIMA 1XDLA 2GQWA 3IAQA 4WEVX 4MAVA 3Q67A 1E6XM 5DY2A 3UGRA 2QT3A 3L4VA 2C13A 4O57A 1QW8A 5AC6A 2WSKA 3DI0A 1JGIA 1UWUA 4M0XA 2OB3A 3GQYA 4LYKA 1T0OA 4PTNA 2GZXA 1S3TC 2OVLA 1PTDA 2Y70A 3VGFA 2A7PA 1OFBA 1Y5VA 3LCLA 5KZMA 3M5ZA 4GZ7A 1UR0A 5CLWA 4FLSA 3ZWTA 1BKHA 5D2YA 2O9RA 4TMCA 1X8FA 4IG2A 4UBPC 3AMZA 3H54A 1KM4A 1GT8A 3NS1B 3T55A 1OX5A 1RD5A 2AL1A 3KBMA 1GOQA 3GG1A 2ACQA 4AHPA 1JCJA 2A21A 4LUIA 3E0LA 1ZDLA 1GVQA 4XVEA 3TCSA 3FDKA 5JXQA 1DJZA 4DIAA 2E5AA 1CLKA 1J93A 2OSYA 4TVWA 3M0ZA 1W31A 3EZ4A 3W6YA 2DUXA 1RBOB 2CHRA 4QDMA 3WQ5A 3OBEA 3VKAA 3JRKA 3KZSA 1HW6A 3SCWA 3VC6A 1NSJA 3CAVA 4H9UA 4PA8A 4PUWA 5AHFA 3OIXA 2VTFA 2E6FA 2J8TA 5HPOA 1F73A 2PRMA 3URQA 4JXCA 2GPTA 4DO7A 1BQCA 4R5EA 2BP1A 3NOEA 5EU9A 4QS6A 3GR4A 4ZOAA 1JAKA 1UWRA 5EGRA 2XH0A 3NPUA 3VKDA 5FMHA 3EYPA 1PB0A 4K68A 3STPA 1VFTA 4D6GA 4GLEA 1EKOA 2DZTA 3FA5A 3ES8A 3EDEA 1R7OA 2CW6A 4HPHA 5LNSA 2DT1A 1YTDA 2NUWA 4H00A 5ECVA 1VBUA 2GUYA 2WNWA 3VGBA 4BZYA 1IZCA 3LB8A 2VRJA 4GI6A 4UIOA 3WNOA 5F2GA 1IGSA 1OD0A 2OJPA 4JQAA 4O52A 2BZNA 1P4CA 3Q6JA 4K8GA 5D30A 5D8WA 1JUEA 4C1NA 1MW0A 1XDMA 3QOKA 3W70A 1JUKA 4HHHA 4C6FA 1QHZA 3HQ1A 1NOFA 3OHIA 5H1WA 1UOKA 1KXQA 3CH9A 1Z3NA 3HU7A 1IT7A 3CASA 4JTDA 4XD3A 3W1NA 3JVAA 2HEJA 1VPXA 1LTDA 4F66A 4GCAA 4CNPA 1IHIA 2YGYA 3UYIA 4P8UA 1UKQA 3BSHA 3G24A 4AWEA 4XAZA 2NXGA 4I7WA 1B4EA 3IRDA 3MCNA 3W2LA 3LBMA 4RE2A 3L2LA 3DUGA 4IIFA 1Q3NA 3VNZA 2EQ8A 1OFAA 4LFYA 5C55A 1AZ2A 1HZYA 4JTTA 2XWDA 3GD3A 3AMKA 3PG8A 2I14A 3QV9A 3PTMA 4HN8A 2GJLA 1X7FA 4NVTA 2EG7A 5HOSA 4Z0JA 1CWYA 2PP3A 3PG6A 2RAGA 3QKZA 4M7TA 1V3MA 4ZSTA 1GVIA 3PBVA 4K8EA 4Z1YA 4UTMA 4DZHA 4RE3A 4DXKA 3FSTA 4ASTA 1AJ2A 4PMNA 3SIZA 2HSAA 3FW6A 1XX1A 5GNXA 2DV0A 2EF9A 3W1QA 3CT7A 5GQBA 2UY3A 4LNCA 4BQ2A 5ABHA 2EQDA 4PODA 4MUPA 1RV8A 1I2PA 4NZ1A 3E0VA 1VZWA 1UWSA 2OFJA 5C9ZA 2YA0A 3KBJA 2WYSA 3DECA 4C5YA 1B2YA 1KQYA 4FNUA 3LPFA 5AN7A 4HSOA 4D6DA 3EPOA 2HZGA 3WNMA 2C7FA 1A3XA 1P5BA 2FGZA 1SO3A 3KVJA 8RUCA 3FNDA 1SFJA 3TE9A 1DXIA 4YU1A 1XC4A 5L6UA 3PAJA 3GU1A 2VM8A 3AJXA 1UR2A 4JD4A 1PZ3A 4CD4A 1TMHA 4IH3A 3O0FA 1Z48A 3BCJA 1FFUC 3CLMA 2Z26A 1ZY8A 2FHFA 1EP2A 2W67A 2WAGA 1E43A 1GZ1A 1KM6A 4JKKA 1BD0A 4JY8A 1IGWA 4HCDA 1Q2SA 3CUFA 4NYUA 4H4SA 4K7ZA 4HMCA 5CAKA 2FFIA 1FWBC 3VCCA 1W9DM 4R3UA 3GRTA 3P67A 4ZOBA 1RD6A 1E3ZA 2W61A 4ZFMA 1NFPA 4XZBA 4JHMA 3CT2A 1WUEA 1MNSA 3E3HA 1EYWA 1W3TA 1WDPA 1MZRA 4OGZA 4O10A 4C6DA 4LBSA 5HULA 1WOBA 4QROA 3AIEA 3MUAA 4F9DA 4Q4PA 3V3WA 1C8QA 2PSNA 4HBKA 4OHQA 1CXIA 4EQWA 3GS6A 2OWCA 2Q8LA 4LUTB 5D04C 1EC8A 4YWOA 2VNCA 3NOYA 2WZMA 3C52A 1P0KA 4P2VA 4P61A 2QJGA 5K4ZA 4H4ZA 1M5WA 3AROA 3H70A 5IOBA 2QNEA 2QPUA 2VR2A 3RXZA 4GC4A 4EWND 2P53A 5AECA 2X42A 1AZ1A 3LI0A 3L66A 2E8YA 1EJVC 2WM1A 3VIKA 2J7BA 1AJZA 5IBXA 1W8GA 3EDKA 2QDEA 4H4IA 1HG3A 1T8QA 3DZ1A 1ICPA 4S3BA 2WB5A 2CU0A 4R88A 3THAA 1RHCA 5AVHA 4MKSA 1K77A 1QNRA 5I07A 3O6AA 5LA0A 5HNUA 1G4SA 4I5RA 5KVHA 4P8WA 4CVUA 3LBOA 4OE7A 1VH7A 3TAKA 1KGUA 4EMJA 4BI5A 4AU0A 1UP3A 3EDFA 1GEUA 4J3XA 4DWSB 1A50A 2DT0A 3BLDA 1ZU8A 2EPHA 1FHUA 1BTMA 4Q4OA 3BOFA 4JX5A 4KKXA 1BFNA 4Z2HA 3DN5A 1DWGM 3VXGA 4KEUA 4TVUA 1B3OA 5FEXA 1EO5A 1EPVA 5A2BA 5BWAA 2EPMX 2H90A 1W3KA 4A05A 4BI7A 3PZUA 1MEWA 2Z1VA 2QDHA 1Q8AA 3PULA 3R13A 3H7RA 3QSRA 3NL6A 2XG9A 3VIFA 1O5KA 3L0NA 1XYBA 1UROA 3K4WA 3BAKA 2VGBA 3DX5A 2G41A 4W86A 1DEDA 4WOQA 3MP4A 2DZVA 1SO4A 1TMLA 1XSIA 3VNLA 1XLCA 2A0NA 3ZT5A 1RUSA 5A94A 3TEVA 2WHKA 2ZUNA 3PTQA 3GTHA 3TTOA 1P1XA 2ZOXA 4GJJA 5CG7A 3RN6A 3HGSA 3WJZA 5C2XA 2OWWA 3RHGA 4YXGA 2A6NA 1H7RA 3H2OA 5H8MA 1X97A 1PBGA 2GQ8A 5JCKA 3G1YA 1EF2A 5DMYA 2QCGA 1C7SA 3IV8A 3PFMA 5FS7A 3M1ZA 1Q7ZA 3WUFA 3IVUA 4B92A 1Z9AA 3H22A 5FJTA 3V5CA 1DHPA 5FS6A 2QMJA 2WWCA 2VI0A 2VR5A 2X1RA 3VMNA 1N82A 2J7GA 3W2UA 2JBMA 6A3HA 4C1LA 3KBWA 4APNA 4KIRA 5I23A 2PGWA 2TODA 2ISSA 4L4PA 2Z2UA 1NHQA 1AQMA 5FESA 4GBDA 4CNNA 1ZK7A 4GI9A 1KQZA 3CQHA 4IT1A 2EXOA 3TN5A 3WLTA 3FSUA 2E1WA 1C8XA 5K4XA 2DZBA 3NPXA 1B5TA 4W89A 5CPLA 3E0FA 3BJFA 1TR9A 3AYRA 3P81A 4F8XA 2VL4A 3QYSA 3WLQA 1V3HA 4MNKA 3BMWA 1GUVA 3CHFA 4FX9A 1QAPA 1GVEA 3DJJA 4GXMA 1EB3A 3IJ6A 3W82A 2I9EA 3T08A 3P2VA 3WEOA 3APGA 3PB0A 4S2CA 5E0KA 1L6FA 4ADUA 3MSYA 2WNNA 3O6CA 4GQBA 4C6JA 2QJHA 1ZAIA 1XHGA 4LUTA 4IF2A 4PH6A 3CMGA 3M0IA 4U2YA 1C29A 3AS3A 4Z1AA 4RNFA 4N2YA 1Q5MA 2FMNA 1UH2A 1HFBA 3V18A 4HD5A 3RMEA 1RY0A 4ROPA 4NJJA 3C0SA 3TIMA 3SCSA 3NR0A 1FWGC 1I2QA 1FXQA 4UB9A 3A7RA 3QRHA 1UA7A 2QUNA 2V81A 3WMSA 4MKVA 1DWFM 2E28A 4Q4KA 4K6AA 3N11A 4K39A 4LS2A 5G1TA 3QTGA 4BV6A 5J5DA 1H1YA 1EFZA 1Z41A 3STGA 5HNNA 1TV2A 3VNDA 1AUSL 3L67A 4D6CA 1ZJBA 1O66A 9XIMA 4FNTA 1FO4A 3F5LA 1MWOA 4DWSA 3B8UA 4PCPA 1MYRA 4B9YA 4IXXA 2ZKMX 4D72A 3VGHA 1QFEA 1U22A 3W1AA 3AU6A 3OZYA 3N25A 3PZNA 2ZZ7A 1JULA 1FWAC 3WUGA 2NX3A 2FZMA 1EBHA 5IFTA 5F2MA 1FA2A 1XLEA 1U5HA 3W1MA 3T0TA 2OSXA 4HTBA 3SCVA 5JCNA 4WHBA 2XVGA 5D9MA 4XAFA 2O92A 5BW6A 3HPAA 3NZRA 3KX6A 2DZXA 4K8HA 1OFPA 4MG4A 2W3RA 7PTDA 3WELA 4FNPA 2ACSA 1VYSX 2NV9A 1C7TA 3NL3A 3COTA 1RA5A 4AVFA 4WCJA 3TJIA 3APYA 5LNRA 1WXYA 4CD6A 2J25A 5GJPA 1GPWA 4AD4A 1GRAA 1GJWA 2QGHA 1UD4A 4JKMA 1XL9A 3IUHA 4MB4A 4ADTA 4JN6A 2VJXA 3S2MA 3S0CA 3OLIA 3VZZA 3W02A 1MXSA 2Q01A 4I5XA 4LUJA 4C6QA 2BXYA 3H2CA 1GREA 2Z2AA 3W27A 4FA3A 4ZQOA 3B05A 3ZJ6A 3RCNA 4N4QA 2VEPA 2IUZA 4R33A 1AD1A 4H9YA 1QPNA 4X22A 2OO0A 4TV6A 3Q2DA 1A5AA 3VNIA 2W66A 3N13A 1W2VA 3AU2A 2MUCA 1LT8A 4GQ0A 1DIDA 1W5NA 1SB3B 1M04A 4UMCA 3WBXA 1KTCA 3WBWA 1J79A 2R82A 4ZO6A 4HZ6A 7CGTA 5IBXC 1FDYA 1JFXA 2DEPA 4AZBA 2CNCA 3SB0A 2TRSA 3LB0A 1NDAA 1R86A 2VWTA 1EIXA 1D7FA 3ECQA 2XVKA 2P3ZA 3EF6A 2OELA 3TN6A 5JUVA 3TW9A 2C1IA 1BYDA 3W7KA 3PNZA 3HRDC 2DW7A 3ARTA 4RDYA 4XUGA 3MZNA 3AJ7A 3EUB3 4MGGA 2FHCA 3VFLA 1NDZA 3GY1A 3P0WA 1EL3A 2W63A 1XLAA 3WLNA 5JBDA 4WXYA 3W24A 1A4LA 5ENLA 2Z7GA 1TCDA 5IDIA 1TELA 3I7QA 4H6RA 2XFFA 1X1ZA 1F3TA 3AO0A 1LBLA 1QOPA 1K8XA 4ZQPA 4AVNA 5IRPA 3M0LA 3H12A 1MI3A 3AWNA 3K1GA 1SR9A 4ZBCA 1PVNA 4HHMA 1Y5XA 3QR1A 3W7HA 1MUCA 5DT7A 1ZRQA 3R5EA 2WMJA 2ODOA 3S83A 4DBWA 2VHLA 1UR1A 3I10A 3OZOA 2CFFA 1JDAA 1UWQA 3N2XA 2VUYA 2VZOA 2XN1A 1AQ0A 1VLIA 3TXVA 3ZLGA 2DH2A 4A35A 4DAFA 1PL9A 5CPOA 5GJMA 3W28A 3P5YA 4K7YA 2GL5A 1UJQA 4ATWA 1U2YA 2IKIA 3RGTA 4UFLA 1HKVA 4E5TA 3AHTA 3ZLFA 3PBMA 3OVGA 4GJIA 5FS8A 4LVAA 3HPFA 4JCLA 4N4PA 3SCTA 1XIHA 4PCFA 1WBHA 2VURA 1J6PA 3M6DA 1N5WC 1Q6QA 4ZCWA 1YBQB 4L80A 3F5JA 1VEPA 1ZAJA 3EANA 4GI4A 3UESA 2E6DA 3NZQA 4ZVJA 4LIIA 1XP3A 4AZCB 2A85A 1H1NA 5CAHA 3V16A 1GVFA 2F8QA 3BW4A 3R2GA 4DF0A 3ANVA 3WJWA 3EXSA 3FYPA 9XIAA 2Y88A 1KO0A 1H0GA 3GR7A 3GFXA 3NTYA 1M6IA 1XIBA 2Y61A 1JIBA 4W87A 1ADSA 4HU8A 3WNKA 3OG3A 1XIJA 2BY1A 1GG0A 3IIOA 4O18A 1UBPC 2PTXA 3W88A 4KCTA 4MIMA 3TSDA 1DTUA 1OK4A 4WX2A 3T8QA 3W76A 2V3AA 2ZIDA 3HFYA 1WDDA 5ABFB 4YLWA 3HJEA 2E1DA 1YXDA 3SQSA 1KCXA 4F2TA 6ENLA 4HMNA 2MNRA 4AX6A 4HIBA 3WD2A 5EMJA 5JCMA 2V3EA 1XLHA 3NL2A 3WF2A 1P43A 3BTNA 1MQPA 2NVKX 4QE4A 1V6XA 3WQOA 3GX9A 2PC8A 4H8VA 3OGSA 4L6OA 4IZGA 4O4WA 1UR3M 1M9HA 1GETA 1K9FA 3RNMA 3N6QA 3WL0A 1W9BM 4B91A 5D8ZA 2BS9A 2WO5A 1D8WA 3ZVHB 1V6UA 3KP1A 4U3AA 3W72A 3LPGA 4XQ6A 3B04A 3DFYA 4O54A 2Y8UA 3T2QA 4UFIA 1JDFA 3A4WA 2ZA3A 1B90A 4K2SA 4I9JA 3GBDA 1F3WA 1BXCA 1VB9A 1LZOA 4H6KA 1YEYA 3E96A 1HGYA 1D7YA 2HV5A 2HVMA 3T7VA 4YHEA 1K7XA 4NRSA 4UNKA 1RP9A 1NF0A 3MSDA 3LRMA 4ZB5A 3IRSA 1H61A 4AZ5A 2WC4A 1RBAA 1XHCA 4DWSC 3GC5A 4Y8EA 3WLHA 1OT1A 3CL6A 4XISA 3NRZB 4Q8NA 1TREA 4ATDA 4LYPA 2WM0A 2Y0FA 2XDFA 4NXKA 2NVAA 4LYRA 1WQ5A 1NARA 5H8PA 4GVGA 3M9YA 1Z89A 4EM4A 4ZE5A 4ZZ9A 2GVJA 3FVDA 3K8LA 1QNVA 3CB3A 3S2NA 5A6TC 3G3MA 1JEHA 4IP7A 1K4GA 3TQVA 1K8CA 3PANA 3P8IA 1HTIA 1XI3A 2BGQA 2XN2A 3IGXA 3WF4A 3CL7A 1LRNA 4CQCA 2PC4A 4JDRA 2NWSA 4A3HA 4PFMA 4RR4A 2HE8A 1EXPA 3Q45A 5I0DA 2Z2BA 3DOPA 4FP1A 2G4FA 2H9AB 3AC0A 5JH1A 1KLYA 2XM2A 1Q6FA 2PLKA 4JAWA 2Z24A 4H4QA 5KEZA 4FOKA 4GYJA 1EZWA 4GKTA 5F1VA 1ZHAA 1GTEA 4DM2A 4CLMA 4B5TA 2QEZA 3PM6A 3TA9A 1YBQA 1OJXA 3E9AA 5GRTA 1SMAA 3QSTA 5HAOA 4C5ZA 1M6JA 3AXHA 3RJYA 3H26A 2QCLA 4MVAA 3TYEA 1FCQA 3AISA 2G8ZA 4UR9A 4PRTA 1HXJA 2E6AA 2IXUA 2ON3A 1KLZA 2OR2A 1MW2A 5FJRA 3T8LA 1ZJHA 4HVXA 4BFAA 4UFHA 4BCEA 1AOGA 1EPXA 3MKCA 4GO8A 1XYMA 4UFKA 1IZJA 3T2OA 3VMPA 4JTIA 4OT7A 4AH7A 2GR2A 3GR8A 4LF2A 4XAYA 1JZ8A 1MO9A 2X7VA 4LCQA 1B9ZA 5ABFA 2X99A 1TKKA 3NJ3A 2GGHA 3P14A 4O17A 5LA1A 2YAUA 1WNOA 1TZZA 2WPFA 3S9ZA 3S1WA 1RQHA 1BYAA 4JQ4A 4TTGA 2J8GA 4IISA 3BAJA 3SUSA 1J18A 3W01A 1A5BA 5HR7A 2Y7GA 4AF0B 5XINA 1W0MA 3CGDA 2QIIA 3C6CA 4LOCA 2OXNA 1E5JA 2D22A 2P10A 2VUNA 1JPMA 4IIDA 3NURA 2YZRA 4MF4A 4ZB2A 1H2IA 4UOQA 1M7PA 5HXMA 5FIPA 2Y62A 3TMLA 4IIBA 2PLCA 3W26A 5JH2A 4KEZA 4RW5A 3ZVHA 1GKPA 1GRHA 1GVYA 4MFEA 3NL5A 1REQB 2WZTA 3W1UA 1E9ZB 4MHBA 2JQXA 1AW1A 3K13A 3PZGA 2PWDA 5C9XA 3TC6A 4PL1A 2VXNA 3GXPA 3RNDA 3AIWA 2OEJA 4LVFA 2DSUA 3H2NA 4GK8A 3FA3A 1ZGDA 3RILA 1W6TA 4LCSA 3D3AA 3KRUA 5JCIA 2G50A 3RU8X 3C2EA 4QG9A 4NZ3A 2H8XA 1BTCA 2PP0A 2POTA 4KPLA 3APTA 3VIIA 2PFHA 3WLMA 5D9NA 4ZA0A 3B9DA 1E1CB 3KLKA 4L65A 3SY1A 2XGBA 1N62C 5DFAA 2BY3A 1V0LA 2ACUA 2WJFA 4URIA 2W3ZA 2BC0A 3UCCA 4NASA 1HL8A 3OVQA 4I9AA 1E4IA 4EACA 1NF7A 3CTTA 3M0JA 3SJ3A 1XH1A 1KW1A 5FF3A 3CZLA 1NOWA 4WLCA 4IQJA 1VD6A 4CQ9A 3HPSA 4E4PA 4A29A 1UD5A 4E0CA 5DANA 5I09A 4LBUA 2CDUA 3AIQA 2DT3A 2HMCA 3N2OA 1G4EA 3VOJA 3UG4A 3IANA 2HS6A 3V36A 1F6KA 1VFOA 4LH8A 3ETRB 2C3CA 4P7LA 5D9OA 4AQLA 3DC0A 2HDJA 3SY5A 1RJQA 3UNTA 2WMFA 1SPQA 3A5VA 4QGCA 5I06A 4M56A 4JTAA 3U4FA 3QPEA 3N29A 3VD7A 6ALDA 5DCBA 5I79A 1FFRA 2WZEA 1MEIA 2QDDA 5BRPA 5LHEA 3TJXA 1IWPA 4M3PA 3UZYA 4OVXA 1E6PA 1OQFA 3C8NA 4HA4A 4Q8PA 3OPSA 3VIOA 2Z0IA 4IMCA 4BA0A 1F61A 3S5SA 3OC4A 1KN0A 3FJ6A 4J3ZA 1F05A 3OTRA 3FS2A 5KTLA 3OQEA 3WNLA 2J74A 4NI8A 4LY4A 2UWFA 2QJIA 3F2DA 1JDDA 4NILA 2XH4A 2G3JA 1P6BA 4OV4A 3CU2A 1S46A 1GRFA 3CXOA 4IQLA 3N15A 4KCUA 3U7VA 4BEUA 4MADA 2DP3A 4IXHA 5EMLA 1TV4A 1VBRA 2V3FA 1W5QA 1VHNA 4H04A 1Q65A 3WJSA 3W7PA 3FLUA 5ABGA 3CO8A 3C8FA 3RUBL 5EL1A 1Q45A 3NO3A 1V3KA 4DX3A 1GNXA 2CLFA 4WQ6A 3R07C 3C2OA 3IIZA 4AF0A 1XF0A 2HBXA 4GD0A 4YJ5A 1Q6OA 2OQYA 3AIVA 4YS1A 2PWGA 2ZUVA 2C8NA 3DC8A 3DFHA 1EDGA 2VOMA 3TWBA 4X61A 4JTGA 5FKYA 4ORMA 3MC5A 3CHVA 1OSEA 3MI3A 3QOMA 5D02A 1A53A 5A8QA 3P0XA 2PD9A 1WX0A 3LMYA 1WPCA 1LL7A 1M65A 1SYTA 2R1NA 1REQA 2GWNA 2A6LA 1QR7A 2V9DA 3O7UA 4GRSA 4G7EB 2O4MA 3KVKA 4PB5A 4QTGA 1H41A 5A95A 3C56A 4HCLA 3DJGX 1JRBA 1XLFA 4F0KA 4QCFA 2BSLA 1VFMA 3GXDA 4GCXA 4Y96A 4NNBA 3DBNA 4PMYA 1VCVA 3ALFA 2UY5A 3UA3A 4ECLA 3ITYA 3KZPA 5FA5A 3UZWA 1JGMA 1E1CA 3RR4A 2YOCA 2C0HA 2JF7A 4TXEA 3OLGA 4JIRA 1TUFA 2GSJA 4B15A 3GNDA 1V51A 3L23A 1I2OA 3T09A 5I03A 2J7FA 1XLBA 3ZS4A 4P7QA 3TQPA 2E9BA 1V6TA 4F0HA 1NEYA 4RPQA 5DMLA 5HQLA 1NHPA 3H23A 5CPNA 4HHPA 1SO6A 2CEQA 3GU9A 4PGLA 2Y4SA 4ZXLA 4KFNA 4KS0A 4JTLA 2E4TA 4MB1A 1GYNA 1XH0A 1PJ9A 1Y7VA 1OVDA 5FI8A 2XHYA 5LIKX 4D71A 3I3EA 1DHKA 4PYSA 1D3HA 1D3GA 1QU4A 2V6OA 3P93A 1QPKA 5CC5A 4PC8A 1SW3A 3HG3A 4A3YA 3N6JA 3RM8A 3L5AA 2ZICA 4DJED 1CNVA 3W7DA 3STCA 4CD8A 3EWCA 1V08A 4DI9A 1CIUA 4JEJA 1Q1WA 4JS3A 1YPIA 3TYAA 4LALA 1E6QM 4OBTA 3UNDA 4P5UA 5HBFA 4Y9NA 1E6NA 4HPNA 1Q6GA 3WIJA 3DESA 2XWEA 2PU0A 4GIYA 3OO2A 3TOYA 4AIOA 3P6LA 2ZZ4A 2OQHA 3WSUA 2WNQA 3KUMA 2WBKA 2IKJA 2QHAA 1UCWA 3SRHA 4X0VA 1LLOA 5KMYA 2J9ZA 4PTXA 3VKKA 3UXAA 1OJTA 3GWQA 4WSHA 2ACRA 4CUCA 1E5NA 1TO3A 4XSLA 1TFVA 4GUJA 1SZFA 2GGJA 5BCAA 1FY6A 2EPNA 3MHFA 3S2JA 3FHQA 1KTBA 5MKGB 2VEGA 3ZYZA 3QV7A 3E38A 2D2OA 3CZJA 1L8NA 1AFSA 1XBYA 2Q71A 4TU1A 4D2JA 3W1LA 4KRTA 2R1LA 4Y9OA 2XIOA 1FIQB 3GK0A 4EXAA 3GXFA 3GNXA 1HQTA 1QO2A 3S5NA 2BASA 3TYDA 2AAQA 5FAGA 4JKLA 1RPKA 3C2YA 2XISA 2CLLA 3F2BA 1MW1A 1I4NA 3T4WA 3LXBA 1JYWA 2J7HA 4LW7A 3UD6A 3NQ2A 3VDHA 4ICCX 4GQRA 3RPTA 5AVNA 1JPDX 1VS1A 4QG8A 4K3ZA 3LX9A 4HOXA 3W7QA 2PTZA 3WK3A 3MP3A 1LYXA 1ZENA 5CH9A 4DUWA 4H9ZA 4AWTA 4QG6A 3BXWA 2PWHA 4RZBA 3WH9A 3M47A 3ZZ1A 3BJTA 1G4TA 1FWIC 3W71A 1H2JA 1H11A 1OINA 4XBJA 2UY2A 2VDIA 2DSVA 2PDGA 3BV4A 1C9WA 3T0CA 3LV5A 1KRCC 5HWJA 1WO2A 2RHGA 1EEXA 1A49A 4G7EA 2VCCA 4FS9A 4UR8A 3AZRA 1R3SA 2AMGA 4JDBA 1LLWA 5C70A 1J9YA 3A6OA 5FJIA 1XPGA 4EE9A 4J40A 4UZSA 2Z6JA 4YVPA 1RR2A 2CETA 1PKNA 4FAMA 3W23A 2DZPA 1U1UA 5C2CA 3UCDA 2Z1XA 3VM7A 5C6MA 4L6HA 1LUCB 3FEQA 2ZBTA 2BXVA 3NWRA 3P5ZA 3HQPA 3EOLA 3QFBA 4H4WA 4IGNA 3CMFA 5DXXA 3FVMA 3VCRA 4BS0A 1PHWA 2QPXA 3LTPA 4E4FA 3O2LA 2X1IA 2ZA2A 4ROQA 4GJ1A 2A5HA 3AXIA 1HL2A 3VOCA 3ZR4A 1TYPA 2BC1A 2B7QA 1ZP4A 2YVGA 2PU1A 3Q37A 2WQDA 2VDGA 2BG5A 5D37A 1VC4A 4J3WA 4MYXA 1TPUA 4KCVA 3UJSA 2PDUA 3WLKX 1BVNP 2AQOA 4PUMA 1ITXA 2A2IA 2ZUTA 2BY2A 3VTRA 4PMVA 5IDZA 3UP8A 1VRDA 1W1IE 2FKPA 4QR6A 5LHFA 3LM3A 3C61A 4WDTA 3KXQA 3G1FA 1YDYA 2R6OA 3S1GA 5HWMA 2OZ0A 4J3TA 1BWVA 4YCOA 1FDJA 4MJZA 3BGGA 4FNRA 5KZEA 4QJ4B 1NP0A 2OYKA 4PB4A 4FB7A 2XSXA 4CVWA 1JPHA 4KT2A 4L1GA 1OC7A 3EX3A 5EA9A 1MDLA 4L6DA 3N3MA 4O8AA 3AZTA 4XX6A 3MYPA 4H50A 5IFPA 1N63C 1W5PA 4TIMA 2CWNA 2GVGA 4UNIA 2PEVA 3PPFA 3T4CA 3PG9A 3ITTA 3AWOA 4UQBA 3P60A 3POCA 3AS2A 3PBUA 1WZLA 2XUCA 3VUPA 1UC4A 1TVNA 2VEKA 3ARVA 1NIUA 4U3CA 1F4HA 4H19A 1UH3A 1IT0A 1W1ZA 3MP5A 3DFTA 5MKGA 2FFCA 3ES7A 2WOVA 4QXIA 1KFLA 1HKJA 3EGJA 3HGOA 1IWAA 1XLDA 1YNPA 1M41A 3AMLA 3FY1A 2GJRA 1U1HA 2OZTA 5KZDA 3RLUA 5DEZA 4KEMA 3KWXA 1ZNNA 3OYXA 3RO8A 3LPPA 2D73A 3FXGA 3CGEA 3L2IA 4MNMA 4N6FA 5JBEA 3E2VA 5FJOA 3C2FA 4XZIA 4B5SA 3LM7A 3MI2A 2ISFA 3NQGA 2YL9A 4C6OA 3DBPA 5D32A 4IMAA 2WPEA 2PDMA 3J7HA 3KRBA 3QLLA 1TPVA 1CENA 2ZTKA 4A3RA 3G1SA 5BMXA 1XLLA 4M6UA 2V3GA 4UOZA 3TNOA 1ZP3A 1Z69A 2QCMA 3B03A 5C9WA 5I78A 3I3DA 1NM9A 1KM2A 3KOYA 1YADA 2J9XA 2YCLB 4TMBA 1AH4A 3W0KA 1I60A 4QSFA 2V5JA 3OJGA 3RU6A 3TDFA 2YVJA 2XU2A 2NQLA 5CBBA 2YR1A 3SUUA 3PJUA 3W37A 4IM4A 3DYMA 1WZKA 3PUOA 1O7AA 2WOQA 3POHA 5AC7A 4IL2A 5CQ1A 4ES4A 5I3JA 1J0ZA 1SSDA 1TCMA 2NZLA 8XIAA 4JPGA 4TOQA 3C86A 3AXKA 2WVSA 1CXHA 1Z8AA 3BAXA 3NO1A 1JVNA 1UOZA 3MDWA 4GH1A 4M5PA 4F0SA 4A21A 3RMJA 3IWPA 1VJIA 3U2CA 3LERA 1R3RA 4UTUA 3LD5A 4QNWA 1UWIA 4ZL1A 1LUCA 1TPB1 2V2CA 3M0XA 4RE4A 4EKJA 3SRDA 4U10A 4DLFA 1MEHA 3K5XA 1AD4A 3W07A 1MRAA 3LLDA 4MOZA 3WH6A 1H49A 1B3XA 4IMFA 1IE7C 1KD0A 3LS9A 3CPUA 3KW3A 1X96A 1JD7A 4Z08A 2H3DA 5I3GA 2EO7A 1S1RA 1TVLA 2B7NA 1OD8A 3V0SA 2POZA 2QS8A 4JEQA 2E3TA 5FCZA 1JZ3A 1UD8A 1KNWA 1EHAA 4XD5A 1PKLA 3SW6A 2JF6A 3QY7A 2P50A 3WMBA 1LPFA 4AHQA 4LCRA 4K8DA 3S6TA 2D69A 2G97A 1DWIM 4HGXA 1RK6A 3D9XA 4LANA 2WOWA 1PXGA 4O0ZA 4JR5A 4ERAA 3GYEA 2I1OA 1O1HA 1W3LA 1OZQA 2ZRXA 3GHRA 3HMJG 4LPCA 1TX2A 1CW2A 3GVVA 2DU2A 3H2FA 1YRRA 2X8GA 3EBVA 3CM4A 4H4XA 2CZVA 3PZQA 1L6GA 1CX9A 2GQ3A 1YIXA 3FKRA 3GH4A 1E71M 4IJBA 3WQWA 4AZHA 3T2PA 4M82A 3QLDA 2C15A 5RUBA 1EUAA 1JFHA 3NNTA 4KMQA 2Y85A 3L4UA 3EOUA 2DJLA 2VRQA 2QV5A 4YPJA 2DVTA 4J35A 1CGUA 2YL5A 4ML4A 3T44A 3ID7A 4CN1A 4HN4A 1TV5A 1HJUA 1OF8A 1V03A 4OBRA 3WFLA 4S3KA 2P3EA 1PCKA 3I6TA 4EVZA 1PYMA 1GOKA 4NQ1A 4KF1A 2GWGA 1PIIA 3XISA 1H7NA 2EBNA 3VPLA 4UTLA 2V6AA 4JOMA 4IMGA 1EZ2A 3HZ3A 3LNMA 3CV2A 3PC0A 4AY8A 2RJHA 3CL8A 1WB0A 1ITCA 1XRFA 5TBOA 2HPMA 3MUIA 1MQQA 3K8KA 1H0IA 1TRDA 5TF0A 4OOUA 1W1PA 4UQDA 4IHCA 2OQLA 3RPMA 3INPA 4Z1BA 1FCBA 4N0RA 2QUUA 1OGBA 1MXGA 1V93A 3B9AA 4E4UA 2V5BA 5A6KA 1JAEA 1S3HA 1AVAA 4N02A 3E5PA 4K36A 3M44A 2YCLA 3I3BA 2UBPC 4JIQA 3W29A 5G2IA 3CH0A 3MZ2A 1ZTVA 2HRWA 3A5FA 4NI3A 4DF1A 1FECA 3BQ5A 3AFBA 1E3XA 4J9JA 2WP5A 4DLMA 3UY8A 2OEKA 3GD6A 5BZAA 1F3XA 3PWIA 4PMRA 1OFDA 1GOXA 3KRSA 5E0FA 5FL0A 1EBDA 3H55A 4UUIA 2D0FA 1DYSA 5I7GA 2FTYA 1C92A 4GXPA 2I56A 5AHNA 3FXYA 3BLIA 3FG2P 1R30A 3N73A 5KZ6A 3EB4A 2V67A 2G3IA 4F2UA 1VQTA 1PPIA 1DJWA 2WC3A 3BWWA 3W1RA 1F7BA 4JQ3A 3HQNA 3AICA 4EQSA 3NQEA 2A3AA 3W7JA 4KGJA 1S2CA 1TB3A 3U2ZA 2CLHA 3BV7A 4MB5A 5HMSA 3OBAA 6CGTA 4XSMA 3HURA 5FJJA 3S9IA 3C3UA 2D0GA 4D6JA 1XXXA 3KDNA 4JTJA 3QGVA 2BHZA 1R9ZA 4H9VA 4Y9PA 2HNEA 4EAMA 3C2RA 3F4VA 1QI5A 1XIIA 4E6MA 1UYQA 5A5WA 1EGVA 4J3VA 1ITQA 4D6IA 3MKVA 5B7ZA 2I7GA 3M16A 1OCQA 3NSXA 2PDIA 3GM8A 1ZBKA 4GVHA 1CGWA 3H21A 1ZBWA 4LX4A 2IKHA 1L2UA 3LHYA 3UWEA 1M7JA 3Q58A 1FOBA 3T9PA 4MWAD 3AUOA 1UKPA 2F38A 3HMCA 2JEPA 1X6NA 4AIBA 1F3PA 1QW7A 3UGVA 1GQKA 3BG9A 1GRBA 4GYPA 3LBCA 2CKRA 3EKGA 4Q3MA 5DF0A 5K9DA 2VD9A 3CJPA 3RX3A 2ASHA 2XFWA 2E5BA 1ZAHA 2P0IA 2WWDA 4WZHA 3TYBA 2CKSA 4JTCA 2QXWA 3WDRA 3PUDA 5FF4A 2YCJA 3IC9A 3PJXA 4DJEA 2WKJA 4PCSA 3R10A 3PAOA 5CGQA 1DPMA 3BLEA 2I17A 1ITUA 4TV5A 1EA9C 1R38A 2RDWA 5DQPA 1YYAA 1VAHA 3FFSA 1Z42A 1YQZA 3GC2A 3NZPA 4QJ5B 1VBJA 4C6EA 1J12A 3WBEA 1FTXA 2PDQA 1EBGA 4N9BA 3TN3A 4BJHA 2OO6A 4HPJA 2NW0A 1F8WA 1EWDA 3H4KA 1XRSA 1UBSA 3TMQA 3S47A 1RJRA 1KM1A 3LDVA 3TTQA 4IWWA 1JL8A 1OT2A 3F4NA 1PZ2A 2GGIA 2CLOA 3H53A 1QI3A 1SJDA 4JFTA 2R1PA 4C91A 2QZRA 3LRKA 4B3KA 2DSWA 5HMEA 3R6IA 2NVDA 3IJ7A 1EEPA 3AQUA 4G8TA 1W1A1 2GR0A 2H3BA 5LXXA 3GC4A 3TCEA 2PP1A 1F8MA 1OFEA 2Z1KA 3LEPA 4WF7A 4PTDA 3TVAA 1H6VA 4MY1A 4AW7A 3URNA 2O9OA 1GQLA 2I16A 1B3ZA 4B4HA 2FVLA 1R3YA 2OYMA 3GSMA 2ICSA 1FX6A 3QEZA 1H4PA 2J62A 3CEUA 3E49A 4H6QA 3VX1A 1RSCA 3QQWA 5D9PA 2PUZA 2WBGA 1DBTA 3B0VC 4IJCA 4JTUA 2IMRA 2Z1WA 2CLKA 4HNCA 4PMOA 2INEA 1O5XA 1RCQA 4ZODA 3DKLA 1ICQA 3CC1A 2RDUA 3PS7A 3P80A 4H7VA 5FD0A 3CPRA 4NX0A 4UR7A 4CCDA 2C1GA 1UWTA 3GDRA 3ITVA 5A2CA 5A69A 1FHVA 2GR3A 3MI6A 6XIMA 3Q65A 1WXJA 3SEPA 5F1UA 4A4AA 2VCBA 3F4WA 4HTYA 4XBSA 1K7EA 3QQ0A 3KEHA 1HO4A 5FJPA 3W81A 2YBUA 3ARQA 1W3IA 1ZJIA 1G0CA 2XPKA 3BO9A 1ENUA 3G3DA 2FQIA 1ESWA 2FZ9A 2YX0A 3SZ8A 3RO6A 1JYNA 4NU7A 3KE0A 1HJXA 3QN3A 4JX4A 4YTSA 4FK9A 5EBAA 1RLCL 2ZZCA 2HROA 1OFRA 1X7IA 3OLEA 4BY3A 4MDPA 4QBXA 3UG3A 2E0PA 4IFOA 3W87A 3FKKA 1X1NA 4O1AA 5H8UA 3PZMA 4IPNB 2GJXB 4JQ9A 1ZCOA 2B4GA 3L4XA 3IV3A 4UC5A 3P61A 1IXQA 3GE7A 3PZOA 2ZVIA 3DFOA 3HIJA 1JZ4A 1K8ZA 4F0LA 3EEGA 3WH8A 4RKAA 1KCLA 4RDWA 2D24A 4WOZA 1J11A 3IGUA 1HKIA 1QDSA 5G2HA 3TSBA 5AC4A 3CV7A 4QM1A 4HNUA 2O56A 4XVDA 3SR7A 3U5UA 3FAWA 1HKWA 1ZCCA 3V35A 2CIPA 4K1GA 1UPMB 4JBRA 5FEWA 1GOMA 3FCPA 3LSBA 3QPYA 4Q22A 4YYFA 2HBVA 5BU9A 4AIEA 4AIUA 2V3DA 1HT6A 4WUIA 2ANUA 1QT1A 3SBFA 2QDGA 1J0HA 2ZRZA 1UPPA 4IPJA 1SGJA 4JIIX 3ORWA 3R1ZA 4GUFA 5JIPA 1MUMA 2CLIA 3T0DA 4FF7A 1ZUAX 4XAPA 4AMCA 5I00A 1G67A 3KTCA 1OFOA 1YNQA 5DRCA 1UIOA 5E9XA 2D2GA 2HISA 1BSIA 3VNYA 3DGRA 2Z00A 4KWVA 1HP5A 1W91A 3G6LA 1LWIA 1GOIA 3FJ4A 4HKPA 4RJEA 2PDJA 2CCRA 4D1IA 3QFAA 3A23A 4DBSA 1D2KA 1PAMA 3N1AA 1BGGA 3I7RA 4AXNA 4L9YA 1J2WA 1PTGA 3B0PA 2OPJA 2DQXA 5CC3A 1XUZA 3EWZA 1Q1RA 4MDOA 4IIGA 1K6AA 1NWTA 2PD5A 2BDQA 3IVSA 1KBKA 4MYAA 2OSWA 2PURA 1LT7A 1H7XA 1DJXA 5CG0A 3WD4A 4BR1A 2ZZ2A 5U7SA 1OYCA 1LOSA 4FMVA 1QO5A 1VYPX 3HN3A 1XYFA 3OBKA 4OV9A 4LRTA 1KGXA 3OODA 1JQVA 1G6CA 2BVTA 3WDJA 4BWLA 4R34A 3RFAA 1F3EA 3LRLA 4GKLA 4DHGA 1H63A 3MA8A 4UCFA 4PRWA 5I02A 4EANA 1THFD 3NQCA 4LA1A 2W55A 3TU9A 5JQ9A 4UXDA 5D38A 1QI0A 5C5YA 4FALA 2FB3A 2XIIA 3QY8A 2NPXA 2DFAA 3LOTA 5T9BG 1CBGA 4FSAA 4K1WA 1C93A 2X05A 4XUYA 4RNJA 3KP0A 4NJHA 5PTDA 1O68A 1LCOA 3VYLA 3DERA 3ABOA 4JN7A 4J7RA 4X60A 4I6KA 1KCZA 2TPSA 4D8ZA 4B4FA 5CGTA 4Z2GA 1UKOA 4WVXA 1QWGA 2X40A 1BVWA 3G77A 4YMZA 4D6HA 4TX8A 1UD6A 2B81A 1E56A 1BWLA 4NJIA 1GJPA 4K37A 4L7ZA 5BWFA 4JFWA 2PCEA 5EBKA 7TIMA 4E2OA 4ACYA 3R25A 8TIMA 1GRTA 2R14A 1A80A 2R94A 5TR3A 3MMUA 1XS2A 5J5RA 4DJEC 5L9FA 5CZKA 1V6YA 5G4EA 4IX2A 3THQA 4XZ9A 1R3WA 4DM1A 1JZ2A 3CUHA 1QOXA 3A24A 1DE6A 2ISWA 2BVDA 3UZXA 1TV7A 4ZOEA 2GJXA 1TV3A 1V3IA 1LBFA 1K6WA 4WKAA 4H8HA 1S5WA 4WD0A 4XV0A 4FHAA 3W7LA 4EPKA 3TFXA 4RXGA 4RDZA 3TOPA 1FH8A 3PPCA 1Q6EA 4W7UA 5M17A 3AI0A 3WDQA 2YB1A 1EOKA 3O15A 3QFWA 3ZT7A 3NPWA 4GRTA 8CGTA 3PSWA 3SURA 1D3CA 3M64A 2BY0A 3O6DA 1PTAA 2NUYA 1OEPA 2V5DA 4XTDA 2E7FA 5GJNA 4AY7A 1LG2A 4ZE4A 3LGDA 5AKQA 4ZTYA 4NL1A 2IQTA 1TTQA 1DJYA 1JNDA 5BXPA 5IHRA 1WAWA 3E2QA 1SZGA 5H6HA 2Q6ZA 1IXNA 3W4RA 5FF7A 1SQ7A 4V1YA 3P62A 3ITXA 1H7OA 1P0EA 3DYOA 5DXYA 1IEXA 4NRRA 1K7FA 4YIWA 3NFUA 2W3SA 3L4TA 4GMEA 4WGHA 4JCMA 3N4EA 1WE5A 2YDQA 4G1KA 5CZJA 4DI8A 2F2KA 3BAWA 3GW0A 1J0KA 5ER0A 1C8YA 4LGXA 3DGHA 2HS8A 1S1PA 4Z42C 4L1XA 1XCFA 3W74A 3LHZA 3STEA 3NYZA 2Y5SA 4A8LA 3CMJA 5DMMA 1QXLA 1FWJC 3T05A 4G56A 3LK6A 4X2RA 4HSHA 1GXFA 1BYBA 3W7OA 3JS3A 2XH2A 3ARXA 2VZSA 4I3GA 3G1RA 4NF7A 3W1TA 4QHRA 3GKAA 5XIAA 4ZQMA 8A3HA 3FJLA 2VZUA 2FGLA 3IEBA 4UFJA 4IMEA 2OU4A 3LXAA 1EDQA 3P84A 3S8HA 1X6LA 3GG8A 3TTSA 3ZSSA 3BLKA 4S3CA 5A2AA 1KV5A 4ML9A 1RH9A 3BICA 3HV9A 1G7UA 2BV9A 2F2HA 1FHLA 2BOEX 2EKCA 1R2TA 4HA1A 4M1BA 1CT5A 1UMLA 2J77A 2AGKA 1UR9A 1ZMDA 4H1ZA 4M29A 4DF2A 3CWOX 3BAIA 2X16A 2ZRYA 2TSYA 2WVVB 2VR4A 3MSRA 4HZ8A 2FMOA 3BJSA 4B3ZA 2Y6ZA 2XGZA 3GG0A 3W3OA 7XIMA 4PMZA 4Q7BA 1GW1A 1W9PA 4BEQA 3AZSA 1TWSA 3PUEA 2WKGA 2VC5A 4D6FA 4OBSA 3SGUA 3T1GA 2PDNA 1DJGA 4Q7NA 1FWEC 3KOXA 3LQLA 4LVDA 4MFDA 3V5OA 4GUHA 1IV8A 1OWQA 2XVLA 1XC6A 5LNWA 3ANUA 5HNTA 5LNUA 2XJ7A 4YL2A 3KTSA 1O4UA 5BMWA 3V5FA 3S4TA 3THUA 3NZ1A 1MDRA 3VVGA 3UYCA 3WY1A 2OODA 3WQCA 4OUIA 1TQJA 4Q8OA 4AEOA 4KGLA 3MCMA 3KL3A 3QGAC 1VP5A 1KTNA 3A4XA 3ABZA 2PPGA 2QF7A 3FN9A 3NG3A 2I9UA 2BOGX 3B9JB 3IGHX 2A4AA 1EP3A 5I5RA 2OYLA 1N8IA 1VGAA 3GG7A 4CNSA 3B4YA 1W9VA 1TUXA 4O1CA 1W1B1 1KGWA 3UPWA 3S42A 2NVCA 3FEMA 1W8SA 5G5IA 2YB4A 4OECA 5HWNA 2ZA1A 3GAYA 4KWOA 6XIAA 2NV2A 4FO4A 2VKZG 3VOFA 1I9CB 4WXZA 3M5YA 4F40A 2F84A 1NDYA 5LIWX 2BODX 1EQCA 3SCQA 1Z7AA 2IQ0A 3UWZA 3DEQA 5KINA 4Q6XA 3UR8A 3QFEA 4JYDA 1W54A 2DQWA 1TYGA 2PBOA 3VU2A 1DKWA 2CC0A 4PFHA 4S23A 2VFEA 3LZ3A 4BF9A 1XGDA 3ZSTA 4MWAA 4XZMX 1XIMA 1I75A 5EMKA 2P5NA 3OHMB 4PMQA 2IS7A 1SVDA 4TQTA 2EPOA 1TR1A 4BWLC 2HVNA 3WDIA 2QJMA 5LIXX 3ATYA 3I65A 2PMQA 1OM0A 1HJVA 1P0DA 2ZUWA 1ONWA 1FFVC 5KETA 3QZAA 3BCDA 4U28A 2J8FA 2YYTA 2J78A 4C6BA 2XVPA 1ZSXA 1D8CA 1FRBA 2HQAA 1H3GA 1TJ1A 4JGDA 4UQCA 2DZAA 1N8FA 3SCRA 7ENLA 4UTHA 3GH5A 3V1HA 5FAJA 4CU8A 4JNZA 2PGEA 4NUWA 2BVYA 3A12A 1AA1B 2QUMA 1KBIA 2VENA 2YIHA 4QLKA 2IQDA 3WK2A 3LTYA 1VBGA 1FWDC 1QTWA 4ZEPA 1SFTA 1GHSA 4DO4A 5LXEA 3CZ8A 1S2UA 3MMDA 1OK6A 2BGNE 3QZ6A 3M0VA 5DLCA 1TJ0A 3MVTA 2BGSA 2WVVA 4IP5A 5HNRA 4QQUA 1TWZA 3W7IA 3UQNA 4LJ3A 3R0DA 1XFCA 1V0NA 4IOTA 5HR6A 5J8LA 3OLDA 1H1ZA 4UCGA 1TSIA 2CXEA 2VGIA 4NJKA 2DW6A 3BOXA 2PA6A 1TPDA 4DYJA 2Z1BA 3SUTA 3QVQA 1V3JA 4F3HA 5LGXA 1QASA 3IJQA 1UZDA 4LV4A 3E74A 3TUUA 1UZ4A 2GGGA 4AEEA 3O6YX 1CCWB 1GQIA 3D47A 2PDBA 4RZ5A 4I6VA 1Q6DA 1WP6A 4CEXC 1AMKA 3KHDA 3UXDA 3WZ0E 4O53A 4H3DA 3K46A 5XIMA 4O16A 4QRNA 4D6EA 2W0HA 1CI1A 1WKDA 2C6QA 1XW8A 1MFUA 1KM0A 5BROA 1EJRC 2CBJA 2VZTA 3HW2A 4M24A 4RPPA 1OIFA 4KEVA 3ZFHA 4Y9MA 3G18A 4GQQA 3IJDA 1ME8A 1F07A 1T7LA 4QEHA 2FDSA 2J7DA 1XQLA 4BQ5A 2QCDB 2ATMA 3MTWA 4DRSA 1QHOA 1GERA 2P1FA 2PDFA 3QHMA 4R53A 2WHMA 1E1FA 4JYFA 5D03A 2F5ZA 1O95A 4ZB0A 3LCFA 3ARYA 4FNQA 2ZWYA 2WC7A 2W92A 1NU5A 2QV4A 3CZEA 1VKFA 4LSBA 4IX0A 4US5D 2DT2A 3QR0A 1K9EA 3NVDA 4NZ4A 1DQWA 1Z32X 3FDGA 3KS6A 1WXZA 3FYYA 1JNEA 4Z1CA 5AHIA 3EWUA 1Z6KA 5B80A 4MNJA 1F76A 3UR5A 1GPFA 2OT0A 4NNAA 3SN0A 4AZIA 1JCTA 4HU3A 2VDHA 1AK5A 1KFBA 5C8BB 1C8VA 1OZMA 4CCCA 1R47A 3GNNA 3M41A 3SRKA 2A3HA 4DNMA 3CV1A 1LQ2A 3NCOA 3IPWA 3GDTA 2FZ8A 3N2TA 4WGXA 2VVNA 3CZKA 5HPCA 3DG3A 3F4DA 5KITA 3E5BA 4XZNX 4TX9A 3BAYA 3GH7A 1KXTA 3DU0A 4W84A 4QAIA 1W1YA 2B7OA 4PR4A 5EFFA 3CUZA 3PZVA 2KX9A 2Y89A 4D8AA 1G94A 3GNRA 1J10A 3PB2A 3WD1A 3U0HA 1WKYA 2TMDA 4DPQA 5F7UA 3TJLA 2INFA 3TROA 4V1XA 5CZTA 3WFAA 5M1TA 5I24A 4PUEA 2O7SA 2GR1A 4GR1A 3CQKA 1W37A 1YDVA 3L2MA 2W27A 3UJ2A 4Z2KA 3MV01 3N17A 1PZ1A 2IPJA 2V5LA 2J66A 1Q2RA 2F61A 2YA2A 5CXPA 3QC0A 1EX5A 3N4AA 1A47A 1GESA 3PZ9A 3VGGA 4PUUA 4AB4A 5BOFA 3A7UA 1BAGA 3B0YA 3EPNA 1OFQA 3QQ1A 1ZKQA 3CQ0A 1W3JA 4J57A 4TO8A 1GK8A 1V6VA 1IEQA 2DSKA 3LLXA 4RNIA 5EFDA 3RLGA 2XYLA 3LNPA 2Y2WA 3C0QA 3W75A 3MUXA 2FZNA 4QJ3B 1OC6A 3N4FA 4H8UA 1CEOA 3ZR6A 1IXPA 4P7RA 1PE1A 3M4HA 1G9HA 4M51A 1GCYA 3UPMA 3GDKA 1B3VA 1Y5WA 2D3NA 5T9CE 1VCFA 5CPQA 1B1YA 4S2BA 4BURA 1R85A 2RKXA 2A1YA 4DN1A 2FVKA 4EM3A 1UA3A 1RA0A 3A4JA 3ENLA 3PR2A 2R9RA 3AHXA 3TW6A 2V2DA 2OGJA 3RLHA 3NGFA 4DJDD 1A5NC 1B0IA 3GIQA 4MPKA 1UKTA 3QH2A 1ZS2A 2GOKA 2Z6IA 2RABA 4S3GA 2E68A 4O1FA 1IEVA 1NELA 1HP4A 3H4WA 4AWUA 2DUZA 5D4YA 3GB6A 3ZLHA 3N2CA 3R79A 2BB0A 3VO0A 1XYLA 1O60A 1XLGA 3MWCA 2RDXA 2XTKA 2QCDA 4UQ9A 1VDVA 1FWHC 3DK8A 3OB8A 5A6MA 3NDZA 4J2PA 4WR3A 1UWAA 3GDBA 4P8XA 1SJBA 4GO9A 6PTDA 2W54A 2WVUA 1VFFA 5E09A 2H8ZA 1BKSA 1QK0A 1R0MA 2RGMA 3NQDA 2DVXA 2WQPA 3NA8A 3MUY1 3UR7A 2DSZA 3LMZA 2PTDA 5CZSA 4ZSUA 2WZHA 3G1DA 3V7PA 3B8WA 2VP8A 1FKWA 1XIFA 2EQ6A 2QCCA 3HG2A 1EF3A 1A4MA 5AB3A 3A3HA 4F0RA 1CB2A 1H62A 1DIKA 3IJ9A 4JYEA 2ZWZA 1SZNA 4M52A 3S1XA 3AM9A 2WOIA 2D2HA 1DJIA 2Z28A 1SW0A 5HUPA 1TA3B 1EX1A 1HJQA 2CZDA 1IR1A 5C7HA 3MV11 4XKYB 3LA4A 4D8LA 3MT1A 3IIXA 3UCQA 4RV3A 2XGIA 1MSSA 1XYCA 3VINA 2C3ZA 1K4QA 1L6YA 3ABXA 5FF0A 4W8BA 1DJHA 3TSMA 3VOHA 4RXFA 2JGYA 2YL6A 4HYRA 5EYWA 4GZJA 3R94A 2PTYA 4JDYA 1J96A 5AOUA 1E0VA 2QJNA 3P74A 2R1KA 3MB9A 2E6YA 3CWNA 5EKYA 4LV9A 5TIMA 1EDTA 3TP4A 1TPC1 5I2UA 4FR6A 1GSNA 4PB3A 4M19A 1FKXA 1XPYA 3LN3A 3UZZA 1M1BA 5AHLA 4DQWA 4AYGA 3PTDA 2ZFAA 4Q4RA 3GZAA 4FLOA 3R4IA 4XO6A 4IFRA 4XO7A 1LLZA 3RG6A 3EPMA 3TTEA 3L9CA 1C3FA 2VO5A 2GQ9A 1VFUA 1ODUA 1JZ6A 3EMCA 4DPPA 2VWSA 1FWRA 1XJBA 1R2RA 3EA2A 1KB3A 3NSMA 1JG9A 4YWSA 4PMDA 4GG9A 3EWBX 5CKSA 4UMBA 1J0IA 3VI2A 4GPNA 4FZIA 2AQVA 2OKOA 2ZX6A 4CEUC 1FH9A 4WY0B 2FH6A 3KCLA 4JQ2A 4ZO7A 1VFSA 2E3ZA 3O05A 2VZVA 1JOAA 3TFCA 2DZWA 5EY5A 1UHVA 3ARWA 3U57A 3TA6A 1HKKA 2YJQA 1QHPA 3M0KA 4O1BA 3K2GA 1PEZA 4XAGA 1IEWA 1K4HA 3CTLA 4M80A 4DNAA 1P48A 2R91A 2ZYFA 1JQXA 1PUDA 3SGZA 3TLLA 5JU6A 1M68A 3OEXA 3R8RA 4QITA 5A8GA 4BQ4A 2V69A 2X8RA 3W38A 2I5IA 4U4MA 3I6EA 3ZJ8A 3WBAA 4DWSD 4I8YA 1BHGA 2OEMA 4FR1A 2ZXBA 4EQXA 2XFYA 3L0GA 2YZ5A 1XH2A 4AHOA 3GU2A 4Z17A 1VBHA 3GRIA 4GXWA 1TJ2A 3SQLA 3KDOA 1M53A 3NZGA 4NIRA 4L9XA 3UG5A 1XQKA 1FP9A 3NAVA 3LSCA 4ZQCA 1E4LA 1L9WA 2IPGA 2QVHA 2V5KA 1MUWA 2V63A 4R7OA 1IYXA 5HQEA 4H6EA 3ISIX 2WANA 2VYOA 1L8PA 1JXKA 2WVTA 3TJ4A 3B9NA 1VCGA 3M5VA 4UTJA 1U1JA 3PPGA 4AVOA 4AXKA 2YW4A 1O5QA 2HPIA 3G0XA 5LKYA 2KAUC 5K9XA 3MBFA 4I9MA 4Y90A 3NQAA 1R8LA 1R6WA 3C2VA 4NG3A 1SJCA 3VOIA 3P8JA 1K9DA 4U2ZA 4NYYA 3ZJ7A 3SGGA 4UOJA 4N7QA 1X6UA 1HKMA 4CN4A 1NJJA 1UD2A 1V79A 4GGBA 3KVLA 4H4VA 1RVGA 1BF2A 4CD5A 1J5SA 2X09A 3W7RA 3CEPA 4QAWA 2QF8A 2XVNA 4JX6A 4CU7A 4LC8A 1ADOA 5EMUA 1WCGA 3DHUA 2ZX5A 4RUBA 4TUFA 2PCQA 1GKQA 2JK2A 2UY4A 3W84A 3WQ6A 4RCXA 1CLVA 1EOMA 1TA3A 5CBIA 3ALGA 1DOSA 5T26A 4JNMA 1CXEA 4HNOA 4XKYA 4MNLA 1US0A 4S1FA 1US2A 2F9RA 3G5EA 1PIFA 1Q6RA 3N6HA 1NAL1 2EJ1A 3U7BA 3PBWA 4BKNA 5M03A 1TG7A 3TYZA 4ZO8A 4YNGA 3Q94A 1XBZA 1OYAA 4DBUA 2OLSA 3T42A 1KCKA 1R2SA 3KAOA 4PRRA 5HK4A 1GZJA 3EX4A 3MHGA 3WD0A 1N60C 1RVKA 4LVGA 1X2GA 4GY0A 3WF1A 2HTMA 2WCAA 4JY9A 4U33A 4KETA 2Q3RA 1EXBA 4GX9A 3TH6A 4Z2LA 1L2QA 4AY1A 3AHYA 2VQTA 3YPIA 1M7OA 4C6KA 1GGOA 4WDWA 5M5DA 1SR0A 3L5LA 4AZ6A 3JW7A 3GBEA 1VPQA 4CCEA 3ZJKA 3E1F1 4CCZA 4W7VA 1ONRA 4HP5A 3NVVB 1AMYA 3TK7A 1QPRA 3USZA 3C4UA 1B4KA 3RRXA 3DK9A 1UUMA 1YXCA 3B0XA 4ZMGA 4WY0A 4J4KA 1RY8A 5DBUA 1PIGA 1T40A 3TNBA 4INFA 2C18A 3CGBA 3BPWA 2ZC1A 2C79A 2Y5EA 4WK9A 1SZRA 3GYCA 1TMQA 3DFNA 3KBSA 4JTKA 3WEMA 2INZA 2A3BA 2QJJA 1Q6LA 2WHLA 1J8VA 1GVSA 3D3FA 4ZXOA 2FPVA 3KCJA 1PX8A 3KLLA 5TQLA 4EK7A 4JIEA 4ZGYA 1MO0A 4QDWA 5A8MA 1ODZA 3SUVA 4EOUA 3VIHA 5E93A 3DK4A 4XKMA 4FIQA 1HO1A 3E2SA 2W4XA 3HQOA 2GVLA 3IAPA 5IM51 4EQRA 3BGAA 2ZXDA 4GE8A 2CLEA 3KM8A 4IGHA 4PBFA 3KTXA 1UR8A 2ZRVA 4XB3A 3MDUA 4AWSA 3CUIA 1LROA 3PWAA 4XZWA 5J04A 4LAUA 4DZIA 3M7SA 4HOWA 2EQ9A 1E6SM 3SM0A 1W2PA 4PMJA 3SCNA 1KRBC 3TQKA 4Q6JA 2CFYA 4O19A 3IIVA 5D2TA 3VNJA 4LAMA 4KFOA 5E1QA 4AFYA 3R43A 4GIAA 4DZ5A 1B3WA 4NAFB 2QCHA 4O14A 3FIGA 3PZTA 3ITOA 4PCTA 4HU0A 3KBVA 1EC9A 3UBPC 4RNHA 3I68A 2EPKX 1FWFC 3B8DA 3EWWA 4ORIA 1TE6A 1CPUA 3WN6A 1E1EA 2EKGA 3LQGA 2BCPA 1E9LA 3A3WA 4QFUA 3W83A 3K4AA 1GVRA 3WJXA 4NY2A 2QIWA 1ISWA 2YLAA 5DX7A 4V33A 2VVSA 4US5A 4KPRA 4O1DA 4I8DA 1O12A 3CNYA 2CHNA 2ZZ1A 2FZDA 2J13A 4L4MA 5D33A 3S2CA 3WCZA 3F03K 3WNNA 1RLDA 1BZLA 1JCYA 3GFYA 4KH2A 1W1VA 3HTWA 3HJZA 2PB1A 3CAQA 2NSOA 1QBBA 2XINA 3BANA 1FQ0A 2AKMA 1HF6A 4EPDC 1IT8A 4KESA 1PSCA 1H09A 2G3FA 1D7KA 1XGZA 3L0KA 3QHNA 1B54A 2QYGA 1SFSA 2BWGA 1GHRA 1VJZA 2WW5A 3B3DA 3WDPP 4G5DA 2Q09A 2XH7A 1MNZA 3BLOA 1DORA 3AALA 1BRLB 5EPDA 4LB3A 3MMWA 3CPGA 2TYSA 4ZOHB 3TAOA 1U30A 4OFCA 4BHYA 1CGYA 4UQEA 5A6LA 1V4YA 1ZB5A 3F1QA 3QV8A 3HGRA 3VE9A 4RW3A 1OG6A 3O9NA 3TONA 3HA1A 2PGFA 3VK5A 4M6QA 3NVTA 2DY3A 3PWGA 5CSUA 2X1UA 2WSYA 3QMTA 2WLYA 3DG6A 2PRLA 3G22A 4HQVA 2PDHA 3TQ0A 5CGMA 1RBLA 2QUTA 1XDIA 4KWSA 1PWLA 2ZC8A 1GORA 3WX7A 1W1TA 4C60A 4H4UA 5BXTA 3CHCA 2X2GA 1KRAC 4LQ1A 1BQGA 1I1XA 2VEIA 3WK1A 3EA3A 1XSJA 2BHYA 5AHMA 1H5VA 3QBUA 6REQB 1FWTA 4S3EA 1R7AA 1PWMA 2OOGA 3SSZA 1JPIA 3T0BA 1XBXA 3OA5A 5JBFA 5U4NA 3LADA 1KKOA 3B9EA 1A5OC 2JEQA 1TJRA 3F4CA 1ZZMA 3JZUA 6TAAA 4IMDA 1JRCA 3AN1A 3IK2A 2ISVA 3NVZB 2VFIA 3WQ8A 3PFRA 4XBKA 3W7CA 4LUSB 4Q32A 3GTFA 4E38A 1EJXC 1XR2A 2ZDRA 1KXVA 4HK5A 3LPOA 4PUNA 1DP0A 1LRQA 1KFCA 3I7SA 2X8CA 2PTWA 1RCXB 1AH3A 2E40A 4DELA 3UVAA 4IIEA <