3QLHB

Hiv-1 reverse transcriptase in complex with manicol at the rnase h active site and tmc278 (rilpivirine) at the nnrti binding pocket
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
423
structure length
407
Chain Sequence
ETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Synthesis, activity, and structural analysis of novel alpha-hydroxytropolone inhibitors of human immunodeficiency virus reverse transcriptase-associated ribonuclease H.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase,hydrolase/inhibitor
molecule keywords reverse transcriptase/ribonuclease H
total genus 101
structure length 407
sequence length 423
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3qlhB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3qlhB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3qlhB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3qlhB03
2WONB 4XPCA 3SFGA 2W7PA 2ZE2A 1S1VA 3KK3B 1BQNB 2HNDB 4DL7A 3DLKA 5JXSA 1C1CB 2BQ3A 1BQMB 4Q0BA 3DOKB 2IJFA 3QZ7A 3M9NB 1T3NA 5F9LA 3OL6A 3RAXA 3BGRB 3GV8B 1RT5A 4ED1A 3SI8A 4XO0A 4WXOA 4QWBA 1S9GB 1LW2A 5C42A 4MK7A 4U7CA 4NLGA 1TKTA 1TV6B 1NHVA 1T03B 1WNEA 5HLFA 2IJNA 1RT3A 4PWDB 3I5CA 1NNDA 1IKYB 2RF2A 5C25B 3V6DA 4MKAA 4ECWA 3T5JA 3KK1B 3KMQA 1S0NA 1TVRB 3GILA 2AGOA 2FLNA 4IFVA 4NLYA 3FFIA 5J2PB 5KFMA 1RT4B 4ECTA 3ISND 1LWEB 3V4IB 4KBIA 1HMVB 1U09A 5K14B 5J2QA 2I1RA 4IQXA 1C1BA 5FDLA 3D5MA 3DYAA 3CJ2A 4R8UA 4NLWA 5DGAA 1JLEA 1JLFA 2ZD1B 3C6UA 3E01B 3IS9B 3FQLA 3MEGA 4ZP7A 3KLFB 5I42A 4TQRA 5KT5A 5J2NB 1LWCA 4Y2CA 3Q8QB 3G6VA 3FQKA 3V6KA 1TQLA 2AGPA 2E9RX 4NRUA 2FJXA 3G6XA 3DOLA 4J9OA 4DG1B 2ALZA 1JLAA 4ECZA 3KHRA 5J1EA 2W8LA 3CDWA 2YNIB 1C0UA 1RTIB 5HP1A 1RTDA 2GIRA 4IH5A 3N6MA 4IDKB 1Z4UA 5KFZA 1HNVB 2J6TA 4ZVFA 1UWBB 4OL8A 2BANA 4IG0B 5KT4A 3OLBA 2YKMB 4O3OA 4KV8A 4KFBB 4MIBA 4LQ3A 2W9BB 2HNZA 1N5YA 3OL8A 3MEDB 1RDRA 2W9CB 1HPZB 2ASDA 3UR0A 1HQEA 3PW7A 3UPFA 2UVWA 1HQUA 4RW6A 2C28A 4O3RA 3LAKA 2QE5A 4PUOA 1IKWB 3I5BA 1VRUB 5KFPA 3BSOA 3DM2B 2BRKA 1S9EB 1T05B 3V81A 3M8PB 3T5HA 4RW4A 2XGPA 2IC3A 4J9LA 2DPIA 4WXWA 1J5OB 3NAIA 4YMEA 3C6TB 3RB3A 2RKIB 3NBPB 2ILZA 4KB7A 1FKPA 2J6SA 4IR9A 1TL1A 4M95A 5DQGA 5KT7A 4ZHRA 4I7FA 3H5SA 3NAHA 4IRDA 4WE1B 1S6QB 3H5YA 1QAIA 3GV7B 4ED0A 3CVKA 5DLFA 2JC0A 4X2BA 3NMAA 3CO9A 1S9FA 2WB4A 3LP1B 2D7SA 3BR9A 1K1QA 4LQ9A 2V0NA 2OH2A 1SV5B 2WCXA 3DDKA 1S0OA 4R5PB 1S48A 1JLCA 1KHVA 1EP4B 1S1XB 1N6QA 2FJWA 4ID5A 2CJQA 5DQHA 1I6JA 2C22A 2B5JA 1S1UB 3LANA 4YQWA 5F9NA 1S0MA 1MU2B 5J2MB 4EYIB 2FJVA 4ZVHA 3DI6A 3MTKA 1RT7B 3MR3A 4O4GA 1XR7A 3DMJB 3KHLA 2AGQA 5KFWA 3LP0A 2CKWA 4Y2AA 2WONA 5KG4A 3CJ0A 2IA6A 1KLMB 3GIIA 4IH7A 1BQNA 2VG6B 4Q43A 3BQ1A 3QIPA 1DTTA 4NLRA 3JSMB 3N6NA 3PJWA 1DLOB 4KKOB 4WFZA 3BQ0A 2OPSA 1IKXA 4ICLB 4LSLA 3TAMA 4K4WA 4F4YA 3QIDA 2IMWP 2E9ZA 5DLGA 3IG1A 1LW0A 4G1QB 3SFUA 1TKZA 4ECVA 4WZMA 1S1TA 2WK4A 3EPIA 1D1UA 2HWHA 3FRZA 4IG3A 1RA6A 5C24B 5HROA 4HKQA 3MFHA 2FVCA 2VG5A 4QW9A 5KFKA 5CYQB 3T5KA 1RT3B 4PWDA 4KO0B 3DLGB 2I5JB 5F8NA 4NLVA 4RUCA 4F4ZA 3DRPA 1HNIB 5KFLA 3JYTA 4ED8A 5J2PA 3QYYA 4NLPA 5HBMA 3HVTA 3OHAA 4F4XA 1JLQB 2YNGA 3V4IA 4WYLA 3GV5B 5K14A 5J2QB 4ZP9A 1N48A 1QE1B 3DRRB 1N4LA 3H2LA 3IGVA 3BJYA 1T94A 1RTJB 4GC6A 1JLFB 3E01A 4EO8A 3PR4A 4NRTA 4YR0A 3Q8RB 3I0SA 4KAIA 3DLEB 4LSNB 4RW7A 3KLHA 5D3GA 3EZUA 3MECB 5JUMA 3MR6A 2V4QA 4IFYB 4DL6A 4Y3CA 4Q44A 2OPPA 1GX6A 4RNMA 3PW5A 1HARA 1VRTB 3TVKA 4ECUA 5L1IA 4K4VA 4TY9A 5KFQA 3MF5A 4ZPDA 4K4ZA 2UVRA 2XCAA 4MIAA 3G6YA 5C5JA 2WOMA 2YNHB 5KG1A 3QLHA 2BQUA 1JIHA 2D3ZA 2GC8A 2BE2A 2XI3A 4RZRA 1JKHA 5L1KA 4KV8B 4ECYA 1GX5A 3H5UA 1IKVB 3HHKA 3MR2A 2XC9A 4ZMMA 1DTQA 2ZKUA 2R8HA 2YKNB 3DRSB 4B3OA 3DM2A 1S1WB 2D3UA 3QGIA 4O44A 4WYWA 4K4UA 4ED6A 3NKYA 3M8PA 3KOAA 1K1SA 1RA7A 1XR5A 1J5OA 3CDEA 4NLUA 4KHRA 4NZ0A 3QO9B 2YNFB 4I2QA 1FKOB 4RW9B 5CYMA 2HAIA 2UUTA 1TL1B 3E51A 3OSNA 3GQCA 4QPXA 4DL2A 1TL3A 3I0RA 4NCGA 4ECRA 3G86A 3KNAA 1JLBB 4YR2A 2HWIA 5L9XA 5EWEA 3LP1A 1SUQB 3KHHA 4H4MA 5KFTA 3BSCA 3KLEA 1SV5A 1W25A 3H40A 2JLEA 5EUHA 1N6QB 3KLIB 4K4SA 2C2DA 4MFBA 5J2MA 4O4RA 5KFSA 3IRXB 4FBTA 4TQSA 3T1AA 3M8QB 4HYKA 3H4BA 1D0EA 3DLKB 2B43A 4J9MA 2VG6A 2C2EA 2C2RA 2UVVA 3JSMA 1S49A 4KKOA 1ZTWA 4ED7A 4MKBA 3IG1B 1LW2B 5C42B 4PQUA 4TY8A 4IG3B 1HYSA 1FK9B 5L1LA 2VG5B 4KHMA 1ZETA 1MMLA 1LWFA 5KFFA 2BQRA 4URSA 1EETA 4KO0A 3OLAA 5F8GA 2HMIB 1RTHB 2IAJB 1TVRA 2ASJA 3KLGB 4IFVB 2JEGA 3EPGA 3DRPB 4NLOA 2FLPA 3M9MB 2WRMA 3MFIA 5T14A 1LWEA 4GC7A 3KJVA 3HVTB 2JEJA 5FDLB 4F4WA 1JX4A 3DYAB 4JV1A 2ZD1A 5KFAA 3KLFA 1RTJA 2ZE2B 1RT2A 2B6AB 3KK3A 1IM4A 3BQ2A 2HNDA 1LWCB 5KT2A 1C1CA 5DG8A 3I0SB 2IM0A 4F50A 3DLEA 4LSNA 5D3GB 4Q0BB 4EBEA 4EO6A 4ECSA 3DOKA 3PVXA 1C0TA 4IFYA 1RT6B 1S4FA 3RAQA 1JLGA 3BGRA 3GYNA 4YP3A 4K4YA 1RT5B 1RYSA 5KFBA 1NHUA 5F8MA 2D41A 5EDWA 1TKXA 3H4DA 1VRTA 2IBKA 3LP2B 4MK9A 4IRKA 1C0UB 1RTIA 1S9GA 1YVFA 3PW2A 4NLQA 4I2PB 2FLLA 4IDKA 1TKTB 1TV6A 1HNVA 1T03A 3KMSA 5HLFB 3BSNA 2BANB 3ITHB 2RF2B 4IG0A 5C25A 3V6DB 4IKAA 4EBCA 1S10A 3QLHB 2OPQB 3QGHA 1N5YB 3H98A 3HKWA 3LALA 3NGDA 2R2UA 1QAJA 2JEIA 3CWJA 5I3UB 4ZPBA 4O3PA 1IKWA 2XGQA 1C1BB 4O3QA 3T5LA 5KFRA 1R0AB 4YR3A 2R8KA 2R8JA 4ZVEA 1S9EA 2HNYA 1JLEB 3C6UB 3IS9A 1N56A 4J9RA 2V9WA 4B3OB 3MEGB 4QWAA 1S1WA 4DL5A 3MEEA 3ICLA 4ZP8A 4ED2A 4RW4B 5J2NA 2FVPA 3RBDA 4IR1A 4QWDA 3QGGA 3PHEA 2RKIA 3NBPA 4NYZA 1FKPB 1RYRA 2R8GA 1REVB 2YNFA 2VG7A 4I7FB 4DG1A 2R2RA 3OL7A 1JLAB 2W8KA 3HVAA 2YNIA 1S97A 1RTDB 2RDIA 1JLBA 1C2PA 5KFEA 3KHGA 4K4TA 4J9PA 4O3SA 1SUQA 3T19A 4FS1A 4URGA 3PZPA 3QZ8A 2F8EX 4FBUA 1JLCB 1S1XA 3KLEB 1S6PB 2IM1A 3CIZA 4RW8B 4TXSA 2OPRA 2HNZB 3V6JA 3MEDA 1MU2A 2R2SA 5KG3A 4ZP6A 5KFHA 1RT1B 5KT6A 4MH8A 4O4GB 1HQEB 5KFOA 4DEZA 2AU0A 4QW8A 3IRXA 3RBEA 4PUOB 2JEFA 3OHBA 4JV2A 4TYBA 1RAJA 5KG7A 1SH3A 1KLMA 2V4RA 3TQ1A 5KFJA 2WHOA 2DPJA 3QIPB 1DTTB 3OSPA 5EWGA 4WZQA 3C6TA 1IKXB 3TAMB 5KFUA 3V6HA 2E9TA 3BREA 3BSAA 5KFCA 1TKZB 4ZHRB 1S1TB 4H4OB 3Q8PB 1XR6A 4J9SA 2QV6A 3KK2A 5HROB 2R2TA 2O5DA 1ZTTA 1HYSB 5DG7A 5CYQA 2VA2A 3IN5A 1LWFB 3UDLA 4R5PA 3IGNA 4TLRA 2HMIA 2IAJA 1RTHA 3D28A 4IH6A 1HNIA 4URQU 5F8IA 4ECQA 3JYTB 2B5JB 1S1UA 2ASLA 4NLXA 3GIKA 3DI6B 1JLQA 1RT7A 2YNGB 4ZPCA 3DMJA 2W9AA 4WFYA 1QE1A 3DRRA 3LP0B 1S1VB 5F8LA 3CDUA 3RB6A 1RT2B 2B6AA 3PJXA 4J9QA 3PW4A 1BQMA 4RW7B 3KLHB 3H59A 4G3IA 4K4XA 4RNNA 4XPEA 4Q45A 2JC1A 1DLOA 3OL9A 2OPSB 4ICLA 1C0TB 1RT6A 4LSLB 3CJ4A 4NLDA 2RDJA 1JLGB 1JXLA 1LW0B 4G1QA 2W7OA 3PW0A 1TKXB 3LAMA 3LP2A 5KG6A 4RNFA 5C24A 4M94A 4I2PA 5KFGA 1IKYA 1SH0A 3CJ3A 4ZPAA 3KK1A 2UUWA 3ITHA 5KFIA 1QUVA 3DLGA 2AWZA 1JKHB 4H54A 2I5JA 5DQIA 2WTFA 3GIJA 2OPQA 4RUAA 3FFIB 3KLVA 4ECXA 1RT4A 3RB4A 2AX0A 4Y34A 4TN2A 2EC0A 4RNOA 1HMVA 3NL0A 5HBMB 4DL4A 4KE5A 5EWFA 5I3UA 4R8UB 5KFXA 2FVSA 2FVQA 3ISNC 1R0AA 3HVWA 2HNYB 3FSIA 5I42B 2IM2A 2BRLA 3I5AA 3MR5A 4ED3A 2AQ4A 4K50A 4WFXA 3MEEB 3PR5B 4JUZA 3MECA 3DOLB 4U6PA 2OPPB 2ILYA 5DG9A 3RB0A 2BR0A 1REVA 5J1EB 2VG7B 1TL3B 3CJ5A 4NLTA 5HP1B 2FVRA 2XI2A 4RU9A 4JV0A 4ZVGA 4DL3A 3M9OB 4QWCA 1UWBA 4O3NA 2WOMB 2YNHA 2YKMA 4KFBA 1TP7A 2XWYA 2W9BA 2BE2B 5KFDA 3KLIA 1S6PA 3N6LA 2XCPA 4RW8A 2W9CA 1HPZA 2OPRB 4MFBB 1IKVA 2AX1A 1KHWA 1RT1A 1HQUB 4RW6B 4Q8FA 1VRUA 4Q8EA 4MK8A 5KFVA 2IM3A 5KG2A 1DTQB 3GIMA 2YKNA 3DRSA 5KFYA 4EBDA 1T05A 3V81B 1CSJA 4QWEA 4O44B 2IC3B 5KFNA 3H5XA 2GIQA 1OS5A 2VA3A 4KSEB 3QO9A 4I2QB 4RW9A 1FKOA 5CYMB 4R0EA 1SH2A 4RNHA 5KT3A 5DGBA 4WE1A 1S6QA 4EYHB 3I0RB 4NCGB 4PQUB 4H4OA 4TY8B 5F8HA 4J9KA 4NLSA 3KK2B 5KG5A 2ATLA 1FK9A 3UQSA 4EEYA 2UVUA 4FS2A 5F8JA 1EETB 4H4MB 4IOBA 1EP4A 4ID5B 3KLGA 3FDSA 5KG0A 4IRCA 3VQSA 3KJVB 2J6UA 4J9NA 2R8IA 5L1JA 4TYAA 3M8QA 3Q8SB
chains in the Genus database with same CATH superfamily
1NB7A 3F73A 3MM8B 2KU7A 2LXIA 2MKCA 1DAXA 1PYOB 2OELA 1RQ0A 3QZ7A 2CZ4A 5F9LA 5LMUJ 3OTBA 3DDNA 2P8IA 4UTGA 2H65B 5DDOC 3GV8B 3E3XA 2BOPA 3U1NA 3MOZA 2EI5A 2OFGX 3TJAA 1S9GB 1MWYA 1WUUA 2CPXA 3BGLA 4KGKA 3GFXA 1GTEA 4LR7A 4NX9A 3OV7A 1FDDA 5HI7A 1T03B 2RE1A 5HLFA 1K8AT 1RT3A 4B3TJ 4YEAA 1J2VA 2LQ9A 4DV4J 4DFKA 1KOOA 4MKAA 2VDIA 1DQAA 1CULB 5GMDA 2DGTA 1YZ7A 3T5JA 3Q23A 2JX2A 2AGOA 4IFVA 4NLYA 3MGJA 5KFMA 1CEZA 1BE4A 2GVDA 4ECTA 3ISND 3MR7A 4ZJQA 3OD2A 3V4IB 4RWWA 4USJC 2P9GA 3R8YA 4A48A 1C1BA 2LXFA 5FDLA 1Y5NB 1N34F 3I55S 4R8UA 2AHOB 4ZP7A 2ZD1B 1YLXA 1DQ9A 1RSCA 3KLFB 2QZ8A 4LSZB 3G71S 3K0JA 2BM1A 4TQRA 1A9NB 1SC3B 2YPYA 1UVJA 2RHSB 1HBUA 3SZ2A 2UXBJ 1G3OA 4LJMA 1TAQA 2DTJA 2MLXA 2DHHA 2YH0A 3M6XA 4DPTA 4FF3A 3BH7B 5J1EA 2DNLA 2W8LA 3OVBA 1VHFA 4I6WA 2YNIB 1RTIB 4IH5A 5A6WA 2ZZTA 4UOCA 3GG1A 1Z4UA 4PABA 5KFZA 1FXLA 1HNVB 5H9EJ 2NS1B 3JQJA 3OLBA 2C3OA 2YKMB 4O3OA 4CM2A 2ZBQA 3H42A 4IO1A 4NZ6A 4U7UK 2ROEA 4ENOA 2W9CB 1HPZB 1AUDA 1QY7A 4BC9A 3B8HA 2ASDA 2YX7A 2PI5A 3D6FB 2UVWA 3EVMA 1HQUA 5SZTA 1IR0A 4A8QA 2C28A 4O3RA 2Z2LA 1IBKJ 1VRUB 4PG8A 1T7PA 1RKIA 5A8WA 4F25A 2N82B 1S9EB 1TMJA 2GZOA 5CYJA 2QL9B 2BW7A 4WU2A 4F3MA 1W2BR 2DPIA 5D8HB 4HTIA 3GU0A 1Z2LA 3RB3A 2J6SA 3ZZ0A 4PZVA 1Q7YT 2NXUA 2HVEA 3EDRB 3DRXA 3M7VA 5DQGA 2U2FA 2FJEB 4I7FA 3EXCX 3NOCA 3PRBA 3SSRA 5B0CA 5GAHU 1HW8A 3H5YA 4EZ6A 1URNA 3GV7B 4CLZA 2J76E 4ED0A 2JC0A 4X2BA 3VAKA 3CO9A 2WB4A 3LP1B 1IVZA 1DZ5A 2W2MP 3QQCD 3THTA 4F0MA 3CB4A 2WCXA 2AD9A 2PA8D 3GQCA 2CJQA 2RB7A 2CPYA 2XS7A 2B5JA 1S0MA 1V6HA 2DXFA 3QRQA 4EYIB 4ZVHA 1RWXB 2W01A 3H2UB 1RT7B 2XZWA 4O4GA 4HH1A 4M5MA 4EZ9A 1NSKL 1U7LA 2LQ8A 2F3JA 2UUCF 5K20B 2CG4A 1VISA 1PIEA 3EVOA 3FGVA 4KPCA 3WHIA 4ALZA 1UL3A 4WKYA 2IA6A 3KNGA 3BN7A 3N79A 2V34A 3UCUP 2NPIA 4USTA 4QU6A 3R2CJ 2CRLA 3MTJA 2ZZMA 3QIPA 4NLRA 1HBOA 2GFFA 4KGMA 3JSMB 1FRHA 2O01C 1LFWA 3N6NA 4WFZA 3BQ0A 4ICLB 4F4YA 2WBRA 3G8QA 1KVKA 1URRA 4PWUA 2XYGB 5ETOA 3OW2R 1M5VC 2DH9A 4G1QB 1WF0A 3SFUA 1Y3KA 3FBBA 4NYPA 1JMTA 1BWVA 4ECVA 1IBMF 2AKWB 2HWHA 4Z2XA 4DPUA 1H73A 5HROA 3PIOQ 5J1PA 2HHSA 3PHTA 2ASYA 1NSPA 2D9PA 5D78A 1H74A 3QT7A 3TEHB 3T5KA 3NNCA 2RRAA 3BGUA 1QSLA 3DLGB 4FVCA 2F40A 3FK4A 1KFDA 3T1HJ 1XTZA 1LWXA 1ZPWX 4V19X 3KG0A 1NDPA 2FUG9 3MM5A 3MPWA 5B7WA 2EWHA 4LFBF 3ZZOA 1OMSA 3GV5B 1K0VA 1N48A 2PFFB 4GC6A 2BKPA 1JLFB 3E01A 3W66A 3D6HB 4NRTA 4CWBA 3CD6S 2XY5A 4Y28C 4DXLA 3MUVP 3MECB 1RK8A 2V4QA 1NLKL 4IFYB 4OJGA 4Y3CA 4DL6A 4CTAA 4B9UA 1EX8A 2VKZG 3M1VA 1L3UA 2CG8A 3IBWA 3KFWX 1RTZA 1VRTB 1N5VA 3TA0A 2KG1A 3UDCA 2V9KA 4DF4A 2F9DA 1M1GA 3CJ8A 1EQMA 3PCOB 3U02A 1VQ5S 5KFQA 3MF5A 4ZPDA 2XCAA 2V63A 2YWWA 2YNHB 2CJXB 3AHPA 4KY3A 3I32A 5C5JA 1R8AA 2VFUA 1RLDA 3QLHA 4X4PA 3P3DA 2CPDA 2XI3A 3A3PB 4ECYA 1R8PA 3PX4A 1EZZB 4RBTA 4USWA 5FLXU 3H5UA 1D9FA 2VFTA 4FXDA 3DLHA 5ETTA 4E0DA 3EUNA 4OFZA 2JNJA 4M5JA 5C7PA 2XC9A 3DOMA 4ZMMA 4QIWD 1R89A 2PO4A 2E1MC 3IM9A 3OTCA 5D4PA 4Q5VA 3DGPB 1YK9A 2G0CA 7FDRA 3EGZA 1NXIA 2D3UA 1VIXA 3A1YG 3J80U 2DNYA 2FJAB 1OIAA 2HFVA 5KTQA 2V8PA 3WQPA 2QA4G 5CH7B 4WCEQ 1O5JA 2J0SD 2QX0A 2HHPA 2LXUA 3VCDA 2L08A 2MZQA 2MQMA 3JQKA 3OL9A 3E51A 1TL1B 2DRBA 1QD1A 2W7AA 2CPHA 4W98A 4P72A 3TOQA 2X1AA 3VAFA 3CE8A 4ECRA 1YJ9S 1NPKA 2DHAA 1JLBB 4I68A 3KNAA 3WIVA 4LREA 2HWIA 2IYGA 3CUNA 4F3OA 3DXBA 1SUQB 3SCJE 1NDKA 5IT0A 3LGMA 2PE8A 3KLEA 2AEJA 4TNOA 3VQTA 1W25A 3W64A 3H40A 2JLEA 3G8SA 1PAEX 3O44A 4K4SA 4ANEA 1RADB 3BGOP 4EI2A 2C2DA 5J2MA 3CNQP 3M05A 4IQMA 4O4RA 1WHXA 5U47A 2NXJA 3IRXB 2ACYA 3R7BB 5KFSA 3M8QB 3ZZTA 4DWIA 4RPFA 4JI5F 2DJWA 2MQ8A 3H4BA 1SKRA 4CNYA 4KHPF 3WBZA 2P6TA 3DLKB 1XJWB 2EFGA 1EIYB 1Q16B 5D0RA 3KG1A 1N32J 2KT3A 4ZN1A 3FNNA 3HHLD 1R8HA 2G13A 2OSRA 2C2RA 2UVVA 2HVIA 2C2NA 2EFNA 4KKOA 3H7HB 2UUBJ 1UFLA 2G2ZA 3LGHA 2ZWOA 1T9TA 3Q86A 4MKBA 1LW2B 1TZ0A 2CQ4A 4XTTA 1RAHB 4LRCA 4LFCF 4IG3B 4ILLA 1HYSA 2GHVC 1S77D 5IXUA 1MROA 1B0TA 3BBFA 4HT5A 1KWMA 2OEMA 1MMLA 4HT7A 1APSA 1U8SA 3A4TA 1R7IA 4URSA 5HK4A 2HHVA 1I1GA 1RTHB 2IAJB 1TVRA 2W2PP 2HFOA 1IR2A 2QSFA 3M6WA 5HQMA 2ASJA 1FE4A 1RAGB 2RJZA 3CJTA 2LYVA 1LK7A 1U8WA 3EPGA 1HNXJ 2UXDF 2MYFA 3P5TL 5T14A 2P2CB 2EFQA 2JEJA 4M8LA 3ENWA 4MAKA 1NH8A 3CW2C 4ZITA 5D4OA 1VQKS 5T7LA 1OWXA 5KFAA 1S6OA 3B6BA 1CVJA 4HHHA 1RTJA 1FTRA 4QR1A 1IM6A 3W65A 1LWCB 5KT2A 1SIWB 2ZWPA 4CLKA 4IOAQ 2XS5A 2IM0A 2DY1A 2G1HA 4DX8H 4DR1F 1CC7A 1X4HA 1Q79A 4RNFA 2LCWA 1SQFA 1JLGA 2MKSA 3O5TB 1FRXA 5E3AA 4YP3A 3PRDA 1MLAA 1RYSA 5F8MA 2D41A 4ER8A 2IBKA 3TX8A 1U2FA 4IRKA 1C0UB 1VJWA 1S9GA 1YVFA 1PBAA 4NLQA 4C8NA 4CM0A 5D6GA 1X0FA 1NJXA 4IDKA 1T03A 4X4QA 4QBUA 5HLFB 2O66A 3R5AA 2DNOA 2XLJA 3KMSA 2BANB 4IG0A 4KTQA 3ONQA 4I56A 5DJBA 2RQ4A 2OPQB 2YH1A 1RGVA 4C3KA 3CTRA 5EX0A 4BWMA 1WDDA 2J7WA 2JH3A 2M9KA 1NK4A 2GVDB 5GAEU 1WELA 1Y4ZB 3I56S 4BC7A 3ZTQA 3V5RA 2XMWA 4KGXB 3RGIA 1C1BB 3CT9A 4QQBA 3ISZA 2E5HA 1SC1B 1N56A 2ZM6J 3K57A 3TARA 5A6PA 1L3KA 1U49A 3MEEA 2YBVA 4NEYA 4ZCKA 4F2SA 3DXSX 2FVPA 1FDBA 4IR1A 5G0RB 4QWDA 2WW8A 5E0OA 2ROGA 4AE5A 2GQQA 4DDFA 2ZJRQ 1UMJA 3GP9A 4U9RA 1UZDA 2XQCA 2R8GA 2EEYA 1W2IA 4KYZA 4BBYA 2R2RA 3HMJG 4CLWA 4JI1J 1HBMA 2EXUA 4U8YA 3T1YJ 4P2MA 2YNIA 2G2OA 2GJIA 3JTPA 3R5CA 5ETKA 3FBCA 2MKKA 4K4TA 5KFEA 2LDIA 2ZNZA 2VD3A 4WTOB 5K8NA 2J7UA 3PO4A 4O3SA 3T19A 2XTJP 1RU2A 5BYSA 4G1IA 2EW9A 3PZPA 1VBKA 1JLCB 2MB0B 4C0OC 3OFGA 4OYZA 1FRJA 1Y11A 1MU2A 3HSDA 5C2CA 2CWKA 5KT6A 2Z2MA 5E41A 4AYBD 4P9SA 4JP8A 3ADAC 3R27A 2WB1D 4QW8A 3FBEA 4RBUA 1M5KC 1HHSA 2NZCA 3ELHA 2OJ3A 4JV2A 2ZUGA 1IBCB 2HQFA 4U67Q 3TUIC 1FJ7A 1KLMA 1RABB 2W25A 2NLWA 4N8NA 2WHOA 3AB2B 3HFKA 3HULA 2DPJA 2Z0GA 2ZVSA 3OSPA 4FVMA 4M63A 4BCAA 4FYDA 1SL0A 5GMEA 3JQMA 4B3SJ 3V6HA 1VMBA 3MMCA 1ZA1B 1S79A 4J9SA 3PKMA 1WC1A 2QV6A 2G1DA 3T3FA 4TU9A 2LFVA 3RBXA 4A8YA 4JI4J 4DR5J 5CQGA 1U6ZA 4PG5A 2DGSA 5DG7A 1TFYA 2V2QA 3NWRA 5L8RC 2MLZA 3QRPA 3M2UA 1LWFB 1NUEA 3UDLA 2E7XA 4QIGA 2J9EA 2HMIA 4X65F 2LP4A 5F8IA 2ASLA 1SB6A 3JYTB 2B5JB 4PG7A 2RQKA 3PX6A 1QSSA 2B9XA 2E5JA 1NK9A 2YNGB 1RT7A 3B4MA 1Y7PA 3QGPA 4ZPCA 3HCXA 2W9AA 4AFFA 2FQQB 1L3TA 3DRRA 1YJTA 4D3GA 1SC4B 4LVOP 1GQEA 3BKTA 1S1VB 4WU3A 2PA3A 2VICA 3K8VA 1X5TA 3RB6A 1RT2B 2B6AA 7FD1A 4YDXA 3HZGA 2ZH6A 3CCMS 4K0KF 4RW7B 3KLHB 2DNMA 3H59A 3MCNA 1RU1A 4P74A 1HBOB 5BYRA 3RW6A 3FMWA 2JC1A 4ICLA 2CWXA 1NRKA 2YKPA 1JXLA 4G1QA 4P7TA 4U8VA 2EK6A 1T02A 2LU1A 2DBBA 5IC6B 2CQIA 5EN1A 3X3UA 1HL6A 2G0JA 3EGVA 2APOA 3BV8A 2D9OA 4I2PA 3I9V9 2HVZA 3MPUB 2DNRA 5KFGA 3OVAA 4W90B 4L3NA 3CJ3A 2E5GA 3ITHA 5KFIA 3DLGA 2EBEA 4ZLLA 1O8BA 2HIQA 4JI0J 1LXJA 3A8IA 3D3BJ 5CHCB 4DV2J 4UZCA 4Y34A 3RJMB 1U1NA 3VVUA 1F60B 1WG4A 3VAGA 3T6BA 3Q89A 1FD8A 4KE5A 5I4MA 2E66A 1TFWA 2JFDA 1RBOB 1EJ7L 2RU3A 2FVQA 1R0AA 1M5HA 4BWJA 4CH0S 1QVFR 2CA9A 1WC3A 2RNEA 1YHQS 1Q81T 2AQ4A 1N54B 3MAQA 1B70B 1VQYA 1XK8A 4PKDB 3UVJA 3PR5B 2VU5A 3MPDA 3MECA 4C8MA 3DOLB 4U6PA 1NHKL 4I0WA 1H72C 2ILYA 5DG9A 2VG7B 3R2DJ 2VBWA 3GIRA 4OJ1A 4PXDA 4CO2A 1CC8A 1MW7A 2F65A 2FVRA 1UETA 5IFMA 2R7OA 4P2SA 1ZM9A 3RR7A 2FY8A 1B0PA 1N5SA 1C4CA 2HW3A 3Q22A 1XWLA 2NXNA 1MNEA 3HKZD 1FO1A 2YNHA 3GYXB 4CYUB 1EB0A 3M8YA 4OZ1A 3TRGA 4KFBA 2HHQA 1K9MT 4Q7AA 2W9BA 2K3KA 3A12A 3N6LA 4YB5A 3RRGA 3LWLA 4JI7F 4NZ7A 3SQOP 3OTOF 2LQBA 4OJ3A 1KHWA 4FN5A 1RT1A 1PGZA 3GCXP 2YWHA 2CIMA 3C16A 2COLA 2ROPA 2HGMA 4ZVRB 2QEXS 4Q8FA 4N7TA 4Q8EA 3MM6B 3Q2SC 1SKUB 1UP1A 4OHWA 2BJDA 3DGPA 3DFEA 4ANDA 4EBDA 2ADCA 4B9SA 1QAYA 2CJAA 4QWEA 2HEKA 2R7RA 1YITS 2CQ2A 2DNPA 3G8TA 2DNGA 2IC3B 2V69A 3NP5A 3HP6A 2ZH3A 4RJVA 5A0YB 1OS5A 2CPFA 1FRIA 3C66A 4ZVPB 2MQOA 1PC4A 1KC8T 4KSEB 1FJCA 1MWQA 1GH8A 5KT3A 2WVBA 4PAAA 4WWSA 3LH2S 2IVFB 1S6QA 2KYXA 3GB0A 5IT9Y 4PQUB 1MMNA 4Y65A 4DUZJ 2SXLA 2XHCA 3VVTA 3KK2B 1QAXA 2K2PA 2WW4A 1RHJB 1FRKA 3EWGA 1U6BA 1RAFB 1LOUA 5RUBA 5F8JA 1EP4A 3CD7A 4ID5B 2RMLA 3KLGA 4M5NA 2BZ2A 1R43A 5KG0A 1HNWF 4ED4A 3EMTA 1ZOTA 4BHQA 3ENQA 4OI6A 3KJVB 3VQSA 2R7TA 3HHLC 3KYLA 4USIA 4J5OA 4O23A 2P6SA 2XULA 3OR2B 3M8QA 4YB7A 1FI4A 2MKIA 3R6GB 4OZLA 2WONB 4XPCA 1SJ1A 3SFGA 5D0EA 4X4NA 2ZE2A 2AW0A 4DR5F 2WVCA 3D0IE 2XNQA 3DLKA 2KO1A 2JL9A 5JXSA 3W60A 1VLYA 4L72B 4OI1A 3PFEA 3OXFA 4Q0BA 2ZEJA 4HI1A 4P71A 3QSYB 3M9NB 4WP3A 3OL6A 4QYRA 1T3NA 1FERA 1VK3A 2CNLB 5ETPA 3BGRB 1N36F 3HZEA 2CJYB 3W9IA 1U47A 1N34J 2IDLA 1WEXA 4K4YA 3CCJS 4XO0A 1H2UX 2EBGA 1WORA 1LW2A 4MK7A 5CABA 4U7CA 3A8JA 4J9VA 4P73A 1TKTA 3HHEA 4FYXB 1NHVA 1UEVA 5ETVA 2DHGA 4PWDB 2RF2A 4PR6A 2DNZA 2QSWA 2MKYA 3KK1B 2XMMA 2Y1RI 3AY0A 3ENVA 2MPUA 3HD2A 4E98A 4WFAQ 1TVRB 4ANCA 5KFCA 1K73T 5HMZA 1W7WA 1RT4B 5LXRA 1FVSA 3A13A 4KBIA 1FFWB 1HMVB 1TL7B 5K14B 1E6YA 1U09A 1WOPA 2I1RA 3LA0A 4DOZA 2DK2A 4IQXA 3C19A 1WF1A 3D5MA 2J7KA 1LQ9A 4NLWA 2I6WA 4NXNJ 1JLEA 3IS9B 5T7LB 3PXGa 2RQCA 5I42A 4QJVA 5KT5A 2BEFA 5LJ5Y 1LWCA 2Z56B 4Y2CA 3Q8QB 3V6KA 3HSGA 3VGTA 4QYZJ 2AGPA 2DNKA 3J80Y 1NSAA 1HA1A 1H98A 3CF5Q 4HL9A 1JWWA 4ES3A 4J9OA 4WFBQ 3MAHA 2DR6A 8AT1B 3DU6A 3KHRA 2HK3A 4RWXA 1C0UA 1RTDA 1EHWA 4DCJB 2H4WB 3ZZUA 4X62F 4MJKA 3SMZA 4DPWA 5IOLA 4IDKB 5SUHA 2J6TA 4ZVFA 3WZ0A 2CPZA 3FUYA 4NXMJ 3SXLA 5FJ4A 2BANA 4IG0B 1RAEB 3S8SA 2QLBB 3TA2A 4CH1A 2ZVIA 2HNZA 1Q4RA 5L39A 3H0PA 2JZ5A 3R1LA 2NCKL 2DH8A 2C2KB 4DCPB 2Z2YB 3UR0A 2FPHX 2M4MA 4TLQA 5GAHI 2HFZA 4RW6A 1UW9A 4I6AA 2QE5A 1IWAA 2VBYA 1IXKA 3I82A 4DV6J 2D3O1 1NK0A 5FIIA 2DIVA 3RAMA 3DM2B 1ZS6A 4OHXA 2BRKA 3L7PA 3HT3A 4C8OA 1RUSA 3T5HA 2IY5B 4A8KA 5DS7A 5H1SV 2Q3PA 4K2JA 1J5OB 3VR1A 1UVLA 3C6TB 1U6FA 2ILZA 4L75A 1FVQA 2F8HA 4OZ2A 4USUA 4YUDA 2KM8B 3WX8A 4Q2MA 1PSDA 2RDDA 4ZHRA 4K5SA 4WK3A 3NGSA 1QAIA 2N4DA 3BO3A 4ZVQB 2OD6A 1YZ6A 4LBHA 2AJ2A 5HN0A 2D1CA 3BR9A 2RILA 2CVIA 3MURP 1SV5B 1S0OA 3H90A 1RZMA 3CMQA 1Q86T 4R5PB 1JLCA 2FJWA 1OPZA 3CCZA 5B0FA 2C22A 4XDCA 5B0DA 3LANA 1ZM4A 1WOOA 2QO3A 1WKKA 5L9NA 1MU2B 2ZC4A 2QC3A 4B9TA 1V3ZA 1VBZA 1RBAA 2GHPA 1ACMB 1VJQA 4GKKF 2HK2A 3MM9A 2DR9A 3SYZA 1RWMB 5KFWA 2HHHF 4F4KA 1CJTA 2C3YA 4Y2AA 3L7UA 4ETZA 1KLMB 2CNOB 2QLFB 4LFCJ 1BQNA 1U26A 4GKJF 2VG6B 1X4GA 2B4UA 2DNQA 2L9WA 4X64F 4DSJA 1ITPA 1FWKA 2PD1A 1EAYC 1DLOB 3ET6A 3MZIA 3PJWA 2OPSA 1OY9A 4U96A 1T95A 1WACA 2DIUA 2IMWP 3CCTA 2EFVA 5GVQA 4NCAA 2CNNB 1LW0A 2MZJA 4MMOA 1X9SA 2BACA 1RXOB 2PMWA 2UXDJ 2VJUA 2ERRA 1D1UA 2GAHC 1CJVB 3UN5A 4LRDA 5A8KB 2FVCA 2VG5A 2RAQA 4E2FB 5KFKA 2XSFA 2UUCJ 4KO0B 1XC9A 4CZCA 2LEAA 3VGSA 2I5JB 3DLBA 5F8NA 2MDAA 3PY8A 3DRPA 3QSIA 2QN6B 3JYTA 3DHWC 3N9UC 4ED8A 4JI1F 5J2PA 4NLPA 1KDNA 2E1PA 5HBMA 3HVTA 2KXNB 1VQPS 4F4XA 2YNGA 3MUMP 1HHTP 3M30A 5J2QB 2QG9B 4GVBB 2I9SA 3DRRB 1N4LA 2L9DA 2BMBA 2ZBCA 3H2LA 2HBQB 3IGVA 4KH1B 3VV2B 4CNZA 3BJYA 3O3LA 4EO8A 1U0HA 2GJFA 4WPAA 2XYPB 3FCWA 1TKDA 3Q8RB 3I0SA 3PV8A 5D3GA 4RW7A 3KLHA 3EZUA 4HVZA 4K59A 1UVMA 3BH6B 4M5DB 1F5AA 1FNOA 3QFWA 1GX6A 1P1LA 3FZ2A 2ZFHA 3RR8A 3H20A 3TVKA 1WKLA 5H9FK 1GMWD 5HVHA 3SCLE 4ELVA 2EVZA 3AOCA 1I5OB 3THPA 3W2VB 2DD8S 1WKJA 2VPYB 4DX6A 1ZM3A 3G6YA 4S0MA 4C98A 2ZUAA 3CJKA 5KG1A 3OUYB 2BQUA 1JIHA 4I67A 4RZRA 4QCLA 4UQTA 4KV8B 1GX5A 2X1GA 1IKVB 1ZBTA 2D69A 2DO4A 3LPEA 2B4OA 4N8OA 5DDPC 2D3OR 5LMUF 4OI0A 1VS3A 3MMAA 4OMFG 3MR2A 3G4SS 4KH0B 5LSRA 2EKNA 4USKA 1DTQA 2R8HA 4A8SA 3DRSB 3T1YF 1WC5A 1S1WB 3QGIA 5AE3A 3JSYA 1DARA 2I38A 4PG4A 1WTBA 3ENAA 3NKYA 3M8PA 4ZOSA 4DHVA 2J9DA 3CCSS 3UVJB 3DU5A 4DS5A 3KOAA 2P5VA 3AFGA 3G87A 3ILIA 4WBFA 2FLNA 1RAOA 3CCLS 5CYMA 2POKA 1FKOB 1X60A 2E5IA 2HAIA 2JFKA 2NSBA 2Z57B 4B17A 2GO8A 5GAEI 2UXBF 1Q1KA 2BKOA 5B0AA 1D9DA 3I0RA 2AEFA 4HACB 2R7SA 3EXYA 5THWA 1HLWA 3CJQA 3GJQB 4YR2A 3QJJA 5EWEA 4LUBA 4DFJA 2KH9A 4P7VA 3N28A 3NGKA 3J81U 3KHHA 4H4MA 1MMDA 5KFTA 4CYUA 4NPOA 2EPIA 5D4NA 2QJ3A 3CC7S 1VOMA 2E7WA 2VPWB 5EUHA 1YRXA 1N6QB 4OX9F 2QMUB 4YHHJ 1BLUA 2ZC3A 4KGVB 3MMBA 1PBUA 1HWJA 4IOCQ 2Y9HA 3M2RA 3H2VE 2NXEA 1F3FA 1UTAA 3C16B 4LRFA 4LRAA 5EX3A 3BEGB 3NEKA 1R31A 4HYKA 3RTVA 2L41A 3AA9A 1DRZA 5KAKA 1D0EA 3DGVA 1XNQF 3SQGA 2B43A 2J0WA 2GQ2A 2M2BA 5F0WA 4J9MA 2FY1A 3GFHA 1KS2A 4R0JA 3CCES 2C2EA 5A0YA 4QIEA 5D15A 4G6VB 4PPZA 1S49A 1N33F 3CDAA 2JLFA 4TU7A 3B4DA 2NYHA 3IG1B 2LVWA 2V8HA 3QAEA 5C42B 5HMXA 1VYAA 4PQUA 1ZZNA 4DR3J 1UEKA 1F0XA 4UY8T 3CDBA 1BHNA 3IWNC 1LNQA 4KHMA 2DGXA 1ZETA 2KT5A 5KFFA 2BQRA 3QATA 1B64A 3OLAA 3T6JA 2YKOA 3TP2A 3KLGB 2Q43A 1R8CA 2WVFA 3POTB 2XG8A 4NLOA 1HIYA 2K7KA 5JVGQ 4QZVB 2YX1A 2WRMA 3MFIA 1EKRA 1LWEA 4GC7A 3KJVA 2KHCA 1M5PC 3R5DA 1FFSB 1S6UA 2E7VA 3K8WA 2KHDA 3OR2A 5HJYA 3PKYA 4DS4A 4JV1A 1NK6A 1VGYA 4GO5X 5HVFA 2ZE2B 1IM4A 1VRQC 2A1BA 3MPYA 3M8SA 2XO6A 1N5TA 4CLFA 4ECSA 3DLEA 4LSNA 2KM8C 4Q0BB 1C0TA 6FDRA 2HFNA 2UU9J 3BGRA 3KDOA 4C9DA 5KFBA 5EDWA 1TKXA 1IWGA 4HEA9 3LP2B 2LQJA 3PW2A 4LRBA 2FLLA 4MKYA 1TKTB 2ZDOA 1SQGA 2P9CA 4PXCA 3FJ2A 3RRKA 2AZ1A 3Q8VA 4IKAA 2RF2B 2F1FA 2W2NP 2HPUA 3R5GA 3QGHA 2XZDB 2LLZA 4UY85 3Q2TC 1SVDA 1ZZFA 2UV8A 3WDOA 3TZWA 3O8WA 4D3HA 3LALA 3CIMA 4TU8A 2R2UA 4CO0A 4DSLA 4J7CA 3A3OB 1IKWA 2D74B 5KFRA 2DY9A 4ZVEA 2LDYA 2HNYA 1JLEB 3IS9A 4NI2B 3V2UC 2HZAA 4B3OB 4DPOA 1NO8A 2W4CA 3GLJA 4L73A 4RW4B 4I69A 3RBDA 1PILA 4C8ZA 5B0EA 3NBPA 4NYZA 1NKCA 1B7YB 2W4DA 3PG9A 4ZA1A 2YNFA 1X4FA 3OL7A 2Z30B 2W8KA 2MKHA 2DNHA 4RO0A 3IMQJ 2RD5C 3G6ES 2AYBA 5IM0B 1RTDB 2MHNA 3KG4A 1AFIA 5AE1A 5K8OA 1U45A 1L3VA 1M5OC 3BB5A 4WKRA 4FS1A 4QIFA 3FEZA 4ZPWR 3DDIA 4X84A 1A7GE 4B3SF 2IM1A 2FB0A 4RW8B 3CIZA 2RIJA 1WC6A 3IM8A 2HNZB 4CO3A 4PWWA 4LF9F 4K0KJ 1JNZB 2ZBPA 1UWAA 2OFHX 2AYMA 1B4SA 1JJCB 2X7IA 4HTJA 1RWNB 1Y00A 2O3DA 4OYWA 4DEZA 5KFOA 1YBAA 1T9UA 3RBEA 4LR9A 4OV6A 5HVGA 4TYBA 2VB6A 4M5LA 2QL7B 2V4RA 3NCQA 2YPZA 3W63A 2J9CA 5KFJA 1S72S 5F41A 2MQPA 3FRYA 2ZKTA 1DTTB 1KTQA 2O1PA 1P9YA 4B3RJ 4JI0F 1ZA2B 3C6TA 3TAMB 3C8YA 4DQPA 4KRWA 2EFPA 1SJFA 2E9TA 3BO2A 3HD1A 2ZHOA 3OR1A 4ZHRB 3BM7A 1AFJA 4H4OB 1RCXB 1HD0A 4F36A 2B9YA 3TAQA 2HWTA 2CJ9A 2CQ3A 2K8GA 4M1KA 4FZVA 5CYQA 4QPTA 3J7YI 2FC8A 1S7HA 1BMQB 3IN5A 2VA2A 2HHTA 4JYAF 2JSXA 1M0SA 2HLUA 3HHLB 4R5PA 2KB2A 1FESA 2V6AA 4A8XA 4URQU 2MXYA 2IDEA 1HNIA 1SIZA 3DC2A 1U1RA 3W62A 4L6V3 2V67A 4NLXA 2FJBB 2RVJA 4CQ1A 2KFNA 3ZNJ1 2H4YB 2BKNA 3KXDA 1QE1A 5M2RA 3TYTA 4B02A 1QJHA 1SJRA 3MM8A 5F8LA 4GO7X 3FCVA 3CDUA 3OJSA 4NXMF 1OYDA 1H0HB 1TUWA 3BYRA 3TWZA 3PW4A 5HMWA 1U1LA 1YBUA 3GZ7A 4JI3F 4B3RF 4Q45A 1YIJS 3K5OA 2KZZA 3UFCX 1DLOA 3ET6B 2PDAA 2OPSB 1RT6A 4YB6A 2FHKA 3P8BB 4NLDA 1RHUB 3P4UB 1YJUA 3AODA 4HHUA 3HSJA 1LW0B 3UW1A 2GGPA 3TVYA 3LAMA 4O0IA 1NPRA 4DV3F 1IJFB 1XNRF 1CJVA 1G4CA 2GJ2A 5IWAJ 1ULRA 2AZ3A 3GE9A 3CCUS 5H9EK 6AT1B 1RAIB 4OV1A 5L38A 1SH0A 3BF4A 4ELTA 5GADI 3JAMU 1JJ2R 1JK9B 4Y00A 1AB8A 3EM1A 2V8GA 1QUVA 2AWZA 2YWFA 1JKHB 2NUHA 2I5JA 1YJ7A 2CFXA 2VFRA 3NCPA 1NDLA 1E6VA 2WTFA 3KLVA 3LWMA 4ECXA 1N88A 1ZPVA 2AX0A 4LBIA 4C0BA 4Z7CA 4QU7A 3UN2A 4RNOA 2UU9F 1FWLA 1HWKA 3NL0A 5HBMB 2AIRB 4DV3J 3B82A 4N41A 4QR2A 5EWFA 5I3UA 1U4BA 4R8UB 1Q5VA 5KFXA 4J91A 2V2KA 2Q79A 1X5OA 2Z2ZA 2MJUA 2BRLA 1U0HB 4K50A 4WF9Q 1HBUB 2UV8G 1QM9A 4JUZA 2OTLS 3W7BA 4A8MP 1F3VA 1XMBA 2ZDPA 1SC6A 3NWGA 3R5JB 2BE7D 4HLBA 3UWTA 4ZLPA 2ZH5A 1REVA 3UCZP 5J1EB 5ETMA 3RB0A 2BR0A 4ITSA 3OXLA 4QYZK 4KQZA 1Q5YA 4JI5J 4NLTA 2CQBA 2B4PA 3IO1A 5E3QA 3EE3A 2QTWA 4DL3A 4ZVGA 3M9OB 2V50A 1DBDA 2ZH1A 4GKJJ 3HX9A 4P6QA 3MDFA 3BYPA 2YKMA 4DUYF 3F0NA 4RX6A 4N47A 2A6OA 1VQ4S 5ETNA 3KLIA 1S6PA 3OBIA 3QBCA 5A8RB 2W9CA 1HPZA 2OPRB 5CZXA 3ETMA 1N5QA 4EFAC 1I3OB 1IKVA 1YDLA 3DRYA 4DSIA 1RBLA 1HQUB 3DCAA 2ZJQQ 2QFIA 2HBZB 3NG8A 1VRUA 3BR8A 3I87A 5A8WB 3LF0A 1JXVA 2GAGC 1DTQB 1X5PA 2DHXA 2GX8A 3DRSA 2IM3A 2QLXA 3RW7A 2XMAA 2HGNA 5ETSA 4YY3J 2DXDA 2V2ZA 5CD4A 3CEDA 3SEOA 5KFNA 3CCVS 2HSEB 1WEYA 1HR0J 2MY7A 3QAUA 4HHJA 3FEYB 3HHDA 3W8PA 2YXLA 3K2YA 3IBCB 3PNIA 5CYMB 5CCMA 5HQ8A 1FKOA 4DV7F 2RT3A 3NXZA 5DGBA 1J27A 1SL2A 4EYHB 2HZCA 3I0RB 4HACA 4TY8B 4OYOA 4J9KA 4JV5J 2BJ8A 1YRUA 1KP6A 2ATLA 3UQSA 1FNMA 4B3MF 1AZSB 1OY8A 2HKEA 2J9DE 3C15A 1VC6A 4DR4J 1EETB 4H4MB 1Q7LB 5J1NA 3AJDA 7AT1B 1B3TA 4X4UA 2N4CA 5AXNA 3ZTRA 1OO0B 3BGFA 3MMBB 4ZN3A 2J6UA 5D0GA 2BUNA 5DZ7A 2MSSA 4J9NA 3NY0A 2R8IA 1TMMA 1IBMJ 3PRVA 4TYAA 5G4DA 4OX6A 4BLGA 1CPZA 2KL8A 2HHUA 1WHVA 4N77A 3GJTB 1M1HA 3ILLA 3SQGB 4DL7A 1S4EA 1Q95G 1XERA 1BQMB 2MKJA 3T1HF 3DOKB 3IAM9 3BN4A 2FZGB 1Y10A 3MMJA 3RAQA 2JVRA 1Q82T 2KYZA 1EKSA 2JVOA 3D0HE 4K5RA 2VQFJ 2W1BA 1RT5A 1HNWJ 3AD8C 2BOAA 1LEOA 1VDHA 4WXOA 4QWBA 5C42A 1T0TV 3P96A 4DN9A 2LKZA 4B9MA 4RUHA 1TV6B 2IRYA 4DBQA 1WNEA 5DETA 3PM9A 1NNDA 1IKYB 3V6DA 3F41A 3T9NA 2EFOA 3D1HA 4WFNQ 1S57A 1F1BB 3HJFA 5ETQA 3GILA 3TW0A 2NZ4A 3POTA 3HDSA 3FFIA 1CG2A 4NASA 3OPKA 4HI2A 1RB0A 3D1OA 5E33A 5EHHA 5IV4A 3R1HA 1LWEB 1VC0A 5JVHQ 4H4KC 4ZVUB 1BXNA 4DV0J 2ABYA 1WI6A 3I4HX 3CJ2A 2KT2A 1NZAA 5DGAA 4DQRA 1TK8A 3C6UA 1JLFA 3E01B 2BJEA 3FQLA 4PCQA 4UOGA 2R9LA 1GK8A 1ZH5A 1WC4A 3D7SB 3SV4A 1TUGB 3A8EA 4XK8C 3FQKA 1TQLA 1VI7A 5D4LA 2BJ9A 3UD4P 4FF1A 2L48A 1VQNS 4NRUA 2FJXA 1KEKA 3M1VB 1UW4A 1KQFB 4DG1B 4JI8F 2ALZA 4UOHA 2YKQA 1AUSL 3CDWA 4GKKJ 3JS9A 4AL6A 3QJLA 5HP1A 2GIRA 2ZZNA 2HQCA 5JJBA 3N6MA 2HQGA 5LJ3Y 3A8KA 4HDGA 5H9FJ 1UWBB 1WG1A 4EK2A 1Q8KA 4OL8A 5E2QA 3DN9A 4LQ3A 2QYGA 3EX7B 3OL8A 3F44A 3MEDB 3HSZA 2GIFA 1RDRA 1O0PA 3QNWB 3CULA 2RRNA 2WSFC 4AUKA 5HSPA 3CD0A 3UPFA 5LMNJ 2DNNA 4USVA 3DOMB 3PW7A 1XMQF 4FXWA 2WSEC 3GONA 1BC6A 4PUOA 4OZ3A 1IKWB 1FEEA 2Y1LB 2V5HG 5KFPA 1XEZA 3AOBA 2XSJB 4NI2A 3B54A 2JOQA 4B08A 1T05B 3V81A 2HZVA 4LF8F 1Q8LA 2IRXA 2CXEA 2MQLA 4RW4A 4W4MA 4WXWA 4YMEA 1EQ0A 3NBPB 3M2VA 1FJGF 1HD1A 1HW9A 1TL1A 4M95A 1R0BG 3S6EA 3SCKE 3TZZA 5KT7A 4YFUA 5HL7Q 1R27B 3NAHA 3OJUA 4WE1B 2E1AA 2KN4A 3I4PA 3CVKA 1VR6A 4LMZA 1IQZA 2LEPA 2MQQA 1YTYA 1CQNA 2D7SA 2V0NA 3GCWP 3TEGA 2FZKB 2OH2A 3I96A 2VASA 3DDKA 4C2MA 3Q24A 2PT0A 1YSJA 3VF0B 1S48A 3G2XA 4ATNA 5DQHA 3HT0A 1U1QA 2H9ZA 2IPOB 1S1UB 2HLTA 4UUXA 5F9NA 2IA0A 5J2MB 3IR6B 1M90T 2FJVA 2CQHA 1NSQA 4F67A 1XR7A 3KHLA 5E7OB 1N33J 2KTQA 2JJ4D 2B3TB 1OJ4A 1G2EA 1QDUB 4JV5F 2CKWA 3DNCA 1K47A 5KG4A 1AYEA 3CJ0A 1U1OA 2JWNA 3GIIA 5I3QA 1VQ9S 4Q43A 1DTTA 1A0OB 1YKWA 1DFDA 1Q53A 1S9FA 4KKOB 3TAMA 1X7VA 5ADZA 2PSZA 3QIDA 3NRBA 1WJ9A 2E9ZA 2NUUG 5DLGA 3OR1B 1SPBP 5HQLA 4WZMA 5KOWA 3FRZA 4IG3A 1UEUA 1CJKA 1S59A 4LF1A 2GMLA 3MFHA 3J7AN 3KKFA 5CYQB 1RT3B 3JSRA 2Y1JA 1R3NA 1N0VC 4J37A 3HHLA 2NXCA 2DO0A 4NLVA 2CPIA 2KJVA 1GT8A 4MIWA 1HNIB 2B56A 1M1KT 3QRRA 3NLCA 2BVZA 3QYYA 4I64A 4ZVOB 4YDDB 2VONA 3D67A 1N0UA 3V4IA 1HI1A 4H4KA 4O0NA 1DHMA 4WYLA 5AXLA 3TJ8A 1NKEA 3AD9C 1QE1B 2ZHBA 3HK2A 1RTJB 2I2YA 4DR7F 4C3MA 4JYAJ 3PR4A 3AB4B 4LFAF 4A8FA 1UAWA 4FNHA 2IVMA 2XMVA 2ZOGA 3R7SB 4EUVA 3J7Z5 3G9CA 3H25A 4JI6J 5JUMA 2KFYA 3RG6A 3R6LB 1F9EB 3L95X 3RU0A 3MAAA 4Q44A 1KQGB 2M0GB 3K17A 2H1YA 5LOQA 4ERDA 2XM3A 1NAQA 4ECUA 3IWLA 2H48B 2VFVA 3ILJA 4K4VA 4TY9A 2C1EB 3LQVA 2DGUA 2HFSA 2UVRA 1KN6A 2CPEA 2PFDA 2R42A 2WOMA 2JHEA 4DSFA 2AJ0A 1WSRA 3PTWA 1XBWA 4FNIA 2CQGA 2EG2A 4L76A 2D3ZA 2GC8A 2BE2A 4F2RA 1JKHA 5L1KA 1H6KX 2A2CA 2X51A 3KJFB 2AJFE 3KJNB 2YWKA 1OSDA 9RUBA 4CLPA 1ZAXA 3G82B 2CQ1A 5GAGI 3HHKA 4CRJA 1N36J 4OJHA 4DUZF 3CCWA 2BJ1A 2FZCB 2DEIA 3IR5B 8ATCB 5IWAF 1XNRJ 1YBTA 2IBOA 1V9OA 3PYGA 5CD4H 4X4SA 3X1LB 4LVNP 4WYWA 4ED6A 4OZJA 5G0RA 2OSQA 4NA2A 2X3GA 1NK7A 2ZH7A 4QOTA 3S7RA 1XR5A 4NLUA 2VC0A 4NZ0A 4C7QA 4KHRA 1U1PA 3QO9B 4RW9B 2HFUA 4NA3A 2HYIB 2LECA 1K0TA 4DV0F 4P52A 2HG4A 4ETXA 1P6TA 1GXLA 1GMVA 2GVZB 2V4JA 4DR2F 4A8OA 4X4OA 3LP1A 2A0FB 1RCOB 2BBEA 2KZMA 1UCNA 2CQDA 2AP6A 4XIUA 1I51B 2CUYA 2FYXA 4DX5A 4M5HA 3BPDA 1KQKA 3KLIB 2XEXA 1F6TA 3IP0A 2DHSA 4NOHA 5A8RA 3E8OA 4F0KA 3O6QA 4IYQA 3ETOA 5M2UA 1UA0A 5E3RA 1LK5A 3DKDA 4C6AA 4DR2J 4DSKA 1GMUA 3FEXB 3PEHA 1SJ3P 1NMEB 1HI0P 1YRTA 4AXIA 4DU8A 1RI7A 4ZDNA 2CYYA 4NA1A 5E3CA 1DQ8A 2N7CA 3ULHA 1RISA 1D9AA 1FJEB 3JSMA 1FT8A 2CAJA 4P2FA 1SJ4P 3HHNB 4ZJOA 1ZTWA 4ZLNA 2XO7A 3CMES 3P6YC 3HVRA 1C4AA 3W9JA 2AMCB 2QLWA 4DZDA 1F5CA 4NWBA 4TY8A 5IT4A 2QFJA 4RUBA 3ZTOA 3QT5A 5DM6Q 1P9QC 5L1LA 2Z8QA 1LWFA 2K06A 1U0SA 2OEJA 1KFSA 1EETA 1NEEA 4IUFA 5LSOA 2HMIB 1FWPA 2VC1A 2XY6A 3VGVA 3ZO7A 1FDAA 1DJ0A 3GSDA 3IRWP 2EC2A 2JEGA 4KT0C 2DGVA 3M9MB 1YJNS 2R7VA 3S1TA 3MM5B 4A8WA 1X4BA 4C0HA 4CT9A 4FF2A 3PJ9A 4CT8A 2Y8WA 4F4WA 3DYAB 2A10A 1JNRB 3DHXA 1RLCL 2YQ0A 3SDEA 3ZC4A 1YI2S 3W9HA 1RT2A 2B6AB 1PCAA 2ZJPQ 1NH7A 1WHWA 3LPYA 4DU7A 3OXGA 1F9FA 4F50A 2ZH4A 4EBEA 3PVXA 4DSEA 3DOKA 1GXUA 2FHJA 2I0XA 4HR2A 4IFYA 3OTEA 2CZVC 5B0GA 1B7FA 1AROP 1GNKA 4JBCA 3QPIA 3M6UA 2PMZD 1RT5B 1T9YA 1Q78A 1NHUA 2EKYA 1FRLA 5C2GA 5MLCV 3H4DA 1VRTA 3PDNA 1FF2A 1TUVA 1Q8IA 4JI2J 5AE2A 3A3NB 4I2PB 2FC9A 4LR8A 5DZ6A 1TV6A 2UUAF 4LF6J 2F4VJ 3MI7X 1M5SA 1NK8A 3BSNA 4RKUC 3WX4A 3ITHB 3V6DB 3UI3A 1S10A 2XB2D 5IT9U 3QLHB 1UJ6A 4DV5J 1N5YB 1CS4A 2VL1A 3H98A 4DMZA 3FVYA 3M32B 5ETLA 4NL5A 2ACMA 3IBFB 4X66F 1QAJA 3MWBA 2JEIA 1QUPA 3GSIA 2FJDB 3R5BA 1HWLA 2RHQB 4ZPBA 3T5LA 2UUAJ 4DF8A 1R0AB 4DZ6A 4YR3A 4OI2A 4DFMA 2V9WA 3C6UB 3KJQB 4ILRA 2GV1A 2M88A 4QWAA 2ADBA 3TQEA 2UXCJ 4ZP8A 2OTJS 4RBVA 2YQ3A 5CXTA 3D66A 2RKIA 2B0GA 1I94F 1FKPB 1WI8A 2AT1B 2OI2A 5GAGU 4N56A 2OAUA 1UJ4A 4OIXA 2VG7A 2JDJA 3P5BP 5LXYA 4DG1A 3ZZZA 1RJJA 1ZAVA 4ZS6A 1FEHA 2QMXA 2YKAA 1D8YA 3HVAA 2JRSA 2Y8YA 2F63A 5B08A 2DGOA 1UKUA 4YB1P 3VWSA 2RDIA 2H5JB 1JLBA 1C2PA 1WDTA 1FRMA 1PC5A 3TA1A 1SUQA 4URGA 4JI6F 1ROFA 2F8EX 3QZ8A 4FBUA 2BDPA 1FD2A 1S1XA 3KLEB 4PYAA 4OYXA 4TXSA 4JI3J 2BV3A 1R6YA 3NS7B 3J81Y 3TUZC 1B0VA 3MEDA 3THVA 2V2VA 5KG3A 4ZP6A 5LSLA 1RT1B 5KFHA 1VQMS 4MH8A 3UO0A 1VQ7S 3UNYA 1P27B 4JI8J 1VIOA 4LF9J 2DR7A 1VBXA 4DFPA 3IRXA 1V5VA 3PIPQ 1RKJA 4PUOB 2JEFA 3FZBA 2B8PA 1GEHA 5LT5A 2KG0A 3TQ1A 2XSJA 3QMQA 2VHGA 2VIHA 5K8PA 5D77A 3NMRA 1UPMB 4LF5J 1X31C 3D6MB 1VQSA 3OTDA 1L3SA 1HWIA 4WZQA 1Y3JA 1VK8A 1IKXB 5GMKa 3M2VB 5KFUA 3CMAS 1H2VZ 4DLGA 4WIQA 4ZJLA 3BREA 3BSAA 2BW2A 1TKZB 1P8GA 2MEWA 1S1TB 2MMYA 2Q6BA 3O2IA 4TVAB 1XR6A 4USHA 1IBLJ 1AA1B 3KK2A 1XNQJ 2R2TA 1RHRB 2O5DA 3LTOA 1ZTTA 3IC1A 2AJQA 1HYSB 4DPYA 1H7XA 4JB8B 1MROB 4DUTA 3HO1A 3CSKA 2FLOA 3KUHA 1NJZA 2M52A 1HBNB 1KD1T 1T9XA 3IGNA 4AQYJ 2HS3A 2IAJA 1RTHA 2DRDA 2RUGA 1GXTA 4IH6A 3E2EA 5AJ3J 1S1UA 1TR0A 1NU4A 2GMJA 5L46A 2UP1A 1VCTA 2E44A 1JLQA 2DKOB 2ZOMA 2ZOFA 3HJVA 3NCRA 4Z37A 2VQFF 4N76A 2H5EA 4CIOA 3VZIA 1H2TZ 3AOAA 2NSCA 2QA4S 4ZPTR 5IV3A 5KOXA 1YJWS 2FD2A 1PO6A 3TZXA 1KLNA 4OYPA 5K5MA 1HQ2A 1YQHA 3TUPA 2MSTA 2YVSA 3CD5A 3BO4A 4K4XA 4G3IA 4BDPA 5AJ3F 4XPEA 2MJNA 1S7IA 1FCAA 1SJQA 2OLWA 2M8HA 1U1KA 3GPAA 3CJ4A 2RSQA 4AXJA 1UVIA 1JLGB 4WJBA 2A2DA 3AA8A 2C3PA 2HVHA 1FXRA 1Y5IB 1ZM2A 2AJ4A 3MCSA 1CJKB 4DV6F 4M94A 5E3PA 3SSSA 4HH0A 2B7BB 4OHVA 1JQGA 2MQNA 1N32F 4CP5A 3KK1A 1DY3A 2I8EA 2OD4A 5EGYA 1YG0A 3FSYA 4H54A 1A6LA 1FFGB 4RL1A 2ZNYA 2QA1A 2OPQA 4RUAA 3RB4A 2XZTB 1RT4A 3ILOA 2EC0A 4I1TA 2B9WA 1HMVA 1TL7A 2QIFA 2WVDA 3QT8A 4DL4A 1TELA 2OMLA 2GCFA 3D0GE 3WC2A 1SL1A 2NREA 2FVSA 4QR0A 1KNZA 2U1AA 2KI2A 2HRTA 4DR3F 5I42B 2IM2A 2MY8A 3I5AA 4F3QA 3MR5A 1WHYA 3CCRS 3MEEB 2RU9A 3JB9k 2DR8A 2QT7A 2RS2A 2XNRA 2VPZB 4DV5F 1V5IB 1ICEB 3D68A 3PYEA 3UDEA 4DQSA 1ELOA 5CZVA 3MAAB 3MHYA 1OYEA 1TL3B 1P1TA 1X4DA 3CJ5A 1KVIA 4Y6IA 2X1FA 2XI2A 5BR8F 1HBMB 1PAUB 4RU9A 3GR1A 1F9HA 1U1MA 2WOMB 1Q0NA 3W2WA 2B7CB 5GADU 5M2PA 1SQEA 1G6BA 2XMUA 2BE2B 3W5ZA 4CO5A 2XCPA 1IR1A 4DV7J 1T3OA 4JOUA 1CBKA 2F8MA 4OI3A 3BDEA 2DGQA 4MFBB 3LW5C 4UOFA 2AX1A 4LF4F 3G82A 1FHTA 3C3LA 3L09A 4RW6B 4LT6A 1YWXA 5DRKA 4PXBA 3H8YA 2B8QA 2QYCA 1HNZF 5KFYA 4LIWA 5BYQA 5MAOA 5IZHA 2PMHA 4ES1A 4CLTA 1WF2A 4PPDA 2GIQA 1FX2A 2FHJD 2VA3A 2L3MA 3QO9A 4RW9A 4LF7J 1X9WA 3GFZA 2YWGA 2YY3A 2G0IA 2OKQA 3MMCB 1VC5A 3PO5A 3TO8A 2DYAA 2R3VA 5A2QY 2HHHJ 1MG7A 1FK9A 4EEYA 2GVZA 2V4JB 4V1Ak 3OT9A 1IUJA 2UVUA 2H51B 4FS2A 3IAS9 4PYDA 3VAMA 3GYGA 4IOBA 3MOJB 2FHOB 3JTNA 3M2UB 5IQ6A 9ATCB 5HMYA 4X4RA 1REGX 2BX6A 2PEHA 3GJRB 4ELUA 4KJIA 4ID8A 4ZLJA 3GMGA 3BPSP 1V3RA 3PACA 2WAQD 3MM9B 1OPIA 2XMTA 5L1JA 4PRFA 2BYCA 3RBZA 3Q8SB 4C8KA 1CJTB 2HS4A 2W7PA 2GW8A 3KK3B 1S1VA 4F4AA 1KVJA 3M8WA 1BQNB 3RYLA 2HNDB 1MN9A 2HRUA 3W5XA 1C1CB 2ZH2A 2DR5A 1S0VA 2BQ3A 1D09B 4OX7A 2E1CA 4OHYA 2PN6A 4OYMA 2IJFA 2EG1A 4C8LA 3RAXA 4Y2IA 3BBCA 3U1MA 4UQGA 4Y2KA 2XYHB 1NCLA 3AQPA 4P10A 3MD3A 3V4MA 2GS8A 4X4TA 4ED1A 4CLYA 3SI8A 2XS2A 4FKYA 2F7VA 4LIRA 1JJ4A 1AT1B 5A8KA 4NLGA 1BUXA 3FKBA 4UZBA 2IJNA 3I5CA 2VDHA 5C25B 3NGTA 4UW2A 1MWZA 3OVSA 3Q8YA 4ECWA 3KMQA 2AV5A 2WBMA 4P2XA 1NKBA 1S0NA 3CGIA 3RUBL 3VHQA 5CAAA 3HXMA 3AT1B 5J2PB 1F5BA 1RWWB 2ZBRA 5ETRA 3UN3A 1VHIA 5J2QA 3TX0A 2RQMA 1BWEA 3B78A 1JJHA 4G1PA 3DYAA 3KUEA 4KC5A 1T8EA 4DN0A 3SDEB 3MEGA 4DR4F 3SSQA 1Q8BA 2V68A 3K89A 5J2NB 3G6VA 4RU2A 3US5A 4ZIVA 4WIIA 4KGZB 1Z1ZA 3ZZRA 3CC2S 1KQSR 2E9RX 4C11A 5LMNF 1S76D 2OGUA 3G6XA 1BQXA 3DOLA 2HQDA 2AYGA 1JLAA 4ECZA 3JSBA 4OLPA 5K9FA 4G65A 2FGCA 2YTCA 2DVIA 4WP8A 2WZ1A 1VQ6S 1OQ3A 3ZNUA 3P49B 3QFHA 2OP5A 3QWUA 3W2VA 3D6TB 2AEMA 1D8ZA 4U95A 4DCOB 2CDQA 3CJKB 3OUYA 2Y0SD 5KT4A 1S5ZA 1Y5LB 4KV8A 4KFBB 4MIBA 2IRUA 2MZSA 2W9BB 1N5YA 1CS4B 2E29A 2AF6A 4FXVA 4DR1J 4UF4A 3M32A 3MMAB 1HQEA 1JXEA 1PJ6A 3G96A 1UA1A 2BJ7A 3LAKA 4CDIA 3QWPA 2MLYA 3I5BA 1U02A 2FGOA 2C3UA 2XBPA 3LGNA 2FDNA 1X4AA 3MM6A 4ZCLA 3T9ZA 3WC0A 3BSOA 4DUYJ 1WTFA 4LF6F 2VOOA 4DV4F 4JI4F 4EGLA 1VQLS 3M8PB 1K44A 1XN9A 1RP5A 1WG5A 2NYIA 3W8GA 5BXIA 1X4CA 2XGPA 2IC3A 4J9LA 1NJWA 2DRAA 2LA4A 3NAIA 2RKIB 4KB7A 2OO4A 3KTQA 1FKPA 4IR9A 3F56A 4QIVA 5BJRA 3OTOJ 1FXDA 2C2MB 2J0XA 4OYBA 4X66J 1IJEB 3H5SA 1GFWB 4DL0C 4XAKA 1T9WA 1S6QB 2YX4A 1R6VA 3U1LA 4IRDA 2F9JA 2Q6CA 5DLFA 1BY9A 2VH7A 3NMAA 3I9ZA 1NBEB 1EARA 1K1QA 2Z58B 4LQ9A 1Y0HA 5HO4A 3TANA 1IBKF 3BS9A 2KDOA 1CJUA 2CVEA 2CJBA 2G9OA 1KHVA 1EP4B 1S1XB 1N6QA 4WP9A 4ID5A 2IHR1 5E5NA 1I6JA 2KXFA 4X64J 1TAUA 2DISA 4YQWA 3R97A 3M2RB 2VQEJ 3DI6A 2J8SA 3MTKA 1FJGJ 3MR3A 2AGQA 3DMJB 2UUBF 3EDQB 2BE9B 3GTYX 3LP0A 1KKHA 4OZ0A 2WONA 2VODA 2VJVA 2RH3A 3PYFA 4IH7A 1GTHA 1UFKA 4XDDA 1CLFA 1XMOF 1LFPA 1RACB 3HFZB 1NDCA 3MUTP 3BQ1A 3CJSA 2WVEA 1VQOS 4JI7J 2HHXA 2Q1LA 4K4ZA 1LKZA 4CCHA 4NMXA 4K4WA 4LSLA 1IKXA 4LFBJ 1OSCA 2ZBIA 3IG1A 1Z2ZA 1TKZA 1S1TA 2AYEA 2W2OP 2WK4A 4OYIA 3EPIA 2QA2A 1RA6A 4U7UD 5C24B 1NPPA 2C3MA 2E1RA 4DQQA 4NCBA 1UVNA 4HKQA 3EYZA 4QW9A 1CQMA 2UXCF 3J7YU 4PWDA 1RE1B 2GO9A 4OLOA 4GMKA 3EICA 1HBNA 3AXKA 4RUCA 4F4ZA 2K3IA 3BKFA 1KONA 3VAJA 5KFLA 3K5PA 5HJXA 4ZCIA 3OHAA 2WSCC 1JLQB 1G7CB 2W24A 4Q2LA 5K14A 1E6YB 4ZP9A 2M3DA 5I3PA 4EMDA 2RS8A 4MKVA 1T94A 2CQPA 2A6MA 1T9VA 3AH6A 2W4PA 4CO1A 3HLUA 2DCUB 4YR0A 2F4VF 2G4BA 2LQ5A 4KAIA 3QJPA 3DLEB 4LSNB 2GA7A 1FX4A 2HBYB 3D54A 4PEOA 3MR6A 1FTCA 1TU0B 2JLGA 3L3CA 4I6YA 4KPYA 3MD1A 5B0BA 2OPPA 3MM7A 3CCQS 4RNMA 2PEBA 3PW5A 4B9NA 1HARA 2IMOA 1IQTA 5A2QU 2VBXA 5L1IA 4DV1J 3NNAA 1F2GA 3GFYA 2LMIA 2BXJA 4C4WA 3GWCA 2NPFA 4LF5F 4MIAA 2NQPA 3N5FA 1WOSA 2XHWA 3CJRA 4YN3B 4Y0FA 3NOGA 4GVLA 5FLXY 5ITHA 3NGUA 4K2XA 2DCLA 2R7XA 1PG5B 1U2RA 3QT6A 3J7ZT 2B4VA 2QRRA 3VALA 2ZKUA 2YKNB 4OHZA 3LUYA 2B9EA 4B3OA 3DM2A 4X62J 1KRPA 1FE0A 4OI4A 1WSVA 4O44A 4K4UA 4B9LA 5HATA 1DURA 1SBRA 3I31A 4FP9A 3C14A 3UR3C 1NK5A 4B3TF 1K1SA 1RA7A 2CNKB 1J5OA 3CDEA 3UNGC 4A47A 4I2QA 2YNFB 4YHHF 2UUTA 4OX9J 3OSNA 4CLSA 2R7QA 4QPXA 1TL3A 4NCGA 2OEKA 2KKHA 3G86A 5IM0A 3J81j 4LF8J 4AT1B 1WWHA 2MGZB 1RWUA 1ZYQA 5L9XA 4DR7J 2MTLA 2KFZA 4RR5A 2V8VA 3Q83A 3VAHA 2K1RA 2X3DA 2OHDA 3BSCA 3W2WB 1SV5A 1RAAB 2HS0A 2X1BA 3FMBA 3ZZPA 4MYUA 3OFHA 6FD1A 3KUGA 3Q8UA 1SKWA 4ED5A 2PGCA 2ZHAA 4CLUA 3HF5A 1T11A 4DR6F 4MFBA 2HGLA 2VOPA 2GQCA 8RUCA 1KOHA 4E8UA 1YX2A 4FBTA 4I4BA 3T1AA 1HFEL 1YJVA 2DEJA 4M5KA 5AT1B 4TQSA 2OIHA 4BS2A 3ZZYA 4JI2F 3EGNA 3W61A 2N7YA 3IR7B 1S12A 2CQCA 2CPJA 1R0CB 1LV5A 1D3WA 2DGWA 1UPPA 3ZTPA 2DH7A 1NJYA 2VG6A 1RWVB 3MCOA 3PFOA 2XLIA 3P45B 1X9MA 4EU0A 1TK0A 4UUWA 4ZCMA 1GAOA 5F3TA 4X65J 4ED7A 2BABA 2HAFA 5A76A 2XWXA 1LXNA 3R3TA 3EVWA 5IS2A 3OFFA 5JMNA 3L4BC 2A18A 4Y2MA 1O51A 1XMQJ 3D9BA 2CADA 1FK9B 3PW0A 2M5YA 4NE9C 2CZ9A 2VG5B 2GNKA 3AJ2A 4NEZA 3R9LA 1CULA 4KO0A 3TZYA 3N4WA 5F8GA 3K5MA 4CLLA 3IA0A 4IFVB 2NR0A 1HWUA 3DRPB 1HKAA 2FLPA 1VLOA 2V8DA 1MSWD 3GG0A 1SKSA 1UVKA 1N52B 2CQ0A 3HVTB 2Q66A 5FDLB 3CO0P 1BGXT 1NB2A 2QGFB 3M30B 5F3ZA 4GVBA 1JX4A 1PKUA 4DPXA 2ZD1A 1GMWA 2YQ1A 4AD6A 3NNHA 1XIQA 3KLFA 3N5BA 3KK3A 3BQ2A 2OMOA 2PIIA 2HNDA 4NXNF 1C1CA 5DG8A 1N8RT 2HIYA 3N01A 3I0SB 1SCJB 2HURA 3LO3A 5D3GB 5IQQA 3W5YA 3ZTSA 1YJRA 4EO6A 3C46A 4M5DA 5DM7Q 1RT6B 1S4FA 3FCHA 3DLLQ 3GYNA 4LF2A 2VF3A 4C97A 4W92B 4DV2F 1NM2A 4CH7A 2GGPB 4F0HA 4MK9A 1RTIA 1PYSB 2IVYA 4FPRA 1HNVA 5F0UA 4ZVTB 2ZH9A 3Q0AA 3HFVA 3GJSB 4DL2A 5C25A 4OYAA 2M70A 1V3SA 2MZ1A 4EBCA 3VAIA 1E6VB 3AJ1A 4WK1A 1HR0F 4CO4A 3HKWA 5K8MA 2HQ3A 3NGDA 4F7VA 3CC4S 3CWJA 5HAOA 5I3UB 2J5AA 4NMLA 3AXMA 5LM7E 4O3PA 3UDVA 2XGQA 4DLEA 2R8KA 4O3QA 1OQ6A 2C2OB 4DV1F 2R8JA 4HDHA 1S9EA 2BJ3A 1NJIT 4J90A 4J9RA 1WC0A 3MEGB 3BBBA 2H3EB 1S1WA 3PYDA 3ICLA 2LEBA 4DL5A 2Y1IA 2VPXB 1FDNA 5J2NA 1VFJA 4ED2A 4M5GA 3QGGA 3PHEA 4L3KA 3UD3P 5CCLA 1H38A 1WEZA 4C11B 1RYRA 1REVB 4I7FB 3TUJC 3D3CJ 4X4VA 1JLAB 3AAWB 4LF4J 3TNVA 4B3MJ 2MHEA 3K5LA 2E5LJ 2O67A 1S97A 3S01A 3W1YC 2DXEA 3KHGA 4J9PA 1YGYA 2H54B 4FPIA 3K5NA 1HHQA 1ZAWA 3JAMY 3MPVA 2Y3YA 1S6PB 2DB1A 4FDFA 2OPRA 3V6JA 3CPWR 3EZOA 2HBRB 2L9NA 1IBLF 2R2SA 1SXLA 2A3JA 3D1QA 2QMWA 4AL5A 4FKXA 4O4GB 2VZ9A 1HQEB 2AU0A 2E5LF 2R4FA 2PI4A 1MN7A 4J9UE 3VTIA 3OHBA 1RAJA 5KG7A 3AD7C 1SH3A 2VBZA 2OUGA 2RUSA 4FYVB 3TVZA 4IO9Q 2C2ZB 3QIPB 2RRBA 3DLJA 3W3SA 1U25A 3OQ2A 1HI8A 4K7QA 5EWGA 4ZKAA 1QTMA 1PJ5A 3IWXA 1AW0A 3M6VA 1TL5A 2R7WA 2MZRA 3FC9A 3Q8PB 1FKAF 4KHPJ 1J5EF 5HROB 1F2HA 3EZ5A 2YWEA 3SV3A 1AZSA 2ZM6F 3C15B 1S99A 4MT1A 1H7WA 1FA0A 1X8DA 3FSXA 4PQAA 4ZVSB 4LFAJ 3D2WA 3PX0A 1TK5A 2M7SA 1UZHA 1VBYA 1VQ8S 1CJUB 4TLRA 3UD5A 1I94J 3D28A 3MCMA 4ECQA 4EWTA 2XMKA 4C8YA 1RWOB 2VFSA 4LBPA 4MTPA 3GIKA 3DI6B 3LOUA 1KSPA 1J5EJ 3DMJA 2GHWA 4WFYA 5IC4B 5BR8J 1KTVA 5D0HA 2GMHA 3HI9A 3R7NB 4PXEA 1RHMB 3LP0B 2VV5A 4M5IA 4R25A 5T41A 2G2YA 3GR0A 3K59A 4OZNA 3M4XA 4KIAA 1B99A 4FYYB 4OX8A 3PJXA 4J9QA 3ZFVA 1BQMA 1U48A 2FHMA 5DDQC 1HNXF 1RWKB 3BZQA 3N0VA 4RNNA 2N3OA 3IFEA 3VZHA 2QL5B 2BM0A 2VUGA 4CTAB 3PEJA 3UE2A 4LSLB 4AQYF 1C0TB 3IXQA 3RZAA 4A46A 3HM9A 2RDJA 2ZITA 1X5SA 3TAPA 1JB0C 2IYIA 4P75A 2W7OA 3KWMA 1TKXB 2BA9A 1BD6A 2H5IB 3LP2A 5KG6A 4UT4A 4NYOA 5FD1A 1FNXH 3K58A 5C24A 2F4FA 3BDPA 5AXMA 1IKYA 4DX7A 3U7JA 4ZPAA 2DT9A 4ZPVR 2KRBA 2UUWA 3AQOA 2KRRA 5DQIA 1SI9A 4RLEA 4KR0B 3GIJA 2CDRB 3FFIB 3M8RA 4DQIA 1KR4A 2IIHA 4TN2A 3L7OA 2W2QP 1TTHB 3BKUA 3MXHP 4DR6J 3EGWB 3C2PA 2UZAA 4V19J 3O1LA 2ZH8A 3MEKA 3ISNC 2KXHA 3HVWA 3NGRA 2HNYB 3FSIA 3U27A 2FIUA 2PC6A 4ED3A 4F02A 2LA6A 3T41A 4WFXA 3WIUA 1QVGR 4FYWB 2ALYB 2J8AA 2XY7A 1XQIA 4YS2A 2VQEF 2F5GA 2OPPB 3MM7B 1H3DA 1PJ7A 3FBFA 1OY6A 3JTOA 1R8BA 1HNZJ 5HP1B 4F26A 4JV0A 2VKRA 3EJMA 5AXKA 3TR5A 3D4JA 4QWCA 1UWBA 3CXCR 1XMOJ 3JXOA 3SCIE 2HHWA 1UJ5A 4L74A 4O3NA 2IFXA 3HPOA 1L5UA 2M8DB 1G1XA 1KBRA 1TP7A 2XWYA 4DJBA 1W26A 5KFDA 4OZ5A 2XLKA 4F8RA 4RW8A 2P9EA 2KJWA 1TL4A 3NS5A 2Z4PA 2ATCB 4ZIWA 3J7A1 2R7UA 4CI0B 3KDNA 4DI6A 2Y0BB 5B09A 2KVIA 2IJRA 4YOEA 4MK8A 5LL6d 5KFVA 2V94A 3SBMA 5KG2A 3GIMA 4ILMA 1RHQB 2YKNA 1RWPB 1IN0A 2K7JA 3K7RA 1T05A 3V81B 1CSJA 2KVQE 3ZXWA 4ES2A 5DDRC 4AL7A 4PG6A 4O44B 2QLJB 4C48A 1Y9OA 1QTNB 2MZTA 5CA5A 4Z7YA 3H5XA 3C14B 4A4JA 2XMJA 2EK1A 3L9ZA 4MYTA 4I2QB 2DITA 2HRYA 4B9VA 2FTRA 4R0EA 1SH2A 4K8RA 4RNHA 4USMA 4WE1A 3TJ9A 1UFWA 1WD6A 2LU2A 4NCGB 1O6XA 4H4OA 3OFEA 4GRSA 3VGUA 3NS6A 4NLSA 2C42A 5F8HA 2HVDA 4WTYA 4C3LA 5KG5A 2B51A 3SIPB 1X4EA 4N5SA 2MGZA 4YY3F 3RRHA 1X0PA 1AXQA 2AJ1A 4TKTA 1U24A 2J0QD 2K1RB 5HANA 1RHKB 1NZ8A 3TI0A 3FDSA 4IRCA 2HQIA 4OQJA 4F04B 4FF4A 3UCGA 1U2CA 3I6PA 1QLNA 1PYTA 1QSYA 4LF7F 3M8ZA 5DO2A 2CJKA 4ZK7M 2N3LA
chains in the Genus database with same CATH topology
1NB7A 3F73A 3MM8B 2KU7A 2LXIA 2MKCA 1DAXA 1RQ0A 3QZ7A 2CZ4A 5F9LA 3OTBA 3DDNA 3GV8B 5DDOC 3E3XA 2BOPA 3U1NA 3MOZA 2EI5A 2OFGX 1S9GB 1MWYA 2CPXA 3BGLA 4KGKA 3GFXA 1GTEA 4NX9A 3OV7A 1FDDA 5HI7A 1T03B 2RE1A 5HLFA 1K8AT 1RT3A 4YEAA 1J2VA 2LQ9A 4DFKA 1KOOA 4MKAA 1DQAA 3T5JA 2DGTA 3Q23A 2JX2A 2AGOA 4IFVA 4NLYA 3MGJA 5KFMA 1CEZA 4ECTA 3ISND 3V4IB 4RWWA 4USJC 2P9GA 4A48A 1C1BA 2LXFA 5FDLA 1Y5NB 1N34F 3I55S 4R8UA 4ZP7A 2ZD1B 1DQ9A 2QZ8A 3KLFB 3G71S 3K0JA 2BM1A 4TQRA 1A9NB 1UVJA 1HBUA 3SZ2A 1G3OA 4LJMA 1TAQA 2DTJA 3M6XA 2YH0A 4FF3A 5J1EA 2DNLA 2W8LA 3OVBA 1VHFA 4I6WA 2YNIB 1RTIB 4IH5A 5A6WA 4UOCA 3GG1A 1Z4UA 5KFZA 1FXLA 1HNVB 5H9EJ 2NS1B 3OLBA 2C3OA 2YKMB 4O3OA 4IO1A 4NZ6A 4U7UK 2ROEA 2W9CB 1HPZB 1AUDA 1QY7A 4BC9A 3B8HA 2ASDA 2YX7A 2PI5A 2UVWA 1HQUA 5SZTA 1IR0A 4A8QA 2C28A 4O3RA 2Z2LA 1VRUB 4PG8A 1T7PA 1RKIA 5A8WA 4F25A 2N82B 1S9EB 5CYJA 4WU2A 4F3MA 1W2BR 2DPIA 5D8HB 4HTIA 1Z2LA 3RB3A 2J6SA 3ZZ0A 1Q7YT 2NXUA 5DQGA 3DRXA 2U2FA 2FJEB 4I7FA 3EXCX 3PRBA 3SSRA 5B0CA 5GAHU 4EZ6A 1HW8A 3H5YA 1URNA 3GV7B 4ED0A 2J76E 2JC0A 4X2BA 3VAKA 3CO9A 2WB4A 3LP1B 1DZ5A 3THTA 3CB4A 2WCXA 2AD9A 2PA8D 3GQCA 2CJQA 2RB7A 2CPYA 2XS7A 2B5JA 1S0MA 1V6HA 4EYIB 4ZVHA 3H2UB 4EZ9A 4HH1A 1RT7B 2XZWA 4O4GA 1U7LA 2F3JA 2UUCF 2CG4A 4ALZA 3FGVA 4WKYA 1UL3A 2IA6A 3KNGA 3BN7A 3N79A 3UCUP 2NPIA 4QU6A 2CRLA 3MTJA 2ZZMA 3QIPA 4NLRA 1HBOA 2GFFA 4KGMA 3JSMB 1FRHA 2O01C 1LFWA 3N6NA 4WFZA 3BQ0A 4ICLB 4F4YA 2WBRA 3G8QA 1URRA 4PWUA 3OW2R 4X4VA 1M5VC 2DH9A 4G1QB 1WF0A 3SFUA 1Y3KA 4ECVA 4NYPA 1JMTA 1IBMF 2HWHA 4Z2XA 5HROA 3PIOQ 5J1PA 2HHSA 2ASYA 2D9PA 5D78A 3NNCA 3T5KA 2RRAA 3BGUA 1QSLA 3DLGB 4FVCA 2F40A 1KFDA 1XTZA 1ZPWX 4V19X 3KG0A 2FUG9 3MM5A 3MPWA 5B7WA 2EWHA 4LFBF 3ZZOA 3GV5B 1K0VA 1N48A 2PFFB 4GC6A 1JLFB 3E01A 4NRTA 3CD6S 2XY5A 4Y28C 3MUVP 3MECB 1RK8A 2V4QA 4IFYB 4OJGA 4Y3CA 4DL6A 4CTAA 4B9UA