3QLHB

Hiv-1 reverse transcriptase in complex with manicol at the rnase h active site and tmc278 (rilpivirine) at the nnrti binding pocket
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
423
structure length
407
Chain Sequence
ETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords reverse transcriptase/ribonuclease H
publication title Synthesis, activity, and structural analysis of novel alpha-hydroxytropolone inhibitors of human immunodeficiency virus reverse transcriptase-associated ribonuclease H.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase,hydrolase/inhibitor
total genus 101
structure length 407
sequence length 423
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3qlhB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3qlhB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3qlhB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3qlhB03
5C42B 2D3ZA 3CJ3A 4J9PA 2ASLA 3BSOA 1QE1A 1TKTA 2HNYB 4RW4B 4Y2AA 3V81A 2XI2A 3HKWA 1JLCB 2IJFA 4J9MA 2AWZA 1C1BB 4ECQA 1LWEB 4NLYA 3OSNA 3KLIA 2OPQA 2IMWP 3KLFB 3BGRB 1IKYB 3KHGA 5CYQA 4KHMA 4RNOA 5KFQA 3DRPB 5KFNA 2ZE2B 2R8IA 2IC3A 3RB3A 2FLPA 1S48A 1S6PA 2ZD1B 4I2QA 3H98A 2WONA 3I0SA 2FJWA 1GX5A 4IRKA 2XC9A 5DGAA 4Q43A 4ED2A 2RKIA 3G6XA 3ISNC 1FKPB 1C1CB 2B5JB 4I7FA 3NAHA 2V4QA 3LAKA 1SH2A 4FBTA 3GIJA 2HAIA 4ZP7A 4ECYA 2I5JA 1S0MA 3DLGB 4J9QA 2E9ZA 1FK9B 1SV5B 5HLFB 1HNIB 1IKVB 5DGBA 4O44A 2BR0A 1TV6A 2WCXA 1S0NA 1HYSB 4ZVGA 1RYRA 2V4RA 4KB7A 1HQUA 4EYIB 4NLUA 5F9NA 4TQRA 4MK7A 2R8JA 2BANB 4WE1B 5KG0A 1LWCB 3OHBA 1JIHA 4KO0A 3CO9A 1REVB 1RA7A 4NLPA 3T19A 4MFBB 2W9BA 3BREA 3MFIA 4ECZA 2VG5B 5F8HA 4RW8A 5DG7A 2JEGA 4IG3B 2I1RA 3FFIA 4RNMA 3GQCA 3RBEA 3G6VA 3KLEB 2JLEA 2YNFB 4ICLA 4ZHRA 4URSA 2WK4A 5J2NB 1HQEB 2R2UA 4WZMA 3JSMB 4B3OA 3PZPA 4DG1B 1DTTB 1JLAA 2OPSA 2RF2A 5HROA 3HVAA 4R0EA 5KFOA 1LWFA 1S1VA 5KT6A 3BSNA 4IFYB 2BQ3A 3QIDA 5KFRA 2R8GA 3NMAA 5J2MB 4NYZA 5HBMB 1JLBB 3MR3A 2AU0A 1RYSA 1UWBB 2YNHB 2YKNB 3KMSA 2XCAA 1TL3B 4YQWA 1FKOB 3GIIA 4K4UA 3IGNA 3PR5B 3DMJB 3T5JA 4WYWA 2R2RA 1XR7A 5KFHA 3ITHA 1QAJA 1C0UB 4KKOA 4HYKA 2YNGA 3CVKA 2IAJB 3HVWA 3DRSA 2J6TA 4ECTA 5CYQB 3PW5A 1RT7A 4NLSA 5KFTA 3TAMA 1RT3B 3MEEB 3V6DA 4Y3CA 4WFYA 2WONB 4TLRA 3I0SB 3MTKA 5KFBA 4ECXA 2HNZB 4O3NA 4NLGA 4U7CA 3QLHA 1MMLA 3MR6A 2FLLA 1IKWB 1KHVA 4I7FB 4KE5A 1JKHA 4J9NA 3V6JA 1RT2A 4PWDA 1TL1A 4Q8EA 1S97A 1RTDA 3IS9A 1N4LA 3D5MA 5DG8A 1N5YA 4DL2A 1S1UA 1TV6B 2W8LA 3KMQA 3NBPA 4MK9A 4RU9A 4K4WA 4PUOA 3BJYA 4ECSA 2OPPA 2E9RX 4H4OA 2WB4A 2VG7B 2OPRA 4H4MA 3CJ2A 4Q44A 1HNVB 3KLHB 3Q8PB 1RT5B 3QIPA 3D28A 3KK2B 4URQU 3M8PA 3DOKB 3I5AA 3FQLA 2IM2A 2UVWA 5F8JA 4MH8A 2AGPA 3M8QB 4WFZA 4KHRA 5KFKA 4YR3A 2W9BB 2W9AA 2IBKA 4NLTA 5KG4A 3MR2A 3NGDA 3FFIB 5DQGA 4QW9A 3KHLA 4RW7A 4F4XA 1LW2B 1EP4B 2FVSA 4ZMMA 2UVUA 4RW9B 3PW0A 2UVRA 2GIRA 1HMVB 1LW0B 2QV6A 5KFWA 2JEJA 2YNIB 4ECRA 4DL4A 4JV1A 5CYMB 3MF5A 5L1KA 3SFGA 1VRTB 4K4SA 3KK1B 4DL5A 2OH2A 3MECB 4EO6A 4NLDA 2W7PA 2W9CA 5KFMA 4ZPAA 3KNAA 1RTIB 1ZTTA 5DQHA 2AX0A 4RNNA 4HKQA 2E9TA 1RTJB 3T1AA 3OLBA 2IJNA 4F50A 2HMIB 1RT4A 4M95A 2IM1A 5F8MA 4ED7A 3RB4A 3QZ7A 4FS2A 4Q8FA 5KFIA 4IDKA 5HP1A 4RUCA 3UDLA 3KJVA 1TP7A 2IA6A 2B6AB 2WOMB 2ZKUA 4RZRA 4K50A 3H5SA 3HVTB 3DRSB 4NCGA 3JYTB 1R0AB 4QWDA 1S9GB 1RT7B 4RW6A 1BQMB 1TKZB 3DRRB 3KLGB 5I42A 4IOBA 5KT7A 3LP0A 2XGPA 5K14A 3KHRA 3H4DA 4Q0BA 4IR9A 3DOLB 4ID5B 5C24B 1K1SA 1SH0A 2ILYA 1S9EA 4I2PB 1EETA 1N6QB 1JLEA 5T14A 3IN5A 1RTHA 1VRUB 4O4GB 4KBIA 3BQ0A 3QYYA 3C6TA 1TL1B 3IG1A 1TVRB 3MEGA 1RDRA 3CJ4A 4IFVA 5KFGA 1WNEA 3LP2A 3PW4A 5C25B 3BSAA 3H2LA 1S9FA 4IG0A 4LSNA 4Y2CA 2AQ4A 3E01A 1S1XB 4NLRA 4WFXA 5J1EA 4KFBA 2VA3A 5KFZA 4K4YA 4NZ0A 4H4MB 3PJXA 1C0TA 3DYAA 5J2QB 1T03A 3PW2A 4DEZA 3DM2A 3DLEA 2VG6B 3V4IB 5I3UA 4ED1A 1J5OA 1RT6B 1Z4UA 3H5YA 3C6UB 5FDLB 4J9OA 4F4WA 1DTQB 3DLKA 1KLMB 1IKXA 2BE2B 3HHKA 4R8UA 4U6PA 3I0RB 1HPZB 4O3SA 4H54A 2W7OA 3QO9A 5KG5A 2EC0A 1S6QB 3M9MB 5F8NA 2WHOA 4PQUA 4RNHA 2RDIA 3DI6A 4JV0A 5KT5A 2DPJA 5D3GA 4G3IA 1RT1A 1MU2B 1BQNB 3IRXB 4TY8B 4DL3A 3MEDB 1TKXA 4K4VA 1T05B 4MKAA 3T5LA 4YP3A 3EZUA 1QE1B 1TKTB 1SUQA 3V81B 3TVKA 3QGIA 4F4ZA 4GC7A 4LSLA 4EBCA 3KK3A 3OSPA 3KLIB 2OPQB 4IH7A 2VA2A 2YKMA 4ED8A 5C42A 1RT4B 4J9KA 4QWAA 2HNYA 4RW4A 4FS1A 2IC3B 3I5CA 3LP1A 1JLCA 1S6PB 4I2QB 1C1BA 2RDJA 1LWEA 5DLFA 2B43A 4OL8A 4ECWA 4ZP6A 1T3NA 1QUVA 3BGRA 2UUTA 4DL7A 1IKYA 2RKIB 3OL8A 2XGQA 4K4TA 3DRPA 2ZE2A 3LP0B 1ZTWA 5KG2A 2FVCA 4ZP9A 2C2RA 2I5JB 5JXSA 3KHHA 3OHAA 3CJ5A 1NNDA 4O44B 2ASJA 4QW8A 2F8EX 4ZP8A 3N6NA 4IKAA 3CJ0A 1D1UA 1C1CA 2B5JA 4LQ3A 2BQRA 2XCPA 3H59A 1HQUB 3Q8QB 3V6KA 4EBEA 5KG7A 3DLGA 2ALZA 1FK9A 4TY9A 5HLFA 4RUAA 4IH5A 1HNIA 2XWYA 1IKVA 5KG1A 3T5KA 4KO0B 1JLFA 3FSIA 1RAJA 3TQ1A 4O4RA 4IR1A 1HYSA 4XPEA 3GV7B 5KFVA 3DYAB 5L1JA 2BQUA 4ECVA 1T94A 4R5PA 4RW8B 4WE1A 1LWCA 5JUMA 3KLVA 3RBDA 4ICLB 4ZHRB 1REVA 4YR0A 1W25A 3KOAA 3UPFA 3PR4A 1I6JA 4MFBA 4B3OB 1JLQA 2AX1A 4QPXA 4XPCA 1JLAB 5HROB 2OPSB 2RF2B 4IG3A 2D41A 3ICLA 3GV5B 1LWFB 1S1VB 4ZPBA 4YMEA 4NLQA 2C2EA 4MIAA 4URGA 3KLEA 2YNFA 3ISND 3H5XA 3BR9A 1NHVA 2HNDA 1S1TA 5J2NA 2AGOA 4ZVEA 1HQEA 2FVQA 3PJWA 2R8HA 3RAQA 3JSMA 5L1IA 3GV8B 2FVPA 5C5JA 1OS5A 1DLOA 5KFUA 1RA6A 2GIQA 3QZ8A 4IFYA 1JXLA 4TQSA 3ITHB 2WTFA 5J2MA 4JV2A 4KKOB 2YNGB 5HBMA 1JLBA 5DG9A 2CKWA 2AGQA 2DPIA 2JEFA 1UWBA 2YNHA 2YKNA 4ZPDA 4NRUA 1XR6A 1FKOA 5F8LA 2J6UA 2JC1A 3TAMB 3V6DB 3DMJA 3LP1B 4TYBA 3NKYA 3SFUA 3RB0A 3LAMA 2O5DA 5F8GA 2C28A 5EWFA 1C0UA 4LQ9A 3PHEA 4IRDA 2IAJA 3QLHB 2R2TA 4IRCA 4QWEA 1JKHB 2W8KA 1RT2B 4PWDB 1RT3A 3MEEA 5DLGA 1RTDB 4O3PA 3IS9B 3M9NB 3GILA 1N5YB 5KFSA 1S1UB 1XR5A 2HNZA 1S1WA 3NBPB 5KG3A 1CSJA 1QAIA 4PUOB 4WYLA 5KFEA 3QGGA 3SI8A 4MK8A 2JEIA 3UQSA 2OPPB 1S10A 4H4OB 1IKWA 2OPRB 3PW7A 4JUZA 2FVRA 3N6MA 1YVFA 4EBDA 3QIPB 1JLGA 3M8PB 5L9XA 1JLFB 3Q8SB 5KFFA 4FBUA 4ZVHA 4G1QA 2VG7A 4O3OA 2J6SA 1S49A 1SH3A 4R5PB 1HNVA 3KLHA 4GC6A 1RT5A 3OL7A 4RW7B 3RB6A 3KK2A 3RAXA 1N48A 3DOKA 3H40A 3CDEA 2D7SA 5J2PA 4O3RA 2R2SA 4TXSA 4KV8A 3M8QA 3BSCA 4Y34A 3LALA 4RNFA 1JLQB 2D3UA 3H5UA 4F4YA 4M94A 2IM3A 4K4XA 1K1QA 3EPGA 1JX4A 1LW2A 1EP4A 3VQSA 4WXOA 5KFYA 4YR2A 2W9CB 3H4BA 4RW9A 2HNDB 1S1TB 3N6LA 3E51A 1HMVA 1LW0A 2YNIA 1GX6A 3V6HA 2FJVA 5CYMA 1VRTA 3KK1A 2IM0A 4EYHB 4QWBA 1DLOB 5KFPA 1ZETA 2QE5A 4Q45A 3MECA 5EWGA 2WRMA 2JC0A 4IDKB 3GYNA 2C22A 5HP1B 3CWJA 3BQ2A 3KJVB 1RTIA 4X2BA 5KT4A 4NCGB 3KLFA 2GC8A 1RTJA 4KSEB 4EEYA 3LANA 4RW6B 2HMIA 5I42B 5KG6A 3EPIA 5L1LA 2ASDA 5K14B 4Q0BB 3MFHA 2HWHA 2HWIA 3MR5A 2ZD1A 3DDKA 5KT2A 1S9EB 4O3QA 2B6AA 2WOMA 5KFJA 1EETB 3HVTA 3FQKA 5KFLA 3JYTA 1JLEB 2UUWA 1U09A 5DQIA 1R0AA 4TN2A 5KFDA 4J9LA 1RTHB 1C2PA 1S9GA 3NAIA 1FKPA 1BQMA 1TKZA 3DRRA 3KLGA 3C6TB 2BRLA 3CIZA 2CJQA 3IG1B 3FRZA 5F8IA 3MEGB 2XI3A 3DOLA 4ID5A 4IFVB 1SV5A 5C24A 2BRKA 3LP2B 4NLXA 3OL9A 2FLNA 5EWEA 1S1WB 4KAIA 4WXWA 2C2DA 4IG0B 4LSNB 5F9LA 4I2PA 3E01B 4MIBA 3Q8RB 3GIKA 5J1EB 4KFBB 1N6QA 5KFCA 1TQLA 3I5BA 4XO0A 4O4GA 1VRUA 3GIMA 1C0TB 1T03B 3NL0A 5KFXA 4TYAA 4J9SA 4NLVA 3PVXA 1NHUA 3DM2B 1TVRA 1JLGB 3DLEB 5I3UB 5KFAA 3M9OB 1J5OB 4WZQA 1KHWA 2BANA 3FDSA 5C25A 4ECUA 2ILZA 3DLKB 1D0EA 5EUHA 1S1XA 3CDWA 3IGVA 4QWCA 4IH6A 2UVVA 1IKXB 3BQ1A 4G1QB 4R8UB 4IQXA 5J2QA 3OLAA 3OL6A 2VG5A 4ED0A 1IM4A 3QO9B 4J9RA 2V9WA 2FJXA 2VG6A 3V4IA 3G86A 4ZVFA 1RT6A 3CDUA 3UR0A 2R8KA 4PQUB 5J2PB 3C6UA 3DI6B 5FDLA 2V0NA 5D3GB 4KV8B 4ZPCA 1S0OA 1DTQA 1RT1B 1KLMA 5EDWA 4DL6A 4NRTA 1TKXB 4ED3A 2BE2A 3G6YA 2ATLA 3I0RA 1HPZA 1N56A 4DG1A 1DTTA 1SUQB 4NLWA 1S6QA 3QGHA 4EO8A 4ED6A 4MKBA 4NLOA 1S4FA 1HARA 4LSLB 4TY8A 1MU2A 1BQNA 3IRXA 3KK3B 4K4ZA 3MEDA 2YKMB 1T05A 3T5HA 5KT3A 1TL3A
chains in the Genus database with same CATH superfamily
3OTOF 1PGZA 2XS2A 2IBOA 3OR1A 4CH0S 5D8HB 1IKYB 3ELHA 3TRGA 4C6AA 3H0PA 2C3PA 3AH6A 2MDAA 4JI6J 1IBLJ 3UWTA 4UY8T 4JI7J 2RKIA 2F9DA 3NAHA 3GIJA 3U1LA 5CCMA 2M4MA 5DGBA 3MMBB 3BBBA 3FBFA 1WC0A 5ETRA 3C19A 4NLUA 3THTA 3LGHA 3J7A1 4FKYA 5LSRA 1LWCB 1REVB 1PKUA 3MFIA 2VG5B 3GP9A 3EYZA 2K1RA 2MJUA 3L9ZA 2FUG9 1U7LA 1P8GA 1R8BA 2DIUA 1XMBA 2DGSA 1Y10A 1RCXB 1R27B 4NYZA 4FP9A 3GIIA 3PR5B 2M5YA 1FJCA 2W1BA 2Q79A 1QTMA 2IAJB 4WU2A 3TAMA 2ZH5A 1FD2A 3MTKA 4ECXA 2QA4G 3UCUP 4DV2F 3J7YU 3M05A 2FC9A 2HRUA 3FQLA 3SCJE 1CULA 2B3TB 4KHRA 3I4HX 1Z2ZA 1B0PA 4EWTA 4DV5J 2GIRA 1WEYA 2GVZA 3CCWA 4CTAB 2YNIB 3TZZA 1VRTB 2KXFA 3GWCA 1KVIA 5ETLA 2OO4A 2UXBF 1XERA 2DJWA 4OZ5A 1U1OA 3DRXA 4U7UK 2DITA 5I3QA 2Z0GA 3QZ7A 4RUCA 2IA6A 1WC3A 4B9MA 1BQMB 5K14A 5D4PA 2BUNA 1K1SA 2OD6A 1N6QB 5T14A 2UUBJ 4DR7J 4EK2A 1TL1B 1YBTA 3D2WA 3HULA 3Q86A 4CWBA 3MGJA 1ZAVA 4KFBA 4NZ0A 2OGUA 3PW2A 4Q7AA 3ENAA 1J5OA 1RT6B 2UU9J 2N3LA 1W2BR 3D6TB 1V9OA 2LKZA 1KLMB 1EIYB 2DO4A 2HK2A 3CJKB 2ADBA 4JI5J 4G65A 4E98A 2DPJA 2HFUA 3IFEA 1UTAA 2QC3A 1TKTB 2V2VA 3V81B 4I1TA 4F4ZA 1GMVA 4OZLA 3QAEA 3QRPA 2HFZA 2JX2A 4R0JA 1C1BA 1LWEA 1FTCA 2ZE2A 5KG2A 2KVQE 3JQMA 1VQ7S 2V63A 2ZHAA 3ILIA 3Q8QB 5KG7A 1ZAXA 4NA2A 2XLIA 5KG1A 1IKVA 2AYEA 2EKNA 4ZCKA 1JJ2R 4UF4A 1RBAA 1L3UA 1KTVA 4RBUA 4BC9A 4BWMA 4DPUA 4PEOA 5THWA 3D0GE 4PPZA 1HBOA 2KT3A 2GIQA 2HZCA 1YITS 1RACB 4TQSA 2WTFA 3RG6A 5J2MA 1X5SA 1DRZA 4YB1P 3KDNA 4ZPDA 1HW8A 2W4DA 5E3QA 3JTPA 2HFSA 5E33A 1REGX 3CMQA 1RTDB 2QJ3A 2W2PP 4QBUA 3M9NB 4DZ6A 3IO1A 1S1WA 2FB0A 3SI8A 5KFEA 2UZAA 1HNWJ 4CNZA 5EGYA 1NJZA 4FF1A 1NK5A 1FDNA 3VGTA 2BZ2A 1OYDA 5L38A 2ZZNA 2VG7A 2J6SA 1JWWA 1P9YA 3KLHA 4JI8F 1YI2S 3R9LA 1JB0C 4XDCA 1W2IA 3ENQA 4CLUA 3BO2A 3CD6S 1EP4A 3CCMS 4ZVPB 4LF8J 4NZ7A 1TZ0A 5SUHA 5KFPA 3A8IA 1HD0A 4M8LA 3UD5A 5K8PA 3KLFA 3M6WA 2R42A 3SYZA 1WTFA 3TNVA 2DHAA 5KG6A 3T1YJ 3FKBA 4BC7A 1RISA 1RU2A 3M32B 3PO4A 4IFVB 4LF2A 1YRUA 2QG9B 2MKKA 3K2YA 1N0UA 2JDJA 3SV3A 2V2ZA 4OFZA 2VPXB 4XO0A 2HSEB 3DCAA 4X66J 3R5BA 2NYIA 2KO1A 2W2QP 3BQ1A 2FJXA 1M5SA 3ZXWA 5D77A 4MAKA 2PD1A 1TKXB 3CCQS 1MWQA 4H4KC 2NZ4A 4EO8A 4ED6A 2E44A 2EFVA 1S76D 2MLZA 3KK3B 3MEDA 1SJ3P 1T05A 2HNYB 2VOPA 4RNOA 5KFQA 5GVQA 5IC6B 5LSOA 4OX9J 3H98A 1GX5A 2HRYA 3ISNC 3LAKA 5IFMA 1Q8KA 2PDAA 4BLGA 1G2EA 1S0NA 2GV1A 2ZM6F 1SJFA 1CJKA 5DO2A 5F9NA 3CO9A 3GR0A 4B9NA 3CD5A 3DC2A 5A76A 4CT8A 7AT1B 2APOA 1S5ZA 3IAM9 1VIOA 4HTIA 1YGYA 3KLEB 4ZCIA 1Q79A 2B9YA 5HROA 2BA9A 3QIDA 3HCXA 4WK1A 3CD7A 4YQWA 2RAQA 2PI5A 4DCJB 2OSRA 2IPOB 3JB9k 4WYWA 3K17A 2UUCJ 1QLNA 4WP8A 4UTGA 1NMEB 1RT3B 4LFBF 1RT2A 2AYBA 4DL2A 1TV6B 3SXLA 4K4WA 2IYIA 2OPRA 1UW9A 4Q44A 2FZCB 2AYMA 3MPVA 2DVIA 1WOOA 4OX7A 3GYXB 3POTB 5A6WA 4RW7A 2O67A 4B9VA 1NDPA 1VMBA 2UXDF 4PAAA 2RJZA 4EO6A 2R7WA 5DQHA 4NEZA 3PYDA 1U45A 2VUGA 3VAGA 2RHSB 1YTYA 1VQPS 1S9GB 5GADU 2ZUAA 2CQ2A 3PEJA 4IR9A 1HHQA 3GTYX 1EETA 3UNYA 1RTHA 4UUWA 1NXIA 4C97A 2XYHB 3NEKA 4IG0A 1I3OB 3NS5A 3HO1A 1FHTA 2JFDA 3GU0A 3AHPA 3OUYA 1QM9A 1WWHA 4U6PA 3PYGA 2KXHA 3A8EA 2WHOA 3JAMY 4DL3A 4KY3A 2VFUA 4L6V3 1YRTA 4LSLA 3KLIB 3CCRS 4LF6F 1B70B 2BKPA 2KI2A 3W2WB 1L5UA 4PRFA 1S6PB 3HT0A 1X7VA 1QUVA 2LXUA 2G4BA 2XGQA 3LO3A 1AXQA 2W25A 1RWKB 1NNDA 1IBKF 1D1UA 1N33J 3V6KA 1AZSB 2YBVA 2IRXA 1HNIA 2MGZA 3OPKA 1M5HA 2C3YA 1NSAA 4WE1A 2Y1IA 2HHSA 3G71S 1N34F 4R25A 4NLQA 1TKDA 3O8WA 2HHPA 3MAAA 3KDOA 4M5DB 2H9ZA 3WC2A 4JV2A 2YNGB 1T95A 2YNHA 1Y11A 2YKNA 1SKWA 1R3NA 1OQ3A 2HURA 2AIRB 1F0XA 4L3KA 1Q8IA 5GMKa 3ENVA 1C0UA 4K0KF 4CP5A 2V50A 2J9CA 3EM1A 1J27A 2QZ8A 1XR5A 2QL7B 3IXQA 2OPPB 3TZXA 3M8PB 4B9UA 3EMTA 3W66A 1VR6A 1ZBTA 2JLGA 3U1MA 3OL7A 2OI2A 2D7SA 3V2UC 2R2SA 3WZ0A 3M8QA 4Y34A 1KRPA 4F4YA 4AT1B 1T9XA 3OXLA 3LOUA 3CCUS 3E51A 5KOXA 2YWHA 1IR0A 3OV7A 4EYHB 2RB7A 1S79A 4DR1J 4DFKA 1N5SA 5GAHI 2WBMA 1V5VA 3CEDA 2V6AA 4KPCA 2MQ8A 5KFLA 5HVGA 4GVBA 3HFKA 2JWNA 1PCAA 3DRRA 2E7WA 3LP2B 3AOCA 4LRAA 2IRUA 2EFNA 4CO0A 4F02A 4MIBA 3I9ZA 5HMXA 5I3UB 4CO5A 5EUHA 1D0EA 1I1GA 1S1XA 3KJNB 3VGUA 3DXBA 3PYEA 5A0YB 1O6XA 1VQKS 4LVOP 1KD1T 4DUZF 2RT3A 4FXDA 4TY8A 2J9DA 4OI0A 1UZDA 4CLLA 3MTJA 3MCMA 1X5PA 1DJ0A 3NS7B 4NLYA 3O6QA 4FPIA 3CCVS 3M4XA 3BEGB 4OYIA 1XWLA 1RSCA 3D3BJ 4Z2XA 2Y1LB 2KTQA 1FK9B 1FI4A 2B8PA 3ULHA 1H3DA 3MM7B 2AD9A 4A47A 1LFWA 1K47A 3N01A 3BBFA 2WW4A 4ECZA 1NPRA 1WC6A 4EI2A 1R0BG 2Z2ZA 4URSA 1AB8A 1M5VC 2BJ1A 8ATCB 4MYUA 3HVAA 2HVZA 3OVAA 2YWEA 1F5AA 1TMJA 3Q22A 2AU0A 2MEWA 3IGNA 2JVRA 5KFBA 4O3NA 3DHXA 4S0MA 3LA0A 2DRBA 5E3PA 4JOUA 4DF4A 1N88A 4WWSA 4GKJF 3NBPA 4YHHJ 1U47A 4DPTA 1X4BA 2XSJA 4H4MA 2Z58B 3CJ2A 3BKFA 4RKUC 2QMWA 2BJ9A 2XNRA 4K7QA 3R7NB 5F8JA 4XK8C 4PXEA 1VGYA 4PKDB 4IQMA 2YX1A 2OAUA 1AA1B 4LT6A 2HKEA 1ZPWX 3M30B 2W9CA 2ZHOA 4HKQA 3AD9C 2N4DA 1HKAA 3TEHB 4ZA1A 3KG1A 2M7SA 3F73A 2P2CB 1QSYA 3BR8A 1N32J 3M1VA 3JYTB 2M3DA 3B4DA 4Q0BA 3DOLB 4NXNF 5G0RA 3JTOA 2DHSA 3MM6A 2NYHA 5LXYA 3PW4A 4LUBA 2N7YA 4EU0A 3V4IB 2Q66A 5FDLB 4RO0A 2VU5A 5FLXY 1Q8BA 2DNNA 2JLFA 2JOQA 3MCNA 3HJFA 4PQUA 1BC6A 5D3GA 4B9LA 2RSQA 3UDCA 4G6VB 2Z2MA 3VR1A 1SUQA 3TVKA 3J81j 2JHEA 3CCSS 1YIJS 2GAGC 3OR1B 4USWA 1PYOB 4A8KA 1UEVA 5C42A 1XJWB 5F41A 3SCIE 2R7SA 1TUVA 5DLFA 1NJIT 3BGRA 3D6FB 4DV2J 2RKIB 3U02A 4GRSA 3AY0A 4OHWA 3X3UA 3KJFB 3HHLA 2BQRA 4TNOA 2XZWA 4H4KA 4HL9A 5HK4A 5JVHQ 1VI7A 3LUYA 2BQUA 1FKAF 3NNHA 2XMMA 2BABA 1JQGA 4MFBA 2H5JB 3GV5B 4B9SA 4URGA 1TUGB 3H5XA 5LT5A 3JSMA 3CT9A 1YLXA 4OHVA 4NMXA 4DSFA 5HN0A 3SBMA 3EGVA 1U48A 3DGVA 1KQFB 1VISA 3TAMB 2X51A 2MYFA 3SFUA 2C28A 1GEHA 2W01A 4LQ9A 4IRDA 4ZVQB 2W8KA 4HHHA 3VAHA 1FRJA 2KH9A 2CJBA 4ZCLA 3UQSA 4JUZA 3MPDA 4N56A 1IR2A 1TL7A 2HVIA 2B7CB 1Q53A 1CULB 4YOEA 1TAQA 2CG4A 1PAUB 1S49A 1SH3A 2MHEA 2IFXA 2LDYA 3KK2A 1SKUB 4CLPA 3CDEA 1I94F 4CNYA 1VIXA 2GVZB 4CLKA 1IUJA 3NCRA 4C2MA 1WI6A 1IXKA 2YH1A 3L4BC 2CFXA 2E5IA 4FF4A 1BE4A 1FWKA 4KPYA 2CPZA 5SZTA 2AEJA 4RUHA 5K14B 3BDPA 3MR5A 3QPIA 4QIEA 4O3QA 5BR8F 4DL0C 1OJ4A 1GMWA 4DLEA 4TN2A 1SBRA 1SV5A 3K89A 4C3MA 3SQGA 2CUYA 3ZZTA 4KFBB 2FZGB 2XQCA 3NP5A 2VDHA 1J5OB 1KS2A 3FDSA 2ZH3A 3W8PA 1S12A 1Q4RA 5J2QA 2DISA 1NK9A 2J8SA 1SC1B 3PX6A 2BE2A 2EG1A 3G6YA 2ZDOA 3CPWR 3K0JA 2RRNA 1RCOB 1S4FA 4BDPA 2LA4A 4WF9Q 1WF2A 1RABB 3OW2R 4DUYF 1DHMA 4RX6A 1C1BB 2XMKA 1LWEB 5LL6d 4TU9A 4J9VA 2ZE2B 3CGIA 4I2QA 3RZAA 5BYQA 4LVNP 2HZVA 5IWAF 4JI0F 3L95X 4DLGA 1IKVB 1CC7A 2MY7A 2XS7A 1NB7A 1JIHA 3VAFA 4DR4J 2H5IB 4LF4F 2CPFA 1H7XA 2LQ5A 2R2UA 1HBOB 3OVBA 4DUTA 5KT6A 1S1VA 5J2MB 3MR3A 5A8RB 4V1Ak 3TZYA 1B0VA 3O3LA 2CVEA 2HPUA 5CZVA 1RT7A 4UOGA 5C7PA 1R8AA 4TLRA 3I0SB 2B56A 3GJSB 2LDIA 3CCJS 1P9QC 4U7CA 3HM9A 2ZC4A 1RAHB 2UV8G 1RK8A 1TU0B 2WVEA 4J91A 1M1KT 1SKRA 2VG7B 3W3SA 3KLHB 3QIPA 4URQU 2GQCA 1ZZNA 4MH8A 2AGPA 3N9UC 1S99A 4WP3A 2W9BB 2G1DA 3H2VE 2DHGA 4MJKA 4ZOSA 2MQQA 1VQ9S 4OV1A 4ELUA 1EP4B 1HBUA 1Q82T 1MSWD 4QU6A 3CJSA 2RUSA 5DM6Q 3JTNA 2W7PA 1ZTTA 3TUZC 2VBYA 4DS5A 5IV4A 2IJNA 4M95A 3ZZOA 1YK9A 1NHKL 4PG5A 4BCAA 5I42A 5KT7A 3BH6B 2FD2A 4YN3B 2VF3A 3AA9A 2FYXA 4ZPVR 4USIA 3IG1A 1R8PA 3HD1A 4AFFA 1OYEA 1ZM3A 5J1EA 1FD8A 2V8VA 1F3VA 1Q78A 1M5KC 2JJ4D 2RDIA 1ZM2A 3MEDB 1T05B 2YPYA 3IWNC 2VBXA 2BM0A 4LBIA 4IH7A 2YKMA 3MURP 4P10A 3N5FA 4FS1A 3TARA 3LP1A 3NY0A 4RPFA 3M6XA 2YPZA 4V19J 3D0HE 1YKWA 4K4TA 3HFZB 3VWSA 5A8KA 4A46A 1B64A 1D9DA 3GJRB 3UW1A 5BYSA 3THVA 1VC5A 4G1PA 2WZ1A 1T7PA 1LEOA 4Z7CA 2NPFA 3MM8A 5K9FA 3PFEA 1FRHA 3GJQB 1T94A 2EBEA 2A10A 4PR6A 2UXDJ 3W2VA 1CBKA 4LFAJ 2GAHC 2EFQA 4QPXA 5HROB 4QPTA 3G96A 2RQ4A 3EJMA 1RUSA 2AGOA 3SDEA 1HBNA 1RTZA 5ITHA 6FD1A 3ZTRA 3QZ8A 4IFYA 3TO8A 2GX8A 3A8JA 4WTYA 1Y9OA 2JC1A 4TYBA 1UJ5A 4GKKF 4QJVA 3IWXA 1CQNA 1RT2B 2BM1A 3K5MA 3MOZA 5DETA 2Z4PA 2OPRB 3PW7A 2XMWA 4ZPWR 3AB2B 1X60A 1DAXA 1FJGJ 4ZVHA 4O3OA 4QCLA 3GMGA 4RW7B 1O0PA 2KFNA 3QT7A 2E7VA 4TXSA 2EBGA 1B7FA 3LW5C 2ZH4A 3EPGA 5KFYA 4AYBD 4J7CA 4LF6J 4LRFA 5CYMA 3SEOA 3CMES 3MUVP 3HKZD 5ETTA 1SL0A 5KT4A 4KGMA 2ZH2A 1QSLA 1XNQF 1IJEB 1FNXH 1X0PA 4FYVB 2CRLA 2KFYA 1IBKJ 3NNCA 3G4SS 5KFJA 5DM7Q 1EETB 3FQKA 2XZTB 2CZ4A 3DDNA 4UOHA 1RTHB 5B0BA 3CIZA 1RAGB 2CNNB 2FLNA 2P5VA 4IG0B 4ID8A 1NKCA 4F4AA 3ZTSA 3J80Y 1UVLA 4ECUA 5HQ8A 1FESA 3OUYB 4QWCA 2E66A 1IQZA 2FHKA 4IH6A 1WC1A 4G1QB 4IQXA 3OL6A 4L73A 2WSFC 1O5JA 2QLJB 5J2PB 1DTQA 1CG2A 1GFWB 2VKZG 3KYLA 4LSLB 1MU2A 2GGPA 1NO8A 5KT3A 1TL3A 5K5MA 4EUVA 4J9UE 1UPMB 2Q6BA 3FJ2A 3PG9A 4K0KJ 2IJFA 4BWJA 1Q7YT 2PA3A 3AJDA 2ZD1B 3C14A 5DGAA 1QVGR 3NWGA 4D3HA 3TEGA 1BHNA 2I5JA 3SV4A 2XEXA 1IWGA 1HNIB 2JFKA 2MMYA 2MQPA 5F0WA 4HHUA 2L08A 3PO5A 3JQKA 3R97A 4AQYJ 1EZZB 2BANB 4WE1B 5U47A 1UVMA 3UD3P 4RNMA 3GQCA 1KTQA 2CA9A 4LBHA 2ZH6A 1NUEA 4OJ3A 2CWKA 4WZMA 3MAAB 2AYGA 1NH7A 3OD2A 2W24A 2YNHB 2YKNB 1H2VZ 4USMA 3OXGA 3P4UB 4M5LA 3UVJA 1C0UB 3TJAA 1FDAA 2XMAA 4ECTA 5CYQB 1BQXA 3QLHA 1VBYA 1UJ6A 2FLLA 4PWDA 1S97A 4WKRA 1X9SA 2E5GA 3A3OB 3D0IE 3UO0A 3M8RA 3DKDA 1LK7A 1XMQJ 4ELTA 3M8QB 4DUZJ 1ROFA 1YHQS 2QTWA 4F4XA 2LU2A 2FY1A 4FF2A 2I6WA 4C0OC 4JV1A 3CDBA 4LR9A 2E1RA 2ZFHA 3MMJA 2G0IA 2YY3A 1MROA 2GZOA 2E9TA 4DQIA 1T9UA 4E2FB 3B6BA 5F8MA 4ED7A 3LH2S 4FS2A 4WPAA 4LIRA 4DI6A 4X4QA 5HP1A 5CA5A 1NM2A 2KM8B 1BWEA 3H5SA 4GVBB 3BO4A 3JS9A 3DRRB 4CLWA 4DF8A 3QBCA 2NPIA 1G3OA 4B17A 3RRHA 4NL5A 3C3LA 1N52B 3BQ0A 3QYYA 1UL3A 2F4VJ 3QT6A 1SQGA 6AT1B 5G4DA 3JSYA 5FD1A 4JI6F 1S1XB 1IBLF 4C48A 3DYAA 4JI7F 3D1QA 2QO3A 2ACYA 4OYZA 4JI4F 5D4NA 4N5SA 3HMJG 2HG4A 2WVCA 2UV8A 5KG5A 3M9MB 5KT5A 4TY8B 4F36A 1K73T 1N5QA 3W5XA 2ZNYA 2PMHA 2BKNA 2R7VA 1YQHA 3N28A 4J9KA 4DSIA 2RDJA 3SSQA 4GKJJ 1D8ZA 1VQLS 2D3O1 4QW8A 3FEZA 2GMJA 4IKAA 1M90T 3H59A 3HLUA 5HQLA 3RGIA 4O4RA 3BGLA 1HYSA 4JI1F 4XPEA 3UI3A 2KB2A 4R5PA 3KLVA 2F40A 1BXNA 4YR0A 1W25A 4AL7A 5GAEI 1JLQA 2AX1A 5B0GA 1PAEX 4C8YA 2D41A 4IG3A 1E6VA 3A8KA 1UZHA 1Q7LB 2DGTA 3WIUA 3EVWA 2NZCA 1HBMA 3D3CJ 3RBZA 4YB5A 1UAWA 1CJUA 4DV5F 4NXNJ 3WIVA 2VBZA 3W63A 3R5DA 2AZ1A 1R6YA 2O5DA 2G0CA 3UCZP 1N54B 4DJBA 2PMZD 2UP1A 3A4TA 3QAUA 1OSCA 2ZWPA 3NBPB 3AB4B 4ZVTB 2XSJB 1N36F 1PG5B 4MKYA 2AJ2A 3C15A 1EKRA 3MMAB 4N7TA 3FK4A 1GH8A 2F5GA 1X4AA 4DR7F 2LP4A 4WU3A 4Z7YA 1PBAA 1NBEB 5T41A 3H5UA 3UD4P 4M94A 4IO1A 2W9CB 4WXOA 2HNDB 1LK5A 1S1TB 2DGXA 3V6HA 1EAYC 2X1BA 3KK1A 2FGCA 4QWBA 3MECA 3OFEA 2V8DA 2H65B 1CQMA 1KQGB 3LANA 4HVZA 2DR7A 3M8SA 4Q0BB 1KDNA 3HVTA 3MM6B 3NAIA 3HP6A 3KLGA 4E0DA 2PEHA 1F3FA 3Q8RB 2IVYA 3NMRA 3DHWC 1A0OB 3NL0A 2GO9A 3H2UB 4CO2A 1HNZF 1JLGB 2VPZB 3UNGC 1EQMA 2KRRA 3G86A 4ZVFA 4PQUB 3PKYA 5D3GB 4KV8B 1T11A 2F8MA 2PC6A 3SCLE 3THPA 1DTTA 1TL5A 1SUQB 2CDQA 1FX4A 2BJEA 1UFWA 5C42B 2XI2A 3RW7A 5HATA 3BGRB 1H7WA 4F7VA 3RB3A 3LWLA 3MCOA 3H7HB 2H5EA 3HHLB 2DCUB 5F3TA 1X8DA 4Q43A 1HI0P 4LIWA 4FBTA 3FBBA 5KTQA 4IO9Q 2BR0A 2WCXA 3E3XA 4UOCA 3RW6A 2V4RA 1I94J 1LXJA 3M8ZA 5DDOC 4FXVA 2HEKA 3WX8A 4MFBB 2C3MA 5GAGU 3ETOA 2XNQA 1D3WA 4EGLA 4CLZA 1GNKA 4ICLA 4KR0B 1RQ0A 4I64A 2WK4A 3JSMB 4DG1B 1JLAA 1U1PA 4DV3J 4C3KA 2EI5A 3KUHA 1MWZA 5K8NA 1P27B 2Z57B 3ITHA 4KKOA 5KFTA 3Q0AA 3JSRA 4B3SF 1YJNS 1SQEA 3MR6A 3TQEA 5D0EA 2QSFA 1N4LA 1TL7B 3T1YF 2LEPA 2W8LA 1SQFA 1AUSL 3QSYB 1SKSA 3KK2B 5KFKA 2IVFB 8AT1B 3FFIB 1OO0B 4X66F 2QV6A 2KZZA 1NAQA 2IYGA 3PHTA 4DUYJ 4W4MA 4OZJA 2F9JA 1BD6A 3KG0A 3I9V9 4OJGA 2F4FA 1NSKL 2Y1RI 3PEHA 3KJVA 2LQJA 3UR3C 5IWAJ 3DRSB 2P9CA 4JI0J 2KJVA 2DNZA 1WEZA 5LSLA 2G2YA 2M0GB 3SQGB 4NE9C 3VAIA 2PE8A 3UE2A 3IN5A 2DGOA 1LQ9A 4LF4J 4KH1B 1Q5VA 2QLWA 2YWFA 4C8LA 1S6OA 4NLRA 4CO4A 5J2QB 2XO7A 2BE2B 4O3SA 3QJJA 2JNJA 3DXSX 3NCQA 2DGVA 2MSSA 3P96A 2MQOA 1UVJA 4RW4A 3I5CA 4I2QB 2QSWA 4ECWA 1U0HA 3NXZA 4DX8H 3H20A 2VODA 3K57A 2M2BA 1ITPA 1JNZB 3T9NA 1U8SA 3VHQA 4FXWA 2RRBA 4LRBA 2ALZA 5H1SV 5ETSA 3GLJA 2D69A 4PG7A 1RAOA 2FLOA 3EZOA 4ALZA 3F56A 4ZVOB 4XPCA 3MMCB 1S1VB 2FPHX 1YJ7A 1HQEA 2FVQA 1G4CA 3MPYA 2KG1A 5KFUA 3T9ZA 2CKWA 2YX7A 3D9BA 3ONQA 3QT8A 2DK2A 2CNKB 1UVIA 4DFMA 2VDIA 3J7YI 4O3PA 1UMJA 2ZBQA 2MSTA 3CULA 2J5AA 4DV7J 2V2QA 2NREA 4IUFA 2PFDA 5LOQA 2LYVA 2NUHA 3QIPB 3NG8A 2HAFA 3QATA 4U67Q 3C16A 1HBUB 1RBOB 1T9VA 3PRDA 4W90B 4ZIWA 4LF7F 4K8RA 1HMVA 1LW0A 1MN7A 4PWWA 4B3TF 5CD4H 5B0CA 2VZ9A 5JJBA 2QE5A 4PYAA 1VHIA 2C22A 4X2BA 3UN2A 5HSPA 5I42B 1KLNA 4DXLA 2WOMA 2YKPA 4J9LA 3J81Y 1FKPA 2CQ1A 3IG1B 4NLXA 4U8YA 5EWEA 4I6YA 5J1EB 3RR8A 2HS4A 4A8YA 2A18A 1C4CA 3GG1A 2BW7A 3TI0A 2R8KA 3AXKA 4P73A 2V0NA 3I4PA 1X4GA 4NRTA 4KJIA 2LXFA 2YTCA 1UW4A 3W9IA 4OZ1A 1QUPA 4ZLPA 2YKMB 1HI8A 1TFWA 3CC4S 4GKKJ 3MPUB 2EFOA 2OPQA 1CJTA 5A8KB 2KG0A 4CM2A 4FNHA 3NGSA 4I7FA 2VFSA 2HAIA 4P6QA 2HHTA 4O44A 3MM8B 1WF1A 3NWRA 2DRAA 4V19X 4C11A 2KZMA 1ZYQA 3W2VB 4CT9A 4RUBA 1FXLA 4ERDA 2B9WA 3G6VA 2BXJA 1NDCA 3G8QA 4ZHRA 3SDEB 1F9HA 3PZPA 4IFYB 1XNQJ 4PG6A 4RJVA 4PXBA 1F9FA 4MMOA 4QIFA 4K4UA 4A48A 5GMEA 4QYZJ 1XR7A 5KFHA 1KOOA 2FHJA 2BJ3A 2HYIB 3V6DA 4Y3CA 2WONB 1RADB 1YJVA 4NLGA 4DR1F 4FNIA 5M2RA 3D5MA 1N5YA 4MK9A 2HQ3A 4ZN1A 2X3GA 1XEZA 5ETOA 5ETPA 2XMUA 3WHIA 2UVWA 1FXRA 2G1HA 5HJXA 4WFZA 1WG5A 1U8WA 2IBKA 3NGDA 2HGNA 1Y5LB 3CCTA 4BHQA 2F65A 3SMZA 2J9EA 2BE7D 5CYMB 2CJ9A 1Q5YA 3CCES 1NJWA 2CPEA 2Z2YB 3FUYA 4ZVSB 2KRBA 4F50A 2B9EA 2ZJQQ 1NJYA 1KFSA 1TP7A 2R7UA 1SCJB 4WCEQ 4RW6A 1VLYA 3H4DA 1Z1ZA 4USHA 4WTOB 1JLEA 3CDAA 1RDRA 2B4PA 4JBCA 4LSNA 2AQ4A 4WFXA 2CJYB 5KFZA 1FVQA 2RQCA 2DNQA 1UFKA 1GXUA 4J9OA 1DTQB 2IDLA 1KNZA 5E3RA 1QVFR 5A2QU 3OFFA 4TU8A 3EZ5A 3MWBA 2W7OA 5F8NA 1MU2B 2GGPB 2Q43A 2QFIA 5B09A 2CAJA 1WSRA 1U2CA 4EBCA 3GE9A 1NPPA 2WVBA 1Y5IB 3BGUA 1FXDA 3C14B 2B43A 1OIAA 4P52A 3HHLD 2RILA 3PTWA 2GQ2A 2I5JB 3BYRA 4LF9J 3DOMB 3CJ0A 2B5JA 5CHCB 2XCPA 1SIWB 2CVIA 1JLFA 3M8WA 1AYEA 2R7QA 2ZBPA 3BKTA 2EW9A 1I6JA 4YHHF 1RBLA 1WI8A 4MIAA 3GZ7A 1ZH5A 3ISND 2QMUB 5HMZA 4ZVEA 1N0VC 3ISZA 2O66A 2FVPA 2F8HA 5HANA 2BX6A 3R5GA 2M9KA 3FNNA 3UVJB 2QLXA 2ZH9A 1RWVB 1U6ZA 1FKOA 3LGMA 3K5LA 3QLHB 4IRCA 1VQNS 4HTJA 2OD4A 3K5NA 4PWDB 1HL6A 2OTLS 3GILA 5BXIA 2CQGA 2LQBA 2QLFB 1WHVA 1AT1B 1S10A 1N32F 2FVRA 4JI4J 2LVWA 3PNIA 4JP8A 1RGVA 2B7BB 2FIUA 3L09A 2HLUA 4WFAQ 1GTEA 3GFZA 1FJ7A 3O1LA 1FTRA 1V6HA 1PYTA 1MROB 5A6PA 5GADI 5IC4B 3OTBA 5D15A 5HP1B 3BDEA 4LBPA 1PO6A 1RTJA 1TR0A 2O3DA 4F3QA 1GMWD 1TMMA 3E2EA 3WBZA 1HQ2A 1IBMF 1N5VA 5D0GA 1RAIB 3OR2A 5C24A 2BRKA 4JI1J 2C2DA 3GIKA 4FVCA 2BJ8A 2GW8A 2ZH1A 2DCLA 3HPOA 1YJ9S 3C66A 3BM7A 2VG5A 3TW0A 4ED0A 4M5NA 2VG6A 2CPDA 3SZ2A 4EFAC 1FFSB 3MEKA 4MKBA 3GCXP 1DQ9A 1TL4A 3DLLQ 2Y0BB 5HAOA 1QE1A 5HJYA 1SC4B 3TOQA 4ES2A 4NCBA 2IC3A 4GO5X 1B7YB 4I6AA 4P71A 1N36J 4IRKA 2OEMA 2H48B 4Q2LA 2YWGA 3OTEA 1S0MA 3PX0A 1B3TA 4PQAA 1HYSB 3O2IA 2CPIA 2DXEA 2V8PA 1SJQA 4MIWA 1NPKA 2DNKA 1H73A 4NLPA 4A8WA 2GVDA 2NXCA 4OYWA 1UA0A 5DG7A 4IG3B 1E6VB 3RBEA 3SSSA 1HBMB 4XDDA 3FZ2A 2RF2A 1LWFA 2NSBA 2AJQA 2R8GA 2DH7A 3FEXB 1CJUB 4C9DA 2NR0A 2C1EB 2R2RA 3HVWA 3ET6A 2I0XA 4FVMA 1CLFA 4BBYA 4WFYA 4KYZA 1NSPA 4LRDA 3ZZYA 1HNZJ 4FZVA 1TL1A 1Q8LA 5C2GA 2VH7A 4RU9A 2HQCA 2VFVA 3G6ES 2XMVA 3MAQA 3Q8PB 2AJFE 4ES1A 3P6YC 4NLTA 4U95A 2D9PA 2LCWA 1B99A 3MCSA 3KK1B 2W2NP 2CQ3A 3MECB 3CD0A 2RRAA 4Y2KA 1TFYA 4A8MP 4ZPAA 4C8KA 1O8BA 1XK8A 1HR0F 2LU1A 2HHHF 1BUXA 3MM9A 3HVTB 3BH7B 6FDRA 1ZOTA 4IOBA 3KLGB 3KHRA 2O01C 2PGCA 2QA1A 2O1PA 1Y5NB 4DR3F 1SH0A 1MWYA 3CIMA 2RMLA 4PZVA 1JNRB 1E6YA 5KFGA 2C42A 2VA3A 1RI7A 2DGQA 1R43A 5FLXU 5E5NA 2QFJA 3DLEA 4ED1A 2BYCA 1SJRA 3DLKA 7FD1A 4LR8A 1QJHA 3IP0A 2HGMA 4MKVA 3EX7B 4CQ1A 1RT1A 4DR4F 3GFXA 3EZUA 1RT4B 1G6BA 1VOMA 4B3SJ 2V4JA 4DQRA 1Q16B 2HHVA 4ED5A 2C2RA 3GG0A 4KIAA 2ASJA 4RR5A 3FCWA 1C1CA 2EFGA 3AA8A 5IV3A 3Q24A 4JI2F 2E1AA 4ZK7M 5JUMA 4HACB 4ICLB 1PSDA 3PR4A 1LKZA 3GONA 3PXGa 1JLAB 4DSKA 3IBFB 4ZJQA 5L1IA 3GV8B 1X4FA 2XLKA 3ITHB 4KKOB 4B3MF 2DTJA 1CS4A 1AW0A 2XHWA 2CQHA 2PIIA 3VZIA 5F8GA 3KNGA 1T8EA 2XWXA 3M32A 4QWEA 4DQSA 4DR6F 3JSBA 3IAS9 2YKOA 1ULRA 5DJBA 1YRXA 2GNKA 4WYLA 1NDLA 4FKXA 1RHRB 2MZQA 4EBDA 4CLFA 2PMWA 2CJKA 3FMBA 3CJRA 2RQKA 2GHWA 1RB0A 2K06A 2D3UA 5EHHA 1K1QA 3QMQA 1P1TA 3TANA 2NXJA 1S72S 1PJ6A 1DLOB 1ZETA 3FEYB 3K58A 2JC0A 3GYNA 3KJVB 4DX6A 2C2ZB 3VAJA 3HT3A 3MFHA 2HWIA 3DDKA 2ZBCA 2AJ1A 5KFDA 4ZIVA 4ETZA 2BDPA 3G9CA 4ETXA 4X4SA 1U49A 3VAKA 4I2PA 3WX4A 1W26A 1TQLA 3M9OB 2IY5B 3QNWB 3IGVA 1RWUA 3U7JA 3W9JA 4DV0J 1XMOF 1YSJA 5E0OA 2CQPA 4M63A 4HH0A 4DR2J 3R7BB 1MN9A 1WHYA 4DL6A 1M5OC 4CO3A 3I0RA 4B3RF 4NLOA 1HARA 1EQ0A 1BQNA 3IRXA 4N47A 4I67A 3N6MA 2D3ZA 4LFAF 4RW4B 3M2RB 2AWZA 3FCVA 4I56A 4ZLJA 1U0HB 2BOAA 2R8IA 3BV8A 3AXMA 3D67A 1H6KX 4X4VA 3BKUA 4ZP7A 1TV6A 3QJPA 2RIJA 2VB6A 3BYPA 2GCFA 1YWXA 3Q8VA 5F0UA 2NLWA 4ATNA 4LF7J 4B3TJ 1HQEB 2RUGA 1FJGF 1X5TA 3IWLA 4UZCA 5KFRA 2OFGX 5AE1A 3T5JA 1JXVA 2KYZA 2VQFF 2I9SA 4HYKA 1WTBA 4X4OA 1FRMA 2DR9A 2DR5A 4F3OA 1DZ5A 1VQYA 4DHVA 4OI2A 1VS3A 3C8YA 1ZM4A 3I5AA 2MLXA 4OYBA 1T02A 2CDRB 1BY9A 2CWXA 3BGOP 2GJ2A 1HMVB 1LW0B 4GO7X 2OIHA 4NLDA 4OHYA 1Q86T 2XY7A 2AX0A 4RNNA 4Q8FA 1WELA 4NX9A 1YJUA 2WOMB 3BF4A 2FHOB 4PWUA 3T6JA 3CC2S 3IR5B 2J7WA 4KBIA 4AL5A 1H72C 1P1LA 4DOZA 4TLQA 4OHXA 2KL8A 4DCPB 4WK3A 4ANCA 4OIXA 1R6VA 1T03A 1L3SA 2ZVIA 1X9MA 1NJXA 3MXHP 2PN6A 1H98A 1TUWA 3R6LB 1IKXA 3D4JA 4NEYA 4QQBA 3QO9A 1U4BA 1UVKA 2VPWB 3OQ2A 3HF5A 4AQYF 3TA2A 3EVOA 2P6TA 3KTQA 4N8OA 4M5DA 3FZBA 3VGSA 2OPQB 3TVYA 1RHUB 3J7Z5 4QR0A 1CJTB 2GJFA 3DLJA 3K7RA 4NI2A 4ZCMA 2AMCB 2Z8QA 2OEJA 1FX2A 4K2XA 3LP0B 1ZTWA 4O44B 3IBWA 1KN6A 4ILMA 1QD1A 4C11B 1H0HB 2CJXB 4TY9A 4IH5A 2DNHA 1HHSA 3GV7B 4C8MA 4OJHA 5L46A 1X0FA 3AODA 3T1HF 4ZHRB 2ATCB 2V2KA 2W2MP 5L39A 3KOAA 3OFHA 3MZIA 2MQNA 3BBCA 1XMQF 1IM6A 1T9YA 3F0NA 4EZ9A 1SC6A 5DG9A 3AJ2A 2KFZA 3CC7S 1YDLA 5I4MA 3V6DB 2D74B 1FDBA 2YKAA 4HDHA 3LAMA 2N82B 5MLCV 5LMUF 4PPDA 3MEEA 5HVFA 5DLGA 1N5YB 1CSJA 1QAIA 1H74A 2DNMA 3R3TA 3QWUA 2HW3A 3PV8A 4OYOA 3VGVA 1RT5A 1N5TA 2F4VF 4X65J 2AT1B 2I8EA 5LMNF 2EK1A 2VQEJ 1KQKA 2CQIA 2FJVA 4N76A 4KGXB 4P2MA 3ZZRA 3BO3A 4C4WA 5EWGA 1XN9A 1DFDA 1ACMB 3CWJA 1Y00A 1RTIA 1K0VA 1XTZA 2ZEJA 4RW6B 2ASDA 4NPOA 5KOWA 4EZ6A 3GIRA 2DNLA 5KT2A 1JLEB 2UUWA 4OYPA 4A8QA 3VALA 1C2PA 4FYDA 5DZ6A 3GJTB 3TUPA 4ID5A 1WDTA 2ZC3A 4QYZK 3E8OA 4ZJOA 1NK0A 4KAIA 3W1YC 4LSNB 2RE1A 4GMKA 4O4GA 1VRUA 2DY9A 2XBPA 2G0JA 4NMLA 1NHUA 5GMDA 2DKOB 2BEFA 2HHUA 4QIWD 3CDWA 3AD8C 5EX0A 1IBCB 1R31A 3GCWP 3C6UA 4UY85 5B7WA 3OJUA 2QA2A 2A2CA 3QGHA 1FRLA 1VBXA 4U9RA 5E7OB 3A3PB 2L9DA 4O0IA 3T5HA 2B0GA 4F2SA 4DN0A 4J9MA 2HVEA 4LSZB 1U2FA 4ZVUB 3DLBA 1W7WA 2FJWA 3I87A 1DBDA 2B5JB 3L7OA 3BS9A 5IS2A 3EGWB 3U1NA 3PCOB 4F0HA 3L7PA 4YUDA 4I68A 4AXIA 1VQ5S 2UXCF 3N5BA 1PC4A 3DRYA 5KG0A 1RWMB 4YS2A 2LMIA 3A1YG 3BREA 2MKIA 2OSQA 4RW8A 2JEGA 2I1RA 2HS0A 2ZZTA 3W5ZA 3C46A 3AAWB 3R2DJ 3M30A 3TA0A 2XMTA 4M5IA 4KRWA 3TAPA 1FKOB 1RLCL 4DMZA 1IBMJ 3AT1B 1HI1A 4YB6A 1S7HA 3B82A 3M6VA 4NA1A 1VFJA 3QJLA 1KHVA 1OQ6A 2P8IA 1B4SA 1KKHA 5D6GA 4KE5A 2HBQB 3ZFVA 1MMDA 5IT9U 1YBAA 1JMTA 1NU4A 2E9RX 3BPSP 3ZNUA 2MPUA 4DX7A 4WJBA 1FF2A 5KG4A 4TKTA 3LF0A 4ANDA 2K1RB 5DQGA 5CZXA 4QW9A 3ENWA 2AW0A 2C2MB 3JQJA 3C2PA 4ECRA 2VL1A 3SFGA 3HJVA 3HZEA 2IHR1 2ERRA 2KVIA 1S77D 1RTJB 3T1AA 3TX8A 2E1CA 4ILRA 5KFIA 4IDKA 3PACA 3WQPA 4DFJA 1A9NB 2VFTA 1EKSA 2XGPA 2ZOFA 3OR2B 4XTTA 5C24B 1UA1A 4WKYA 2ILYA 2AF6A 3Q83A 1OY8A 3KG4A 1SL2A 3MEGA 5ETNA 1RWPB 3E01A 1C0TA 4RBVA 5DDRC 2VG6B 1UETA 1QDUB 5LJ5Y 2DD8S 3HZGA 2HIQA 4JV0A 1CC8A 2QN6B 3HSJA 4K4VA 4CIOA 1X4EA 1ZPVA 3T5LA 1QE1B 1L3TA 1RKJA 1X9WA 2KT5A 5K20B 3OSPA 2NXNA 3LPYA 4ED8A 4JI3F 1Z2LA 2AHOB 2IC3B 3DU5A 2X3DA 2KYXA 4C8ZA 2L48A 4DV3F 2Z2LA 2DGWA 4JB8B 3DRPA 4ZP9A 5JXSA 4CI0B 2DO0A 1D09B 3NOCA 3IM8A 4KH0B 3W60A 2EC2A 3CW2C 3VCDA 5CXTA 5HLFA 4RUAA 2KM8C 5F3ZA 4X64F 3CJQA 2GVDB 2HK3A 1GXTA 1WACA 2QRRA 3VZHA 3R1LA 2RF2B 1LWFB 2PA8D 1HR0J 5J2NA 2NSCA 2XS5A 3RAQA 2HHHJ 3Q8UA 5C5JA 1UKUA 1OPZA 5HBMA 1JLBA 2JEFA 3MOJB 3ET6B 4DR3J 3DMJA 1BMQB 3I56S 4UQTA 1J2VA 4ED4A 1J5EF 4M5GA 1G7CB 1R7IA 5KG3A 2QYCA 3I6PA 1VLOA 2PI4A 3PX4A 1NH8A 2QX0A 2SXLA 3ZTPA 4DPWA 1RHMB 1O51A 4RNFA 1LW2A 5L8RC 3VQSA 5MAOA 4ER8A 4DFPA 2V8HA 2K2PA 1S59A 3BQ2A 3MM9B 2QIFA 5HL7Q 2GC8A 1UPPA 2AZ3A 4USUA 2B8QA 4B02A 4DZDA 1WKKA 2B6AA 2A6MA 2EVZA 3AFGA 2F7VA 2HBYB 2VD3A 1E6YB 4JI2J 4IOAQ 2OMLA 1S1WB 3CTRA 3GIMA 1RAEB 3VAMA 4JYAF 4P9SA 3DLEB 2KDOA 4DV1J 5C25A 1F6TA 4LF5F 4TU7A 3DLKB 1BWVA 1EARA 8RUCA 4OYMA 3HDSA 2V9WA 2ZBRA 1K44A 2OUGA 2FTRA 1RT1B 3PIPQ 2ATLA 1S6QA 3PIOQ 4B3MJ 3MPWA 4U96A 2D9OA 5A8RA 4IOCQ 2ASLA 4HH1A 3A12A 4XIUA 3HKWA 2V4JB 4KHPF 4CZCA 4ZPTR 2K7JA 4DR6J 3BZQA 3KLFB 3ILOA 1WSVA 1RAAB 2K7KA 2N3OA 2JL9A 1SPBP 3TP2A 3I0SA 1C1CB 2F63A 1FO1A 1K8AT 2YQ1A 4MK7A 5JMNA 4CLSA 2VFRA 2W9BA 4DV7F 2ROGA 3R6GB 3VV2B 3S7RA 2P9GA 4PABA 1RYSA 3Q2TC 1CS4B 1X4DA 2Y0SD 2FHJD 4K5SA 3LWMA 1VQSA 3R5AA 2HHQA 4AE5A 3PW5A 1FCAA 3ZO7A 1WOSA 1T9WA 2HRTA 1XMOJ 3R7SB 2ZH8A 1CJKB 4H4OA 4OI4A 4K59A 3M7VA 3HHLC 4B3RJ 2JSXA 4YR3A 4OHZA 4ZVRB 2MKYA 3K5OA 1H2UX 2QL9B 2UUAJ 4DL4A 3A13A 3MF5A 2XY5A 2V9KA 4UZBA 2CNLB 1GT8A 1Q1KA 4DBQA 1JJCB 4OYXA 3KNAA 3OLBA 2WBRA 2ZKUA 2G9OA 4RZRA 3K59A 4NCGA 3AOAA 1KSPA 2RQMA 5D4LA 3R8YA 4I2PB 3ZC4A 4NYPA 2W4CA 2HQIA 2U2FA 5D4OA 3I31A 3PJXA 3X1LB 4DEZA 3DM2A 3JXOA 3CXCR 2HVDA 3HHKA 1JJ4A 4LFCJ 3I0RB 2WVDA 3ADAC 3UN5A 3DI6A 5HO4A 1VCTA 1BQNB 3IRXB 3G2XA 1Q81T 3O44A 2VQFJ 2POKA 2L9NA 3DFEA 1RZMA 3NGRA 1DQAA 2G2ZA 4O0NA 1V3SA 1AROP 2RVJA 2IMOA 1JLCA 4OX6A 1X4HA 1T3NA 3OL8A 3OT9A 3OHAA 4Q2MA 3VVUA 2Q1LA 5GAGI 1LWXA 3SSRA 5AXKA 1EJ7L 1AUDA 1GK8A 1VRQC 4DR5F 3SCKE 2EG2A 3S1TA 2DR6A 3M2UA 1FA0A 4K4ZA 3ICLA 4X4PA 2C2EA 4ZPBA 4YMEA 4C0BA 4FN5A 3AQOA 4KC5A 3UFCX 2XMJA 3NOGA 2CQ0A 1OS5A 1PYSB 2C2NA 2DXDA 2GHVC 1U2RA 4QIGA 4B9TA 5F8LA 2J6UA 2RD5C 1SJ4P 3RUBL 5EWFA 1F2GA 1VQ8S 4USJC 1RXOB 3PM9A 2HNZA 5D78A 1AFJA 5B08A 2VASA 2EXUA 1YVFA 2HFVA 4PXDA 5J1PA 2IA0A 2MGZB 3CJTA 4G1QA 3KXDA 1UWAA 1ZZFA 2JH3A 3W65A 2OLWA 3D68A 4GC6A 1KVKA 5J2PA 5DRKA 5A2QY 1K0TA 4P7VA 2DH9A 2J9DE 1Y3JA 2ZJPQ 1KEKA 2GA7A 1V3RA 4K2JA 3IR6B 4L72B 3I55S 4CCHA 3TJ8A 4DSJA 1VYAA 2HWTA 3IMQJ 3J81U 3HVRA 3FCHA 2ZD1A 2ZJRQ 1U09A 2ASYA 2QT7A 2DYAA 3FRZA 5F8IA 4NCAA 2QEXS 2H4WB 3I5BA 1T03B 3AOBA 3T1HJ 5KFXA 3PVXA 1VQOS 3QT5A 2BANA 2XG8A 1U0SA 1IKXB 4LF9F 2EK6A 1IM4A 3QO9B 3R5CA 1N56A 1KR4A 2WW8A 1FFGB 1KQSR 4U8VA 1RKIA 2X1GA 4NI2B 4EMDA 5LMUJ 2IMWP 5CYQA 3FSYA 5KFNA 4L76A 2FLPA 1R89A 4DWIA 3NCPA 2YWKA 2XC9A 2OTJS 2ADCA 2V4QA 5H9FJ 3VVTA 5AXNA 2DEIA 2J0XA 1NK6A 1HD1A 5M2UA 1FE0A 4QZVB 5LMNJ 3OHBA 2PSZA 2COLA 1TELA 3T19A 4DU7A 2R4FA 2N7CA 5EX3A 2J0SD 1LFPA 2JLEA 1RWWB 3CB4A 3UDVA 3TJ9A 2XHCA 1F1BB 3PRVA 3NMAA 2MKHA 3GSIA 3W7BA 4HLBA 1NSQA 2MJNA 1N8RT 3H8YA 4F0KA 5K8OA 1FJEB 3MEEB 4Z37A 4A8OA 1P6TA 1JKHA 3V6JA 2FZKB 1S1UA 4PUOA 3BJYA 2HLTA 1ZM9A 2WB4A 3D66A 1RT5B 3EUNA 4ENOA 4DPOA 2EFPA 3CUNA 5HVHA 4N77A 4RU2A 2ALYB 2W9AA 4Y2IA 5FIIA 1WUUA 3S8SA 3OBIA 3KHLA 3EE3A 2HZAA 1GQEA 2PT0A 1D9FA 2UVRA 1IJFB 5L1KA 4L3NA 2VHGA 1U1QA 1RTIB 4JV5J 1Y0HA 1M1GA 4PG8A 2HHWA 3P5TL 5E3AA 1VQ6S 3K8VA 4QWDA 4A8XA 1IWAA 2P6SA 4ID5B 3NGKA 4DSEA 2UXCJ 2X7IA 4DU8A 3ZTQA 2GHPA 4O4GB 1VRUB 1ZA2B 2E7XA 1WORA 3P8BB 1L3KA 2XSFA 3Q2SC 5CD4A 4H4MB 1NB2A 3C6UB 2HQFA 1HA1A 3IR7B 3MUMP 4KT0C 2HVHA 4H54A 2M52A 1TK0A 1U1NA 2MZJA 5B0AA 3QGIA 4LRCA 3ZZZA 4FDFA 2K3KA 2L3MA 5B0FA 1T9TA 1HNXJ 3P3DA 4DN9A 1KWMA 4RLEA 3M1VB 4RWWA 4AL6A 5G0RB 4DCOB 4WIQA 5L9NA 4ILLA 1VC6A 3N6NA 5AE2A 3U27A 1V5IB 5ETKA 1NZ8A 3MMAA 4L74A 2VONA 4IR1A 3B78A 4QR2A 5KFVA 4RW8B 2LLZA 3RBDA 2RU9A 3W64A 3UPFA 3OTOJ 2FGOA 2FJDB 2CQCA 2DR8A 4X62F 2W7AA 2YNFA 1NHVA 2HNDA 1S1TA 2EKYA 3PJWA 2FJEB 1WC4A 2HFNA 4OX8A 3G82A 2DHXA 1UWBA 1CJVA 4Y2MA 4G1IA 1NK4A 1RP5A 1UEKA 1S4EA 2R2TA 3AJ1A 1KOHA 3EVMA 1M0SA 1RU1A 3TR5A 2V94A 4DPXA 4RBTA 1JLGA 3Q8SB 5KFFA 5KAKA 2H4YB 3UN3A 2J7KA 4O3RA 4KV8A 2IRYA 2IM3A 1JX4A 1NK8A 4RW9A 1FWLA 4JI3J 5LM7E 4Q5VA 4Q45A 4WBFA 2WRMA 4IDKB 2OEKA 4USVA 4F25A 2HMIA 4OZ2A 4FYWB 2VC1A 4HR2A 4KGVB 4NZ6A 1TK5A 1NCLA 4ZJLA 1R0AA 9RUBA 1TKZA 3MEGB 5B0DA 4X64J 1DURA 5E41A 3E01B 2OELA 5AT1B 1C0TB 2B4VA 3F41A 1TVRA 3OTDA 5KFAA 2AJ4A 2DNOA 4X4NA 2MXYA 2UXBJ 4YB7A 3LQVA 2NXEA 1QTNB 2JZ5A 1NEEA 1HPZA 4DG1A 1IQTA 4J9PA 2VPYB 3G8SA 1IVZA 2X1AA 3TYTA 1J5EJ 1U1LA 3KHGA 3HHDA 3DRPB 5DZ7A 3H25A 3D6MB 3T41A 4HT5A 2VJVA 3O5TB 2GJIA 3DNCA 4ED2A 1NLKL 4J9QA 1SV5B 5HLFB 3PDNA 3DDIA 3BB5A 5A8WA 2E5HA 1HQUA 4NOHA 4QOTA 1MMNA 3NNAA 1RA7A 3ILJA 2M8HA 3W9HA 2XTJP 3FFIA 1S57A 1XQIA 3Q23A 3GR1A 5J2NB 1ICEB 4NA3A 3EGNA 2I38A 4CLTA 4R0EA 4WFBQ 5D0HA 1YJRA 2BQ3A 7FDRA 4UW2A 5H9EJ 2QA4S 5HBMB 1JLBB 3D7SB 2MQLA 3KMSA 2XCAA 4Y0FA 3DMJB 2FDNA 1UEUA 1ZS6A 4KGZB 3CVKA 3DRSA 1GAOA 2H1YA 2V34A 5CAAA 1H38A 4JYAJ 2VC0A 1MMLA 1GMUA 4I0WA 3LTOA 4LF5J 4F2RA 4ECSA 2GQQA 1DY3A 3I96A 1I51B 2Y8WA 4Y65A 4P74A 2E5LF 2CPHA 3ILLA 2ABYA 1DQ8A 1LW2B 2FVSA 1RHQB 1EX8A 4KHPJ 4DL5A 3M8YA 4DV0F 1LOUA 2VV5A 2YWWA 5KFMA 2CPJA 1Q95G 4A8SA 3PY8A 2AV5A 4DR2F 1SB6A 3DGPA 4USTA 1XC9A 3GB0A 3UDLA 1WD6A 1UCNA 2B6AB 3OVSA 4M5JA 1RT7B 3QGPA 3M6UA 1WKJA 2QGFB 4JI8J 3C6TA 5GAHU 2HHXA 3PFOA 5C25B 3BSAA 1IN0A 3H2LA 4OZNA 4Y2CA 4OZ3A 2ZOGA 1Z4UA 3GFYA 2R7RA 3MD1A 3SIPB 4F4WA 2VIHA 3MMCA 3T6BA 1S6QB 4G3IA 3HHNB 2RS2A 1D9AA 2G13A 1TTHB 2CQDA 4MKAA 5IQ6A 2KT2A 2HGLA 1R8HA 4A8FA 3KUGA 2M88A 5IM0A 3NS6A 1MNEA 1U25A 5IXUA 2MY8A 1YBUA 5CH7B 2FVCA 1HW9A 2D3OR 4B08A 4ZP8A 3OTCA 2IJRA 4LQ3A 3DLGA 5DS7A 2JVOA 3TQ1A 1HWIA 2E29A 5LXRA 3RR7A 2NXUA 1URRA 3KUEA 2I2YA 1KP6A 4DV6F 2E9ZA 1NK7A 4UT4A 3BR9A 1EHWA 4F26A 4U7UD 3MAHA 3CJ8A 5AJ3F 3MM5A 2Q3PA 4M5KA 5CABA 1VC0A 1HLWA 3LP1B 3EGZA 3FRYA 2MB0B 2ZM6J 2A2DA 4LREA 4W98A 1S7IA 4M1KA 5DDPC 4DSLA 1F2HA 1NKEA 3QGGA 4H4OB 1IKWA 2QYGA 2R9LA 2NS1B 4PG4A 2Y8YA 2A3JA 4CO1A 4FBUA 1PIEA 1T0TV 4YY3F 3PRBA 1HNVA 2V8GA 3D1HA 3DOKA 1A6LA 2ZUGA 1HWJA 3CCLS 3MI7X 2OHDA 2XLJA 2CXEA 2LECA 1XNRF 1WG4A 2VBWA 2WSCC 1HBNB 1GX6A 3HX9A 3T3FA 2B4UA 4LFBJ 3QFWA 3L3CA 4NCGB 2M8DB 1S6UA 5IT0A 5L1LA 3KWMA 4A4JA 3UCGA 2V69A 2HWHA 2CQ4A 2N4CA 4NYOA 2YQ3A 2UVUA 3D6HB 1KBRA 2BRLA 4WIIA 1TAUA 5IT4A 1WNEA 4NXMF 4DR5J 3DM2B 1HHTP 5ETQA 4WZQA 2ILZA 1PJ7A 4CYUA 3IBCB 3CDUA 3DI6B 2RHQB 3ZTOA 1S0OA 4ED3A 5CQGA 5T7LA 2LQ9A 2DH8A 4L75A 2HFOA 4BS2A 4ZITA 2OFHX 2MQMA 3EWGA 5BJRA 1JLCB 2MKCA 2FJAB 2XM3A 4X4UA 1OMSA 4I4BA 2AKWB 3TAQA 2WONA 2KN4A 1YJTA 3VTIA 3QFHA 1FE4A 3RRKA 3EDQB 1VK3A 1RHJB 4ANEA 2VJUA 2J8AA 9ATCB 4TQRA 2CJAA 3OJSA 4KO0A 2DXFA 5EN1A 3M2UB 4J37A 1R8CA 4KGKA 3RU0A 1RHKB 2IDEA 2A0FB 3JAMU 4B3OA 2FY8A 2HQGA 2OPSA 2Y9HA 4C98A 4X65F 3M2VA 1TL3B 4LMZA 2VQEF 4ITSA 4Y28C 1QAJA 1VJQA 3UDEA 1SL1A 2BMBA 4NLSA 1F9EB 2YVSA 2LEBA 1X4CA 2HNZB 3P45B 4E8UA 2KXNB 1EB0A 2KHDA 4J9NA 3GFHA 3IS9A 1V3ZA 2CG8A 5DG8A 1N34J 3KMQA 1YJWS 1WHXA 3CSKA 2B9XA 2ZITA 3MR2A 4F67A 2QMXA 3N4WA 4ZMMA 4DX5A 2JEJA 2LEAA 1XBWA 4AXJA 1OY9A 4DDFA 3DLHA 2RS8A 1M1HA 2MZTA 1QSSA 2DNRA 2VOOA 4P2XA 4DV4F 1F5CA 4K50A 1T3OA 2PEBA 3MDFA 2C2KB 2PFFB 2OKQA 3LGNA 1S9EA 3DOMA 1HIYA 4NWBA 4F0MA 4AD6A 2IVMA 2WAQD 4K4YA 3NLCA 4ZS6A 3H5YA 3BN4A 4DS4A 1U1KA 4R8UA 4X4RA 5AXMA 2EC0A 1UFLA 4FF3A 1KFDA 1RAFB 1URNA 3CMAS 3CNQP 3NGUA 3D1OA 4C3LA 2J0WA 2KJWA 4P75A 2B51A 4QWAA 3US5A 2R3VA 3W61A 1Y4ZB 5B0EA 1RWOB 4ZP6A 2UUTA 1IKYA 5HQMA 2CPYA 3EXCX 2QLBB 5IT9Y 2XWYA 3FSIA 2K3IA 3MMBA 3B8HA 3DYAB 3IRWP 4ECVA 2DGUA 3BN7A 4Y00A 1BGXT 3MD3A 1LWCA 1REVA 1FVSA 1QAXA 1WC5A 3OXFA 4EYIB 1YG0A 3BPDA 2J7UA 2YKQA 1JXLA 5LJ3Y 2DPIA 1FEEA 2BVZA 4NRUA 2MHNA 3KFWX 2MKSA 2PO4A 5HMYA 2IAJA 1JKHB 2R7TA 4WFNQ 1S1UB 1I5OB 5HI7A 4PUOB 2V67A 2JEIA 4UUXA 1B0TA 1Y3KA 3TWZA 1X5OA 3ZZPA 5DDQC 5K8MA 2K8GA 1F5BA 2FQQB 4R5PB 3N79A 5H9FK 2MTLA 1FERA 3I82A 2DEJA 4I69A 1JLQB 3PKMA 4YR2A 4AUKA 3N6LA 4CTAA 2YNIA 4Y6IA 1VRTA 1WOPA 2NUUG 4N41A 4WP9A 1LXNA 4MT1A 2ZVSA 4KSEB 3EPIA 1BQMA 2WVFA 5F9LA 3PJ9A 1N6QA 5KFCA 1FDDA 1VBKA 3C15B 1KHWA 2FHMA 2P9EA 4OJ1A 1WHWA 1VBZA 4X62J 4HDGA 1JK9B 1RT6A 1QY7A 1KLMA 4RWXA 5EDWA 1VQ4S 2KKHA 4HI1A 3CJKA 2ZBIA 2F3JA 2J76E 1ZAWA 3ZNJ1 4O23A 1FT8A 1TKTA 1U6FA 4Y2AA 3V81A 3V4MA 4ECQA 4KHMA 3P5BP 2ZWOA 5IQQA 1S48A 1CVJA 4N8NA 2B4OA 1SH2A 1U02A 2Y1JA 5CYJA 2JRSA 5BYRA 1HWUA 1RYRA 1OWXA 2DNYA 3D54A 3MR7A 2UUBF 2R8JA 4HHJA 1GTHA 4ZDNA 1WF0A 2RU3A 4C7QA 2ROEA 4M5HA 1XIQA 3R1HA 3KJQB 4TVAB 2YNFB 1Y7PA 4F04B 2ZDPA 2UU9F 5HMWA 2F1FA 1DTTB 4DPYA 3G82B 4P72A 1OPIA 4JI5F 3RAMA 1UWBB 1CJVB 2WB1D 3ZZ0A 2J6TA 4C8NA 1KVJA 2DHHA 1RE1B 2A6OA 4OI3A 2ZKTA 1RTDA 4HT7A 2HIYA 2GO8A 2H54B 4GVLA 4CH7A 3RTVA 3SQOP 3G8TA 2EWHA 4W92B 2IM2A 3CO0P 1MG7A 2C2OB 2GIFA 2V5HG 2LA6A 3CCZA 3S6EA 4RW9B 3PW0A 3W8GA 4DV1F 2OH2A 5ETMA 1SC3B 3MUTP 2HMIB 1RT4A 4J90A 1HWKA 3J7AN 1R0AB 3ETMA 1U6BA 2AEFA 1TKZB 2RH3A 1WDDA 3LPEA 3CF5Q 3K8WA 4F3MA 1CPZA 1U1RA 1TVRB 3CJ4A 4IFVA 2EPIA 3MHYA 5IZHA 5I3PA 1S9FA 4C8OA 2C3OA 4DQQA 3RYLA 3IC1A 1HNWF 4HACA 4CDIA 3W5YA 1HPZB 1YZ6A 1PBUA 1HFEL 3HI9A 3B4MA 4HI2A 2OMOA 1TKXA 1NRKA 2HS3A 4ZLNA 1NZAA 1RWNB 4YP3A 5BR8J 1WEXA 3DN9A 4D3GA 4GC7A 3KK3A 1ELOA 2IIHA 3QRRA 4LF8F 4OMFG 2CIMA 2HNYA 2DRDA 2YXLA 4DL7A 2ROPA 4LJMA 2KHCA 3CJ5A 2H3EB 2BW2A 2F8EX 5A8WB 2E5LJ 1FNOA 2HQDA 3WDOA 1HQUB 4EBEA 3R2CJ 2E5JA 4PCQA 1FRXA 1UP1A 1FRIA 2GS8A 4X4TA 4CM0A 1M5PC 1SI9A 2LFVA 1PC5A 4ZLLA 2MZRA 4MYTA 3KLEA 2DNPA 2R8HA 3IM9A 1VK8A 1HWLA 1DLOA 2AEMA 2AJ0A 1RA6A 2W2OP 3AD7C 2LQ8A 4P7TA 1RLDA 2UUAF 4K5RA 3NKYA 4J5OA 3RB0A 3B54A 3HFVA 2D1CA 2YQ0A 1RT3A 1SIZA 4OX9F 2XY6A 1OY6A 2Z56B 3I32A 3K5PA 2V68A 1VDHA 2L41A 1N48A 4OI6A 3H40A 1TK8A 3BSCA 4CLYA 5FJ4A 3POTA 4K4XA 1X31C 3HSDA 3H4BA 3GPAA 3DGPB 2CNOB 1NKBA 1MLAA 4UQGA 4QR1A 4LFCF 1H2TZ 3M2RA 3CE8A 2OP5A 4NASA 1L3VA 3RJMB 5H9EK 5DQIA 1S9GA 5E3CA 1VJWA 5CCLA 3C6TB 3GYGA 3TUJC 2UUCF 2CYYA 3OL9A 3NGTA 1JJHA 2A1BA 4TYAA 4J9SA 4NLVA 4P2FA 3H42A 5JVGQ 4DV6J 1IR1A 1LV5A 1GXLA 2BACA 2UVVA 2Y3YA 3C16B 3QSIA 4J9RA 1YZ7A 1SJ1A 3UR0A 5AJ3J 2BKOA 4QU7A 4X84A 4NLWA 3DU6A 2CPXA 3QQCD 4FPRA 3TUIC 4RL1A 3OFGA 3CJ3A 5IM0B 3BSOA 1WKLA 2ZHBA 3OSNA 3KLIA 1SXLA 2M70A 3RRGA 3W2WA 2CQBA 1S6PA 3P49B 2U1AA 3G6XA 2R7OA 2CADA 1FKPB 1YX2A 1OSDA 4ECYA 3DLGB 1FRKA 4YY3J 3NRBA 3N0VA 2BJ7A 4ZVGA 2DBBA 3HHEA 4KB7A 1D8YA 1AZSA 3A3NB 2ACMA 1XNRJ 5F8HA 4YEAA 4OLOA 2ZH7A 1RJJA 3ZZUA 4CRJA 5KFOA 3BSNA 3MM5B 4IYQA 5GAEU 2ZNZA 2YH0A 2HBRB 2FC8A 4YDXA 4USKA 1QAYA 2YNGA 4QIVA 3GSDA 4ELVA 4NXMJ 2OJ3A 1IKWB 4I7FB 1Q0NA 2Z30B 2DY1A 4Q8EA 3FMWA 3L7UA 3QRQA 2XO6A 2OPPA 1HNVB 4F8RA 2EEYA 1AFIA 3D28A 3M8PA 3DOKB 1N33F 2NQPA 1A7GE 5ETVA 5KFWA 1ZA1B 4PXCA 4K4SA 1PILA 4PYDA 1KONA 2XYGB 4OQJA 4M5MA 5D0RA 2IM1A 3RB4A 1PJ5A 2E1PA 5RUBA 1RWXB 2FJBB 2BV3A 2DB1A 3EXYA 3G87A 1VHFA 2E1MC 3LP0A 4ZN3A 2VKRA 5AE3A 1U26A 3HK2A 4UOFA 1CEZA 1FNMA 3LP2A 3FVYA 3HXMA 1FFWB 2GMHA 4CYUB 1UJ4A 5I3UA 2C3UA 5T7LB 5A0YA 4OV6A 4RNHA 3TX0A 1VQMS 4P2SA 3AQPA 1DARA 3PYFA 3HSGA 4DQPA 2H51B 2VA2A 2KU7A 4YFUA 3F44A 1FWPA 2MLYA 1FEHA 4OL8A 1S0VA 1SVDA 3R5JB 2AP6A 3KHHA 4XAKA 4OLPA 4FYXB 3TA1A 1F60B 1C4AA 1FK9A 3J80U 1WJ9A 3W62A 3T5KA 4KO0B 1RAJA 3MM7A 5L1JA 3J7ZT 3RBXA 2L9WA 1U24A 2DNGA 2MKJA 1K9MT 1R0CB 1JXEA 4B3OB 3HSZA 3FC9A 2OPSB 4MTPA 2VICA 2YX4A 2J0QD 2GMLA 3M2VB 4OYAA 4DV4J 4ZKAA 2BJDA 2BE9B 4KTQA 2AGQA 3EDRB 4F4KA 2XB2D 4OZ0A 1XR6A 3VF0B 2Q6CA 5M2PA 3PHEA 2GFFA 5E2QA 2ZOMA 4JV5F 4C0HA 3IS9B 5KFSA 1NDKA 2HBZB 4MK8A 3FBCA 3S01A 4YDDB 2XZDB 5L9XA 1JLFB 2R7XA 4FYYB 3RAXA 3RB6A 1UVNA 2CZVC 3LALA 4LR7A 1U1MA 2RNEA 5AXLA 4ES3A 2BOPA 2WSEC 3V5RA 2XULA 3Q89A 2IM0A 5IOLA 3FSXA 2BBEA 2W4PA 2DT9A 4EEYA 2CZ9A 4KQZA 3FGVA 1KC8T 1S9EB 2G2OA 3EICA 3KKFA 3BGFA 3JYTA 2X1FA 2NCKL 2ZZMA 3R27A 2DIVA 4HEA9 2CJQA 2XI3A 3DOLA 2QL5B 4WXWA 2RDDA 1WG1A 1HNXF 3IA0A 3H90A 4OI1A 3QWPA 5J1NA 4LF1A 4R8UB 3OLAA 2LXIA 2MZ1A 1LNQA 3V4IA 3WC0A 4QYRA 5FDLA 3TVZA 4ZPCA 1APSA 1BLUA 4I6WA 1G1XA 3VQTA 4CH1A 3Q8YA 5ADZA 1MW7A 2MZSA 5C2CA 3HD2A 2XYPB 3FBEA 3TZWA
chains in the Genus database with same CATH topology
5K5MA 2D3ZA 4EUVA 4LFAF 4J9PA 2Q6BA 2VPYB 4RW4B 3FJ2A 3G8SA 2IJFA 3OTOF 3M2RB 1PGZA 2AWZA 2XS2A 2IBOA 4I56A 2X1AA 4BWJA 3TYTA 1Q7YT 2PA3A 3OR1A 4CH0S 1U1LA 5D8HB 1IKYB 3KHGA 3TRGA 3HHDA 2R8IA 3DRPB 2C3PA 3AH6A 3H25A 2MDAA 2ZD1B 1H6KX 4HT5A 4X4VA 3O5TB 5DGAA 1QVGR 2GJIA 3UWTA 3DNCA 4UY8T 4ED2A 2RKIA 3NWGA 4D3HA 2F9DA 3NAHA 3GIJA 4ZP7A 3U1LA 2I5JA 5CCMA 4J9QA 3SV4A 1SV5B 2XEXA 5HLFB 1HNIB 2M4MA 3PDNA 2JFKA 2MMYA 5DGBA 2MQPA 1TV6A 3QJPA 5F0WA 2RIJA 3BB5A 3MMBB 2VB6A 5A8WA 2E5HA 2L08A 3PO5A 1HQUA 4NOHA 4NLUA 3THTA 4QOTA 2BANB 4WE1B 5LSRA 1LWCB 3J7A1 1MMNA 3NNAA 1REVB 5U47A 1RA7A 2GCFA 1UVMA 1YWXA 2M8HA 3MFIA 5F0UA 2VG5B 3UD3P 2NLWA 4ATNA 2K1RA 2MJUA 3EYZA 3FFIA 4RNMA 3GQCA 1KTQA 3Q23A 2ZH6A 3GR1A 2FUG9 1U7LA 1P8GA 4OJ3A 5J2NB 1R8BA 2DIUA 1HQEB 1XMBA 2RUGA 4NA3A 3EGNA 2DGSA 4WZMA 1FJGF 2AYGA 1X5TA 2I38A 4R0EA 4WFBQ 3IWLA 1NH7A 1YJRA 2BQ3A 7FDRA 1R27B 4UW2A 5KFRA 5H9EJ 2QA4S 4NYZA 5HBMB 1JLBB 2MQLA 2W24A 2YNHB 4FP9A 2YKNB 3KMSA 2XCAA 1H2VZ 2OFGX 3GIIA 3OXGA 4Y0FA 2M5YA 3PR5B 5AE1A 3DMJB 3T5JA 1FJCA 2KYZA 2FDNA 2VQFF 2Q79A 1C0UB 2I9SA 1UEUA 4HYKA 1QTMA 1FDAA 3CVKA 2IAJB 3DRSA 4ECTA 5CYQB 4WU2A 1GAOA 3TAMA 1WTBA 2ZH5A 1FD2A 3MTKA 4ECXA 1BQXA 1H38A 2QA4G 3QLHA 2VC0A 1MMLA 4X4OA 1VBYA 1FRMA 1UJ6A 2FLLA 3UCUP 4I0WA 4PWDA 4DV2F 1S97A 4F2RA 4WKRA 2DR9A 1X9SA 2E5GA 2DR5A 4ECSA 3D0IE 4F3OA 1DZ5A 2GQQA 3M8RA 3I96A 4Y65A 1VQYA 3J7YU 4DHVA 4OI2A 2E5LF 1VS3A 3C8YA 1ZM4A 3I5AA 3M05A 2FC9A 1LK7A 2CPHA 2ABYA 2HRUA 3FQLA 3SCJE 4ELTA 1DQ8A 3M8QB 2B3TB 1T02A 4KHRA 3I4HX 1BY9A 1Z2ZA 1ROFA 1YHQS 2GJ2A 4F4XA 1LW2B 1B0PA 2FVSA 2LU2A 4EWTA 2FY1A 2GIRA 1WEYA 3CCWA 4CTAB 1HMVB 1LW0B 4C0OC 4JV1A 4FF2A 2YNIB 4GO7X 1VRTB 2KXFA 3CDBA 3GWCA 1KVIA 4DL5A 4DV0F 2E1RA 2OIHA 2OO4A 4NLDA 1LOUA 4OHYA 2UXBF 1XERA 2DJWA 2VV5A 2ZFHA 3MMJA 4OZ5A 5KFMA 1Q86T 2CPJA 1U1OA 4A8SA 2AX0A 4RNNA