3QLHB

Hiv-1 reverse transcriptase in complex with manicol at the rnase h active site and tmc278 (rilpivirine) at the nnrti binding pocket
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
423
structure length
407
Chain Sequence
b'ETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords reverse transcriptase/ribonuclease H
molecule tags Transferase,hydrolase/inhibitor
source organism Human immunodeficiency virus type 1
publication title Synthesis, activity, and structural analysis of novel alpha-hydroxytropolone inhibitors of human immunodeficiency virus reverse transcriptase-associated ribonuclease H.
pubmed doi rcsb
total genus 101
structure length 407
sequence length 423
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3qlhB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3qlhB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3qlhB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3qlhB03
2XI3A 4NLYA 2R2UA 4EYIB 4Q8EA 3KLHA 3PW4A 1RDRA 4RW8A 2XC9A 3GIKA 3DOKB 2WK4A 2FVSA 2W8LA 4Q43A 5J1EA 3DOLB 2ATLA 2BRLA 4TY8A 1XR6A 3BSAA 1KHWA 3OHBA 4YMEA 2IA6A 3DRSB 4HKQA 1S6QB 2WOMA 1ZTWA 3QIDA 3PR4A 2AGQA 2UVWA 2ZD1A 1IKYA 2C2RA 4NLRA 1DTQB 5KT3A 2WONB 4DL7A 1QE1A 2OPRA 3LANA 4MKAA 3OLBA 3MEEA 4LQ9A 4F4ZA 5I42B 3G86A 2OPSB 3SFGA 3JYTA 2R8KA 5FDLB 5C5JA 5EWFA 5DQIA 2IJFA 4KKOB 4WZMA 1IM4A 4NRUA 2E9TA 3OL8A 2O5DA 3T19A 3I0SA 3KJVA 2YNHB 3QIPA 2VG7B 3KLFB 3KLVA 4PWDA 2YNIB 4JV0A 1LWFB 2HMIA 1VRTA 3BR9A 4NLQA 5KFBA 1N4LA 3DYAB 4YR0A 1UWBA 2DPJA 3V81B 4NLVA 4Y2AA 4URSA 4IFYA 5DGAA 3IGVA 5D3GB 4J9MA 4Q45A 3N6MA 4Q44A 1RT3A 1JLQA 3UDLA 1S9FA 1VRUB 1HQEA 2R2SA 1S6PA 2D3ZA 5KFXA 4K4TA 4ECRA 5KFYA 4J9RA 3C6UA 3CDEA 4TQRA 3T5LA 3DRSA 3PJXA 4QWEA 2W9CA 4YR2A 3QLHA 3TAMB 5KG4A 3BGRB 2FVPA 4ZVEA 1HQUB 4YP3A 3V6HA 3CO9A 3H5YA 1TKTA 1RYSA 1RA6A 5F8LA 1RT5B 2YKNA 4IRDA 2V4QA 5KG3A 1QE1B 1NHUA 4NLXA 4IG3B 4Y34A 4J9SA 1IKWB 4K4UA 4RW7B 4O3PA 4PQUA 4RW6B 4DL6A 3PW7A 2YKMB 2AQ4A 3KLGB 4ZHRA 3KK2A 4J9NA 1J5OB 2I1RA 3ICLA 2OH2A 5KFZA 4ED3A 2B5JB 4O4GB 4GC7A 3HVTA 2AGPA 3I0SB 3ITHA 1EETA 2HWHA 3UPFA 4K4WA 5KFGA 5KG2A 4MFBA 4MIBA 4B3OA 2R8JA 4FBTA 4O3SA 4ECYA 1FKPA 1S1VB 5J2QB 1JLEA 3V6DB 3BSCA 3MEDA 4F4YA 4IFYB 3KHHA 5KFAA 2D3UA 1S10A 3E01A 1C1BB 1TL1B 2WCXA 5F9LA 3D5MA 3LAMA 4RNMA 1JLFB 4DL4A 3C6UB 1K1QA 3MR3A 2BRKA 5KFVA 4R8UB 3KMSA 3QLHB 3TAMA 4O3NA 3G6VA 2VG6B 5DG7A 4O3OA 3Q8SB 2YKNB 3EPGA 2DPIA 1HYSB 3FDSA 4RNOA 1S9EA 3CJ4A 5KT5A 2W9BA 3KLIB 5DLFA 1RTIA 4R5PA 2JEIA 1HPZA 1XR7A 5DG9A 3RB3A 1TV6B 3M8PA 5F8MA 3DRRA 3CJ5A 1QAJA 4ZPDA 3MTKA 3FQLA 2IAJA 5F8NA 4ZPBA 5I3UB 2AX0A 1S0OA 3CVKA 5F8HA 3DM2B 3FSIA 2YNIA 1GX6A 3RBDA 3BQ2A 4DL3A 4IQXA 3HHKA 2R8HA 4OL8A 4KO0A 3M8QA 4JV2A 1T03B 2OPQA 1TP7A 2XI2A 1JLQB 4NLOA 4NLWA 2UVRA 2UUTA 3NL0A 3LP1A 4J9PA 2UVUA 4I7FB 3NKYA 5KT6A 4GC6A 2XGPA 1C0UB 3M9NB 1C0TA 1TKZA 3IG1A 4RW9B 1JIHA 4O3RA 4YR3A 5HLFB 2CJQA 4IH5A 5KG7A 4LSNA 3E51A 4RW4A 1TKXA 3V6KA 4J9KA 1JLCA 4TN2A 3GILA 5KFSA 1HNVA 1JLAB 4ECSA 4U7CA 3T5JA 5C25B 1I6JA 4IH7A 2C2EA 4Q8FA 4ICLA 3MEGA 4PQUB 1S1UA 4F4WA 4ECWA 1KLMB 3KLGA 3DI6A 2GC8A 4J9OA 4IG0B 1J5OA 1OS5A 5KFQA 4LSLB 5KFWA 5I3UA 5KG1A 2W7PA 4URQU 1RT1B 3LP0A 4NCGA 5HROB 2C28A 2R8GA 4M95A 1K1SA 4EBEA 4MK8A 2XWYA 1IKXB 3TVKA 4R0EA 3M8QB 1SH0A 1S1WB 3HVAA 3KK1A 4EYHB 1TL1A 5DG8A 1RT2B 4IH6A 2IM2A 4MK7A 5KG6A 3KK3A 2JEGA 4TY8B 5J2NA 1N5YA 2QE5A 1JX4A 3GIIA 2B6AA 4QW9A 4URGA 4J9QA 2HAIA 3OL9A 1C0TB 1TKZB 4J9LA 2YNGA 3V6JA 2BQ3A 2VG6A 2HNZB 3CDUA 4HYKA 2VA3A 1DTQA 4WE1B 4O44B 3DLGA 1SUQA 1BQNB 4KAIA 3KMQA 2IM0A 1T05A 1RA7A 2OPSA 4KB7A 2XCPA 3OSPA 5FDLA 1HPZB 2R2RA 4IG0A 4Y3CA 2IBKA 2BQUA 5J2MA 4KV8B 2I5JA 1RTHA 2VG5A 3V4IA 2IM3A 3N6NA 3SI8A 2IAJB 1LWFA 2HMIB 1VRTB 5L9XA 3CIZA 3DYAA 4I2QB 1HNIA 1Z4UA 3I5AA 2J6UA 1R0AB 2UVVA 2WTFA 3SFUA 3IN5A 4DEZA 5D3GA 1TL3A 1S1WA 2FJXA 5EWEA 3FFIB 4X2BA 5HBMA 4NRTA 3I5BA 1T3NA 2OPPB 1HQEB 3DRPB 4ECTA 4IKAA 1MU2B 3NAIA 3HKWA 5L1IA 2JC1A 3BSNA 2AX1A 2W9CB 5L1LA 3KOAA 1TVRA 2CKWA 1EP4A 5KFMA 3BGRA 2XGQA 4I7FA 5KFDA 1HQUA 4NLSA 4ECXA 2RDIA 4WFXA 2JEFA 1KHVA 1BQNA 1LWEA 4NLUA 2R8IA 2ASDA 2ILZA 3LALA 1RTJA 2YKMA 4RW4B 1JLBB 5DLGA 4DL5A 1S1TB 1JKHB 2FJWA 3GYNA 2YNFB 5J2MB 4ECVA 1MMLA 4KV8A 5EUHA 2AGOA 4F50A 3MEGB 1S1UB 2HNYB 4MFBB 4KKOA 1QUVA 4RNHA 1WNEA 3LP2A 5KFNA 3IS9A 3DLKB 3QIPB 1LWCB 4ZP8A 5KFPA 5HROA 2BE2B 3C6TB 4U6PA 4G3IA 4QW8A 4ID5A 3E01B 1SH3A 1U09A 1MU2A 4WFYA 4RU9A 1N6QB 3QYYA 5KFEA 2FVRA 4TY9A 4NYZA 3EZUA 3KK1B 4O3QA 1RT2A 2IMWP 3LAKA 4KSEB 1YVFA 1LW2B 3MFHA 1JLGA 3D28A 4ZPAA 2WRMA 4IOBA 3BQ0A 2J6TA 2W9BB 3IRXA 4IRCA 2HNZA 1RTIB 1DTTB 4R5PB 1CSJA 3PW0A 2D41A 3BJYA 3PW2A 1TKTB 2W8KA 4ZP6A 1S1TA 3M8PB 1TV6A 4RUAA 2YNFA 1SV5B 3QO9A 4H4MB 4MIAA 4ED6A 1T05B 1IKWA 2B43A 4IDKB 4MH8A 1BQMA 4XPEA 3QGHA 4KHMA 5C42A 4TXSA 4WYLA 5CYMB 3JSMB 4DG1A 4O4GA 5C24B 3HVTB 1S6PB 2RF2B 5KFRA 3PVXA 3ITHB 4NLPA 1LWCA 3DLKA 2VG5B 3V4IB 5KFHA 2JEJA 3C6TA 4K4SA 2BQRA 4ZMMA 4I2PB 4I2QA 3I5CA 5CYQA 4QWBA 3T5HA 4IRKA 5DGBA 1S1VA 1R0AA 3DOKA 1JLEB 1ZETA 1N6QA 4KO0B 5J1EB 2IJNA 2VA2A 1TL3B 3FRZA 2OPQB 3DOLA 3FFIA 4QWAA 5HBMB 2ALZA 3RAQA 2OPPA 3DRPA 5HP1A 3LP1B 5DQHA 3CJ0A 3G6YA 4K4YA 4H4OB 1JLFA 2ZE2A 1DLOA 2UUWA 3T1AA 4ED8A 2C22A 1TVRB 5J2PA 3GV8B 4PUOA 4H54A 1HMVB 2BANA 3MR5A 4ECQA 3CJ2A 3MFIA 2V4RA 3GV5B 5KG5A 3Q8QB 3DLEB 5KT4A 1S4FA 1SV5A 2OPRB 3QO9B 1S9EB 1SH2A 3HVWA 4WXOA 3UR0A 4RUCA 3PZPA 5JUMA 2IC3A 4NZ0A 2ASLA 1RT6A 1KLMA 3QZ8A 1D1UA 3RB6A 2FLLA 1NHVA 3RBEA 1S97A 5C24A 2V0NA 4KFBB 5K14B 4IFVB 3NGDA 3KJVB 3OLAA 3GV7B 2AU0A 3LP0B 4NCGB 4JUZA 2W9AA 3CDWA 4IR1A 2RKIB 4Q0BB 3IGNA 4K50A 1REVB 3QZ7A 3LP2B 4K4XA 3OHAA 1IKVB 3V81A 3M9OB 5KG0A 1IKXA 2BR0A 4ID5B 3H5UA 3M9MB 3ISNC 2E9RX 4ED2A 4WZQA 4RW8B 4KE5A 4G1QB 4EBDA 3Q8RB 3H5XA 2ZE2B 5KFFA 3H59A 1DLOB 3CWJA 1T03A 3H2LA 4NLGA 5DQGA 3VQSA 2J6SA 5F9NA 4EEYA 3RB0A 2QV6A 2RDJA 3NMAA 1RT5A 1C0UA 3DLEA 3H4DA 4RW9A 3PR5B 4IG3A 4XPCA 3IRXB 5HLFA 1LW0B 1DTTA 1W25A 4ZVHA 4ZHRB 1RTDB 2D7SA 3MF5A 1JLCB 2WONA 1JLAA 3H40A 2B5JA 3ISND 2ILYA 3QGGA 4KFBA 5K14A 4IFVA 5I42A 1RT7B 3MECB 3FQKA 2FVCA 4ZVFA 4ED0A 3JYTB 3T5KA 1NNDA 1TQLA 1REVA 1HNIB 1T94A 2GIQA 4DG1B 4KHRA 1IKVA 5J2QA 3V6DA 1RT1A 3MEDB 4PWDB 4I2PA 5CYQB 4F4XA 4EBCA 4WFZA 1S48A 1FKOB 1FK9A 4TQSA 5KFIA 3BREA 2JC0A 1RYRA 1RT3B 1EP4B 1ZTTA 1QAIA 3KK3B 5KT2A 4H4OA 3EPIA 1JXLA 4FBUA 3DMJB 3G6XA 4FS1A 3BSOA 5KFCA 3KLEB 1LWEB 1HYSA 4PUOB 3NBPB 2HWIA 3KLIA 1XR5A 5F8GA 3BQ1A 1RTJB 1RT4A 4NLDA 3OSNA 5KT7A 1S1XA 1JLBA 4M94A 4WE1A 2IM1A 4QPXA 3KHRA 3RB4A 2FLPA 3DLGB 2F8EX 3DRRB 1C1CB 4TYAA 3N6LA 3RAXA 1RT7A 3MECA 2IC3B 4RW6A 3QGIA 2V9WA 4K4VA 3H98A 1S9GA 2HNDB 2HNYA 3Q8PB 4TYBA 2W7OA 5KFUA 2I5JB 4MK9A 4EO8A 4RNFA 1RTHB 3IS9B 4MKBA 4Y2CA 1N48A 3PHEA 2BE2A 5JXSA 2RKIA 4Q0BA 5F8JA 3KLHB 4B3OB 4YQWA 1C2PA 4FS2A 4RZRA 3PW5A 1FK9B 1FKOA 3CJ3A 4ED1A 1C1BA 4G1QA 4NLTA 3MR6A 4O4RA 3DMJA 4ZP7A 2ZKUA 4XO0A 1RAJA 3KLEA 4R8UA 3OL7A 1IKYB 4LSNB 2XCAA 1S0NA 2EC0A 1HNVB 1C1CA 5C25A 3MEEB 4ICLB 1LW0A 3MR2A 3KNAA 1BQMB 2WHOA 2JLEA 3DDKA 5F8IA 5C42B 1RTDA 2C2DA 5CYMA 3JSMA 1JKHA 4DL2A 4K4ZA 4LSLA 4ZPCA 5KFTA 2E9ZA 5EWGA 1HARA 1S49A 2WB4A 2VG7A 3KLFA 1D0EA 3I0RA 3GIJA 1UWBB 4ED7A 5KFKA 5EDWA 3DM2A 4ZP9A 3GIMA 5L1KA 1VRUA 5HP1B 4ECUA 4TLRA 5J2NB 1N5YB 2AWZA 5L1JA 2B6AB 4QWCA 2FVQA 4QWDA 2GIRA 3PJWA 4WXWA 5J2PB 2YNGB 3TQ1A 5KFJA 4IR9A 1HMVA 2BANB 5KFOA 4ECZA 1LW2A 3KHGA 4O44A 3KHLA 1JLGB 4WYWA 5KFLA 1SUQB 3IG1B 1S6QA 2WOMB 5T14A 3NBPA 3OL6A 2ZD1B 1S0MA 4RW7A 4JV1A 1RT4B 1RT6B 4RNNA 1S1XB 1TKXB 3KK2B 4KBIA 2FJVA 4H4MA 1GX5A 4ZVGA 1N56A 3GQCA 2ASJA 4IDKA 1EETB 4LQ3A 3UQSA 2FLNA 3DI6B 1S9GB 2HNDA 2R2TA 3H4BA 3H5SA 3I0RB 3NAHA 1FKPB 2RF2A 4EO6A 2YNHA
chains in the Genus database with same CATH superfamily
2PEHA 2MZJA 3HULA 1SC3B 4Q8EA 3KLHA 1TU0B 1UTAA 2DGVA 2XC9A 3ET6A 3ENAA 2P8IA 1RWUA 2FVSA 2IMOA 3I9ZA 4LUBA 1QSYA 5J1EA 1JJCB 2VC0A 5H9FK 3DOLB 1D8ZA 4HR2A 1FERA 1KWMA 3FC9A 5B09A 2NXNA 4X4RA 1VDHA 1BXNA 3MPYA 4QIEA 4CLLA 2WAQD 3HKZD 3IR7B 5DJBA 2CWXA 2WOMA 1VYAA 2JNJA 3K7RA 2ZD1A 3C16B 4OI2A 1NH8A 1W7WA 2M7SA 4NLRA 5DDQC 3TEGA 2N4DA 4JYAF 2XEXA 3B78A 4DL7A 3MM6A 4OZ5A 1TL5A 3OLBA 2DR5A 1U24A 2OEJA 4WU3A 2OPSB 3SFGA 4L6V3 3JYTA 1ULRA 2IJFA 2L9DA 3D4JA 1HWKA 3GWCA 3AOAA 4NRUA 1OPIA 4TLQA 3H25A 3WC2A 4EFAC 2E9TA 2VQFF 3IWXA 2DK2A 4P7TA 2VG7B 1H2VZ 3EM1A 3X3UA 2YNIB 1R27B 1YBAA 1VRTA 4UOHA 4PRFA 5BR8J 1FKAF 2DNLA 1FFWB 4FYWB 4DPXA 4DR1J 3SEOA 1JXEA 3D68A 4ZN3A 2ZH5A 4Q45A 1T9UA 3G71S 3HO1A 3R5GA 3A8EA 2VOOA 4K4TA 1GQEA 2W2QP 2DNMA 2QLJB 4LREA 3BM7A 5KFYA 5KFXA 5CD4H 4DFPA 3T5LA 5B0EA 1EZZB 3HD1A 2W9CA 1I94J 1R7IA 4L3KA 4C8KA 4FF3A 3QLHA 3BGRB 2FVPA 4ZVEA 1TFYA 2ZZMA 3V6HA 4ZLJA 1TKTA 3I32A 2B9XA 1ZA2B 5KG3A 2EG2A 4AD6A 4M63A 1QE1B 5HQLA 4A46A 2E9ZA 4RW7B 1F9HA 4FVMA 5HAOA 1VIXA 5B0CA 3KK2A 3UD3P 2D1CA 3DRXA 1BUXA 1Q8KA 1W2BR 5LSOA 4ED3A 2B5JB 4HTJA 2AGPA 3I0SB 3M7VA 3UI3A 1Q8BA 4AE5A 3TJAA 3P49B 1HNZF 2R7UA 3MAAA 4O3SA 2DGQA 4DSKA 4NASA 1HI0P 4OYXA 5G0RA 5J2QB 3MMJA 1AROP 4F02A 1OMSA 3KHHA 5KFAA 4DUZJ 1S10A 1IQZA 3E01A 2WCXA 4NZ6A 2OO4A 4I68A 1TAUA 3SQGB 3OPKA 1UWAA 2XNQA 1CJVB 2EFNA 2GAGC 4Q2LA 4JI6J 5L38A 2VL1A 1XMQF 1FX4A 1LXNA 4KR0B 2YH1A 2Z58B 4F4ZA 2MLXA 5KFVA 2BDPA 1KKHA 1OQ3A 3FZ2A 3G6VA 1X5TA 4LF7F 2CRLA 3ZZUA 2YKNB 1X4GA 1RAOA 3EDRB 4Q2MA 1OY9A 4CT8A 2W9BA 3A4TA 1NDLA 1NSKL 3U1MA 2R7SA 1IBLJ 4RPFA 4UY85 4H4KA 5DG9A 1XR7A 3SSQA 2L9NA 2QA4G 1RCOB 1T11A 4U8YA 2DR8A 4ZPDA 3MTKA 3OV7A 3TZXA 5H9EK 1N34J 4M5IA 4BLGA 1B7YB 1NSAA 4LRCA 2ZBRA 5IS2A 1NKCA 3F73A 5F8NA 4B08A 1X5SA 1RB0A 4NMLA 3JAMY 1L3KA 4FPRA 4LBPA 1YG0A 2RNEA 3MXHP 2UUCF 2CQ1A 2YKOA 5K8PA 4QCLA 1FRIA 2NUHA 2EFGA 3P5BP 4IQXA 3K0JA 1U45A 5AE1A 3DXSX 2OPQA 2XI2A 3R7BB 2EFPA 1NPPA 3NL0A 4DV5J 4J9PA 4DZDA 4I7FB 1OY6A 2EK1A 1H2UX 5KT6A 1P9QC 2L41A 4GC6A 1CJTA 1XMOF 2HQ3A 2O1PA 1H38A 3RR8A 2BV3A 1VQPS 1C0UB 2JWNA 3G87A 1U6BA 1C0TA 4O3RA 3J7YU 4WU2A 5HLFB 1V6HA 2JRSA 4LSNA 3BO4A 3V6KA 4DR7F 4YEAA 1WKJA 3CCSS 2RQMA 5KFSA 1K8AT 2ZH9A 3OFHA 1I6JA 5E0OA 3Q23A 1Y0HA 1HHQA 2XQCA 1KLMB 2DRDA 3DI6A 2CQ3A 5E5NA 4IG0B 1J5OA 3D54A 1YRXA 4M5KA 3NMRA 1KN6A 4A8KA 3IAS9 4L75A 1WHWA 3MM8B 5KG1A 4B17A 3G6ES 2VQEF 2MZTA 1T9VA 1P8GA 3BR8A 4OYWA 4ELVA 2RS2A 2UU9J 2KHCA 2VFSA 5J1PA 2PDAA 2R8GA 2ZDOA 1URNA 1U4BA 2B56A 4F0HA 1K1SA 4W92B 1UPPA 2DYAA 1Q5VA 1YZ7A 2FLOA 4GRSA 3TVKA 1S12A 2YWEA 4OHVA 4EYHB 2KN4A 4AFFA 1JWWA 4OI4A 5GMEA 2W25A 1RT2B 3E8OA 3V5RA 2LVWA 1XWLA 5KG6A 1O5JA 5RUBA 5LJ5Y 4V19X 5J2NA 1N5YA 3NG8A 2QE5A 2WBMA 2PA8D 2ZVSA 4I6YA 1F3VA 3SCKE 3JXOA 2WVEA 4ZN1A 4URGA 3GIIA 4J9QA 4J9LA 3R2DJ 1HBUA 2EK6A 2LP4A 4WKYA 3NWRA 4HYKA 4NI2A 1T9YA 3B6BA 4QQBA 4DOZA 2V94A 2ROEA 2GMJA 2CQIA 3RRHA 1SUQA 5KOWA 2IM0A 1FFSB 1NPRA 1UVJA 4KB7A 1M5OC 4WTYA 4ZCLA 1HPZB 2L3MA 3DLHA 1I51B 2BQUA 3GJRB 2MLYA 5LMNJ 2CYYA 1RTHA 4PQAA 3CJSA 4CM0A 3N6NA 1OO0B 2RUSA 4CTAB 1VRTB 1NDKA 4DR3J 4JI3F 3CIZA 4M5NA 5EX0A 1HNIA 3I5AA 1WG4A 4DL0C 2NPFA 5B0DA 1FJEB 2XBPA 2BJ7A 1R0AB 2WTFA 4LF6F 1TL3A 2AIRB 5DDRC 2ALYB 3FFIB 4X2BA 2I0XA 2G2YA 3K8VA 3I5BA 2RT3A 3DRPB 4CH7A 3J81U 5GAEU 2V68A 1GMUA 4IKAA 3CDAA 3UW1A 4OV6A 1WTFA 4CCHA 1UFWA 3EVOA 4P2FA 2AMCB 5B0AA 2W9CB 4C4WA 2CJAA 1IBKF 3KOAA 1N5TA 2CDQA 2CKWA 4LR7A 3BPDA 2JSXA 2FQQB 1UEVA 4I7FA 2DKOB 3QSYB 2ZDPA 1NZAA 2F4FA 2RDIA 4DF4A 1MMDA 2Y0BB 2G0CA 2GIFA 3PRDA 4NL5A 1ZOTA 4NLUA 3WX4A 4DSIA 2ASDA 3GLJA 1RTJA 1GTEA 2J0XA 3NGSA 4IUFA 2BYCA 3DOMA 1I3OB 1S1TB 2FJWA 4NWBA 3GYNA 5J2MB 4BC7A 2AGOA 1Z1ZA 2CQDA 3T9ZA 4CH1A 2MXYA 4K59A 4I6WA 5C2GA 2HNYB 1G3OA 1RUSA 2AP6A 4RNHA 1QUVA 5LMUJ 3PEJA 4OZ1A 2KDOA 4DR5F 4A8SA 5HVHA 1SJRA 2HHHJ 3W1YC 4QR1A 4M5HA 4MJKA 4OZNA 4U6PA 4G3IA 1U2FA 1SH3A 3E01B 1FTCA 2RUGA 3B4DA 3HSJA 3CUNA 2ZBPA 2UUAJ 2HQGA 2LQBA 1U09A 4LBHA 4KY3A 1MU2A 2IJRA 2RRBA 4WFYA 4CP5A 2DJWA 3IA0A 2GJFA 4ZVSB 3K8WA 5KFEA 3KKFA 5B0GA 2LYVA 2MY7A 3NS6A 2J5AA 2QN6B 1BY9A 1RT2A 2BMBA 3FBEA 1KOHA 3LAKA 1U6FA 2VJUA 2BA9A 1R0CB 2AV5A 2OHDA 4J7CA 2K7KA 4YHHF 1OSDA 1HW9A 4ZPAA 3HFVA 1M5HA 1HKAA 2Y9HA 1B0PA 3ETOA 2CJBA 2W9BB 4FDFA 1CSJA 4R5PB 1NM2A 3GCWP 5L9NA 3BJYA 5IOLA 3M6WA 3HSGA 1F5BA 4ZP6A 3W9JA 4U67Q 3PKYA 2YNFA 4H4MB 1PG5B 1T05B 1IKWA 2B43A 1V3ZA 4XPEA 1FE4A 2E1AA 2JDJA 3GMGA 3HDSA 3I82A 5C42A 4PPZA 4TXSA 4WYLA 4DJBA 4ILMA 2LMIA 5CYJA 4DG1A 5AE3A 5C24B 3HVTB 1CC8A 1RQ0A 5LT5A 3C2PA 4TNOA 3DLKA 2VG5B 3Q24A 5ETKA 1NK6A 3C6TA 2BW2A 7FD1A 4K0KF 2GHPA 4JI2F 4E0DA 5DGBA 1S1VA 4WJBA 5A8WB 1N6QA 2XLIA 2NCKL 2IJNA 3GZ7A 1TL3B 1O8BA 3BGLA 2VA2A 3DOLA 4HDHA 4QWAA 4CWBA 3LA0A 1FD8A 1CVJA 1HI8A 2XWXA 3LP1B 2UP1A 2AJ2A 2KVQE 2UXBJ 2OFHX 1DLOA 1EARA 2CPZA 3BKTA 4AXJA 1KRPA 3QWUA 2C22A 2A2DA 1HMVB 2BANA 4YB6A 4X62J 3BGUA 2V4RA 3GV5B 3J80U 4W98A 3DLEB 4AXIA 2OPRB 2MTLA 1VFJA 2EW9A 1HLWA 3UR0A 3PZPA 4DR6F 2E44A 3RU0A 3DOMB 3RB6A 1IBLF 4DN9A 4LR9A 2ABYA 3FRYA 4N56A 3RBEA 4YFUA 3OLAA 5K14B 3GV7B 2VDHA 3HX9A 4TVAB 4YOEA 4ZIVA 3LP0B 1YZ6A 4CDIA 2AU0A 2UUAF 2LFVA 4X4PA 2M70A 4UZBA 3IGNA 4LF7J 1JJ4A 2AJFE 4FKXA 4ZPVR 4K50A 3W2VB 4RBVA 3V81A 1RWMB 2OUGA 4XIUA 3KG0A 3BGOP 3UE2A 3OR1B 4ZIWA 3ISNC 2C1EB 3M9MB 3VAGA 4RW8B 4QYZJ 2P5VA 3N5BA 2Q6BA 4DV4F 2DGUA 1O6XA 3CD6S 2KRRA 3H7HB 2ZE2B 4X4SA 3TYTA 1T03A 5GMKa 3I56S 1CULB 1DJ0A 2BJDA 2L9WA 4LF2A 4RO0A 5HMZA 1VQ4S 1U1QA 4WFAQ 4QIFA 2QV6A 2Y0SD 2RDJA 4QU6A 4J5OA 4PEOA 4LFBJ 3PR5B 2CDRB 2ZEJA 1X4FA 1FE0A 1VQKS 3IRXB 4JI7F 1LW0B 1UP1A 1W25A 1R0BG 4ZVHA 3D0IE 2DO0A 2WONA 2KZZA 2VC1A 1JLAA 3H40A 2B5JA 2XYHB 3PR4A 3EUNA 2E5GA 2FVCA 2XSJA 4ED0A 2YX4A 3L7PA 3D0GE 1YBUA 1ZA1B 1FTRA 2ZC3A 3AODA 4LF8J 1REVA 3VR1A 3RJMB 4DG1B 3PIPQ 2JVRA 3MMBB 4AUKA 2EWHA 3UN2A 5LJ3Y 3D3CJ 4DFMA 1RHQB 2Q79A 4DUYJ 1RSCA 2BUNA 3RUBL 1VC5A 1A9NB 4B3SJ 3C14A 3R5CA 5KFIA 2JC0A 2CPYA 5HMWA 3JSBA 3UN3A 3GPAA 4R0JA 2V34A 3FBFA 3KK3B 3FZBA 4F36A 3EMTA 3EPIA 1R8CA 4L73A 1KQKA 4YDDB 3G6XA 5B08A 4LF8F 1IWAA 3Q8VA 3IBFB 1HHTP 3CCZA 4PUOB 4CO5A 1NK7A 3BDPA 1XR5A 3BQ1A 2W2PP 1RTJB 3UWTA 1H6KX 4QPXA 2NR0A 2B4OA 4N5SA 3RB4A 1TK5A 2F8EX 3MD1A 4MYTA 4DX7A 3RAXA 3OXFA 1J2VA 1RT7A 1TL7B 4JI8J 1YJTA 1F2HA 4Y00A 2KT2A 2UXDF 2XS5A 4TYBA 3EZOA 2VFTA 5KFUA 2W7OA 2VJVA 2FC9A 4RNFA 1TK0A 1WHYA 5HSPA 1N48A 1HWLA 1NRKA 3PHEA 3KTQA 4PCQA 4FF1A 4YB5A 4B3MF 5F8JA 2LLZA 1Y3JA 1BMQB 4FS2A 3MM7A 3TA0A 1WDTA 3CMQA 2J0QD 1H0HB 1NDPA 1WEYA 3PW5A 4CLWA 2DCUB 5D8HB 1VOMA 3W63A 1VGYA 3MURP 2RQ4A 4Y6IA 5B0FA 2XY5A 4DWIA 2NXJA 1CJTB 4Z7CA 2V8VA 1Q5YA 3C66A 3NNAA 4C8OA 2G1DA 1HBOA 1H2TZ 1RAJA 3OD2A 4R8UA 2LQ5A 3OFGA 2JL9A 3ZZYA 3OL7A 4JYAJ 2EVZA 4LSNB 5IT9Y 3CCES 3HHLC 3ZTRA 1V5IB 2XG8A 3CO0P 1HNVB 1UAWA 4M8LA 3CF5Q 1YJ7A 2AZ1A 3ENWA 4CLSA 2WHOA 4EMDA 2JLEA 5F8IA 4P9SA 4Y2MA 1U1RA 4C8NA 3VHQA 1HNWJ 2BABA 3ILIA 2Z0GA 2CUYA 4OYZA 4NZ7A 1NLKL 3KLFA 1D0EA 3ELHA 7FDRA 3C15B 4CLKA 1U1OA 1E6VB 2FHOB 4B3SF 4V19J 2ZJPQ 3VGVA 3GIJA 5JMNA 1A7GE 1UWBB 4DR5J 4C8YA 1BLUA 3LH2S 5EDWA 2UUCJ 1N36J 4QYRA 3T1YF 3H42A 4X4VA 2BM0A 4PR6A 2YH0A 3DGVA 4J9UE 5L1KA 2GAHC 4HL9A 1N34F 4YHHJ 1XNQJ 5J2NB 1N5YB 2AWZA 2EFVA 4C0HA 1APSA 2WVBA 4QWDA 3HHLA 2GIRA 3PJWA 4C8MA 2G0JA 1XIQA 3M4XA 5IZHA 2XY7A 1WF0A 4DR4F 3BKUA 2M9KA 1NB7A 1QSLA 2MKHA 2Z30B 3DGPA 1CQNA 4DZ6A 4C3KA 2PEBA 1SQFA 1X4DA 3IO1A 1SUQB 4NOHA 2HG4A 1RWWB 2AYBA 1FDAA 4ZCMA 4CT9A 1S0MA 1H3DA 5E41A 2HQDA 1BWVA 2VPZB 3H90A 4KBIA 2VBWA 1X5OA 4ZVRB 1XQIA 2KL8A 2D9OA 3RGIA 2ASJA 1T8EA 4IDKA 1EETB 3FNNA 3M2UA 5IQ6A 3G4SS 1EHWA 4LQ3A 4ZCIA 5HO4A 3JS9A 1XEZA 3FUYA 3MAHA 3DRYA 4EO6A 2LKZA 2MY8A 2CQGA 2XI3A 2OKQA 4C8LA 3KJNB 4EYIB 3R1HA 1Q79A 1XK8A 3PW4A 3OR1A 2HHWA 1RDRA 4RW8A 3OFFA 5ETOA 3DOKB 1S99A 3DXBA 4Q43A 3AQOA 3OUYB 4OYBA 3IFEA 4C3MA 3A8IA 3MM5A 1Y4ZB 3H2UB 3BSAA 2XMVA 4TY8A 4KQZA 4K0KJ 2VHGA 4P10A 3TZZA 2XMUA 2AEFA 1S6QB 1ZTWA 3UCGA 3QIDA 1XMQJ 2I9SA 1R6VA 1U2RA 3M30A 4RWXA 2C2RA 1BD6A 1DTQB 2ZZTA 1QJHA 4GVBB 1QAYA 3FMBA 2P2CB 2OTLS 2WONB 4DV0F 4ZDNA 3F0NA 1B3TA 1QE1A 1VLOA 3LANA 1PJ5A 1WF1A 3MEEA 2CNLB 2CVEA 2F9JA 2IDLA 2V2VA 3G86A 4LQ9A 4OYMA 3JTPA 1RI7A 1GAOA 5C5JA 1VQOS 1Q7YT 5DQIA 1VQ6S 3R5DA 4WK3A 3ISZA 4P2SA 5ETQA 3T19A 3KJVA 2YNHB 3QIPA 3KLFB 1ELOA 1HBNB 4NA1A 4JV0A 5BR8F 2HMIA 3BR9A 4NLQA 3KHRA 4ELUA 2DNNA 1N4LA 3K58A 3PKMA 2VQFJ 3GU0A 2VQEJ 4Y2AA 4URSA 5JVHQ 1VHFA 3TJ8A 3IGVA 5D3GB 3POTA 2UXBF 4YN3B 1FNMA 3UDLA 1TR0A 1NU4A 2R2SA 4BS2A 2I8EA 2VH7A 2RF2A 2D3ZA 4PZVA 4DR2F 4J9RA 3C6UA 1TAQA 4TQRA 3U27A 4Z37A 1AB8A 3D0HE 3QQCD 4OX7A 2CQHA 2OP5A 2V8GA 4LMZA 1YITS 2RQKA 1XERA 5D4PA 2C3UA 2HZVA 2NZCA 4Q5VA 2IPOB 1RYSA 1G6BA 4IRDA 3PV8A 3GFXA 2CAJA 3J7Z5 3ZFVA 4IG3B 4Y34A 4C0OC 5HQMA 3LF0A 2ADCA 4PQUA 3TO8A 2OH2A 2YKMB 3CGIA 5A76A 2U2FA 4ZHRA 1KP6A 1RE1B 1MWQA 1WACA 2GQ2A 2I1RA 3AXMA 3D6MB 4MYUA 4Z7YA 3MPVA 5HVGA 1VISA 3EYZA 4O4GB 5K9FA 2A10A 3TNVA 3KYLA 2XMTA 2QT7A 3FGVA 3UPFA 3RW6A 1S79A 5K8OA 4MIBA 4FBTA 4P7VA 5IXUA 3VV2B 1FKPA 1S1VB 4QJVA 3TEHB 5A8WA 3V6DB 4RWWA 2YWHA 4CZCA 2FJBB 3TUIC 3D7SB 4X4OA 4DV1J 4G65A 2DGTA 3H8YA 5IQQA 2D3UA 5IV4A 2QLFB 1RISA 2FHJD 1RHKB 2HIQA 3I87A 1IJFB 3Q8YA 3CEDA 3D5MA 5F9LA 2KXNB 1TK8A 1FNXH 2GV1A 2J76E 1KVIA 2F40A 3MR3A 4XDCA 3L3CA 2OSQA 2C2ZB 2CPJA 4OI6A 3FBBA 2ZH2A 2UUBJ 4LF6J 3KMSA 4ES3A 3QLHB 1AYEA 1MN7A 2VG6B 4P2MA 3UR3C 1D8YA 3W7BA 3RG6A 4C3LA 4PXEA 3VQTA 3EPGA 3FDSA 4UOCA 4OI3A 1UETA 4WPAA 3M30B 3KLIB 1PJ7A 2X3GA 4B3RJ 5ETNA 1PC5A 5ETTA 1X0PA 4GVBA 1LFPA 1TV6B 3M8PA 3J7ZT 3R2CJ 3SCLE 4EI2A 2XHCA 1CJKB 4YY3F 2MMYA 2XHWA 3IBWA 1RWVB 2BOPA 1FA0A 3CCTA 3OTOF 3GFHA 1B7FA 1QTMA 3PYDA 1S0OA 2HRUA 5G0RB 3CVKA 3QFWA 5F8HA 3AY0A 3DM2B 3FSIA 1P27B 1NO8A 3H20A 3K17A 2F4VJ 4K7QA 2GVZB 3BQ2A 4DX8H 2GZOA 3OBIA 1YRTA 3BH6B 2LU1A 1H73A 3FBCA 4IOCQ 3LUYA 4LRDA 3H2VE 2IFXA 3BDEA 4DR6J 4UQGA 2HRTA 4JI0J 2PMZD 2GGPA 3NKYA 4HHJA 4RX6A 3UO0A 4LF5J 1PIEA 2NS1B 2AYGA 4B9VA 1JIHA 1MN9A 1TELA 3QT7A 2CNKB 3SDEB 3EVWA 4QR0A 2BEFA 4ZVUB 1PBUA 2Q6CA 3T1HF 1X9SA 2DR9A 2A2CA 3DU6A 2KFNA 2CPDA 4OQJA 1LOUA 1JLCA 2OEKA 2V69A 1F3FA 1HBMA 1JLAB 1UCNA 4HT7A 3HMJG 2YKQA 3J80Y 3T5JA 1NJWA 1X8DA 1L3UA 4Q8FA 2DD8S 3MEGA 5LXYA 2DHHA 4PQUB 2HK3A 2NQPA 2VBYA 2V2QA 4CYUB 4J9OA 4F4WA 4ECWA 1UA0A 1YDLA 3U1NA 4LSLB 1UPMB 1S77D 1UA1A 2WBRA 4C98A 4JI4F 2Y1JA 3R7NB 3MMBA 1EX8A 4C11A 4ED4A 5HROB 3FEYB 5FJ4A 1SL2A 3M8RA 3TANA 4EBEA 2MJUA 1KBRA 3CJRA 3VAIA 3ZZTA 2XWYA 2UXDJ 1IKXB 4DSLA 3D66A 3M8QB 2DCLA 3WHIA 1SH0A 2KT3A 3KK1A 1LWXA 1TL1A 2IVYA 3R8YA 2HS3A 4LFAJ 1NK0A 4USVA 2F63A 4TY8B 2AYMA 2JEGA 2F4VF 4K4SA 1RAEB 4QW9A 3GJTB 3T41A 2MQNA 1C0TB 2DNKA 2V9KA 4BWJA 3WDOA 2ZHBA 3V6JA 2BQ3A 2VG6A 3CDUA 1DRZA 3OTOJ 2VA3A 2HWTA 1DTQA 2LA4A 4O44B 1RTZA 3K57A 4AT1B 2CADA 2HHSA 3L95X 2VDIA 1DFDA 5D78A 3BYRA 3V4MA 2QEXS 4QIVA 3UN5A 3W8GA 4LVNP 2R2RA 4J9VA 4IG0A 3LQVA 4PG7A 4Y3CA 2ROPA 3GIRA 3UNYA 4F25A 1MMNA 5J2MA 3RAMA 4KV8B 9RUBA 2DRAA 2GHWA 1HD1A 4NCAA 4RLEA 3TZYA 3AAWB 3AHPA 4ZLLA 2CPIA 2IM3A 1U1KA 1S6UA 2HMIB 2WB1D 1L3TA 4F2RA 3ZZPA 4YUDA 1Z4UA 1VQSA 2UVVA 2B8QA 3FJ2A 1Q7LB 2BJ9A 1ZM4A 4AYBD 1DARA 4DEZA 5D3GA 3B4MA 3IP0A 3JTOA 5DZ6A 2C42A 2BE9B 3MD3A 3R97A 1HQEB 3EXYA 1WHXA 4DBQA 1MU2B 2DBBA 3NAIA 3HKWA 3OXGA 2HFZA 4OX8A 5KOXA 5L1IA 5ETVA 4XK8C 4B9MA 2B4UA 4PABA 1UMJA 2W2OP 1Y11A 2HLTA 1RWXB 2RDDA 4DFKA 2AD9A 3PO4A 2MQ8A 3LGMA 4I0WA 2JEFA 2X1FA 2BJ3A 4R25A 3UDCA 2MDAA 2AEMA 1BQNA 1M1KT 4ELTA 5AXMA 4WTOB 3GFYA 1CBKA 2WVFA 2B4PA 5GMDA 4RW4B 2RQCA 5DLGA 4GO5X 2XMKA 2YNFB 1DQAA 1LFWA 1OWXA 3BKFA 3MEGB 3R6GB 4F3MA 2HFUA 1S1UB 4HI2A 2GCFA 1RZMA 3CXCR 4MFBB 3THVA 4KKOA 4WF9Q 1WNEA 3TR5A 1O0PA 2MKKA 3TAQA 3IS9A 3DLKB 1TL4A 5KFPA 2BE2B 4FN5A 5HK4A 4QW8A 4CO4A 2E5LJ 1VJQA 3BPSP 2P9CA 3BO3A 3R3TA 4ANCA 4KJIA 4WIQA 4CI0B 1NDCA 2YWWA 4UT4A 3NWGA 4FXWA 2DXFA 3EZUA 4NYZA 3KK1B 3KNGA 3RZAA 2YBVA 1CLFA 4O3QA 5IWAJ 1N8RT 3HM9A 3D9BA 1NJXA 2W1BA 4JB8B 1U0HB 2MYFA 1PKUA 2HGNA 3KWMA 3M1VB 1LW2B 4QIGA 2VASA 4M5MA 3D28A 2ZFHA 3P96A 1J27A 2LDYA 2MQLA 5E3AA 3ZTSA 1H7WA 4X65F 3BQ0A 3WC0A 4IRCA 5ETMA 2F8MA 2UV8A 2BJEA 2D41A 2GFFA 3BBBA 4DV1F 1YJUA 4OLPA 1JJ2R 2K1RB 2E5JA 2VFRA 1SV5B 3S01A 4ED6A 2B0GA 2VPXB 5FLXY 1CJKA 4IDKB 3IM8A 3M2UB 2CQ2A 3QGHA 3RRKA 4OX9J 2EXUA 1NUEA 2GJ2A 1KNZA 2DITA 3ADAC 1L3SA 5M2RA 5HQ8A 1WG1A 1Q0NA 2WZ1A 1R43A 1N5QA 2XNRA 3NGUA 4Q7AA 4OHYA 4QWBA 5IM0B 4ZVPB 3MPDA 3T5HA 3NEKA 4OZ0A 1JLEB 5F0WA 5L46A 1A0OB 1VK8A 1ZETA 1UEKA 2HQIA 3D6FB 1URRA 4CO2A 5HBMB 2H48B 2ALZA 3RAQA 5DQHA 2VOPA 3CJ0A 4KPCA 1VLYA 3OVBA 4H4OB 1JLFA 2ZE2A 1HD0A 2B7CB 4ID8A 4QBUA 2G13A 5J2PA 2RMLA 3NNCA 2C3YA 1NBEB 4ILRA 4DCJB 2B8PA 4I4BA 4DV3J 2NLWA 3LPEA 4OYAA 2IVMA 3CJ2A 2JVOA 3MM9A 4J91A 4UUXA 1WF2A 5ITHA 3BS9A 5KG5A 2V4JA 3MFIA 4KHPJ 1S4FA 3QO9B 3HVWA 1Y7PA 4RUCA 3VZIA 4KIAA 4D3GA 2IC3A 2HBRB 4DCPB 4GVLA 1RT6A 4Z2XA 4U9RA 1T7PA 5HMXA 1D1UA 1Q78A 4C6AA 3NRBA 1VRQC 2VPYB 3QZ8A 4DV5F 1ZH5A 3HCXA 5C24A 1JB0C 4KFBB 2V0NA 4IFVB 1FVSA 2M3DA 3N5FA 4L72B 2XSJB 1TUWA 3AOCA 4XTTA 3UNGC 4C11B 2W9AA 2RKIB 4WFNQ 5DDPC 2B9EA 3BYPA 4WIIA 2XO7A 1YTYA 4DV6F 1REVB 4CIOA 1RAAB 3W9HA 3QSIA 4QU7A 3O5TB 3M9OB 3ZZ0A 4U7UD 2R7TA 5ETPA 1IKXA 1PO6A 1VQNS 1BGXT 2IIHA 1RWOB 2KHDA 2FJEB 3GILA 2DGOA 2E9RX 2OTJS 2D9PA 2RH3A 3MMCA 3Q8RB 4C2MA 3EXCX 2DT9A 2QMUB 3KUEA 3T1YJ 3BZQA 3QJPA 4L3NA 1QM9A 9ATCB 2QRRA 1U7LA 2E1PA 4OI0A 2MQPA 2J6SA 1TMMA 4RBTA 1WG5A 4DF8A 3CD5A 1C0UA 3AJ2A 3DLEA 2DY9A 1AFIA 3BN4A 2E7WA 1XTZA 3BGFA 3SSSA 4MMOA 1DTTA 3R27A 1HNWF 3OT9A 3U7JA 2MGZA 4ZHRB 1RTDB 1D3WA 4QPTA 4ZJQA 1J5EJ 1LK5A 5DRKA 1KONA 4OI1A 3UCUP 3ISND 1FRLA 2ZVIA 5CQGA 3D1QA 4O0NA 4A8QA 1MWZA 1RT7B 1TL7A 4X64J 3W62A 2HFVA 1U1LA 2WSCC 3PTWA 3HK2A 3TWZA 4W4MA 2GIQA 3V6DA 4DV6J 3MEDB 4UF4A 2HW3A 4A8OA 4HACA 2X51A 3SQOP 5MAOA 1YHQS 4UY8T 4NCBA 5CYQB 3OR2B 2SXLA 1WEXA 3P5TL 4B02A 5LMNF 1VQ5S 2DGSA 1S48A 1FK9A 4DUTA 3W5YA 4A8MP 2A1BA 2H51B 3VAJA 1RYRA 1GFWB 3WIUA 2FY1A 4USUA 1EP4B 1NK9A 2H4YB 1QY7A 4RJVA 4FBUA 5IFMA 3RW7A 3T9NA 4USMA 2IHR1 4F0MA 3VVTA 2DXEA 5EHHA 1M1HA 3LOUA 1UL3A 3NBPB 2CNNB 3KLIA 2HWIA 2JX2A 2FTRA 2XMJA 3CCWA 4NLDA 3OSNA 1UW9A 1S1XA 3M2RB 4PG5A 5KT7A 4BHQA 4P73A 4JI8F 3DRRB 2CIMA 4NX9A 3N6LA 4LFAF 2DHAA 1RKIA 2FZCB 2IC3B 4RW6A 2JLFA 5H9EJ 2HNDB 2EBEA 4LF4F 3Q8PB 2J9EA 4ITSA 4DV7J 1OYEA 4HLBA 4DR2J 5DO2A 1K44A 4CO3A 4DR1F 2BE2A 5JXSA 1NMEB 1SKRA 3KLHB 2R7OA 1N88A 3HFZB 4B3OB 3MAAB 4YQWA 4FVCA 1C2PA 1JJHA 3HJVA 3ET6B 3N9UC 5F0UA 5CABA 4RZRA 2ZNYA 1FKOA 2EBGA 2QGFB 2CJKA 5H9FJ 4C97A 2PA3A 4OJ1A 4TU9A 3MR6A 3MMCB 4JI1J 3MCMA 3EX7B 2ZH6A 1I5OB 3FK4A 2XB2D 1KOOA 2DTJA 1R6YA 1PAUB 1W26A 1ZM2A 2R7VA 2AKWB 3KLEA 3JSRA 4BDPA 3W3SA 3FCHA 1IKYB 2A3JA 3WZ0A 3RR7A 3T1HJ 1VQ9S 2VPWB 3AH6A 3KMQA 1PBAA 1HBMB 4LRBA 5AXKA 3HHDA 3F56A 4ICLB 4UOFA 4USJC 3CC4S 4N41A 3QATA 1L5UA 4FF4A 4FYDA 1VC6A 1RTDA 1DHMA 2C2DA 4K4ZA 4KYZA 2AZ3A 5T7LA 3OTEA 5KFTA 1DY3A 3PIOQ 2UXCF 3P4UB 5EWGA 2X1BA 2WB4A 5HMYA 1K73T 2VG7A 3X1LB 3HT0A 4ATNA 1FRHA 1REGX 3O8WA 1PJ6A 4I56A 3W5ZA 3Q2TC 2K3KA 2POKA 3KDOA 1PILA 4IR9A 1IR2A 3T6BA 4M5JA 5LMUF 3PY8A 3G8TA 2H3EB 1BC6A 5B7WA 4YY3J 1VBYA 1XNQF 3ENQA 1S5ZA 1VRUA 5HP1B 4QIWD 4ECUA 1FRJA 4TLRA 2YPYA 3AA8A 3AD8C 2B3TB 2FZKB 1RAIB 4X66J 4QWCA 4AL7A 3J7A1 2JFKA 4LRFA 4WXWA 4TU8A 2YNGB 1YJWS 2BW7A 1MWYA 5KFJA 2M8DB 1WTBA 1CS4A 2PN6A 2K3IA 1AUSL 1Y3KA 2G1HA 4O44A 4NPOA 4WYWA 3R7SB 5KFLA 4OFZA 2HHPA 1S6QA 1SC4B 4USTA 3OTCA 2E5LF 4JV1A 4RW7A 2UUBF 1WWHA 2RE1A 1S1XB 5K20B 2MEWA 3ENVA 1P1TA 4DDFA 2ZH1A 1EQMA 2FJVA 5ETSA 2V67A 3M2VB 4H4MA 1GX5A 2JZ5A 2G2ZA 5D4OA 3DKDA 1KFDA 1YSJA 3HZEA 1IBCB 1S9GB 1NKEA 2FLNA 4B9TA 3H5SA 2HEKA 4G6VB 3ZTOA 3HSZA 3W2WB 3DU5A 2J6TA 1KSPA 2YNHA 2BVZA 3F44A 4BC9A 1S76D 1RGVA 5BJRA 2R2UA 1RAHB 3JQJA 1NJZA 3TUJC 3Q2SC 1CJVA 4F8RA 4D3HA 1YI2S 2JHEA 3SZ2A 4Y2IA 2KYZA 3G82A 4CLYA 1LKZA 2BKNA 3MCNA 3PYEA 2ATLA 1B0TA 1X4CA 1IBKJ 3RTVA 2ZBIA 1IJEB 1FXRA 2DH8A 3TI0A 1VI7A 5IV3A 4YMEA 2IA6A 3JB9k 3DRSB 1RWNB 2PMHA 4HKQA 2DIUA 2H1YA 3W5XA 1X9WA 1IKYA 3PACA 3A8JA 4NI2B 1U6ZA 3BEGB 3OQ2A 2LDIA 2APOA 2FHKA 2MGZB 4B9UA 4RBUA 2OPRA 3H0PA 4MKAA 2OAUA 3QRPA 2EG1A 3QWPA 3EVMA 4EWTA 2R8KA 1BHNA 5FDLB 3LGHA 1Q95G 5EWFA 4ECQA 3RRGA 4JI1F 4KKOB 2DR6A 1OIAA 2XS2A 1IM4A 1DQ8A 1WC0A 1SQEA 1OQ6A 1QDUB 1VMBA 2O5DA 2MKIA 3KLVA 2LECA 4X4UA 2NREA 3QJLA 4ZPWR 3T6JA 5KFBA 2NXUA 2UV8G 4AQYJ 3IBCB 4YR0A 3I96A 2DPJA 3V81B 4NLVA 4Y0FA 3PXGa 1X7VA 4IFYA 1TTHB 1UEUA 1WJ9A 2Z57B 4WZMA 1S9FA 1RT3A 1VRUB 2FYXA 2HKEA 3I6PA 3F41A 2OSRA 1NK8A 4LFCJ 4QWEA 5A0YA 1D9FA 4UQTA 3TAMB 3AJDA 3FKBA 2MLZA 2J7KA 1HQUB 2ZHOA 4YP3A 2ADBA 1G2EA 3H5YA 5F8LA 1AFJA 1YGYA 2V4QA 1X0FA 1NHUA 3L09A 4NLXA 4J9SA 4K4UA 2FHMA 4HI1A 4JOUA 4O3PA 1FNOA 3PW7A 4RW6B 2W2MP 4CNZA 2AQ4A 3KLGB 4I64A 2LCWA 4JI4J 2Y8YA 1J5OB 1DURA 3W64A 1KQFB 2PE8A 4E2FB 5A8KB 2B9YA 1GTHA 1RK8A 4GC7A 2IBKA 2PFFB 2CPEA 4ZJOA 4A48A 4F3OA 2YY3A 1YWXA 5KFGA 2V8PA 4OZLA 3HT3A 4B3OA 3K5MA 2ZH8A 3BO2A 1SIZA 2R8JA 2RVJA 2ZITA 2ACMA 3W2WA 4YS2A 5I3PA 1VQ7S 1FRXA 1JLEA 1JXVA 3BSCA 3Q89A 1HR0J 4NXNF 3LWLA 1FEEA 2PIIA 4UZCA 4YDXA 4UW2A 2H54B 1C1BB 1TMJA 1X5PA 2CWKA 1WHVA 2IYGA 4BWMA 5D6GA 4CLPA 3LAMA 2HHQA 5HJYA 1JLFB 3NP5A 4DL4A 3C6UB 1K1QA 3S8SA 3EWGA 3PYGA 2XM3A 4X84A 3OVSA 4ZLPA 3GSIA 4O3NA 4FNHA 3IWLA 3PX4A 4DU7A 2HVHA 2IDEA 2RRAA 3BBFA 5DG7A 5EN1A 3TZWA 3Q8SB 3HHNB 3B82A 2GMLA 2V4JB 1RADB 3ZXWA 2DPIA 3SDEA 3VAHA 3CJ4A 4YB1P 4R5PA 1FDDA 3E3XA 2JEIA 2DGXA 4JP8A 1HPZA 2VU5A 4FNIA 2E66A 3ZTPA 4A47A 2CG4A 3PX0A 3RB3A 3CJ5A 1IBMJ 4O23A 2EFQA 2MQMA 3MPWA 3K5NA 3FQLA 4OZJA 3KJQB 1WC3A 2KM8C 2KT5A 4ZPBA 2MSTA 2AX0A 1U8WA 1R31A 1VS3A 2DO4A 1CG2A 4OV1A 1S7IA 1YBTA 3MCOA 2YNIA 5GVQA 3UDVA 2KFYA 2HYIB 2IY5B 3RBDA 3B54A 3HHKA 2MZ1A 2LEBA 1MROA 4OL8A 5CD4A 2DNPA 3N4WA 3PEHA 3S6EA 3M8QA 2DH9A 2FY8A 4JV2A 1UVLA 2ERRA 4NLWA 3LP1A 1UKUA 1CS4B 2KJVA 2UVUA 5BXIA 2E7XA 4LVOP 1U2CA 1FT8A 2C3OA 1TUVA 3M9NB 4F2SA 4RW9B 5BYRA 4YR3A 2M52A 4IH5A 5KG7A 3E51A 1SI9A 1TKXA 3O6QA 4NXNJ 4J9KA 4TN2A 4ECSA 1HNVA 2XZWA 2Z2MA 4ZS6A 4U7CA 5C25B 1EKSA 1N52B 4O0IA 1DQ9A 3QMQA 4RKUC 2VONA 4LIWA 2AYEA 1FJGF 3KLGA 2GC8A 5KFQA 3BB5A 3PNIA 5KFWA 5I3UA 1EB0A 5FD1A 1PGZA 1B4SA 4NEYA 1QAXA 2CPHA 1RT1B 1C4AA 3LP0A 1JQGA 1RP5A 4URQU 2YKAA 1BE4A 3MHYA 2GVDA 1L3VA 2HVDA 4C48A 5B0BA 2OJ3A 1UVKA 2BKOA 2VUGA 1NAQA 4MK8A 3DDIA 3CJTA 2XY6A 4WCEQ 2BM1A 2H65B 4R0EA 1D9DA 1S1WB 3MMAB 5DG8A 2OD6A 3M6XA 2FGCA 2HGLA 2CQ4A 3A3NB 5DDOC 2WVDA 4DQQA 1JX4A 1NSQA 1UVNA 3QJJA 2HAIA 3EGNA 1TKZB 4I1TA 1S59A 1Y00A 2IYIA 2LA6A 2M4MA 2ZBCA 2CVIA 3C16A 4G1IA 2PGCA 1SJ4P 4NEZA 4UTGA 4WE1B 4N77A 3QPIA 4DI6A 1V9OA 2MZSA 3DLGA 1BQNB 2JH3A 2HFOA 4RUBA 5D15A 2NXEA 1T05A 1SXLA 2H4WB 3MPUB 4NYOA 3HSDA 2OPSA 5EX3A 3CCMS 3OSPA 2JOQA 5FDLA 2LXUA 4KTQA 1VR6A 5D0RA 3FMWA 4ZK7M 3MR7A 2FJAB 2RD5C 1N32F 2VG5A 5I3QA 1FCAA 2Z8QA 3SI8A 5GAHU 1NK4A 3QBCA 2EEYA 1RBLA 5L9XA 4I2QB 1NKBA 2J6UA 4U8VA 1UZDA 2XS7A 4DUYF 2ZWOA 1GXUA 2HQCA 2QG9B 2EC2A 2VFUA 2R7XA 5GADU 1N5VA 1NHKL 3FSXA 3R5JB 3IN5A 2FJXA 1I94F 1F2GA 1HFEL 4NRTA 4X64F 1T3NA 3IXQA 1YQHA 2ZOMA 4EZ9A 1CPZA 4PG6A 1GEHA 2JC1A 3BSNA 2GHVC 4DUZF 2AX1A 3MTJA 5L1LA 2BOAA 2LQ9A 2XULA 4JI7J 5KFMA 2DEJA 3BGRA 3A3OB 2XGQA 5KFDA 2PO4A 1HQUA 1GXLA 3L9ZA 1W2IA 2L48A 4ECXA 2VD3A 4DR3F 4WFXA 4P71A 1AUDA 3IWNC 1QUPA 5C7PA 4PXDA 1LWEA 4CLUA 2XYGB 3GTYX 4KH1B 3DLBA 2E5HA 3LALA 4C9DA 2YQ3A 4CM2A 1JLBB 2YWKA 2F5GA 4DL5A 4FF2A 2H5JB 2YKPA 3ONQA 4PAAA 5IC4B 1MMLA 4KV8A 2QO3A 5EUHA 1UFLA 1XBWA 1A6LA 4ECVA 1WI8A 2VF3A 2X1AA 2AT1B 4B9LA 5E3CA 5U47A 2KU7A 4OJ3A 3R6LB 2YQ1A 4KGXB 3W2VA 5JVGQ 2G2OA 4CRJA 2MZRA 3LP2A 2KRBA 5KFNA 3PO5A 5ADZA 3TP2A 1LWCB 3QIPB 4ZP8A 3EZ5A 3QRQA 2RSQA 3QT5A 3SXLA 2ZHAA 1H7XA 2WW4A 3SQGA 1HI1A 3MM7B 3M6VA 2J9DA 3C8YA 4RU9A 4HH1A 2HQFA 1KS2A 4PG4A 1WC5A 1SJ1A 3K2YA 1OSCA 2K2PA 2LQJA 1EKRA 3MMAA 5E3PA 1X60A 5FLXU 2ZM6F 1KLNA 3DNCA 2IMWP 3UD5A 2HHXA 3BN7A 3MFHA 1U47A 1IUJA 1JLGA 4NE9C 1FXDA 1HBUB 3MOJB 4FZVA 3IRXA 4GO7X 1CJUB 2CG8A 5E3QA 1CC7A 4X4QA 8RUCA 3PW2A 5DM7Q 1FDNA 2I6WA 2W8KA 1Q81T 4YB7A 4RUAA 3RBXA 1KR4A 3QO9A 1VQYA 1RAFB 1VQ8S 4MH8A 1MNEA 2COLA 3Q8UA 2HVEA 4KHMA 1VQLS 2A6MA 5CYMB 3JSMB 3OFEA 2Z2LA 3CD0A 2KJWA 4O4GA 5KFRA 1S6PB 2RF2B 4LSZB 5HI7A 2BXJA 2ASYA 3ITHB 3I31A 2RHSB 1OPZA 2DGWA 1RHUB 2W24A 4NLPA 5KFHA 4OZ2A 2JJ4D 4I2PB 1WELA 4CTAA 3AD9C 1E6VA 4I2QA 3I5CA 7AT1B 2DXDA 4IRKA 2WSEC 5D0GA 1R0AA 1F0XA 2IBOA 4ZCKA 2BJ8A 5BYSA 3NNHA 1FHTA 2HRYA 4N8NA 3AOBA 5J1EB 3FRZA 2OPQB 3PX6A 3FFIA 4OMFG 3P6YC 3DRPA 4KPYA 2P9EA 2UUWA 3VGSA 2WVCA 5EGYA 3HHLB 1ZAVA 5LXRA 3LWMA 1EQ0A 4LF9J 2PC6A 1YK9A 2O01C 2RHQB 4PUOA 3WBZA 3GV8B 2B51A 2X7IA 3SCJE 1UW4A 2LEPA 3MR5A 3AB2B 4IYQA 2V8HA 3O2IA 2YPZA 3TRGA 2K1RA 1ZAWA 2QJ3A 5MLCV 1SV5A 3TVYA 1S9EB 4WXOA 2PT0A 3W61A 5IWAF 1ZYQA 5JUMA 2ASLA 4NZ0A 4DFJA 1SJFA 4B9NA 4LF5F 1KLMA 1V5VA 4JI0F 1X4BA 2HHVA 2FLLA 1S97A 4B3RF 4U95A 2KKHA 4A4JA 1YRUA 3NGDA 2QX0A 1YKWA 1FXLA 5HN0A 4Q0BB 1X4AA 2GVDB 1IR0A 2CZ9A 2N7YA 1HNXF 5CXTA 3LP2B 3OHAA 2Y3YA 1RWKB 3SV4A 1EJ7L 3MCSA 2NYIA 2BR0A 2L08A 4N76A 1V3RA 3H5UA 3HI9A 4NA2A 4UUWA 2MKSA 4WZQA 4KE5A 4G1QB 1Q8LA 2AW0A 4NYPA 2W01A 1HA1A 5KFFA 3H59A 4GKKJ 1P6TA 2M88A 1KTQA 3CWJA 3VCDA 1RHJB 2KXFA 2LEAA 1P1LA 3CB4A 4HHUA 6FDRA 1HR0F 1ITPA 3VQSA 4USHA 2BX6A 1JK9B 2Z2ZA 4EEYA 2O3DA 4HTIA 4ZVQB 3TVZA 4DPOA 2HBQB 3RB0A 3NMAA 3H4DA 2GO9A 2DNGA 4DSEA 3TW0A 2DH7A 3C46A 3MF5A 1JLCB 1R8HA 5A8KA 2ILYA 3QGGA 4KFBA 1AXQA 4IFVA 5I42A 3FQKA 3QNWB 4OX6A 5E7OB 5ETRA 5FIIA 4ZVFA 5L39A 3VAMA 3T5KA 1YX2A 1K9MT 1XNRF 4JI5F 1HNIB 2QA1A 1UJ5A 3KG4A 3UFCX 4KHRA 1IKVA 5J2QA 2O66A 2YX7A 4JI3J 4PWDB 1U0SA 2CNOB 4I2PA 5BYQA 1RWPB 1T9XA 1FJ7A 5D77A 4LFBF 1F60B 3PDNA 4WFZA 1SL0A 1FKOB 1FEHA 1SQGA 1LV5A 3M05A 4ER8A 3KJFB 2YWGA 1QAIA 4ZKAA 1FWLA 1B0VA 3G8QA 1S0VA 3MAQA 1JXLA 3HVRA 2CPXA 5DZ7A 4FS1A 3PFOA 3BSOA 1K47A 2G0IA 5KFCA 3KLEB 1LWEB 3GFZA 3I9V9 3MDFA 2CPFA 3K59A 2ACYA 5GAEI 1RT4A 1IVZA 3N01A 2E7VA 1JLBA 2IM1A 4FYVB 3SIPB 4M5DA 4DHVA 1D9AA 1HNXJ 1C1CB 3EE3A 2GS8A 5GADI 1B99A 3MWBA 4WP9A 2W4PA 3MECA 3EJMA 4LFCF 3IR6B 3H98A 5HATA 1U1MA 2HNYA 1PYSB 5GAHI 2DEIA 2I5JB 1RBAA 2KXHA 3US5A 4MKBA 3O44A 4Y2CA 4OIXA 2N7CA 5H1SV 4Q0BA 1LK7A 2J9DE 4EZ6A 4DV2F 3DHXA 1AZSB 5A8RA 2MQQA 1MROB 2UU9F 4K8RA 1FK9B 1PC4A 2YVSA 3QGPA 2ZOFA 3CJ3A 3OXLA 3GG0A 2QMXA 3CJ8A 4LF9F 3CSKA 3BV8A 4WBFA 3CMAS 4G1QA 2ZBQA 3UVJB 3ZNUA 5A2QY 3U02A 1SKWA 1KFSA 1QVFR 3JTNA 4F4KA 3DMJA 2MKCA 4BBYA 2OLWA 3JQMA 4XO0A 3THPA 1H98A 5HANA 1Z2ZA 1GMWA 4ZITA 3NCRA 3TUPA 1CJUA 4JI5J 1NZ8A 1WKLA 3GE9A 5T41A 2IRXA 1HHSA 3JAMU 3AA9A 1QD1A 5C25A 4DXLA 3MEEB 3R5BA 1LW0A 1M0SA 3GP9A 3MR2A 1ACMB 5AJ3J 3KNAA 1XMOJ 5C42B 4Y28C 2MB0B 1FVQA 5CYMA 3JSMA 1JKHA 1M1GA 2K06A 2MKJA 4ZPCA 3VGUA 4DL2A 1GT8A 3M2VA 2OGUA 4P52A 5AE2A 1WI6A 1S49A 2RU9A 2HVZA 3R1LA 1FFGB 1UJ4A 2QYCA 3D1OA 1WOOA 3RYLA 1NSPA 3G96A 2Y1IA 1U1PA 3IR5B 4K2XA 3ILOA 2HLUA 3DM2A 2QFIA 1NCLA 5LL6d 4ANEA 1SKUB 3PRVA 3VAFA 4ZP9A 4GKKF 3POTB 2VIHA 4X65J 2QSFA 2RRNA 4L74A 2HZAA 4DLGA 4MTPA 4WKRA 5L1JA 3A12A 3D6HB 3SSRA 4B3TJ 1S57A 3GR0A 2DIVA 3U1LA 1F9FA 2UZAA 3AT1B 1HMVA 2BANB 3DN9A 5CH7B 5KFOA 4HT5A 2ZH4A 2CFXA 1LW2A 5AXNA 1KVJA 4M5LA 3IG1B 2WOMB 3A8KA 2HIYA 1Y10A 1SIWB 2VKRA 2ZD1B 1U8SA 5T14A 4ANDA 3MEKA 1RT4B 4OYPA 3OL6A 4OLOA 1D09B 1ZPVA 2GJIA 1H74A 4IQMA 2MZQA 3NS5A 3EICA 4KRWA 5T7LB 4ZVGA 1N54B 4X66F 1N56A 3G2XA 3UQSA 2W4CA 3AJ1A 1HL6A 2R2TA 1RXOB 3HF5A 4DV3F 3I0RB 3NAHA 1FKPB 4MK9A 2Y8WA 2RJZA 2DNYA 2Q3PA 4NLYA 5AT1B 3K5OA 2OEMA 3J81Y 4GKJF 4A8YA 2KI2A 3NOCA 2R9LA 1AZSA 1RU1A 1KVKA 3GYGA 3P45B 5CCMA 2WK4A 3GIKA 2W8LA 2CZ4A 1MSWD 3OTDA 3MUMP 2E1CA 1Y9OA 4NXMJ 2BRLA 1CULA 1VJWA 3UVJA 2HGMA 3OW2R 1PYOB 1XR6A 4EK2A 5AJ3F 1KHWA 3OHBA 2KG1A 1TUGB 3L7UA 5DETA 2HSEB 3TA1A 4DS5A 2AGQA 3BH7B 2UVWA 2FB0A 3GG1A 3MUTP 1QSSA 3IC1A 5KT3A 5CCLA 3K5LA 2HBZB 3MM9B 3VF0B 2K8GA 3EGVA 2Z56B 4CLZA 1RHMB 2CZVC 1MLAA 1Z2LA 2VKZG 2YQ0A 5I42B 2XZDB 4W90B 1EAYC 1S7HA 3LW5C 1TKDA 5J1NA 3KXDA 3M32A 4HDGA 1S72S 3CW2C 2V63A 4DPYA 3OL8A 3HD2A 2GW8A 4QR2A 3I0SA 4F0KA 4MT1A 3EGZA 4PWDA 3JQKA 1LWFB 3C15A 3DYAB 2R4FA 1YJ9S 4DMZA 2P9GA 5K8NA 3DFEA 1U26A 1UWBA 2EKNA 2KH9A 3N79A 4DQPA 5DGAA 3G82B 4J9MA 4H4KC 1RAGB 2QZ8A 3MI7X 3N6MA 3ZO7A 1JLQA 5C2CA 1E6YA 5GAGU 1HQEA 4Q44A 1YIJS 3CC2S 2CJYB 4ECRA 4PWUA 2V6AA 3CDEA 3DRSA 3PJXA 4YR2A 5KG4A 1VBZA 4NA3A 3CO9A 2QLWA 1RA6A 2QYGA 1RT5B 2YKNA 1GNKA 3MM6B 3A1YG 1WEZA 2KVIA 3VGTA 1NB2A 4CO1A 1IKWB 1VBKA 4DL6A 1XN9A 3RBZA 1MG7A 4RR5A 4EU0A 4CYUA 5CHCB 6FD1A 4J9NA 3CCQS 3ICLA 1G1XA 3ETMA 5KFZA 1IWGA 5A6WA 3HVTA 2HWHA 3ITHA 1EETA 3PFEA 1EIYB 2J8SA 4ED5A 4K4WA 5KG2A 4MFBA 1AT1B 3HXMA 2J0SD 1JNZB 1UJ6A 2HVIA 3PRBA 4ECYA 4GKJJ 4DPUA 4JV5F 4E8UA 3MEDA 2R7QA 2Y1LB 4HVZA 4IFYB 4J90A 4F4YA 4PXCA 2D69A 2NPIA 3TA2A 1TL1B 1R8BA 4FXDA 1JMTA 2FIUA 2ZNZA 3KUGA 4S0MA 3JSYA 4RNMA 1DZ5A 2LXIA 4G1PA 2ZC4A 3D67A 3CJQA 5A0YB 2BRKA 4IO9Q 4R8UB 3TAMA 1IN0A 1FO1A 2Z2YB 1ICEB 1U0HA 4U7UK 4ILLA 1WC6A 3CPWR 1SCJB 1T9TA 1M5VC 3WQPA 1QLNA 4FYYB 4O3OA 3TUZC 5IT9U 1N0UA 2HFNA 1HYSB 3FEZA 4RNOA 1S9EA 1FDBA 2QL9B 2HZCA 5KT5A 5DLFA 1Q16B 1RTIA 3I55S 1T9WA 1NXIA 2B7BB 2CXEA 4KC5A 2HS0A 5F8MA 3DRRA 1SB6A 2MSSA 1QAJA 3DLLQ 1FF2A 1U02A 1R8PA 3LPYA 4ES1A 1MW7A 2NSCA 2IVFB 4ETXA 2IAJA 2GA7A 3AFGA 2CJ9A 3M32B 4X62F 4KHPF 5I3UB 4JV5J 1RLCL 1RLDA 3CC7S 4C0BA 2W7AA 2PSZA 2OI2A 2B4VA 1GX6A 1N5SA 2GMHA 3NLCA 3IRWP 1KQSR 2YWFA 2NZ4A 1GH8A 2PD1A 3ZZOA 5E33A 5F41A 2OELA 4RUHA 3D2WA 4DL3A 2UXCJ 4MKYA 2R8HA 3LTOA 4KO0A 4DQRA 1JNRB 3W60A 1T03B 1NK5A 4I67A 1TP7A 4PKDB 2GO8A 4DQIA 1JLQB 2WSFC 4NLOA 3QFHA 2UUTA 4EUVA 2KG0A 3HP6A 2UVRA 1K0TA 2KM8B 3AD7C 2LXFA 3D1HA 3DGPB 1R89A 2DRBA 2XGPA 1K0VA 4DSFA 3CT9A 1HWIA 1TKZA 3IG1A 2XMWA 3QT8A 4UOGA 4AL6A 2G4BA 2BACA 1AW0A 2CJQA 4P72A 3NGRA 1KQGB 2C2NA 4RW4A 3MGJA 1DBDA 2FDNA 2ATCB 1CEZA 5SZTA 4IH7A 3K89A 2C2EA 1M90T 4DCOB 4ICLA 3DC2A 4MKVA 1S1UA 3J7YI 2R3VA 4TU7A 1OS5A 2QIFA 2QC3A 3KG1A 4U96A 1CQMA 2NSBA 4DS4A 4HH0A 3PCOB 2W7PA 4NCGA 2XYPB 2C28A 3MZIA 4M95A 1FX2A 1WSRA 2R42A 4K5SA 3WX8A 1YJVA 3SYZA 3GSDA 1RKJA 3M8WA 3G9CA 4ZOSA 5JJBA 3C14B 3BBCA 2DHSA 3HVAA 3IMQJ 2LU2A 4DQSA 2I2YA 4IH6A 4Y65A 2JEJA 1WC1A 2FD2A 2IM2A 3KK3A 3MM5B 4MK7A 3EGWB 1T95A 2I38A 1PSDA 3OVAA 2MKYA 2B6AA 1RCXB 1SVDA 3OL9A 4ERDA 2YNGA 1HWUA 4LR8A 3ZZZA 1OJ4A 2ZOGA 2HNZB 2VBZA 3NGKA 2MHEA 3ZNJ1 1KD1T 1X31C 2CA9A 3S7RA 4AQYF 5KTQA 3P3DA 2R7RA 4KAIA 2HK2A 4PXBA 4C8ZA 1P9YA 1RA7A 4P6QA 4E98A 1C4CA 3GCXP 2XCPA 2H5IB 2PI5A 8AT1B 5LSRA 2PMWA 3SBMA 1F6TA 2MHNA 2W4DA 2I5JA 3MM8A 4N47A 1WOPA 4DPTA 3V4IA 1HBNA 5IT4A 2FJDB 2K7JA 2IAJB 1LWFA 1ZM3A 3I4HX 4JBCA 3Q22A 3DYAA 3HLUA 3ZC4A 1O51A 5IM0A 3MOZA 4CO0A 1U1NA 2HS4A 2MJNA 1N33F 3L4BC 5A8RB 3SMZA 3Q86A 4AL5A 2DNOA 3QT6A 4I69A 3NS7B 4HACB 3FSYA 3SFUA 1S1WA 2M2BA 2GVZA 4OJGA 5EWEA 1FJGJ 5HBMA 1XNRJ 4DX6A 1E6YB 2OPPB 4DU8A 4ECTA 2QLBB 3N0VA 3EDQB 4OJHA 3CIMA 1VIOA 3BF4A 1HBOB 1TVRA 4OHWA 4NXMF 2HHTA 1EP4A 3A3PB 1J5EF 5HL7Q 5E2QA 2GGPB 4DN0A 2BJ1A 3PG9A 4NLSA 1VQMS 1VHIA 2XTJP 4HEA9 1KHVA 1RU2A 5CZXA 2Y1RI 2FGOA 2R8IA 4LIRA 3HZGA 2ILZA 5HVFA 3AB4B 4C7QA 2YKMA 1M5PC 3C19A 1Y5LB 2EKYA 3M2RA 4B3TF 1JKHB 3GR1A 2OIHA 2HAFA 3GONA 3P8BB 4N8OA 3O3LA 1X4HA 1ZM9A 3PYFA 4F50A 2CQ0A 2RS8A 5I4MA 3W9IA 2ZJRQ 4DV4J 1N36F 2Q1LA 2DISA 2RB7A 2A6OA 2KZMA 5HROA 3FCVA 3C6TB 1N33J 4MAKA 4ID5A 3UCZP 2HHUA 1F1BB 2RIJA 2ZUGA 2A18A 2CJXB 4QYZK 4PWWA 2F1FA 5CA5A 2MQOA 1N6QB 1I1GA 1RHRB 2NXCA 2VBXA 2FVRA 4TY9A 3A13A 2OMOA 1F5CA 3QAEA 1KTVA 4QZVB 5IC6B 4CNYA 1M5SA 2NUUG 3KFWX 2DNZA 2J9CA 2F9DA 1KC8T 4KSEB 1YVFA 1KDNA 3L7OA 1HW8A 2G9OA 2ROGA 3CDBA 3CCVS 3TAPA 2WRMA 3FCWA 4IOBA 1Y5IB 2HBYB 3CCUS 2VODA 2HNZA 1RTIB 1DTTB 1SBRA 2DHGA 2QL5B 2DNQA 2QSWA 4I6AA 3CJKA 1TKTB 4F26A 3PW0A 3C3LA 1S1TA 3M8PB 1TV6A 2AF6A 4K2JA 4PYAA 1PAEX 4OZ3A 1GMVA 1GK8A 4MIAA 4TKTA 4CQ1A 1VCTA 4F7VA 5DM6Q 4B9SA 5L8RC 1BQMA 1WORA 1YJRA 2FHJA 3LO3A 2V2ZA 1X4EA 3HHEA 1PCAA 1SC6A 3PVXA 1LWCA 3CTRA 3V4IB 2QL7B 2KB2A 1Q1KA 2N4CA 2BQRA 1IXKA 4ZMMA 1Q86T 1Q8IA 2DB1A 5CYQA 3OR2A 4USIA 2D3O1 2E29A 3QAUA 4KH0B 4JI2J 3DOKA 1FWKA 2EFOA 4WWSA 3CCJS 2AJQA 2NYHA 2B9WA 3OUYA 4IOAQ 1R8AA 4KO0B 5K5MA 5E3RA 3NY0A 2C2MB 2OPPA 5HP1A 4ZA1A 3G6YA 2M0GB 3TOQA 4K4YA 3TQEA 3CMES 4GMKA 3NOGA 5F3TA 3OJUA 3M8SA 2PFDA 3T1AA 4ED8A 3TX8A 1SKSA 1TVRB 4H54A 1TZ0A 2HFSA 3CCRS 3GJSB 4LF1A 4M5GA 5GAGI 1SL1A 4LRAA 1FJCA 2DHXA 1NPKA 2VV5A 3Q8QB 2M5YA 2N3OA 5KT4A 1WKKA 2YXLA 1SH2A 4DV2J 1S6OA 3V2UC 2PI4A 4B3MJ 2ZM6J 4P74A 5KAKA 3D6TB 2CQCA 3SCIE 2D74B 4XDDA 2RILA 1F5AA 8ATCB 5D0EA 2ZH7A 4USKA 1NHVA 2D3OR 1QTNB 3MUVP 3LGNA 2Q66A 3FVYA 5LM7E 3KJVB 4NCGB 4JUZA 2OFGX 3PJ9A 3CDWA 3UDEA 5CAAA 1XC9A 4IR1A 1IQTA 2YX1A 1WD6A 4ZLNA 2XLJA 1Q4RA 3DLJA 1G4CA 3AXKA 3QZ7A 4DV0J 4K4XA 1IKVB 4BCAA 2ZJQQ 4FP9A 4WFBQ 1VBXA 5KG0A 4PG8A 1FESA 1ZBTA 2XSFA 3GJQB 1RBOB 4ID5B 4ED2A 1SJ3P 4RU2A 1ZPWX 2E5IA 5G4DA 4EBDA 1RJJA 3H5XA 4KT0C 3GYXB 1Q82T 2X3DA 5D4NA 1DLOB 1WUUA 2AJ1A 3H2LA 4NLGA 5DQGA 2RU3A 1T3OA 4P75A 1NEEA 5HJXA 1NJYA 2QA2A 2KYXA 2QTWA 1ZZFA 3OTBA 4WP8A 1FD2A 5F9NA 3HJFA 2DY1A 3M1VA 5D4LA 2V50A 4F4AA 1RT5A 2C2OB 3TJ9A 4RW9A 4EGLA 4IG3A 2Z4PA 4XPCA 3K5PA 5HLFA 1FRMA 2VZ9A 4ZVTB 3VTIA 1HIYA 1SJQA 5DS7A 4DLEA 1FWPA 1X9MA 2D7SA 1GMWD 4M5DB 3TX0A 2V5HG 4RNNA 1UVMA 2VB6A 2N3LA 1QVGR 5A2QU 3QYYA 5K14A 1ZS6A 3PHTA 3MECB 3Q0AA 2J7UA 3JYTB 2IRUA 3CD7A 1NNDA 1TQLA 3CNQP 1DAXA 2F8HA 2RAQA 2H9ZA 4USWA 1B70B 3B8HA 3M8ZA 4K5RA 4ES2A 1T94A 1U25A 4FKYA 1LNQA 2HPUA 1VC0A 3W66A 1B64A 1RT1A 4LJMA 1FRKA 3ULHA 5LSLA 1U48A 2OMLA 4FPIA 4F4XA 2CQPA 4MIWA 3G8SA 4EBCA 2FUG9 1HNZJ 1N32J 2E1MC 3W8PA 2HURA 3E2EA 2M8HA 4TQSA 1T0TV 2BE7D 3BREA 3W65A 2DR7A 1HWJA 2JFDA 1RT3B 2GX8A 4OHZA 4A8FA 1ZTTA 2KFZA 2FZGB 2ZKTA 4RL1A 1FI4A 4H4OA 1WSVA 2ZUAA 5KT2A 1BWEA 3DMJB 5SUHA 4CH0S 2ZZNA 2E1RA 4OYOA 1HYSA 2F65A 5F8GA 2N82B 2AJ0A 4DV7F 3DCAA 4DPWA 4LF4J 4M94A 4WE1A 2FLPA 1WC4A 3IM9A 2R7WA 3DLGB 4A8XA 4TYAA 2J0WA 2OD4A 3QGIA 2IA0A 3PM9A 2P6SA 2JLGA 2VICA 3R5AA 2V9WA 1S9GA 2ZH3A 3GB0A 4K4VA 2C2KB 3FEXB 3TARA 3VZHA 4EO8A 2GQCA 1RTHB 3IS9B 4FYXB 2AEJA 2C3PA 3NCPA 2RKIA 1NH7A 4HHHA 2QMWA 3VWSA 5LOQA 3NCQA 3T3FA 2H5EA 4P2XA 3ZTQA 3VALA 1ZZNA 2DVIA 1PYTA 2A0FB 3Q83A 4DX5A 4V1Ak 3ILJA 6AT1B 3OJSA 3CULA 3QRRA 3IAM9 1WDDA 2XO6A 1U49A 4ED1A 1VK3A 3NXZA 4N7TA 1C1BA 1UZHA 4OX9F 4ENOA 3HPOA 5M2PA 4NLTA 2AHOB 1IR1A 1GXTA 4O4RA 3VVUA 1RABB 2F3JA 4F3QA 1NJIT 2GQQA 5CZVA 4ZP7A 2ZKUA 4A8WA 2W2NP 1T02A 4LBIA 1XMBA 1BQXA 4DR7J 1Q53A 3ZZRA 4X4TA 3CJKB 2XCAA 3M6UA 1S0NA 2VFVA 1IM6A 2EC0A 2P6TA 2J8AA 3D3BJ 1C1CA 2BBEA 4IO1A 4CLTA 3CE8A 1HQ2A 1YJNS 5F3ZA 1BQMB 2CQBA 2C3MA 1LQ9A 3DDKA 3DHWC 3N28A 4ZJLA 1M5KC 1TFWA 2BKPA 2O67A 1UVIA 4LSLA 1V3SA 4F04B 1AA1B 1XJWB 4J37A 2DNRA 4ETZA 2XMAA 1ROFA 1HARA 2ZWPA 5THWA 2XZTB 3R9LA 2IRYA 5M2UA 3SV3A 2KTQA 3THTA 2FC8A 3S1TA 1KEKA 2FPHX 2U1AA 3KDNA 1G7CB 4Y2KA 3J7AN 2Q43A 2HHHF 3I0RA 2EI5A 2QFJA 4ED7A 5KFKA 4X4NA 5IT0A 1H72C 2BZ2A 4XAKA 4DR4J 2AJ4A 1SPBP 5K8MA 3GIMA 3VAKA 2XLKA 1WOSA 4WP3A 1R3NA 4DSJA 3UD4P 1IBMF 3J81j 4ZPTR 1OY8A 3KUHA 2B6AB 2LQ8A 2KO1A 2FVQA 1N0VC 2YTCA 2V2KA 5J2PB 3TQ1A 4OHXA 2GNKA 1RACB 4ECZA 4CLFA 2QA4S 2X1GA 3HHLD 3KHGA 3KHLA 1JLGB 1OYDA 2QLXA 3M8YA 1LXJA 3DDNA 4KGVB 2EPIA 4PYDA 4ZVOB 3NBPA 1LEOA 2DNHA 4ALZA 3NGTA 2MPUA 1RT6B 4KGZB 4QOTA 1TKXB 2J7WA 5ETLA 3KK2B 1Y5NB 4KGKA 2WW8A 4LT6A 3WIVA 4F67A 3O1LA 3CCLS 4JI6F 1SC1B 1UFKA 3GQCA 2V8DA 1S4EA 4M1KA 1YLXA 4NMXA 4L76A 4OYIA 1ZAXA 3I4PA 4PPDA 5D0HA 3DI6B 2HNDA 2F7VA 2XMMA 4KGMA 5A6PA 3H4BA 3AQPA 4FXVA 4WK1A 3ILLA 1S6PA 1F9EB 5AXLA 3HFKA
chains in the Genus database with same CATH topology
2PEHA 2MZJA 4Q8EA 3KLHA 2DGVA 2XC9A 1RWUA 2FVSA 2IMOA 3I9ZA 4LUBA 1QSYA 5J1EA 2VC0A 3DOLB 1D8ZA 1FERA 5B09A 4X4RA 3MPYA 4QIEA 2WAQD 3HKZD 3IR7B 5DJBA 2WOMA 3K7RA 2ZD1A 4OI2A 1NH8A 5DDQC 2M7SA 4NLRA 2N4DA 4JYAF 2XEXA 3B78A 4DL7A 3MM6A 4OZ5A 1TL5A 3OLBA 2DR5A 1U24A 4WU3A 2OPSB 3SFGA 4L6V3 3JYTA 1ULRA 2IJFA 2L9DA 3GWCA 1HWKA 4TLQA 4NRUA 4WZMA 1OPIA 3H25A 2E9TA 3WC2A 4EFAC 2VQFF 3IWXA 2DK2A 4P7TA 2VG7B 1H2VZ 3X3UA 2YNIB 1R27B 1YBAA 1VRTA 4PRFA 1FKAF 2DNLA 3SEOA 1JXEA 2ZH5A 4Q45A 3G71S 3HO1A 3A8EA 2VOOA 4K4TA 1GQEA 5KFXA 2DNMA 5CD4H 3BM7A 5KFYA 4DFPA 3T5LA 5B0EA 2W9CA 1R7IA 4C8KA 3QLHA 3BGRB 2FVPA 4ZVEA 1TFYA 2ZZMA 3V6HA 1TKTA 3I32A 2B9XA 5KG3A 2EG2A 4M63A 1QE1B 4A46A 4RW7B 4FVMA 1VIXA 5B0CA 3KK2A 3UD3P 2D1CA 3DRXA 1W2BR 5LSOA 4ED3A 2B5JB 4HTJA 2AGPA 3I0SB 3UI3A 1Q8BA 4AE5A 3P49B 1HNZF 2R7UA 4O3SA 2DGQA 4DSKA 1HI0P 5G0RA 5J2QB 3MMJA 1AROP 4F02A 3KHHA 5KFAA 1S10A 1IQZA 3E01A 2WCXA 4NZ6A 2OO4A 4I68A 1TAUA 3SQGB 3OPKA 2XNQA 2EFNA 4Q2LA 5L38A 2VL1A 1XMQF 1LXNA 4KR0B 2YH1A 5KFVA 2BDPA 1OQ3A 3FZ2A 3G6VA 1X5TA 4LF7F 2CRLA 3ZZUA 2YKNB 1X4GA 4Q2MA 4CT8A 2W9BA 3U1MA 2R7SA 4UY85 4H4KA 5DG9A 1XR7A 3SSQA 2L9NA 2QA4G 2DR8A 4ZPDA 3MTKA 3OV7A 5IS2A 1NKCA 3F73A 5F8NA 4B08A 1X5SA 4NMLA 3JAMY 1L3KA 4FPRA 1YG0A 2RNEA 3MXHP 2UUCF 2CQ1A 2YKOA 5K8PA 4QCLA 1FRIA 2NUHA 2EFGA 4IQXA 3K0JA 1U45A 5AE1A 3DXSX 2OPQA 2XI2A 2EFPA 3NL0A 4J9PA 4I7FB 2EK1A 5KT6A 1H2UX 2L41A 1P9QC 4GC6A 1XMOF 2HQ3A 2O1PA 1H38A 3RR8A 2BV3A 1VQPS 1C0UB 2JWNA 1U6BA 1C0TA 4O3RA 3J7YU 4WU2A 5HLFB 1V6HA 2JRSA 4LSNA 3BO4A 3V6KA 4DR7F 4YEAA 3CCSS 2RQMA 5KFSA 2ZH9A 3OFHA 1I6JA 5E0OA 3Q23A 1Y0HA 1KLMB 1Q86T 3DI6A 2CQ3A 5E5NA 4IG0B 1J5OA 3D54A 1YRXA 1KN6A 3NMRA 4A8KA 3IAS9 5KG1A 1WHWA 3MM8B 4B17A 2VQEF 3G6ES 2MZTA 3BR8A 1P8GA 4ELVA 2RS2A 1URNA 2KHCA 2VFSA 5J1PA 2PDAA 2R8GA 2ZDOA 2B56A 4W92B 1K1SA 2FLOA 3TVKA