3QMFA

Crystal strucuture of an inositol monophosphatase family protein (sas2203) from staphylococcus aureus mssa476
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
262
structure length
254
Chain Sequence
KTLQQIDKLICSWLKQIDNVIPQLIMEMTTETKRHRFDLVTNVDKQIQQQFQQFLATYFPEHQLLAENEINHLWIMDPIDGTANLVKQQEDYCIILAYFYEGKPMLSYVYDYPHKKLYKAIRGEGAFCNGIKMEEPPSLKLEDAIISFNAQVMNLDTVQDLFDASFSYRLVGACGLDSMRVAKGQFGAHINTNPKPWDIAAQFLFAELLNLKMTTLDGKAIDHLKGAPFIISNKACHETVLKILNANGGYQKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Staphylococcal dual specific inositol monophosphatase/NADP(H) phosphatase (SAS2203) delineates the molecular basis of substrate specificity
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Inositol monophosphatase family protein
total genus 74
structure length 254
sequence length 262
chains with identical sequence B
ec nomenclature ec 3.1.3.25: Inositol-phosphate phosphatase.
pdb deposition date 2011-02-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 3qmfA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 3qmfA02
2P3VA 2DDKA 3LV0A 2F3DA 1YYZA 1Q9DA 1INPA 1IMCA 5ET5A 4AS4A 1FPGA 4HE2A 4GWZA 1RDYA 1NV5A 1FPLA 3IFAA 4N81A 3RPLA 4FBPA 1QGXA 1FBDA 1EYKA 5F24A 4GX3A 5A5LA 2FIEA 1FBHA 4GX6A 3ROJA 1NV7A 1FJ9A 1IMBA 2QVRA 5LDZA 3BIGA 1AWBA 3T0JA 4GWXA 5T3JA 1FTAA 2P3NA 1FJ6A 1NV3A 5IZ3B 4AS5A 1FSAA 1FPIA 1LBZA 5ET8A 1FPKA 2FIXA 2OX3A 4GX4A 1NUZA 1FRPA 4GWSA 1EYJA 4HE1A 4HXVA 4I3YA 1NV1A 1YXIA 3LUZA 2R8TA 3BIHA 1FBGA 2Q74A 3KBZA 1IMEA 2FBPA 5ET6A 4GBVA 1IMDA 5DW8A 1FPEA 1K9YA 2CZKA 5IZ3A 1FBFA 2QVVA 4MJOA 1DCUA 1JP4A 3QMFA 4G61A 1FPDA 5EQAA 1NUXA 3A29A 1KZ8A 1NUYA 2CZHA 2GQ1A 3FBPA 5IZ1A 5FBPA 1RDXA 2WBBA 5J16A 1DBZA 1FBPA 1EYIA 4GWUA 4I3EA 1XI6A 2QVUA 4GWYA 2WEFA 1LBYA 2PCRA 1DK4A 2HHMA 4IR8A 1K9ZA 3RYDA 5EQ7A 1D9QA 1G0HA 2F3BA 2VT5A 1KA0A 4O7IA 1FPBA 2OWZA 2Y5LA 1SPIA 4PTKA 2Q8MA 2JJKA 4QXDA 1FBCA 1IMFA 5EQ9A 1NV6A 4H45A 2WBDA 1LEVA 1IMAA 1LBXA 4H46A 5EYHA 1NUWA 4GWWA 1G0IA 2QFLA 4KXPA 1CNQA 1LBVA 4HE0A 1FPJA 1LBWA 1NI9A 3B8BA 1YZ0A 2BJIA 1RDZA 2FVZA 5I3SA 2FHYA 5EYGA 2CZIA 1BK4A 5ET7A 1FPFA 1NV4A 3KC0A 3KC1A 1KA1A 5ESYA 3RPLB 1FBEA 5EQ8A 2Y5KA 4I40A 1NV0A 1VDWA 3D1RA 4GBWA 1NV2A 3IFCA
chains in the Genus database with same CATH superfamily
4KHZE 1Q9DA 4AS4A 4FEDA 1IQ7A 4KI0E 2BJJX 4F3PA 2UYFA 1FQDA 4N81A 1FQCA 1HSJA 1P99A 1FBHA 3FVOA 3RT6B 1BLFA 4MEVA 3T9HB 4U2RA 1QVSA 3K1PA 3W9VA 3FJGA 2AYSA 4ELRA 1PBQA 1Y1MA 4C1UA 1XC1A 4GL0A 4ELPA 2Q8JA 3LSWA 5ET6A 1K9YA 3TELA 4F19A 1QKAA 3UIFA 2AL4A 4N15A 2XWOA 5I2NA 5JTYA 3I6VA 3S9MC 2CZHA 3M3KA 3QK6A 5ISUA 4POWA 3RY3A 1B3GA 4G4PA 1M5FA 1ZTYA 4AB5A 5I5PA 2I6EA 4PAKA 1XI6A 2L5VA 4OFLA 4DI3D 4R2BA 1P1OA 5JEIA 4IO5A 4QHQA 1FPBA 1UTHB 3OO9A 4IO4A 1R9QA 1MY1A 3FVGA 4PE5B 2XXTA 1Y9UA 3SDFA 2O7UA 2WBDA 4NE4A 5EYHA 2AL5A 3KN7A 2Y7KA 4KXPA 4NQ8A 3SEUA 5I84A 2X26A 3B8BA 2BJIA 2H98A 3KGCA 1UIUA 3FVNA 1B3FA 3OO7A 3FATA 2V25A 4OVRA 3LV0A 2MKZA 3A3UA 1SQYA 5ET5A 2WKYA 2OZZA 1EH3A 4BDLA 4YKPA 4IGRA 4FBPA 4WXJA 3VXBA 1MQDA 4TOZA 4O94A 4ZS9A 3TTRA 4DDDA 4BDMA 3T0JA 2FNCA 4P9KA 1I6QA 5KCJA 4AS5A 3HO7A 1PB8A 3JZJA 1LAFE 4GX4A 3T66A 3EKIA 2DE4A 2I48A 2XX8A 5CMMA 1NV1A 1MY4A 4DXUA 4FECA 5BWJA 3FXUA 3LC8A 4JVCA 3GBAA 3T22A 5F7VA 4PDHA 4NF8B 4MJOA 1DCUA 3K1MA 1A99A 1UTHA 2PFZA 2WBBA 3FIRA 2DXRA 2E0SA 5IZZA 1AH5A 1P1WA 4R2FA 1D9QA 1B5HA 1G0HA 1LAXA 1N84A 4MHFA 4EF2A 2XXPA 2XX9A 1B4ZA 4R6YA 4X1DA 4ZZAA 1NV6A 4N6DA 5KZTA 3HFUA 2UVJA 3LUYA 4H1XA 3EHUA 1B0HA 1SBPA 3MZ1A 1GV8A 5AA2B 1BP5A 3KN8A 3DP4A 1IITA 1MH3A 1Y3NA 4DI4B 4N17A 2V84A 5EHMA 3QUJA 1Z7ME 5A5LA 2FIEA 4F29A 3N6UA 2DYXA 3B6QA 4TQUQ 4LONB 2QS3A 3S2VA 3MC2A 1B5JA 4DCXA 5L9OA 2I4BA 4BLAA 1SYHA 2YPNA 3K1NA 1N3XA 3G3HA 3SKPA 2R8TA 4NMYA 3C33A 1MQHA 3CFZA 4GXSB 4IO6A 3U93A 3C36A 2X7QA 4DLDA 1LFHA 1USYE 1NUYA 2GQ1A 4R9GA 1URSA 1DBZA 4NN3A 4QFKA 4FATA 3IB2A 2V93A 2V3QA 1LB9A 4O7IA 3I3VA 2DS9A 4ZZEA 1MXVA 2KLFA 2O51A 3HPIA 5ITPA 1A40A 4GWWA 3UK4A 4LATA 4WKMA 3K02A 3QIMA 2OWSA 2O68A 1B3EA 2Q89A 1NFTA 4NG7A 5EQ8A 1LCTA 2Y7IA 1NV0A 1MPBA 1M5EA 3PPOA 4G2ZA 4PF8A 3MZ9A 3MP1A 4TLMB 2B4LA 2H4IA 2RKMA 1FPLA 2KQZA 4LQ2A 4YB7A 1Y3QA 2NXOA 4MIJA 1JVYA 1IMBA 4GRKA 1B9JA 3HV1A 4XKRA 1FTAA 4PFBA 3TTNA 2XXIA 3U8QA 1NH8A 4P0IA 3TFLA 2DWIA 3KJTA 2R71A 2GHAA 5KCJB 3TYHA 4N91A 1T0KA 3ILUB 3MYUA 3MW0A 1XHYA 3H6WA 1LAGE 2ZYMA 1RKMA 2GFEA 1FW0A 3R6UA 3FXQA 4HCYA 2H99A 2OK2A 4GWUA 2RF1A 2REJA 4WEPA 1MXXA 3O66A 4F3BA 2VD3A 4R6HA 3K01A 2OWZA 1R6ZA 4RPOA 1B1XA 1CB6A 3HHGA 3KG2A 5L9MA 4XKNA 1ZIUA 1IMAA 2Z8FA 1QKBA 3CFXA 4NGUA 1CNQA 3G3KA 1B2HA 5TP9A 3KOTA 1B05A 2O69A 2F34A 3KC0A 1A8FA 5CC2A 1SD3A 2G93A 3IOUA 3OENA 4MLVA 2YJPA 1B7ZA 1NNFA 2NVUB 2PT1A 3DELB 1XVYA 3IJXB 3A09A 5ICQA 4GX6A 4X04A 1FJ9A 5AA2A 4KPTA 4RJZA 4OHNA 1LBBA 4X9TA 4G68C 2CEYA 4DIGA 5CBRA 1VFEA 5F1QA 1EZ9A 3LUZA 1MDP1 3CRBA 1IMEA 2ZYNA 5HPQA 4OVPA 4JWYA 1FPEA 1OQHA 1EZOA 1QJMA 3A29A 2P1SA 5TU0A 4NF4A 3VXCA 1RDXA 3ILTB 5J16A 2QMWA 3H6TA 1EZPA 1FQBA 1UTBA 3T9UA 4GF8A 2UVGA 4KYEA 5H8FA 2Q2AA 2DE2A 1BTJA 3E4RA 3TCFA 1S7YA 3E3KA 3SEWA 1B3LA 2OLBA 4NWDA 5AA3A 4GVOA 1M5BA 4GWOA 1LBWA 4C1TA 2RCBA 2FHYA 2F36A 1AOVA 4NF4B 2HPGA 3FJMA 3V8XB 2HAUA 5H8QA 1O7TA 4XXUA 3H3GA 5AA4A 2P3VA 1ZLQA 4FE8A 4OVSA 3VLUA 2F97A 4KYSA 3E78A 1INPA 4I8CA 3FXBA 4IO3A 4G8NA 2I58A 3O97A 4ZEFA 1SW1A 2ALUA 3FJ7A 5I2NB 1D9YA 4M1VA 2DWJA 4PFUA 4ZEKA 3K6UA 2OBGA 3PUYE 4X1BA 4GIZA 2QRYA 3KSXA 2QVRA 4QF9A 1B58A 1GGGA 2W7YA 2CZLA 1NV3A 1I6BA 4AQ4A 2DVZA 4U23A 2Z8EA 2OX3A 1A8EA 3UP9A 2XXRA 3BFUA 1Y4CA 5CMCA 1MG1A 3HCQA 1BIYA 1VR5A 4EXLA 1YAEA 4I1DA 1KWHA 2G29A 2E1SA 5FHNA 2Q9TA 2ZXTA 1AL3A 4H0WA 3ZKKA 4NF5A 1MXYA 5H8NA 2GRVA 3ODBA 2V3UA 4N13A 3DP8A 3IK6B 2Q8MA 1P1NA 5K2XA 1FQEA 5H8QB 4UA8A 2YLNA 1NV4A 4OWDA 3SZPA 1AIVA 3GYYA 4JSDA 2H5YA 4N8GA 3HHFA 1LFIA 3I5OA 2F3DA 1D9VA 2VOZA 5I7IA 2IEEA 3G3GA 1LGBC 4PE3A 1PEBA 4GFRA 4XEQA 3MVYA 4NF0A 1JNFA 4XKPA 2A5SA 1FTOA 2OWTA 2ZYOA 4EXKA 5KDTA 1POY1 1GR2A 3K6WA 4MNPA 4HW8A 3MUQA 1MXWA 4F1YA 3TPAA 1FJ6A 4P8BA 5CBSA 2XWKA 1FSAA 3T93B 2PMSA 1FRPA 3MZBA 3OSQA 3G7WA 1JW1A 3EHSA 1FTJA 2Q74A 4F2OA 1GTKA 3SESA 1H76A 2DOJA 4F1VA 4OTEA 4GBVA 1B1HA 1Y20A 1XT8A 4OERA 3THIA 4HCWA 4K3FA 5K2YA 1JEUA 2XXWA 2Z23A 5CI5A 2VHAA 1SDXA 3GLBA 4PGNA 2WEFA 4PFWA 1LFGA 5EQ7A 3TQWA 3PUVE 4OETA 3C4MA 4YMBA 1B6HA 3PU5A 4ECFA 2XA5A 2Y7RA 3LSLA 4NF6B 4H45A 4OVTA 3W15C 1LEVA 2V3TA 1B0LA 4PBHA 4FJPA 3VV5A 4NWCA 4H65A 3R26A 2CZIA 5ET7A 1D3KA 4YKKA 3O6HA 4O3CA 5I58A 4E0XA 1M5DA 1YCJA 3PD9A 4GBWA 1XOCA 3M3FA 2QS1A 1L5TA 3CG3A 3TKDA 1NV5A 3CHGA 2FA7A 2DWHA 3WAFA 1MXZA 3RPLA 2XWVA 3ZKLA 4GX3A 5AA4B 2PFYA 2Y7WA 1AWBA 5HBCA 4G8HA 4IB2A 4OYVA 4ONYA 4Q5TA 5FHOA 3NOHA 4LN5A 1MM6A 3IL1B 1YTVA 3KN3A 3H6UA 1NH7A 5DVIA 4PP0A 3KBZA 3RTFB 2D21A 4KCDA 4LVQA 3ZS6A 1DTZA 4BDQA 5IZ3A 3MP6A 1FBFA 4R75A 1B4HA 3IOWA 1VE4A 1NUXA 1IXIA 1KZ8A 4Q8RA 4O3AA 5FBPA 5H8HB 5ICTA 1MPDA 1IXGA 4LZ5A 4YKIA 3IR1A 3PGFA 2HQ0A 5AA1A 1PB7A 1DK4A 3T1BA 4KFQA 3FD3A 3GZGA 4O3BA 3RQTA 1ZJLA 1B40A 3V5AA 3PMWA 4H5FA 3HSTA 1ZBMA 4PAIA 1MS7A 4YAHX 4LQ5A 3QSLA 1MY3A 1SW4A 3CI8A 5H8SA 2A5TA 2F6GA 3N94A 3W9WA 3RGYA 4GXAA 2ZNTA 1IIWA 2XXHA 3RUMA 4F31B 2DWAA 4QFPA 2O7IA 3CR9A 2D5WA 3TTKA 3O9PA 3SEVA 2ZMBA 3B7DA 4PCDA 1NL5A 3N6TA 3SETA 4I62A 1R1NA 2PT2A 3LSFB 4FEBA 1FBDA 2OPEA 5FTHA 4YMAA 4DE8A 4TLLB 1NV7A 1LSTA 4OEVA 1B3HA 1TXFA 2F78A 1US4A 4KCCA 4OFJA 3BFTA 5ET8A 3MPLA 5A5XA 3V83A 5IZ3B 4ESWA 4HE1A 1EYJA 3UGWA 4F18A 4BDOA 4KYDA 1Y4TA 4ZECA 4NAPA 5KDTB 3VDFA 2FBPA 1A7LA 3ECRA 1B32A 4R73A 5DW8A 4G61A 1JW4A 4Q30B 5EQAA 1DPPA 4F22A 3MVWA 1UTBB 2DSFA 2I3VA 3Q28A 3DM0A 2QS4A 3OO6A 4P11A 4THIA 3S9LC 2QVUA 3C9HA 3TQLA 4NX1A 4IR8A 3QUFA 4QFOA 4O8MA 3USDA 1TFAA 3IAZA 3OXNA 3N26A 1QW0A 4MMPA 5JK4A 1MY2A 1FBCA 5TPAA 2RINA 5DEXB 5IKBA 2QL3A 4ND9A 5I3SA 1NKXA 4XF5A 5EYGA 4LP2B 2F6PA 3PV0E 5BUUA 1FCKA 2AIXA 1JETA 4EUOA 4F3SA 3TMGA 1GVCA 1VDWA 2HXRA 2XXYA 3SERA 3WAEA 4ZDMA 1I69A 1NNKA 1UQWA 3O29A 3KJ7A 3Q26A 4N07A 2QS2A 4NF8A 3IFAA 1OQGA 3FGSA 4QRZA 2GH9A 1JW5A 2CMOA 3OEMA 4O7MA 4ZEDA 3PMVA 4ZEBA 2THIA 5TPAB 4RYAA 2R9JA 1FTKA 4X8RA 4JB7A 3DP6A 4F1UA 4G68A 3OMBA 1JQFA 1FPIA 1IXCA 2F7AA 4L17A 3O28A 2R6GE 3VE1B 1IEJA 3VVDA 1FBGA 1QUJA 3U65A 2IA4A 3K6XA 3JYRA 3IO6A 1JP4A 1FPDA 5DTBA 3GBBA 2ZZWA 3FBPA 1LB8A 4P47A 1D4NA 5CM6A 1H3DA 3G3JA 3H6VA 3MBPA 1FBPA 4MNIA 4I3EA 5I56B 1JEVA 1ANFA 4BDRA 1DMBA 3T96B 2OJTA 1FQFA 3OELA 4OZ9A 2P2AA 5DT6A 4DXCA 4UABA 1CE2A 3VVFA 4H8IA 5FTIA 1MQIA 3FV2A 2UVHA 4RA1A 4N6KA 2HFBA 2I49A 5CRYA 3M3LA 1FPFA 1SI1A 2VPOA 5AE4A 2Y5KA 3TCGA 4WEDA 3E13X 4F2QA 5I57B 3BBRA 1LLSA 2ZZXA 3TUSA 3HN0A 3FV1A 2B3BA 5ELVA 3OOAA 4OFOA 2PBWA 4MFIA 5F24A 2O1LA 3PUXE 4R6KA 4GL8A 1WODA 2VD2A 4IO2A 3C34A 4QFNA 3VLWA 4GWXA 4U4SA 3PPNA 4EQBA 1FPKA 1OVBA 3Q27A 5I58B 1DTGA 4RK2A 4P1LA 3MVZA 2NWJA 2P0SA 3IB1A 3K0VA 1A54A 3LR1A 3QMFA 3B6TA 4OVQA 2QPQA 3EQ1A 4FIMA 4RK9A 3RNNA 2O1MA 1B7HA 4OQOA 4R9FA 2F35A 2OCUA 2CEXA 4PFTA 1OVTA 4XKQA 3OSRA 4PQJA 4U21A 3CIJA 4MF3A 1N76A 4ZE8A 4JWOA 5EQ9A 5I57A 4H46A 3IOTA 4U22A 1S50A 1G0IA 1DSNA 1LBVA 4HE0A 4LUBA 1YZ0A 4PFRA 1RDZA 4G8MA 1OMPA 1BK4A 2HAVA 3MPKA 2B65A 1KA1A 3PMXA 4NHBA 1EU8A 2WYKA 2Y84A 5H8HA 4PAFA 3IX1A 4P1EA 1YYZA 5FHMA 4PFYA 4HE2A 1MM7A 4JVDA 1P1UA 2M8CA 2ONSA 4RY1A 5LTCA 1SYIA 5I2KA 3ROJA 1HSLA 3D4GA 1ZU0A 4R74A 5DYHA 3PPPA 3JV9A 2F7BA 2I0BA 1JVXA 3R7XA 4GWSA 2I3WA 1SW5A 2I0CA 5I59A 4RPNA 3RN8A 1LAHE 3M8UA 4ESXA 1MPCA 4X48A 2GHBA 3PPQA 4NF6A 5H8NB 3C35A 4NF5B 1B52A 2QMXA 1ZKBA 4F39A 4G68B 5B7DA 4YZZA 1Q1KA 1B5IA 4QBAA 1MH4A 1Y1ZA 4LZ8A 2I4CA 4OA4A 5IZ1A 4I9DA 3FUZA 3CVGA 2RCAA 1K9ZA 1QULA 2UXAA 4OEUA 4KQPA 1KA0A 3TCHA 4G77A 1SPIA 4PTKA 3B50A 4DCYA 4NEDA 2VP1A 4EDPA 5I56A 1II5A 4YKJA 1PC3A 2ZYKA 2ONKE 1POTA 4PF6A 2REGA 4MH5A 1IUDA 3BKIB 5I2KB 4P3LA 4N8YA 3U94A 2OPDA 2DDKA 1US5A 3K00A 4UACA 5CMBA 1VSOA 3UA8A 2DVCA 4C0RA 2XX7A 4OVJA 1QGXA 1QUIA 2F7CA 4ELOA 2DXYA 4OXVA 4KD5A 3RT8A 2HZKA 4Z7EA 3IORA 3BIGA 1TFDA 4OENA 3FASA 1ZMGA 2P3NA 1SW2A 1F9BA 4MBPA 2FIXA 4HXVA 4E0WA 3ZSFA 1YXIA 1FTLA 3U92A 3BIHA 4LZ7A 5LOMA 1MQGA 1S9TA 2Z8DA 4H67A 2QVVA 1Y3PA 2ZZVA 2A5TB 2ZNSA 2HXWA 5JTYB 3N5LA 4F3GA 3S4UA 3TTLA 1UIVA 4ISUA 1AMFA 3H7MA 1DOTA 3KFMA 3RPWA 3MAMA 3SEXA 5L8DA 1NMUA 3PUZE 4Q0CA 4JWXA 2Y5LA 4BDNA 5IM2A 4MAGA 1B46A 5M2VA 1B51A 1OLAA 4IY5A 3D4CA 1IMFA 3MSTA 4H5GA 1LBXA 1URDA 2XXVA 2D3IA 1Z7NE 5DEXA 3Q25A 4GLIA 4U4XA 2QFLA 4PBQA 1PB9A 2RC8A 4ZE9A 5A5XB 1TWYA 4LA9A 4OMBA 3U1OA 1NNTA 5EHSA 4H8JA 4QFLA 1URGA 4PDDA 1WDNA 2XXQA 2PYYA 3F11A 4GWZA 1RYOA 3G3IA 3EF7A 1SVXB 1ATGA 1EYKA 4YB6A 3KSJA 2ONRA 4MLQA 4XIGQ 2DQVA 1O64A 3KEIA 2XXUA 3UORA 3DLNA 1B7UA 3UN6A 4JXIA 3LSXA 1LBZA 4DZ1A 1N7WA 4H6DA 4I3YA 2XWIA 5AA2D 1XS5A 3PUWE 3A3CA 1LBCA 3MVXA 1PBPA 3CSGA 3MJNA 1IMDA 1R9LA 5HM4B 5EYFA 2XXXA 3FXRA 3PTYA 2QJEA 5IGAA 2PVUA 3V89B 3OD7A 1EYIA 5H8FB 3QAXA 2PCRA 2HHMA 3RTWB 2VT5A 4PFIA 3QYTA 3VFJA 3H03A 4GD5A 1H45A 3MQ9A 3EPEA 2B4MA 3S9EA 4QXDA 2Z22A 4MNCA 4YU0A 4JSOA 2VPNA 1NUWA 1HSEA 1OIBA 3KBRA 1ELJA 3K2DA 5ESYA 3VLVA 1QUKA 4I40A 2HEUA 3C31A 4GOTA 1MY0A 3IFCA 1VFDA 3K4UA 5B70A 5IAIA 2UVIA 1FPGA 3CG1A 4U1OA 3MWBA 2XHDA 2LAOA 2NUVA 2ZNUA 4XTCQ 3O6GA 4IO7A 1DPEA 5I59B 2XD2A 4MCOA 3OO8A 2F8DA 4YB5A 3CFLA 5L9SA 1MRPA 3TODA 4ZEIA 3IO4A 5T3JA 1LCFA 2F5XA 3OEKA 3ONMA 4XFEA 3C32A 1BKAA 4DXBA 4KR5A 4R72A 1YPNA 3H06B 2KR0A 5CMKA 3PPRA 1H44A 3E9XA 4HTGA 2O6AA 4M4GA 4FAJA 3O6IA 3TDJA 1MXUA 4Z0IA 5J1DA 3L6HA 5ITOA 1I6AA 1RYXA 3U72A 5DVJA 2HCAA 4U1ZA 4ELQA 4YICA 1NNPA 2DP8A 2QSXA 3G3FA 2V4CA 4POXA 1LBYA 3FVKA 3O2AA 2X7PA 5TP9B 2F3BA 3H4ZA 2H9BA 3IOVA 3T9XB 5DVFA 1P1QA 3T9VA 2WX9A 3B6WA 2H25A 3L6GA 2NOOA 1NI9A 2Y7PA 4N6PA 2FVZA 2HZLA 3KOSA 3KC1A 4OESA 2UYEA 1FTMA 2XXKA 4RXLA 3MP8A 3D1RA 1NV2A 1PDAA 3EHTA 1IMCA 4P0GA 4P56A 1RDYA 1OLCA 4RNSA 2B3FA 1IZ1A 3K6VA 1TT1A 2DE3A 3TAJA 1IXHA 4PETA 1Q35A 1WVJA 3TEPA 3KZGA 2ESNA 3SEYA 2FYIA 3IJOB 5LDZA 3FZVA 4FORA 4GQOA 3TTMA 1N0TA 1NUZA 4N4UA 1M5CA 3ISPA 1A55A 1N7XA 4IY6A 2PX1A 4IGTA 1MDQA 2CZKA 2RC9A 4MX6A 4QSEA 2Q88A 2O84X 4PGPA 1MQJA 1N04A 3Q29A 3LBSA 2RC7A 4GWYA 2ABHA 4QSCA 4JVIA 3EN3A 3RYDA 4EF1A 4OANA 3VVEA 3PD8A 1O63A 1H43A 4AB6A 4EQ9A 2JJKA 3CSBA 3GXAA 1XVXA 1N3WA 4NTLA 4QSDA 2VGQA 3AXFA 3S9NC 1USYH 1FPJA 4HS7A 2XD3A 4PC9A 3TZAA 3IB0A 1J1NA 2Q2CA 4EQ7A 3RPLB 1FQAA 1FBEA 3E79A 3RLFE 3QXMA 1SI0A 2ANJA 2WYPA 3P7IA 4JDFA 4JBZA
chains in the Genus database with same CATH topology
2ZZXA 2P3VA 4OVSA 2DDKA 3LV0A 2MKZA 2F3DA 4P1EA 1YYZA 1Q9DA 4PF8A 5I7IA 3E78A 1INPA 1IMCA 5ET5A 4AS4A 4P56A 1FPGA 4PDDA 3FXBA 4HE2A 4GWZA 1RDYA 4PCDA 4PE3A 1NV5A 2B4LA 4N17A 3CHGA 4XEQA 4DI4B 1FPLA 3IFAA 4JVDA 4N81A 3RPLA 2XWVA 4FBPA 2KQZA 1QGXA 4NF0A 4O7MA 1FBDA 1EYKA 2DE3A 5F24A 4GX3A 4M1VA 5A5LA 2FIEA 5LTCA 1FBHA 4MCOA 4MIJA 4O94A 4PETA 4GX6A 3ROJA 4X04A 1NV7A 2HZKA 1FJ9A 4MNPA 1IMBA 2QVRA 4MEVA 2PFYA 5LDZA 4X8RA 3BIGA 1AWBA 3T0JA 4F1UA 4P9KA 4GWXA 5T3JA 1FTAA 2P3NA 1FJ6A 2F5XA 1NV3A 5IZ3B 4P8BA 4AS5A 1FSAA 1FPIA 2DVZA 2XWKA 1LBZA 5ET8A 3NOHA 4PFBA 4PGNA 4X9TA 2CEYA 4LN5A 4XFEA 1FPKA 2FIXA 2OX3A 4GX4A 1NUZA 1FRPA 4GWSA 1EYJA 4HE1A 4HXVA 2DE4A 3EKIA 4I3YA 4F18A 2KR0A 2XWIA 4N4UA 5J1DA 3W9VA 1NV1A 1YXIA 3ISPA 3LUZA 4NAPA 2R8TA 3BIHA 1FBGA 2Q74A 4P1LA 3U65A 3KBZA 4JVCA 1IMEA 2FBPA 4OVPA 5ET6A 4F1VA 4YZZA 4GBVA 1IMDA 5DW8A 1FPEA 4N91A 1K9YA 2CZKA 5IZ3A 1FBFA 2QVVA 4PBQA 4PDHA 2ZZVA 4MJOA 1DCUA 3MYUA 4HCWA 4MX6A 1JP4A 3QMFA 4G61A 4N15A 4QBAA 1FPDA 5EQAA 2XWOA 3PTYA 1NUXA 5IGAA 2ZZWA 3A29A 4OA4A 4OVQA 2QPQA 2PFZA 1KZ8A 1NUYA 2CZHA 2GQ1A 3FBPA 4PGPA 5IZ1A 5FBPA 2Q9TA 1RDXA 4P47A 5CM6A 2WBBA 5J16A 4YICA 1DBZA 4NN3A 1FBPA 4HCYA 5I5PA 5IZZA 1EYIA 4MNIA 4GWUA 4PAKA 4I3EA 1XI6A 2QVUA 4GWYA 2WEFA 1LBYA 2PCRA 1DK4A 2HHMA 4IR8A 2L5VA 1K9ZA 2V4CA 4JVIA 3RYDA 4NX1A 3T1BA 4DI3D 5EQ7A 2CEXA 1D9QA 1G0HA 4MHFA 4OANA 2F3BA 2VT5A 2V3QA 1KA0A 4O8MA 4PFIA 4O7IA 1FPBA 2OWZA 2DE2A 2Y5LA 1SPIA 4PTKA 2Q8MA 5IM2A 3B50A 4MAGA 2JJKA 2B4MA 4MMPA 4QXDA 4UABA 5JK4A 1FBCA 2XA5A 1IMFA 5EQ9A 3MSTA 1NV6A 4H45A 4MNCA 2WBDA 4PAIA 4OVTA 1LEVA 1IMAA 1LBXA 2WX9A 4H46A 5EYHA 4N6DA 2VPNA 4N6KA 1NUWA 4PBHA 4GWWA 1G0IA 2QFLA 4KXPA 4NGUA 1CNQA 1LBVA 4NQ8A 4HE0A 1FPJA 1LBWA 1NI9A 3HFUA 3B8BA 1YZ0A 2BJIA 1RDZA 2FVZA 5I3SA 2HZLA 4PC9A 4PFRA 2FHYA 5EYGA 4XF5A 2CZIA 1BK4A 5ET7A 1FPFA 1NV4A 3KC0A 3KC1A 4PF6A 3SZPA 4F19A 2VPOA 3W9WA 1KA1A 5ESYA 3RPLB 4NG7A 1FBEA 5EQ8A 2HPGA 2Y5KA 2WYKA 3GYYA 4NHBA 3E79A 4I40A 1NV0A 1VDWA 2XXKA 2WYPA 4PAFA 2HXRA 3D1RA 4N8GA 4GBWA 4P3LA 4OVRA 4N8YA 1NV2A 3IFCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P3V A;  2DDK A;  3LV0 A;  2F3D A;  1YYZ A;  1Q9D A;  1INP A;  1IMC A;  5ET5 A;  4AS4 A;  1FPG A;  4HE2 A;  4GWZ A;  1RDY A;  1NV5 A;  1FPL A;  3IFA A;  4N81 A;  3RPL A;  4FBP A;  1QGX A;  1FBD A;  1EYK A;  5F24 A;  4GX3 A;  5A5L A;  2FIE A;  1FBH A;  4GX6 A;  3ROJ A;  1NV7 A;  1FJ9 A;  1IMB A;  2QVR A;  5LDZ A;  3BIG A;  1AWB A;  3T0J A;  4GWX A;  5T3J A;  1FTA A;  2P3N A;  1FJ6 A;  1NV3 A;  5IZ3 B;  4AS5 A;  1FSA A;  1FPI A;  1LBZ A;  5ET8 A;  1FPK A;  2FIX A;  2OX3 A;  4GX4 A;  1NUZ A;  1FRP A;  4GWS A;  1EYJ A;  4HE1 A;  4HXV A;  4I3Y A;  1NV1 A;  1YXI A;  3LUZ A;  2R8T A;  3BIH A;  1FBG A;  2Q74 A;  3KBZ A;  1IME A;  2FBP A;  5ET6 A;  4GBV A;  1IMD A;  5DW8 A;  1FPE A;  1K9Y A;  2CZK A;  5IZ3 A;  1FBF A;  2QVV A;  4MJO A;  1DCU A;  1JP4 A;  3QMF A;  4G61 A;  1FPD A;  5EQA A;  1NUX A;  3A29 A;  1KZ8 A;  1NUY A;  2CZH A;  2GQ1 A;  3FBP A;  5IZ1 A;  5FBP A;  1RDX A;  2WBB A;  5J16 A;  1DBZ A;  1FBP A;  1EYI A;  4GWU A;  4I3E A;  1XI6 A;  2QVU A;  4GWY A;  2WEF A;  1LBY A;  2PCR A;  1DK4 A;  2HHM A;  4IR8 A;  1K9Z A;  3RYD A;  5EQ7 A;  1D9Q A;  1G0H A;  2F3B A;  2VT5 A;  1KA0 A;  4O7I A;  1FPB A;  2OWZ A;  2Y5L A;  1SPI A;  4PTK A;  2Q8M A;  2JJK A;  4QXD A;  1FBC A;  1IMF A;  5EQ9 A;  1NV6 A;  4H45 A;  2WBD A;  1LEV A;  1IMA A;  1LBX A;  4H46 A;  5EYH A;  1NUW A;  4GWW A;  1G0I A;  2QFL A;  4KXP A;  1CNQ A;  1LBV A;  4HE0 A;  1FPJ A;  1LBW A;  1NI9 A;  3B8B A;  1YZ0 A;  2BJI A;  1RDZ A;  2FVZ A;  5I3S A;  2FHY A;  5EYG A;  2CZI A;  1BK4 A;  5ET7 A;  1FPF A;  1NV4 A;  3KC0 A;  3KC1 A;  1KA1 A;  5ESY A;  3RPL B;  1FBE A;  5EQ8 A;  2Y5K A;  4I40 A;  1NV0 A;  1VDW A;  3D1R A;  4GBW A;  1NV2 A;  3IFC A; 
#chains in the Genus database with same CATH topology
 4KHZ E;  1Q9D A;  4AS4 A;  4FED A;  1IQ7 A;  4KI0 E;  2BJJ X;  4F3P A;  2UYF A;  1FQD A;  4N81 A;  1FQC A;  1HSJ A;  1P99 A;  1FBH A;  3FVO A;  3RT6 B;  1BLF A;  4MEV A;  3T9H B;  4U2R A;  1QVS A;  3K1P A;  3W9V A;  3FJG A;  2AYS A;  4ELR A;  1PBQ A;  1Y1M A;  4C1U A;  1XC1 A;  4GL0 A;  4ELP A;  2Q8J A;  3LSW A;  5ET6 A;  1K9Y A;  3TEL A;  4F19 A;  1QKA A;  3UIF A;  2AL4 A;  4N15 A;  2XWO A;  5I2N A;  5JTY A;  3I6V A;  3S9M C;  2CZH A;  3M3K A;  3QK6 A;  5ISU A;  4POW A;  3RY3 A;  1B3G A;  4G4P A;  1M5F A;  1ZTY A;  4AB5 A;  5I5P A;  2I6E A;  4PAK A;  1XI6 A;  2L5V A;  4OFL A;  4DI3 D;  4R2B A;  1P1O A;  5JEI A;  4IO5 A;  4QHQ A;  1FPB A;  1UTH B;  3OO9 A;  4IO4 A;  1R9Q A;  1MY1 A;  3FVG A;  4PE5 B;  2XXT A;  1Y9U A;  3SDF A;  2O7U A;  2WBD A;  4NE4 A;  5EYH A;  2AL5 A;  3KN7 A;  2Y7K A;  4KXP A;  4NQ8 A;  3SEU A;  5I84 A;  2X26 A;  3B8B A;  2BJI A;  2H98 A;  3KGC A;  1UIU A;  3FVN A;  1B3F A;  3OO7 A;  3FAT A;  2V25 A;  4OVR A;  3LV0 A;  2MKZ A;  3A3U A;  1SQY A;  5ET5 A;  2WKY A;  2OZZ A;  1EH3 A;  4BDL A;  4YKP A;  4IGR A;  4FBP A;  4WXJ A;  3VXB A;  1MQD A;  4TOZ A;  4O94 A;  4ZS9 A;  3TTR A;  4DDD A;  4BDM A;  3T0J A;  2FNC A;  4P9K A;  1I6Q A;  5KCJ A;  4AS5 A;  3HO7 A;  1PB8 A;  3JZJ A;  1LAF E;  4GX4 A;  3T66 A;  3EKI A;  2DE4 A;  2I48 A;  2XX8 A;  5CMM A;  1NV1 A;  1MY4 A;  4DXU A;  4FEC A;  5BWJ A;  3FXU A;  3LC8 A;  4JVC A;  3GBA A;  3T22 A;  5F7V A;  4PDH A;  4NF8 B;  4MJO A;  1DCU A;  3K1M A;  1A99 A;  1UTH A;  2PFZ A;  2WBB A;  3FIR A;  2DXR A;  2E0S A;  5IZZ A;  1AH5 A;  1P1W A;  4R2F A;  1D9Q A;  1B5H A;  1G0H A;  1LAX A;  1N84 A;  4MHF A;  4EF2 A;  2XXP A;  2XX9 A;  1B4Z A;  4R6Y A;  4X1D A;  4ZZA A;  1NV6 A;  4N6D A;  5KZT A;  3HFU A;  2UVJ A;  3LUY A;  4H1X A;  3EHU A;  1B0H A;  1SBP A;  3MZ1 A;  1GV8 A;  5AA2 B;  1BP5 A;  3KN8 A;  3DP4 A;  1IIT A;  1MH3 A;  1Y3N A;  4DI4 B;  4N17 A;  2V84 A;  5EHM A;  3QUJ A;  1Z7M E;  5A5L A;  2FIE A;  4F29 A;  3N6U A;  2DYX A;  3B6Q A;  4TQU Q;  4LON B;  2QS3 A;  3S2V A;  3MC2 A;  1B5J A;  4DCX A;  5L9O A;  2I4B A;  4BLA A;  1SYH A;  2YPN A;  3K1N A;  1N3X A;  3G3H A;  3SKP A;  2R8T A;  4NMY A;  3C33 A;  1MQH A;  3CFZ A;  4GXS B;  4IO6 A;  3U93 A;  3C36 A;  2X7Q A;  4DLD A;  1LFH A;  1USY E;  1NUY A;  2GQ1 A;  4R9G A;  1URS A;  1DBZ A;  4NN3 A;  4QFK A;  4FAT A;  3IB2 A;  2V93 A;  2V3Q A;  1LB9 A;  4O7I A;  3I3V A;  2DS9 A;  4ZZE A;  1MXV A;  2KLF A;  2O51 A;  3HPI A;  5ITP A;  1A40 A;  4GWW A;  3UK4 A;  4LAT A;  4WKM A;  3K02 A;  3QIM A;  2OWS A;  2O68 A;  1B3E A;  2Q89 A;  1NFT A;  4NG7 A;  5EQ8 A;  1LCT A;  2Y7I A;  1NV0 A;  1MPB A;  1M5E A;  3PPO A;  4G2Z A;  4PF8 A;  3MZ9 A;  3MP1 A;  4TLM B;  2B4L A;  2H4I A;  2RKM A;  1FPL A;  2KQZ A;  4LQ2 A;  4YB7 A;  1Y3Q A;  2NXO A;  4MIJ A;  1JVY A;  1IMB A;  4GRK A;  1B9J A;  3HV1 A;  4XKR A;  1FTA A;  4PFB A;  3TTN A;  2XXI A;  3U8Q A;  1NH8 A;  4P0I A;  3TFL A;  2DWI A;  3KJT A;  2R71 A;  2GHA A;  5KCJ B;  3TYH A;  4N91 A;  1T0K A;  3ILU B;  3MYU A;  3MW0 A;  1XHY A;  3H6W A;  1LAG E;  2ZYM A;  1RKM A;  2GFE A;  1FW0 A;  3R6U A;  3FXQ A;  4HCY A;  2H99 A;  2OK2 A;  4GWU A;  2RF1 A;  2REJ A;  4WEP A;  1MXX A;  3O66 A;  4F3B A;  2VD3 A;  4R6H A;  3K01 A;  2OWZ A;  1R6Z A;  4RPO A;  1B1X A;  1CB6 A;  3HHG A;  3KG2 A;  5L9M A;  4XKN A;  1ZIU A;  1IMA A;  2Z8F A;  1QKB A;  3CFX A;  4NGU A;  1CNQ A;  3G3K A;  1B2H A;  5TP9 A;  3KOT A;  1B05 A;  2O69 A;  2F34 A;  3KC0 A;  1A8F A;  5CC2 A;  1SD3 A;  2G93 A;  3IOU A;  3OEN A;  4MLV A;  2YJP A;  1B7Z A;  1NNF A;  2NVU B;  2PT1 A;  3DEL B;  1XVY A;  3IJX B;  3A09 A;  5ICQ A;  4GX6 A;  4X04 A;  1FJ9 A;  5AA2 A;  4KPT A;  4RJZ A;  4OHN A;  1LBB A;  4X9T A;  4G68 C;  2CEY A;  4DIG A;  5CBR A;  1VFE A;  5F1Q A;  1EZ9 A;  3LUZ A;  1MDP 1;  3CRB A;  1IME A;  2ZYN A;  5HPQ A;  4OVP A;  4JWY A;  1FPE A;  1OQH A;  1EZO A;  1QJM A;  3A29 A;  2P1S A;  5TU0 A;  4NF4 A;  3VXC A;  1RDX A;  3ILT B;  5J16 A;  2QMW A;  3H6T A;  1EZP A;  1FQB A;  1UTB A;  3T9U A;  4GF8 A;  2UVG A;  4KYE A;  5H8F A;  2Q2A A;  2DE2 A;  1BTJ A;  3E4R A;  3TCF A;  1S7Y A;  3E3K A;  3SEW A;  1B3L A;  2OLB A;  4NWD A;  5AA3 A;  4GVO A;  1M5B A;  4GWO A;  1LBW A;  4C1T A;  2RCB A;  2FHY A;  2F36 A;  1AOV A;  4NF4 B;  2HPG A;  3FJM A;  3V8X B;  2HAU A;  5H8Q A;  1O7T A;  4XXU A;  3H3G A;  5AA4 A;  2P3V A;  1ZLQ A;  4FE8 A;  4OVS A;  3VLU A;  2F97 A;  4KYS A;  3E78 A;  1INP A;  4I8C A;  3FXB A;  4IO3 A;  4G8N A;  2I58 A;  3O97 A;  4ZEF A;  1SW1 A;  2ALU A;  3FJ7 A;  5I2N B;  1D9Y A;  4M1V A;  2DWJ A;  4PFU A;  4ZEK A;  3K6U A;  2OBG A;  3PUY E;  4X1B A;  4GIZ A;  2QRY A;  3KSX A;  2QVR A;  4QF9 A;  1B58 A;  1GGG A;  2W7Y A;  2CZL A;  1NV3 A;  1I6B A;  4AQ4 A;  2DVZ A;  4U23 A;  2Z8E A;  2OX3 A;  1A8E A;  3UP9 A;  2XXR A;  3BFU A;  1Y4C A;  5CMC A;  1MG1 A;  3HCQ A;  1BIY A;  1VR5 A;  4EXL A;  1YAE A;  4I1D A;  1KWH A;  2G29 A;  2E1S A;  5FHN A;  2Q9T A;  2ZXT A;  1AL3 A;  4H0W A;  3ZKK A;  4NF5 A;  1MXY A;  5H8N A;  2GRV A;  3ODB A;  2V3U A;  4N13 A;  3DP8 A;  3IK6 B;  2Q8M A;  1P1N A;  5K2X A;  1FQE A;  5H8Q B;  4UA8 A;  2YLN A;  1NV4 A;  4OWD A;  3SZP A;  1AIV A;  3GYY A;  4JSD A;  2H5Y A;  4N8G A;  3HHF A;  1LFI A;  3I5O A;  2F3D A;  1D9V A;  2VOZ A;  5I7I A;  2IEE A;  3G3G A;  1LGB C;  4PE3 A;  1PEB A;  4GFR A;  4XEQ A;  3MVY A;  4NF0 A;  1JNF A;  4XKP A;  2A5S A;  1FTO A;  2OWT A;  2ZYO A;  4EXK A;  5KDT A;  1POY 1;  1GR2 A;  3K6W A;  4MNP A;  4HW8 A;  3MUQ A;  1MXW A;  4F1Y A;  3TPA A;  1FJ6 A;  4P8B A;  5CBS A;  2XWK A;  1FSA A;  3T93 B;  2PMS A;  1FRP A;  3MZB A;  3OSQ A;  3G7W A;  1JW1 A;  3EHS A;  1FTJ A;  2Q74 A;  4F2O A;  1GTK A;  3SES A;  1H76 A;  2DOJ A;  4F1V A;  4OTE A;  4GBV A;  1B1H A;  1Y20 A;  1XT8 A;  4OER A;  3THI A;  4HCW A;  4K3F A;  5K2Y A;  1JEU A;  2XXW A;  2Z23 A;  5CI5 A;  2VHA A;  1SDX A;  3GLB A;  4PGN A;  2WEF A;  4PFW A;  1LFG A;  5EQ7 A;  3TQW A;  3PUV E;  4OET A;  3C4M A;  4YMB A;  1B6H A;  3PU5 A;  4ECF A;  2XA5 A;  2Y7R A;  3LSL A;  4NF6 B;  4H45 A;  4OVT A;  3W15 C;  1LEV A;  2V3T A;  1B0L A;  4PBH A;  4FJP A;  3VV5 A;  4NWC A;  4H65 A;  3R26 A;  2CZI A;  5ET7 A;  1D3K A;  4YKK A;  3O6H A;  4O3C A;  5I58 A;  4E0X A;  1M5D A;  1YCJ A;  3PD9 A;  4GBW A;  1XOC A;  3M3F A;  2QS1 A;  1L5T A;  3CG3 A;  3TKD A;  1NV5 A;  3CHG A;  2FA7 A;  2DWH A;  3WAF A;  1MXZ A;  3RPL A;  2XWV A;  3ZKL A;  4GX3 A;  5AA4 B;  2PFY A;  2Y7W A;  1AWB A;  5HBC A;  4G8H A;  4IB2 A;  4OYV A;  4ONY A;  4Q5T A;  5FHO A;  3NOH A;  4LN5 A;  1MM6 A;  3IL1 B;  1YTV A;  3KN3 A;  3H6U A;  1NH7 A;  5DVI A;  4PP0 A;  3KBZ A;  3RTF B;  2D21 A;  4KCD A;  4LVQ A;  3ZS6 A;  1DTZ A;  4BDQ A;  5IZ3 A;  3MP6 A;  1FBF A;  4R75 A;  1B4H A;  3IOW A;  1VE4 A;  1NUX A;  1IXI A;  1KZ8 A;  4Q8R A;  4O3A A;  5FBP A;  5H8H B;  5ICT A;  1MPD A;  1IXG A;  4LZ5 A;  4YKI A;  3IR1 A;  3PGF A;  2HQ0 A;  5AA1 A;  1PB7 A;  1DK4 A;  3T1B A;  4KFQ A;  3FD3 A;  3GZG A;  4O3B A;  3RQT A;  1ZJL A;  1B40 A;  3V5A A;  3PMW A;  4H5F A;  3HST A;  1ZBM A;  4PAI A;  1MS7 A;  4YAH X;  4LQ5 A;  3QSL A;  1MY3 A;  1SW4 A;  3CI8 A;  5H8S A;  2A5T A;  2F6G A;  3N94 A;  3W9W A;  3RGY A;  4GXA A;  2ZNT A;  1IIW A;  2XXH A;  3RUM A;  4F31 B;  2DWA A;  4QFP A;  2O7I A;  3CR9 A;  2D5W A;  3TTK A;  3O9P A;  3SEV A;  2ZMB A;  3B7D A;  4PCD A;  1NL5 A;  3N6T A;  3SET A;  4I62 A;  1R1N A;  2PT2 A;  3LSF B;  4FEB A;  1FBD A;  2OPE A;  5FTH A;  4YMA A;  4DE8 A;  4TLL B;  1NV7 A;  1LST A;  4OEV A;  1B3H A;  1TXF A;  2F78 A;  1US4 A;  4KCC A;  4OFJ A;  3BFT A;  5ET8 A;  3MPL A;  5A5X A;  3V83 A;  5IZ3 B;  4ESW A;  4HE1 A;  1EYJ A;  3UGW A;  4F18 A;  4BDO A;  4KYD A;  1Y4T A;  4ZEC A;  4NAP A;  5KDT B;  3VDF A;  2FBP A;  1A7L A;  3ECR A;  1B32 A;  4R73 A;  5DW8 A;  4G61 A;  1JW4 A;  4Q30 B;  5EQA A;  1DPP A;  4F22 A;  3MVW A;  1UTB B;  2DSF A;  2I3V A;  3Q28 A;  3DM0 A;  2QS4 A;  3OO6 A;  4P11 A;  4THI A;  3S9L C;  2QVU A;  3C9H A;  3TQL A;  4NX1 A;  4IR8 A;  3QUF A;  4QFO A;  4O8M A;  3USD A;  1TFA A;  3IAZ A;  3OXN A;  3N26 A;  1QW0 A;  4MMP A;  5JK4 A;  1MY2 A;  1FBC A;  5TPA A;  2RIN A;  5DEX B;  5IKB A;  2QL3 A;  4ND9 A;  5I3S A;  1NKX A;  4XF5 A;  5EYG A;  4LP2 B;  2F6P A;  3PV0 E;  5BUU A;  1FCK A;  2AIX A;  1JET A;  4EUO A;  4F3S A;  3TMG A;  1GVC A;  1VDW A;  2HXR A;  2XXY A;  3SER A;  3WAE A;  4ZDM A;  1I69 A;  1NNK A;  1UQW A;  3O29 A;  3KJ7 A;  3Q26 A;  4N07 A;  2QS2 A;  4NF8 A;  3IFA A;  1OQG A;  3FGS A;  4QRZ A;  2GH9 A;  1JW5 A;  2CMO A;  3OEM A;  4O7M A;  4ZED A;  3PMV A;  4ZEB A;  2THI A;  5TPA B;  4RYA A;  2R9J A;  1FTK A;  4X8R A;  4JB7 A;  3DP6 A;  4F1U A;  4G68 A;  3OMB A;  1JQF A;  1FPI A;  1IXC A;  2F7A A;  4L17 A;  3O28 A;  2R6G E;  3VE1 B;  1IEJ A;  3VVD A;  1FBG A;  1QUJ A;  3U65 A;  2IA4 A;  3K6X A;  3JYR A;  3IO6 A;  1JP4 A;  1FPD A;  5DTB A;  3GBB A;  2ZZW A;  3FBP A;  1LB8 A;  4P47 A;  1D4N A;  5CM6 A;  1H3D A;  3G3J A;  3H6V A;  3MBP A;  1FBP A;  4MNI A;  4I3E A;  5I56 B;  1JEV A;  1ANF A;  4BDR A;  1DMB A;  3T96 B;  2OJT A;  1FQF A;  3OEL A;  4OZ9 A;  2P2A A;  5DT6 A;  4DXC A;  4UAB A;  1CE2 A;  3VVF A;  4H8I A;  5FTI A;  1MQI A;  3FV2 A;  2UVH A;  4RA1 A;  4N6K A;  2HFB A;  2I49 A;  5CRY A;  3M3L A;  1FPF A;  1SI1 A;  2VPO A;  5AE4 A;  2Y5K A;  3TCG A;  4WED A;  3E13 X;  4F2Q A;  5I57 B;  3BBR A;  1LLS A;  2ZZX A;  3TUS A;  3HN0 A;  3FV1 A;  2B3B A;  5ELV A;  3OOA A;  4OFO A;  2PBW A;  4MFI A;  5F24 A;  2O1L A;  3PUX E;  4R6K A;  4GL8 A;  1WOD A;  2VD2 A;  4IO2 A;  3C34 A;  4QFN A;  3VLW A;  4GWX A;  4U4S A;  3PPN A;  4EQB A;  1FPK A;  1OVB A;  3Q27 A;  5I58 B;  1DTG A;  4RK2 A;  4P1L A;  3MVZ A;  2NWJ A;  2P0S A;  3IB1 A;  3K0V A;  1A54 A;  3LR1 A;  3QMF A;  3B6T A;  4OVQ A;  2QPQ A;  3EQ1 A;  4FIM A;  4RK9 A;  3RNN A;  2O1M A;  1B7H A;  4OQO A;  4R9F A;  2F35 A;  2OCU A;  2CEX A;  4PFT A;  1OVT A;  4XKQ A;  3OSR A;  4PQJ A;  4U21 A;  3CIJ A;  4MF3 A;  1N76 A;  4ZE8 A;  4JWO A;  5EQ9 A;  5I57 A;  4H46 A;  3IOT A;  4U22 A;  1S50 A;  1G0I A;  1DSN A;  1LBV A;  4HE0 A;  4LUB A;  1YZ0 A;  4PFR A;  1RDZ A;  4G8M A;  1OMP A;  1BK4 A;  2HAV A;  3MPK A;  2B65 A;  1KA1 A;  3PMX A;  4NHB A;  1EU8 A;  2WYK A;  2Y84 A;  5H8H A;  4PAF A;  3IX1 A;  4P1E A;  1YYZ A;  5FHM A;  4PFY A;  4HE2 A;  1MM7 A;  4JVD A;  1P1U A;  2M8C A;  2ONS A;  4RY1 A;  5LTC A;  1SYI A;  5I2K A;  3ROJ A;  1HSL A;  3D4G A;  1ZU0 A;  4R74 A;  5DYH A;  3PPP A;  3JV9 A;  2F7B A;  2I0B A;  1JVX A;  3R7X A;  4GWS A;  2I3W A;  1SW5 A;  2I0C A;  5I59 A;  4RPN A;  3RN8 A;  1LAH E;  3M8U A;  4ESX A;  1MPC A;  4X48 A;  2GHB A;  3PPQ A;  4NF6 A;  5H8N B;  3C35 A;  4NF5 B;  1B52 A;  2QMX A;  1ZKB A;  4F39 A;  4G68 B;  5B7D A;  4YZZ A;  1Q1K A;  1B5I A;  4QBA A;  1MH4 A;  1Y1Z A;  4LZ8 A;  2I4C A;  4OA4 A;  5IZ1 A;  4I9D A;  3FUZ A;  3CVG A;  2RCA A;  1K9Z A;  1QUL A;  2UXA A;  4OEU A;  4KQP A;  1KA0 A;  3TCH A;  4G77 A;  1SPI A;  4PTK A;  3B50 A;  4DCY A;  4NED A;  2VP1 A;  4EDP A;  5I56 A;  1II5 A;  4YKJ A;  1PC3 A;  2ZYK A;  2ONK E;  1POT A;  4PF6 A;  2REG A;  4MH5 A;  1IUD A;  3BKI B;  5I2K B;  4P3L A;  4N8Y A;  3U94 A;  2OPD A;  2DDK A;  1US5 A;  3K00 A;  4UAC A;  5CMB A;  1VSO A;  3UA8 A;  2DVC A;  4C0R A;  2XX7 A;  4OVJ A;  1QGX A;  1QUI A;  2F7C A;  4ELO A;  2DXY A;  4OXV A;  4KD5 A;  3RT8 A;  2HZK A;  4Z7E A;  3IOR A;  3BIG A;  1TFD A;  4OEN A;  3FAS A;  1ZMG A;  2P3N A;  1SW2 A;  1F9B A;  4MBP A;  2FIX A;  4HXV A;  4E0W A;  3ZSF A;  1YXI A;  1FTL A;  3U92 A;  3BIH A;  4LZ7 A;  5LOM A;  1MQG A;  1S9T A;  2Z8D A;  4H67 A;  2QVV A;  1Y3P A;  2ZZV A;  2A5T B;  2ZNS A;  2HXW A;  5JTY B;  3N5L A;  4F3G A;  3S4U A;  3TTL A;  1UIV A;  4ISU A;  1AMF A;  3H7M A;  1DOT A;  3KFM A;  3RPW A;  3MAM A;  3SEX A;  5L8D A;  1NMU A;  3PUZ E;  4Q0C A;  4JWX A;  2Y5L A;  4BDN A;  5IM2 A;  4MAG A;  1B46 A;  5M2V A;  1B51 A;  1OLA A;  4IY5 A;  3D4C A;  1IMF A;  3MST A;  4H5G A;  1LBX A;  1URD A;  2XXV A;  2D3I A;  1Z7N E;  5DEX A;  3Q25 A;  4GLI A;  4U4X A;  2QFL A;  4PBQ A;  1PB9 A;  2RC8 A;  4ZE9 A;  5A5X B;  1TWY A;  4LA9 A;  4OMB A;  3U1O A;  1NNT A;  5EHS A;  4H8J A;  4QFL A;  1URG A;  4PDD A;  1WDN A;  2XXQ A;  2PYY A;  3F11 A;  4GWZ A;  1RYO A;  3G3I A;  3EF7 A;  1SVX B;  1ATG A;  1EYK A;  4YB6 A;  3KSJ A;  2ONR A;  4MLQ A;  4XIG Q;  2DQV A;  1O64 A;  3KEI A;  2XXU A;  3UOR A;  3DLN A;  1B7U A;  3UN6 A;  4JXI A;  3LSX A;  1LBZ A;  4DZ1 A;  1N7W A;  4H6D A;  4I3Y A;  2XWI A;  5AA2 D;  1XS5 A;  3PUW E;  3A3C A;  1LBC A;  3MVX A;  1PBP A;  3CSG A;  3MJN A;  1IMD A;  1R9L A;  5HM4 B;  5EYF A;  2XXX A;  3FXR A;  3PTY A;  2QJE A;  5IGA A;  2PVU A;  3V89 B;  3OD7 A;  1EYI A;  5H8F B;  3QAX A;  2PCR A;  2HHM A;  3RTW B;  2VT5 A;  4PFI A;  3QYT A;  3VFJ A;  3H03 A;  4GD5 A;  1H45 A;  3MQ9 A;  3EPE A;  2B4M A;  3S9E A;  4QXD A;  2Z22 A;  4MNC A;  4YU0 A;  4JSO A;  2VPN A;  1NUW A;  1HSE A;  1OIB A;  3KBR A;  1ELJ A;  3K2D A;  5ESY A;  3VLV A;  1QUK A;  4I40 A;  2HEU A;  3C31 A;  4GOT A;  1MY0 A;  3IFC A;  1VFD A;  3K4U A;  5B70 A;  5IAI A;  2UVI A;  1FPG A;  3CG1 A;  4U1O A;  3MWB A;  2XHD A;  2LAO A;  2NUV A;  2ZNU A;  4XTC Q;  3O6G A;  4IO7 A;  1DPE A;  5I59 B;  2XD2 A;  4MCO A;  3OO8 A;  2F8D A;  4YB5 A;  3CFL A;  5L9S A;  1MRP A;  3TOD A;  4ZEI A;  3IO4 A;  5T3J A;  1LCF A;  2F5X A;  3OEK A;  3ONM A;  4XFE A;  3C32 A;  1BKA A;  4DXB A;  4KR5 A;  4R72 A;  1YPN A;  3H06 B;  2KR0 A;  5CMK A;  3PPR A;  1H44 A;  3E9X A;  4HTG A;  2O6A A;  4M4G A;  4FAJ A;  3O6I A;  3TDJ A;  1MXU A;  4Z0I A;  5J1D A;  3L6H A;  5ITO A;  1I6A A;  1RYX A;  3U72 A;  5DVJ A;  2HCA A;  4U1Z A;  4ELQ A;  4YIC A;  1NNP A;  2DP8 A;  2QSX A;  3G3F A;  2V4C A;  4POX A;  1LBY A;  3FVK A;  3O2A A;  2X7P A;  5TP9 B;  2F3B A;  3H4Z A;  2H9B A;  3IOV A;  3T9X B;  5DVF A;  1P1Q A;  3T9V A;  2WX9 A;  3B6W A;  2H25 A;  3L6G A;  2NOO A;  1NI9 A;  2Y7P A;  4N6P A;  2FVZ A;  2HZL A;  3KOS A;  3KC1 A;  4OES A;  2UYE A;  1FTM A;  2XXK A;  4RXL A;  3MP8 A;  3D1R A;  1NV2 A;  1PDA A;  3EHT A;  1IMC A;  4P0G A;  4P56 A;  1RDY A;  1OLC A;  4RNS A;  2B3F A;  1IZ1 A;  3K6V A;  1TT1 A;  2DE3 A;  3TAJ A;  1IXH A;  4PET A;  1Q35 A;  1WVJ A;  3TEP A;  3KZG A;  2ESN A;  3SEY A;  2FYI A;  3IJO B;  5LDZ A;  3FZV A;  4FOR A;  4GQO A;  3TTM A;  1N0T A;  1NUZ A;  4N4U A;  1M5C A;  3ISP A;  1A55 A;  1N7X A;  4IY6 A;  2PX1 A;  4IGT A;  1MDQ A;  2CZK A;  2RC9 A;  4MX6 A;  4QSE A;  2Q88 A;  2O84 X;  4PGP A;  1MQJ A;  1N04 A;  3Q29 A;  3LBS A;  2RC7 A;  4GWY A;  2ABH A;  4QSC A;  4JVI A;  3EN3 A;  3RYD A;  4EF1 A;  4OAN A;  3VVE A;  3PD8 A;  1O63 A;  1H43 A;  4AB6 A;  4EQ9 A;  2JJK A;  3CSB A;  3GXA A;  1XVX A;  1N3W A;  4NTL A;  4QSD A;  2VGQ A;  3AXF A;  3S9N C;  1USY H;  1FPJ A;  4HS7 A;  2XD3 A;  4PC9 A;  3TZA A;  3IB0 A;  1J1N A;  2Q2C A;  4EQ7 A;  3RPL B;  1FQA A;  1FBE A;  3E79 A;  3RLF E;  3QXM A;  1SI0 A;  2ANJ A;  2WYP A;  3P7I A;  4JDF A;  4JBZ A; 
#chains in the Genus database with same CATH homology
 2ZZX A;  2P3V A;  4OVS A;  2DDK A;  3LV0 A;  2MKZ A;  2F3D A;  4P1E A;  1YYZ A;  1Q9D A;  4PF8 A;  5I7I A;  3E78 A;  1INP A;  1IMC A;  5ET5 A;  4AS4 A;  4P56 A;  1FPG A;  4PDD A;  3FXB A;  4HE2 A;  4GWZ A;  1RDY A;  4PCD A;  4PE3 A;  1NV5 A;  2B4L A;  4N17 A;  3CHG A;  4XEQ A;  4DI4 B;  1FPL A;  3IFA A;  4JVD A;  4N81 A;  3RPL A;  2XWV A;  4FBP A;  2KQZ A;  1QGX A;  4NF0 A;  4O7M A;  1FBD A;  1EYK A;  2DE3 A;  5F24 A;  4GX3 A;  4M1V A;  5A5L A;  2FIE A;  5LTC A;  1FBH A;  4MCO A;  4MIJ A;  4O94 A;  4PET A;  4GX6 A;  3ROJ A;  4X04 A;  1NV7 A;  2HZK A;  1FJ9 A;  4MNP A;  1IMB A;  2QVR A;  4MEV A;  2PFY A;  5LDZ A;  4X8R A;  3BIG A;  1AWB A;  3T0J A;  4F1U A;  4P9K A;  4GWX A;  5T3J A;  1FTA A;  2P3N A;  1FJ6 A;  2F5X A;  1NV3 A;  5IZ3 B;  4P8B A;  4AS5 A;  1FSA A;  1FPI A;  2DVZ A;  2XWK A;  1LBZ A;  5ET8 A;  3NOH A;  4PFB A;  4PGN A;  4X9T A;  2CEY A;  4LN5 A;  4XFE A;  1FPK A;  2FIX A;  2OX3 A;  4GX4 A;  1NUZ A;  1FRP A;  4GWS A;  1EYJ A;  4HE1 A;  4HXV A;  2DE4 A;  3EKI A;  4I3Y A;  4F18 A;  2KR0 A;  2XWI A;  4N4U A;  5J1D A;  3W9V A;  1NV1 A;  1YXI A;  3ISP A;  3LUZ A;  4NAP A;  2R8T A;  3BIH A;  1FBG A;  2Q74 A;  4P1L A;  3U65 A;  3KBZ A;  4JVC A;  1IME A;  2FBP A;  4OVP A;  5ET6 A;  4F1V A;  4YZZ A;  4GBV A;  1IMD A;  5DW8 A;  1FPE A;  4N91 A;  1K9Y A;  2CZK A;  5IZ3 A;  1FBF A;  2QVV A;  4PBQ A;  4PDH A;  2ZZV A;  4MJO A;  1DCU A;  3MYU A;  4HCW A;  4MX6 A;  1JP4 A;  3QMF A;  4G61 A;  4N15 A;  4QBA A;  1FPD A;  5EQA A;  2XWO A;  3PTY A;  1NUX A;  5IGA A;  2ZZW A;  3A29 A;  4OA4 A;  4OVQ A;  2QPQ A;  2PFZ A;  1KZ8 A;  1NUY A;  2CZH A;  2GQ1 A;  3FBP A;  4PGP A;  5IZ1 A;  5FBP A;  2Q9T A;  1RDX A;  4P47 A;  5CM6 A;  2WBB A;  5J16 A;  4YIC A;  1DBZ A;  4NN3 A;  1FBP A;  4HCY A;  5I5P A;  5IZZ A;  1EYI A;  4MNI A;  4GWU A;  4PAK A;  4I3E A;  1XI6 A;  2QVU A;  4GWY A;  2WEF A;  1LBY A;  2PCR A;  1DK4 A;  2HHM A;  4IR8 A;  2L5V A;  1K9Z A;  2V4C A;  4JVI A;  3RYD A;  4NX1 A;  3T1B A;  4DI3 D;  5EQ7 A;  2CEX A;  1D9Q A;  1G0H A;  4MHF A;  4OAN A;  2F3B A;  2VT5 A;  2V3Q A;  1KA0 A;  4O8M A;  4PFI A;  4O7I A;  1FPB A;  2OWZ A;  2DE2 A;  2Y5L A;  1SPI A;  4PTK A;  2Q8M A;  5IM2 A;  3B50 A;  4MAG A;  2JJK A;  2B4M A;  4MMP A;  4QXD A;  4UAB A;  5JK4 A;  1FBC A;  2XA5 A;  1IMF A;  5EQ9 A;  3MST A;  1NV6 A;  4H45 A;  4MNC A;  2WBD A;  4PAI A;  4OVT A;  1LEV A;  1IMA A;  1LBX A;  2WX9 A;  4H46 A;  5EYH A;  4N6D A;  2VPN A;  4N6K A;  1NUW A;  4PBH A;  4GWW A;  1G0I A;  2QFL A;  4KXP A;  4NGU A;  1CNQ A;  1LBV A;  4NQ8 A;  4HE0 A;  1FPJ A;  1LBW A;  1NI9 A;  3HFU A;  3B8B A;  1YZ0 A;  2BJI A;  1RDZ A;  2FVZ A;  5I3S A;  2HZL A;  4PC9 A;  4PFR A;  2FHY A;  5EYG A;  4XF5 A;  2CZI A;  1BK4 A;  5ET7 A;  1FPF A;  1NV4 A;  3KC0 A;  3KC1 A;  4PF6 A;  3SZP A;  4F19 A;  2VPO A;  3W9W A;  1KA1 A;  5ESY A;  3RPL B;  4NG7 A;  1FBE A;  5EQ8 A;  2HPG A;  2Y5K A;  2WYK A;  3GYY A;  4NHB A;  3E79 A;  4I40 A;  1NV0 A;  1VDW A;  2XXK A;  2WYP A;  4PAF A;  2HXR A;  3D1R A;  4N8G A;  4GBW A;  4P3L A;  4OVR A;  4N8Y A;  1NV2 A;  3IFC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...