3QMFA

Crystal strucuture of an inositol monophosphatase family protein (sas2203) from staphylococcus aureus mssa476
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
262
structure length
254
Chain Sequence
KTLQQIDKLICSWLKQIDNVIPQLIMEMTTETKRHRFDLVTNVDKQIQQQFQQFLATYFPEHQLLAENEINHLWIMDPIDGTANLVKQQEDYCIILAYFYEGKPMLSYVYDYPHKKLYKAIRGEGAFCNGIKMEEPPSLKLEDAIISFNAQVMNLDTVQDLFDASFSYRLVGACGLDSMRVAKGQFGAHINTNPKPWDIAAQFLFAELLNLKMTTLDGKAIDHLKGAPFIISNKACHETVLKILNANGGYQKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Inositol monophosphatase family protein
publication title Crystal structure of Staphylococcal dual specific inositol monophosphatase/NADP(H) phosphatase (SAS2203) delineates the molecular basis of substrate specificity
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 74
structure length 254
sequence length 262
chains with identical sequence B
ec nomenclature ec 3.1.3.25: Inositol-phosphate phosphatase.
pdb deposition date 2011-02-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 3qmfA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 3qmfA02
3QMFA 1LBYA 1QGXA 1YXIA 5IZ1A 1AWBA 4FBPA 3KC0A 5EQ7A 3B8BA 1FBGA 4GX4A 4HE0A 2R8TA 5LDZA 1RDYA 1NI9A 5F24A 2VT5A 4MJOA 1FPKA 1NUYA 1FTAA 1FBDA 2FIEA 2WEFA 4O7IA 1G0HA 3BIHA 5EQ9A 1KA1A 1Q9DA 1IMDA 1XI6A 1LBXA 4GWZA 4H45A 1LEVA 1K9YA 5DW8A 1LBVA 1CNQA 2BJIA 5EYGA 1FJ6A 1DK4A 1NV1A 1FBEA 2PCRA 1D9QA 1DCUA 1LBWA 1FPGA 5IZ3B 1FBHA 2Q74A 5J16A 4GWYA 4PTKA 4AS5A 5ET8A 5A5LA 4GWSA 4I40A 2CZHA 4GWWA 2Y5LA 1IMCA 2DDKA 3ROJA 4HE2A 2P3VA 1INPA 2FHYA 5IZ3A 1FBPA 1FPFA 1RDXA 3LV0A 4KXPA 5EQAA 2F3BA 1NV2A 1RDZA 2CZKA 1FPLA 1NUWA 1DBZA 1FPEA 4AS4A 2Y5KA 4I3YA 3BIGA 5ESYA 4I3EA 2P3NA 2GQ1A 3RYDA 1NV5A 1NV6A 2FVZA 2QVRA 1KA0A 3LUZA 1NV0A 2OX3A 1BK4A 1IMEA 1FBCA 5FBPA 3RPLB 3T0JA 1KZ8A 3KBZA 1IMAA 4GWUA 4GBVA 2CZIA 5EQ8A 2QFLA 1FPJA 3D1RA 5ET7A 5EYHA 1FRPA 4IR8A 2OWZA 1FPBA 1FPDA 1JP4A 1YZ0A 1EYKA 1LBZA 2QVVA 2WBBA 1NV4A 1VDWA 3RPLA 2F3DA 1NUXA 4QXDA 1K9ZA 4HXVA 5ET6A 3FBPA 2FBPA 1EYIA 4GX3A 4G61A 3KC1A 1NV7A 4GWXA 1EYJA 4GBWA 2HHMA 2Q8MA 1NUZA 1FJ9A 1YYZA 2QVUA 1IMBA 4HE1A 1SPIA 1G0IA 3A29A 3IFCA 5I3SA 1FPIA 2JJKA 4GX6A 1NV3A 1FBFA 2WBDA 2FIXA 4H46A 3IFAA 1IMFA 4N81A 5ET5A 1FSAA 5T3JA
chains in the Genus database with same CATH superfamily
4NF4A 1LBYA 4JWYA 4OMBA 1YXIA 4R2BA 3GLBA 2Y7WA 3KC0A 3OELA 3K1PA 1D9YA 4HE0A 2QS1A 4H1XA 4YICA 4MLVA 1FTAA 2ZNTA 1B32A 3DLNA 1XI6A 1LBXA 1UTHB 1LEVA 3A3UA 4TLMB 1NFTA 1FBEA 2PCRA 3MAMA 4MEVA 3QUJA 1DCUA 4XKPA 4GWSA 2OCUA 2F5XA 1LCFA 3H03A 3HV1A 3MW0A 3K6VA 3VV5A 3OO9A 1ELJA 4LA9A 1DPPA 1Z7ME 1XVXA 1R9LA 4F29A 3K01A 3RYDA 1R1NA 3OEMA 1HSLA 4R73A 4ZEBA 3UN6A 3RNNA 3LUZA 1ZU0A 1B1XA 5TPAA 1PBPA 3QK6A 2O7UA 4PFIA 2XX8A 3K6WA 2XA5A 2Q88A 1FTLA 4F39A 1Y3QA 1P1UA 1GR2A 3IOWA 4OEUA 3HPIA 3O6GA 2Y7KA 1PB8A 2NVUB 3IX1A 3T9XB 3ODBA 5AA2D 4GX6A 4PFUA 3EQ1A 5FTIA 1I69A 2F7CA 4F2QA 3T22A 3BFUA 1FQEA 2GH9A 4H67A 2NXOA 4PCDA 2H99A 2XXUA 4MFIA 5CMBA 5EQ7A 3LC8A 4PBQA 3VLVA 1NNKA 2F7BA 4N13A 4PFTA 1OLAA 2ZZVA 4FEBA 2O51A 3W15C 3QIMA 5HBCA 1IXGA 5EQ9A 3PUXE 4OXVA 5ICTA 4GLIA 3OO7A 2PFZA 1NV1A 3IJXB 4EXKA 1JQFA 2RKMA 1FBHA 5A5LA 1BP5A 3RTFB 4O7MA 1UIVA 2Q9TA 1INPA 4RYAA 1RDXA 5EQAA 1VSOA 1H43A 3ISPA 4NF6A 4Q30B 3K1NA 3PMWA 2AL4A 3MSTA 4BDRA 4YB6A 4I3EA 4HS7A 3FVGA 2IA4A 1B3FA 1MPDA 2OX3A 4GWOA 4LVQA 3DELB 4DI3D 1S50A 4TQUQ 3HO7A 2DE3A 1XVYA 3U65A 4KCCA 2V84A 3TTMA 4G68A 4YMAA 4F1VA 5I2KA 1NV4A 1PBQA 5AA2B 1B3HA 4JVIA 3KC1A 5DVIA 3VDFA 1S9TA 4OETA 1G0IA 2DWJA 1UQWA 4H46A 3PGFA 1MY1A 3T66A 4ESXA 3IK6B 3O6HA 1AWBA 2GHAA 2RCBA 1B3GA 2B65A 1IEJA 3GBBA 4RPOA 4GX4A 2VGQA 3G3HA 2XXYA 3UGWA 5I58B 4KFQA 3BIHA 4EQ9A 4I9DA 4MX6A 1SQYA 1B3LA 3SERA 3FVOA 4DZ1A 1N7WA 3KN8A 3QAXA 2DS9A 5H8HA 1URDA 4N6PA 4FATA 2CMOA 4JVDA 5B70A 1NKXA 2FHYA 2F34A 4QSCA 2XXKA 4F3BA 4LP2B 1MH4A 1FCKA 2UYEA 4F31B 2GHBA 4F22A 1YAEA 4PBHA 5A5XB 1LAXA 5K2XA 3OXNA 3W9WA 1ZJLA 3W9VA 3OOAA 4OQOA 3FVNA 1IMEA 4LQ2A 2REJA 5ISUA 2OWSA 1VDWA 1US4A 3FGSA 2HFBA 4ZEIA 5CMMA 4XIGQ 3VLWA 1TT1A 4QRZA 5TP9B 1NUZA 1B6HA 1H76A 1QUIA 1URGA 2FIXA 4KI0E 4ECFA 3VVFA 5ET5A 3CVGA 3THIA 3I6VA 2HCAA 3TAJA 4GXAA 2RINA 2Q2CA 1ZMGA 1T0KA 3CFXA 5KCJA 4QFLA 3T93B 1UTBB 4WEPA 4DXBA 4DI4B 1LBBA 2QMXA 4NEDA 4ZZEA 3C36A 4M1VA 3CFLA 2Z8FA 3B6TA 3LSLA 2I48A 3H6WA 1CNQA 4JSOA 4OVRA 3HFUA 5I5PA 4OEVA 4AQ4A 4IO6A 1M5CA 3MP1A 1B7UA 3PD8A 5H8FB 1UTHA 4LZ5A 4ZZAA 4PTKA 2VP1A 3Q27A 2DWIA 1NH8A 3CSBA 1MXVA 2YLNA 2PX1A 3K2DA 3MPKA 3QYTA 1SBPA 4THIA 4MNCA 2R9JA 5I57A 3KJTA 2RCAA 3IR1A 3O2AA 4PFRA 1BLFA 3KFMA 3K0VA 3OMBA 1FPEA 3TTNA 1NNFA 1MG1A 4F18A 2P3NA 2Q89A 4GFRA 1BTJA 1TXFA 2A5TB 2XHDA 5CI5A 2F6PA 1FBCA 2L5VA 4GBVA 5EQ8A 3BKIB 1FPJA 1FRPA 2OWZA 1FPDA 3O97A 4R72A 4XFEA 4U4SA 1IUDA 1NUXA 5DT6A 1VR5A 2XD3A 4NE4A 4U4XA 3PUWE 2DYXA 4X9TA 4F1UA 1FJ9A 1SPIA 3A29A 1LFHA 4X1DA 2F97A 4MH5A 4QFPA 2VHAA 1QJMA 1FQDA 3M3KA 2IEEA 4ELQA 1WDNA 4ND9A 1B46A 4U23A 2CZLA 3FJMA 4RK9A 4OHNA 4DIGA 3IL1B 2CEYA 2ZYKA 1VFDA 3C31A 4MMPA 4O7IA 3IB0A 4R6KA 1GVCA 3TQLA 1MY0A 4PFWA 4NF5A 3WAEA 1B7ZA 5DW8A 5DEXB 1B9JA 5EYGA 3C33A 4ELRA 1WVJA 3ILUB 4P3LA 4NHBA 4N8GA 4WKMA 3R7XA 4R6HA 4GWWA 3MZ1A 3LR1A 2QS4A 3B6QA 1MDQA 2ZYMA 1MPCA 3U93A 1RYXA 4NF8B 4HCYA 5H8NA 3KOSA 3LSWA 3RPWA 3FV1A 1MRPA 3SEYA 3KSJA 2X7QA 5IKBA 1A55A 2HPGA 1CE2A 2PYYA 3EPEA 4OWDA 1YZ0A 2WBBA 3ILTB 4XF5A 3KJ7A 2THIA 4MNIA 3PPPA 5I7IA 4GD5A 3RLFE 2RC7A 4G8HA 4YU0A 2I49A 3E78A 1SW2A 3G3KA 4BDQA 1I6QA 2Y84A 1B52A 1N04A 2AIXA 2JJKA 1IXHA 2UYFA 3TMGA 3ZS6A 3V8XB 3TDJA 3FJGA 1OIBA 4KHZE 3IB1A 3WAFA 3PU5A 5EHMA 3C34A 4WXJA 4G2ZA 1SW5A 5L9SA 4N6DA 1G0HA 2I6EA 1IMDA 4IO2A 1UIUA 1H3DA 4PAKA 1MXUA 4G8MA 1EH3A 1BIYA 1LAHE 1M5EA 4R2FA 4GWYA 1MQHA 5ET8A 1OVTA 3O66A 4IO4A 4N6KA 3N26A 4RPNA 5AE4A 3MUQA 2XXRA 3ROJA 2P3VA 3IB2A 2QL3A 4U1OA 4OFJA 1O63A 2GFEA 2OPDA 4KCDA 4LZ7A 1NUWA 3MZ9A 5AA4B 3BIGA 1QW0A 4RA1A 3SETA 2QVRA 3DP6A 5A5XA 1PEBA 1Q35A 5ET7A 1FTJA 4PQJA 4ZE8A 4MAGA 5M2VA 5I56B 2OLBA 4QF9A 3B7DA 3T9VA 2VPNA 1LAFE 2VOZA 1CB6A 4TOZA 4YKKA 1EYIA 4HTGA 3ECRA 3MVYA 3NOHA 2XWKA 2HHMA 5FHMA 2LAOA 4PE3A 2UVJA 1LLSA 1FPIA 1LFIA 5DVJA 2WBDA 3FD3A 4EF1A 1QGXA 3IAZA 2I3WA 2Q2AA 5IZZA 4DCYA 3D4GA 1EZOA 3H6VA 2XWOA 4L17A 3RTWB 5IM2A 1P1QA 4GL8A 3T9HB 2F36A 2DQVA 2HZKA 3FXUA 5B7DA 4OFOA 3Q26A 2XXXA 2ZZWA 1A7LA 3U92A 3RN8A 5I59A 4PF8A 1ZBMA 1SYIA 4PAIA 4RJZA 4P56A 4G77A 4BDLA 5H8FA 3K00A 3OO8A 4F3GA 1FPFA 4R74A 2KLFA 3GXAA 1RDZA 4YKPA 4P1LA 3SEUA 2V3TA 3TTKA 2GRVA 2ZXTA 1NV6A 1EU8A 2VD3A 4MNPA 1Y1ZA 3U8QA 1IXCA 4ZS9A 4DDDA 2PMSA 2MKZA 1IMAA 1IXIA 3TTRA 2CZIA 3ZSFA 3B50A 2A5TA 4C1TA 2RF1A 3PUVE 3U94A 1K9ZA 1S7YA 3RT8A 4GX3A 3E13X 4POXA 3UIFA 5DYHA 1MM6A 4ZE9A 2Z8EA 4NF0A 4P9KA 3S4UA 2Y7IA 4N81A 3TFLA 1NNPA 3VVEA 4POWA 1SW1A 1B7HA 4E0WA 3KEIA 4G68C 1R9QA 4IY5A 2VT5A 3TODA 2CEXA 2B4MA 2DXYA 3PD9A 4OVSA 1YTVA 3E9XA 4I1DA 1LBVA 1B51A 1SW4A 3TKDA 4H5FA 5ITOA 1JETA 4KR5A 2AL5A 1LBWA 1MQJA 3KN7A 5J16A 4JXIA 2Z8DA 4PETA 5JTYB 2QJEA 2DDKA 4O3CA 5FHNA 3LUYA 4ESWA 3OSQA 4X8RA 3EHSA 4NG7A 4PDDA 1MH3A 2PT2A 1RKMA 2I0BA 1NV5A 2HQ0A 4P47A 5I2NA 3H6UA 4OESA 1B40A 2RC8A 1VE4A 2D5WA 1Y4TA 4IY6A 4IO5A 5CC2A 1OLCA 1LBZA 1HSJA 2FYIA 3A3CA 4MBPA 2Q8JA 3LSFB 5BUUA 1IQ7A 1XC1A 5I3SA 3TTLA 1DTGA 3MVZA 2DSFA 1NV3A 4MIJA 2DOJA 3UK4A 1LCTA 3CI8A 2QSXA 2H98A 1FQAA 3FJ7A 5LTCA 4QBAA 3FIRA 3S9EA 3DM0A 4ELOA 4QSDA 2W7YA 3ZKKA 4H6DA 2O7IA 4H8IA 5IAIA 3IO4A 3CIJA 3SZPA 5KDTA 3N6UA 3ONMA 2I0CA 5TPAB 3CRBA 3TQWA 3UP9A 1MQDA 1NL5A 4U21A 4PAFA 3TEPA 1B4ZA 4BDMA 1P1OA 1RYOA 5DTBA 1N0TA 5ELVA 4N91A 1LB9A 5CM6A 2QS2A 1ZLQA 3VVDA 3O6IA 4ZEKA 3MVXA 3U1OA 3HSTA 4KXPA 2YPNA 2ONKE 2QPQA 1FPLA 3CHGA 4G4PA 4BDNA 3KN3A 2HAUA 2Y5KA 2O1MA 3K02A 1B3EA 4GL0A 3I3VA 2DVCA 1EZ9A 4GWUA 1B5IA 1DSNA 1LSTA 1FPBA 1B58A 4R9GA 2QVVA 2O69A 2F78A 2V3UA 4GVOA 4OVTA 5ET6A 4ZEDA 2I3VA 4GWXA 3U72A 3RGYA 5I56A 1YYZA 3IFCA 2P2AA 2P0SA 3TPAA 2VPOA 1A8FA 1YCJA 4NN3A 1DPEA 3PPOA 2D21A 4FBPA 1D3KA 1US5A 1L5TA 5ITPA 2B3FA 1Y3PA 4NTLA 4NF6B 3OEKA 4I62A 4MJOA 4K3FA 4LZ8A 4ZECA 5F7VA 5HM4B 1J1NA 2V4CA 4F1YA 4PDHA 1JVXA 1FJ6A 2V25A 1DK4A 1AOVA 3CSGA 3PPRA 1A54A 3G3GA 3SDFA 4KYSA 4G68B 4AS5A 3FXRA 3G3IA 1JW4A 4OVPA 3C35A 3KOTA 5K2YA 3PMVA 4OYVA 4RNSA 2ESNA 4IGTA 4JB7A 5ESYA 3DP8A 3UORA 2FVZA 4F3SA 1SDXA 5JK4A 2ALUA 2F7AA 2WKYA 1Y20A 3IO6A 1KZ8A 1M5FA 2PVUA 4I8CA 4QFNA 4N15A 3SEVA 5LOMA 2OPEA 3T96B 3GZGA 3D1RA 3MPLA 5F1QA 3G3JA 2H4IA 4AB6A 1B5JA 3EHUA 1R6ZA 4EDPA 2OJTA 4H5GA 1Y4CA 1P99A 4JWXA 4BDOA 3FZVA 3HHFA 3HHGA 3AXFA 2E0SA 3GBAA 3G3FA 2XX9A 4GBWA 1JEUA 4XKQA 4HE1A 1JW5A 3O29A 3QSLA 2XWVA 5H8HB 3IFAA 4QSEA 4G8NA 1MQGA 4NX1A 4PC9A 3B8BA 1MPBA 2B4LA 3PTYA 2HAVA 4P11A 3SEXA 2ZYNA 2XX7A 3H06B 4XTCQ 5AA2A 4GF8A 2PFYA 1FQBA 4H45A 1K9YA 1XHYA 1POY1 1B0HA 1N3WA 1Y1MA 4FORA 3H7MA 1D9QA 5IGAA 1B5HA 2Z23A 1MM7A 5IZ3B 1A99A 5I84A 2H9BA 4PFBA 4MF3A 2CZHA 1XS5A 4RXLA 2G93A 3LV0A 3IOUA 1II5A 3C9HA 2CZKA 1XOCA 3LBSA 3MQ9A 5I58A 3SKPA 2KR0A 1FTOA 1JW1A 4X48A 4FE8A 1GTKA 1KA0A 4LONB 3KBRA 3VXBA 1FQFA 3R6UA 3MZBA 3MJNA 5KCJB 2O68A 2R6GE 4O3AA 5L8DA 1MXYA 2H25A 1B05A 2NUVA 3K6UA 1EYJA 1Y3NA 4NQ8A 3FVKA 2QVUA 2PBWA 2ONSA 4F19A 4WEDA 4N07A 2HXWA 3MWBA 4F3PA 4R75A 3TYHA 1B2HA 3MYUA 2ZMBA 2F6GA 4OANA 3UA8A 4P8BA 5DVFA 4IGRA 4OVJA 4ISUA 2R8TA 3PMXA 3TUSA 2DVZA 5I57B 1RDYA 5F24A 4U1ZA 3IORA 3B6WA 2HXRA 2O6AA 1NUYA 2FIEA 3TELA 1URSA 2REGA 1ANFA 1SVXB 5HPQA 5TP9A 4ELPA 1JNFA 3A09A 3LSXA 4XKNA 4UA8A 3TCGA 1O64A 4PF6A 2Q74A 1VFEA 1OVBA 1SD3A 4DXUA 1N76A 1N3XA 4JBZA 1IMCA 5CMKA 2OK2A 2ONRA 3N6TA 1UTBA 2F8DA 3OENA 2F35A 2F3BA 5KZTA 1LAGE 4C0RA 1DBZA 2XXIA 4I3YA 3KG2A 5H8QB 1HSEA 5FBPA 2XXWA 5EYHA 2DWHA 4NWDA 3L6HA 4GXSB 2E1SA 4FAJA 1FW0A 4Z0IA 4QXDA 1SYHA 4HXVA 4FJPA 4NF5B 1TFAA 3TCFA 3M3LA 4G61A 1NV7A 4QHQA 1OMPA 2Q8MA 1ZKBA 3FUZA 1IITA 2AYSA 1DTZA 1FBFA 5AA1A 4YKJA 4UABA 2WX9A 1P1WA 3E4RA 3FV2A 3MBPA 4KD5A 2XXVA 4IB2A 4PP0A 4IO3A 1OQHA 3C32A 1ZTYA 1D4NA 3T1BA 4R9FA 3CG1A 4JDFA 4JVCA 1QUJA 4RY1A 5LDZA 1Q1KA 3V5AA 2I4CA 3MVWA 2Y7RA 4P0IA 2WEFA 5H8NB 1AMFA 1B4HA 1KA1A 2NOOA 3N5LA 1AH5A 3OD7A 3PV0E 1WODA 1GV8A 3BBRA 1FPGA 4O94A 1ZIUA 4H8JA 2G29A 4RK2A 2Y5LA 4XXUA 3PPNA 3FXBA 4HE2A 1YPNA 4R6YA 1FBPA 3MC2A 3R26A 2Y7PA 5J1DA 3CFZA 3K1MA 5CRYA 1MDP1 3CG3A 1LB8A 2O84X 2H5YA 2HZLA 3EKIA 2UVGA 3VFJA 3V89B 2GQ1A 2NWJA 1XT8A 5DEXA 1NV0A 3EF7A 3IOVA 2QS3A 3RPLB 4GRKA 1BKAA 3ZKLA 3KBZA 4NAPA 2QFLA 3S9LC 4EQBA 4IR8A 2I58A 1DOTA 4IO7A 1A8EA 1EYKA 2VD2A 4OA4A 4X04A 4U22A 1OQGA 3CR9A 2XXPA 3RQTA 4NF4B 2BJJX 4NF8A 1IMBA 4Z7EA 3VXCA 4TLLB 4C1UA 4N17A 1IMFA 3GYYA 5T3JA 3C4MA 4KPTA 1P1NA 3E79A 1FTKA 1QULA 2X26A 3TCHA 5CMCA 3BFTA 1D9VA 3V83A 2XXTA 4YMBA 1FBDA 2R71A 5L9MA 4HW8A 1Q9DA 2UXAA 4EF2A 1SI0A 3TZAA 2XXQA 2ZNSA 3OSRA 3M8UA 4QFKA 4AB5A 3FATA 4O8MA 4HCWA 1GGGA 2RC9A 5IZ3A 3Q29A 3JV9A 1NV2A 2QRYA 3KSXA 3P7IA 4LQ5A 4AS4A 2FA7A 4MHFA 4OVQA 3O9PA 3H4ZA 1TFDA 4GOTA 1EZPA 4LN5A 2OBGA 2DP8A 2YJPA 2OWTA 1QKBA 4F2OA 2D3IA 4KQPA 4N8YA 4N4UA 2M8CA 2ZYOA 1JP4A 4FEDA 3T9UA 1I6AA 3S9NC 2F3DA 2DWAA 3RY3A 4P0GA 1O7TA 2DE4A 1MXXA 3N94A 5ICQA 2O1LA 3Q25A 1PB9A 4XEQA 1Z7NE 1USYH 4OZ9A 3L6GA 5AA4A 3DP4A 4YZZA 2UVHA 1LFGA 1FSAA 5I59B 3S9MC 3VLUA 5CBSA 1PDAA 2QMWA 3K4UA 5AA3A 1M5BA 2WYKA 4X1BA 1USYE 1N84A 1M5DA 3KZGA 2B3BA 4Q5TA 4DCXA 4QFOA 1QKAA 4H65A 1FPKA 3Q28A 3JZJA 4DLDA 3G7WA 3I5OA 3MP6A 4GIZA 4GWZA 3IOTA 2DXRA 2KQZA 3EN3A 2BJIA 4YAHX 2X7PA 3E3KA 5EYFA 4LATA 3O28A 1MS7A 2P1SA 3SESA 3QUFA 1FTMA 2UVIA 3OO6A 4PE5B 4JWOA 1MXWA 4EXLA 4ZDMA 3MP8A 3RT6B 4BLAA 4XKRA 2V3QA 4PFYA 4PGPA 5FTHA 4MCOA 1A40A 1JEVA 1LGBC 2XD2A 1BK4A 4NMYA 5I2KB 3H3GA 5CBRA 3EHTA 1MY4A 3USDA 1I6BA 5H8QA 2PT1A 1MXZA 1NNTA 3HN0A 4PGNA 5FHOA 4H0WA 3S2VA 3PUZE 1H44A 1F9BA 3FBPA 5H8SA 4U2RA 4EQ7A 2DE2A 1NMUA 3PUYE 3K6XA 4O3BA 3RUMA 3D4CA 1ATGA 3QMFA 4Q8RA 4ONYA 2FNCA 5IZ1A 1SI1A 2ANJA 4FECA 3KGCA 4NGUA 1FBGA 3H6TA 2ABHA 1MY3A 4UACA 1NI9A 1B1HA 2ZZXA 4OENA 1Y9UA 4GQOA 4NWCA 3FASA 5I2NB 2WYPA 3M3FA 1H45A 4P1EA 4Q0CA 2XWIA 5TU0A 1TWYA 4EUOA 4LUBA 2OZZA 2HEUA 1B0LA 1PC3A 4I40A 1QVSA 4DE8A 5JEIA 2ZNUA 5L9OA 2I4BA 4KYDA 4YB7A 1PB7A 1IIWA 3FXQA 5BWJA 1MQIA 2Z22A 3F11A 3SEWA 1JVYA 2A5SA 1KWHA 4M4GA 1MY2A 4ZEFA 1DMBA 3T0JA 5EHSA 1QUKA 3JYRA 1AL3A 4OERA 3PPQA 3HCQA 3QXMA 1AIVA 1NH7A 3RPLA 4OTEA 2V93A 1FQCA 5JTYA 1POTA 1N7XA 3IJOB 1IZ1A 4YB5A 4KYEA 2FBPA 5KDTB 4YKIA 3VE1B 4FIMA 4E0XA 4DXCA 4JSDA 4OFLA 1LBCA 2XXHA 4MLQA
chains in the Genus database with same CATH topology
1LBYA 4UABA 2WX9A 1YXIA 3KC0A 5LTCA 3T1BA 4JVCA 4QBAA 4HE0A 5LDZA 4YICA 2CEYA 1FTAA 2WEFA 4MMPA 4O7IA 1KA1A 1XI6A 1LBXA 1LEVA 3SZPA 5DW8A 5EYGA 1FBEA 2PCRA 4P3LA 4MEVA 1DCUA 1FPGA 4NHBA 4PAFA 4O94A 4N8GA 4GWSA 4GWWA 2F5XA 4N91A 2Y5LA 5CM6A 3FXBA 4HE2A 1FBPA 4KXPA 5J1DA 2QPQA 1FPLA 4HCYA 3CHGA 2HZLA 2Y5KA 3EKIA 3RYDA 2GQ1A 3LUZA 1NV0A 3RPLB 3KBZA 4GWUA 4NAPA 2QFLA 4PFIA 2HPGA 4IR8A 1FPBA 2XA5A 1YZ0A 1EYKA 2QVVA 2WBBA 4OA4A 4XF5A 4MNIA 4X04A 5I7IA 4OVTA 5ET6A 3E78A 4GWXA 1YYZA 1IMBA 3IFCA 2JJKA 4GX6A 2VPOA 4N17A 1IMFA 4NN3A 3GYYA 5T3JA 3E79A 4FBPA 4PCDA 5EQ7A 4PBQA 2ZZVA 4MJOA 4N6DA 1FBDA 1G0HA 5EQ9A 1Q9DA 2V4CA 1IMDA 4PDHA 1FJ6A 2PFZA 4PAKA 1DK4A 1NV1A 4O8MA 1FBHA 4GWYA 4AS5A 5ET8A 5A5LA 4HCWA 4N6KA 4OVPA 4O7MA 2Q9TA 3ROJA 2P3VA 1INPA 5IZ3A 1RDXA 5EQAA 3ISPA 1NV2A 1NUWA 4AS4A 3BIGA 5ESYA 3MSTA 4MHFA 4I3EA 4OVQA 2FVZA 2QVRA 5JK4A 4LN5A 2OX3A 1KZ8A 4N15A 4DI3D 2DE3A 3D1RA 5ET7A 3U65A 4N8YA 4N4UA 4F1VA 1JP4A 4MAGA 1NV4A 2F3DA 2VPNA 4JVIA 2DE4A 1EYIA 3KC1A 3NOHA 2XWKA 4GBWA 2HHMA 4XEQA 4PE3A 4HE1A 1G0IA 1FPIA 2WBDA 2XWVA 4H46A 3IFAA 4YZZA 1FSAA 1QGXA 1AWBA 4NX1A 2WYKA 4PC9A 3B8BA 5IZZA 2B4LA 3PTYA 4GX4A 2XWOA 1FPKA 5IM2A 3BIHA 2PFYA 4GWZA 4MX6A 4H45A 1K9YA 2KQZA 2BJIA 2HZKA 1D9QA 5IGAA 2ZZWA 5IZ3B 4PFBA 4PF8A 2CZHA 4JVDA 4PAIA 4P56A 2FHYA 2XXKA 1FPFA 3LV0A 2V3QA 1RDZA 2CZKA 4P1LA 4PBHA 4PGPA 2KR0A 4MCOA 1NV6A 3W9WA 1KA0A 3W9VA 4MNPA 1BK4A 1IMEA 2MKZA 1IMAA 2CZIA 3B50A 4PGNA 1VDWA 1K9ZA 3FBPA 2DE2A 4GX3A 1EYJA 4NQ8A 1NUZA 2QVUA 4F19A 4NF0A 4P9KA 2FIXA 4N81A 5ET5A 3QMFA 5IZ1A 3MYUA 4OANA 4NGUA 1FBGA 4P8BA 2R8TA 2DVZA 1RDYA 1NI9A 5F24A 2ZZXA 4DI4B 2VT5A 2HXRA 2CEXA 1NUYA 2FIEA 2B4MA 4M1VA 4OVSA 1LBVA 1CNQA 2WYPA 4OVRA 3HFUA 5I5PA 4P1EA 2XWIA 1LBWA 4PF6A 2Q74A 5J16A 4PTKA 4I40A 4PETA 1IMCA 2DDKA 4MNCA 4X8RA 2F3BA 4PFRA 4NG7A 4PDDA 1DBZA 1FPEA 4I3YA 4F18A 2P3NA 1NV5A 4P47A 1FBCA 5FBPA 2L5VA 3T0JA 4GBVA 5EQ8A 1FPJA 5EYHA 1FRPA 2OWZA 1FPDA 1LBZA 3RPLA 4XFEA 1NUXA 4QXDA 4HXVA 2FBPA 4G61A 1NV7A 4X9TA 4F1UA 2Q8MA 1FJ9A 5I3SA 1SPIA 3A29A 1NV3A 1FBFA 4MIJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QMF A;  1LBY A;  1QGX A;  1YXI A;  5IZ1 A;  1AWB A;  4FBP A;  3KC0 A;  5EQ7 A;  3B8B A;  1FBG A;  4GX4 A;  4HE0 A;  2R8T A;  5LDZ A;  1RDY A;  1NI9 A;  5F24 A;  2VT5 A;  4MJO A;  1FPK A;  1NUY A;  1FTA A;  1FBD A;  2FIE A;  2WEF A;  4O7I A;  1G0H A;  3BIH A;  5EQ9 A;  1KA1 A;  1Q9D A;  1IMD A;  1XI6 A;  1LBX A;  4GWZ A;  4H45 A;  1LEV A;  1K9Y A;  5DW8 A;  1LBV A;  1CNQ A;  2BJI A;  5EYG A;  1FJ6 A;  1DK4 A;  1NV1 A;  1FBE A;  2PCR A;  1D9Q A;  1DCU A;  1LBW A;  1FPG A;  5IZ3 B;  1FBH A;  2Q74 A;  5J16 A;  4GWY A;  4PTK A;  4AS5 A;  5ET8 A;  5A5L A;  4GWS A;  4I40 A;  2CZH A;  4GWW A;  2Y5L A;  1IMC A;  2DDK A;  3ROJ A;  4HE2 A;  2P3V A;  1INP A;  2FHY A;  5IZ3 A;  1FBP A;  1FPF A;  1RDX A;  3LV0 A;  4KXP A;  5EQA A;  2F3B A;  1NV2 A;  1RDZ A;  2CZK A;  1FPL A;  1NUW A;  1DBZ A;  1FPE A;  4AS4 A;  2Y5K A;  4I3Y A;  3BIG A;  5ESY A;  4I3E A;  2P3N A;  2GQ1 A;  3RYD A;  1NV5 A;  1NV6 A;  2FVZ A;  2QVR A;  1KA0 A;  3LUZ A;  1NV0 A;  2OX3 A;  1BK4 A;  1IME A;  1FBC A;  5FBP A;  3RPL B;  3T0J A;  1KZ8 A;  3KBZ A;  1IMA A;  4GWU A;  4GBV A;  2CZI A;  5EQ8 A;  2QFL A;  1FPJ A;  3D1R A;  5ET7 A;  5EYH A;  1FRP A;  4IR8 A;  2OWZ A;  1FPB A;  1FPD A;  1JP4 A;  1YZ0 A;  1EYK A;  1LBZ A;  2QVV A;  2WBB A;  1NV4 A;  1VDW A;  3RPL A;  2F3D A;  1NUX A;  4QXD A;  1K9Z A;  4HXV A;  5ET6 A;  3FBP A;  2FBP A;  1EYI A;  4GX3 A;  4G61 A;  3KC1 A;  1NV7 A;  4GWX A;  1EYJ A;  4GBW A;  2HHM A;  2Q8M A;  1NUZ A;  1FJ9 A;  1YYZ A;  2QVU A;  1IMB A;  4HE1 A;  1SPI A;  1G0I A;  3A29 A;  3IFC A;  5I3S A;  1FPI A;  2JJK A;  4GX6 A;  1NV3 A;  1FBF A;  2WBD A;  2FIX A;  4H46 A;  3IFA A;  1IMF A;  4N81 A;  5ET5 A;  1FSA A;  5T3J A; 
#chains in the Genus database with same CATH topology
 4NF4 A;  1LBY A;  4JWY A;  4OMB A;  1YXI A;  4R2B A;  3GLB A;  2Y7W A;  3KC0 A;  3OEL A;  3K1P A;  1D9Y A;  4HE0 A;  2QS1 A;  4H1X A;  4YIC A;  4MLV A;  1FTA A;  2ZNT A;  1B32 A;  3DLN A;  1XI6 A;  1LBX A;  1UTH B;  1LEV A;  3A3U A;  4TLM B;  1NFT A;  1FBE A;  2PCR A;  3MAM A;  4MEV A;  3QUJ A;  1DCU A;  4XKP A;  4GWS A;  2OCU A;  2F5X A;  1LCF A;  3H03 A;  3HV1 A;  3MW0 A;  3K6V A;  3VV5 A;  3OO9 A;  1ELJ A;  4LA9 A;  1DPP A;  1Z7M E;  1XVX A;  1R9L A;  4F29 A;  3K01 A;  3RYD A;  1R1N A;  3OEM A;  1HSL A;  4R73 A;  4ZEB A;  3UN6 A;  3RNN A;  3LUZ A;  1ZU0 A;  1B1X A;  5TPA A;  1PBP A;  3QK6 A;  2O7U A;  4PFI A;  2XX8 A;  3K6W A;  2XA5 A;  2Q88 A;  1FTL A;  4F39 A;  1Y3Q A;  1P1U A;  1GR2 A;  3IOW A;  4OEU A;  3HPI A;  3O6G A;  2Y7K A;  1PB8 A;  2NVU B;  3IX1 A;  3T9X B;  3ODB A;  5AA2 D;  4GX6 A;  4PFU A;  3EQ1 A;  5FTI A;  1I69 A;  2F7C A;  4F2Q A;  3T22 A;  3BFU A;  1FQE A;  2GH9 A;  4H67 A;  2NXO A;  4PCD A;  2H99 A;  2XXU A;  4MFI A;  5CMB A;  5EQ7 A;  3LC8 A;  4PBQ A;  3VLV A;  1NNK A;  2F7B A;  4N13 A;  4PFT A;  1OLA A;  2ZZV A;  4FEB A;  2O51 A;  3W15 C;  3QIM A;  5HBC A;  1IXG A;  5EQ9 A;  3PUX E;  4OXV A;  5ICT A;  4GLI A;  3OO7 A;  2PFZ A;  1NV1 A;  3IJX B;  4EXK A;  1JQF A;  2RKM A;  1FBH A;  5A5L A;  1BP5 A;  3RTF B;  4O7M A;  1UIV A;  2Q9T A;  1INP A;  4RYA A;  1RDX A;  5EQA A;  1VSO A;  1H43 A;  3ISP A;  4NF6 A;  4Q30 B;  3K1N A;  3PMW A;  2AL4 A;  3MST A;  4BDR A;  4YB6 A;  4I3E A;  4HS7 A;  3FVG A;  2IA4 A;  1B3F A;  1MPD A;  2OX3 A;  4GWO A;  4LVQ A;  3DEL B;  4DI3 D;  1S50 A;  4TQU Q;  3HO7 A;  2DE3 A;  1XVY A;  3U65 A;  4KCC A;  2V84 A;  3TTM A;  4G68 A;  4YMA A;  4F1V A;  5I2K A;  1NV4 A;  1PBQ A;  5AA2 B;  1B3H A;  4JVI A;  3KC1 A;  5DVI A;  3VDF A;  1S9T A;  4OET A;  1G0I A;  2DWJ A;  1UQW A;  4H46 A;  3PGF A;  1MY1 A;  3T66 A;  4ESX A;  3IK6 B;  3O6H A;  1AWB A;  2GHA A;  2RCB A;  1B3G A;  2B65 A;  1IEJ A;  3GBB A;  4RPO A;  4GX4 A;  2VGQ A;  3G3H A;  2XXY A;  3UGW A;  5I58 B;  4KFQ A;  3BIH A;  4EQ9 A;  4I9D A;  4MX6 A;  1SQY A;  1B3L A;  3SER A;  3FVO A;  4DZ1 A;  1N7W A;  3KN8 A;  3QAX A;  2DS9 A;  5H8H A;  1URD A;  4N6P A;  4FAT A;  2CMO A;  4JVD A;  5B70 A;  1NKX A;  2FHY A;  2F34 A;  4QSC A;  2XXK A;  4F3B A;  4LP2 B;  1MH4 A;  1FCK A;  2UYE A;  4F31 B;  2GHB A;  4F22 A;  1YAE A;  4PBH A;  5A5X B;  1LAX A;  5K2X A;  3OXN A;  3W9W A;  1ZJL A;  3W9V A;  3OOA A;  4OQO A;  3FVN A;  1IME A;  4LQ2 A;  2REJ A;  5ISU A;  2OWS A;  1VDW A;  1US4 A;  3FGS A;  2HFB A;  4ZEI A;  5CMM A;  4XIG Q;  3VLW A;  1TT1 A;  4QRZ A;  5TP9 B;  1NUZ A;  1B6H A;  1H76 A;  1QUI A;  1URG A;  2FIX A;  4KI0 E;  4ECF A;  3VVF A;  5ET5 A;  3CVG A;  3THI A;  3I6V A;  2HCA A;  3TAJ A;  4GXA A;  2RIN A;  2Q2C A;  1ZMG A;  1T0K A;  3CFX A;  5KCJ A;  4QFL A;  3T93 B;  1UTB B;  4WEP A;  4DXB A;  4DI4 B;  1LBB A;  2QMX A;  4NED A;  4ZZE A;  3C36 A;  4M1V A;  3CFL A;  2Z8F A;  3B6T A;  3LSL A;  2I48 A;  3H6W A;  1CNQ A;  4JSO A;  4OVR A;  3HFU A;  5I5P A;  4OEV A;  4AQ4 A;  4IO6 A;  1M5C A;  3MP1 A;  1B7U A;  3PD8 A;  5H8F B;  1UTH A;  4LZ5 A;  4ZZA A;  4PTK A;  2VP1 A;  3Q27 A;  2DWI A;  1NH8 A;  3CSB A;  1MXV A;  2YLN A;  2PX1 A;  3K2D A;  3MPK A;  3QYT A;  1SBP A;  4THI A;  4MNC A;  2R9J A;  5I57 A;  3KJT A;  2RCA A;  3IR1 A;  3O2A A;  4PFR A;  1BLF A;  3KFM A;  3K0V A;  3OMB A;  1FPE A;  3TTN A;  1NNF A;  1MG1 A;  4F18 A;  2P3N A;  2Q89 A;  4GFR A;  1BTJ A;  1TXF A;  2A5T B;  2XHD A;  5CI5 A;  2F6P A;  1FBC A;  2L5V A;  4GBV A;  5EQ8 A;  3BKI B;  1FPJ A;  1FRP A;  2OWZ A;  1FPD A;  3O97 A;  4R72 A;  4XFE A;  4U4S A;  1IUD A;  1NUX A;  5DT6 A;  1VR5 A;  2XD3 A;  4NE4 A;  4U4X A;  3PUW E;  2DYX A;  4X9T A;  4F1U A;  1FJ9 A;  1SPI A;  3A29 A;  1LFH A;  4X1D A;  2F97 A;  4MH5 A;  4QFP A;  2VHA A;  1QJM A;  1FQD A;  3M3K A;  2IEE A;  4ELQ A;  1WDN A;  4ND9 A;  1B46 A;  4U23 A;  2CZL A;  3FJM A;  4RK9 A;  4OHN A;  4DIG A;  3IL1 B;  2CEY A;  2ZYK A;  1VFD A;  3C31 A;  4MMP A;  4O7I A;  3IB0 A;  4R6K A;  1GVC A;  3TQL A;  1MY0 A;  4PFW A;  4NF5 A;  3WAE A;  1B7Z A;  5DW8 A;  5DEX B;  1B9J A;  5EYG A;  3C33 A;  4ELR A;  1WVJ A;  3ILU B;  4P3L A;  4NHB A;  4N8G A;  4WKM A;  3R7X A;  4R6H A;  4GWW A;  3MZ1 A;  3LR1 A;  2QS4 A;  3B6Q A;  1MDQ A;  2ZYM A;  1MPC A;  3U93 A;  1RYX A;  4NF8 B;  4HCY A;  5H8N A;  3KOS A;  3LSW A;  3RPW A;  3FV1 A;  1MRP A;  3SEY A;  3KSJ A;  2X7Q A;  5IKB A;  1A55 A;  2HPG A;  1CE2 A;  2PYY A;  3EPE A;  4OWD A;  1YZ0 A;  2WBB A;  3ILT B;  4XF5 A;  3KJ7 A;  2THI A;  4MNI A;  3PPP A;  5I7I A;  4GD5 A;  3RLF E;  2RC7 A;  4G8H A;  4YU0 A;  2I49 A;  3E78 A;  1SW2 A;  3G3K A;  4BDQ A;  1I6Q A;  2Y84 A;  1B52 A;  1N04 A;  2AIX A;  2JJK A;  1IXH A;  2UYF A;  3TMG A;  3ZS6 A;  3V8X B;  3TDJ A;  3FJG A;  1OIB A;  4KHZ E;  3IB1 A;  3WAF A;  3PU5 A;  5EHM A;  3C34 A;  4WXJ A;  4G2Z A;  1SW5 A;  5L9S A;  4N6D A;  1G0H A;  2I6E A;  1IMD A;  4IO2 A;  1UIU A;  1H3D A;  4PAK A;  1MXU A;  4G8M A;  1EH3 A;  1BIY A;  1LAH E;  1M5E A;  4R2F A;  4GWY A;  1MQH A;  5ET8 A;  1OVT A;  3O66 A;  4IO4 A;  4N6K A;  3N26 A;  4RPN A;  5AE4 A;  3MUQ A;  2XXR A;  3ROJ A;  2P3V A;  3IB2 A;  2QL3 A;  4U1O A;  4OFJ A;  1O63 A;  2GFE A;  2OPD A;  4KCD A;  4LZ7 A;  1NUW A;  3MZ9 A;  5AA4 B;  3BIG A;  1QW0 A;  4RA1 A;  3SET A;  2QVR A;  3DP6 A;  5A5X A;  1PEB A;  1Q35 A;  5ET7 A;  1FTJ A;  4PQJ A;  4ZE8 A;  4MAG A;  5M2V A;  5I56 B;  2OLB A;  4QF9 A;  3B7D A;  3T9V A;  2VPN A;  1LAF E;  2VOZ A;  1CB6 A;  4TOZ A;  4YKK A;  1EYI A;  4HTG A;  3ECR A;  3MVY A;  3NOH A;  2XWK A;  2HHM A;  5FHM A;  2LAO A;  4PE3 A;  2UVJ A;  1LLS A;  1FPI A;  1LFI A;  5DVJ A;  2WBD A;  3FD3 A;  4EF1 A;  1QGX A;  3IAZ A;  2I3W A;  2Q2A A;  5IZZ A;  4DCY A;  3D4G A;  1EZO A;  3H6V A;  2XWO A;  4L17 A;  3RTW B;  5IM2 A;  1P1Q A;  4GL8 A;  3T9H B;  2F36 A;  2DQV A;  2HZK A;  3FXU A;  5B7D A;  4OFO A;  3Q26 A;  2XXX A;  2ZZW A;  1A7L A;  3U92 A;  3RN8 A;  5I59 A;  4PF8 A;  1ZBM A;  1SYI A;  4PAI A;  4RJZ A;  4P56 A;  4G77 A;  4BDL A;  5H8F A;  3K00 A;  3OO8 A;  4F3G A;  1FPF A;  4R74 A;  2KLF A;  3GXA A;  1RDZ A;  4YKP A;  4P1L A;  3SEU A;  2V3T A;  3TTK A;  2GRV A;  2ZXT A;  1NV6 A;  1EU8 A;  2VD3 A;  4MNP A;  1Y1Z A;  3U8Q A;  1IXC A;  4ZS9 A;  4DDD A;  2PMS A;  2MKZ A;  1IMA A;  1IXI A;  3TTR A;  2CZI A;  3ZSF A;  3B50 A;  2A5T A;  4C1T A;  2RF1 A;  3PUV E;  3U94 A;  1K9Z A;  1S7Y A;  3RT8 A;  4GX3 A;  3E13 X;  4POX A;  3UIF A;  5DYH A;  1MM6 A;  4ZE9 A;  2Z8E A;  4NF0 A;  4P9K A;  3S4U A;  2Y7I A;  4N81 A;  3TFL A;  1NNP A;  3VVE A;  4POW A;  1SW1 A;  1B7H A;  4E0W A;  3KEI A;  4G68 C;  1R9Q A;  4IY5 A;  2VT5 A;  3TOD A;  2CEX A;  2B4M A;  2DXY A;  3PD9 A;  4OVS A;  1YTV A;  3E9X A;  4I1D A;  1LBV A;  1B51 A;  1SW4 A;  3TKD A;  4H5F A;  5ITO A;  1JET A;  4KR5 A;  2AL5 A;  1LBW A;  1MQJ A;  3KN7 A;  5J16 A;  4JXI A;  2Z8D A;  4PET A;  5JTY B;  2QJE A;  2DDK A;  4O3C A;  5FHN A;  3LUY A;  4ESW A;  3OSQ A;  4X8R A;  3EHS A;  4NG7 A;  4PDD A;  1MH3 A;  2PT2 A;  1RKM A;  2I0B A;  1NV5 A;  2HQ0 A;  4P47 A;  5I2N A;  3H6U A;  4OES A;  1B40 A;  2RC8 A;  1VE4 A;  2D5W A;  1Y4T A;  4IY6 A;  4IO5 A;  5CC2 A;  1OLC A;  1LBZ A;  1HSJ A;  2FYI A;  3A3C A;  4MBP A;  2Q8J A;  3LSF B;  5BUU A;  1IQ7 A;  1XC1 A;  5I3S A;  3TTL A;  1DTG A;  3MVZ A;  2DSF A;  1NV3 A;  4MIJ A;  2DOJ A;  3UK4 A;  1LCT A;  3CI8 A;  2QSX A;  2H98 A;  1FQA A;  3FJ7 A;  5LTC A;  4QBA A;  3FIR A;  3S9E A;  3DM0 A;  4ELO A;  4QSD A;  2W7Y A;  3ZKK A;  4H6D A;  2O7I A;  4H8I A;  5IAI A;  3IO4 A;  3CIJ A;  3SZP A;  5KDT A;  3N6U A;  3ONM A;  2I0C A;  5TPA B;  3CRB A;  3TQW A;  3UP9 A;  1MQD A;  1NL5 A;  4U21 A;  4PAF A;  3TEP A;  1B4Z A;  4BDM A;  1P1O A;  1RYO A;  5DTB A;  1N0T A;  5ELV A;  4N91 A;  1LB9 A;  5CM6 A;  2QS2 A;  1ZLQ A;  3VVD A;  3O6I A;  4ZEK A;  3MVX A;  3U1O A;  3HST A;  4KXP A;  2YPN A;  2ONK E;  2QPQ A;  1FPL A;  3CHG A;  4G4P A;  4BDN A;  3KN3 A;  2HAU A;  2Y5K A;  2O1M A;  3K02 A;  1B3E A;  4GL0 A;  3I3V A;  2DVC A;  1EZ9 A;  4GWU A;  1B5I A;  1DSN A;  1LST A;  1FPB A;  1B58 A;  4R9G A;  2QVV A;  2O69 A;  2F78 A;  2V3U A;  4GVO A;  4OVT A;  5ET6 A;  4ZED A;  2I3V A;  4GWX A;  3U72 A;  3RGY A;  5I56 A;  1YYZ A;  3IFC A;  2P2A A;  2P0S A;  3TPA A;  2VPO A;  1A8F A;  1YCJ A;  4NN3 A;  1DPE A;  3PPO A;  2D21 A;  4FBP A;  1D3K A;  1US5 A;  1L5T A;  5ITP A;  2B3F A;  1Y3P A;  4NTL A;  4NF6 B;  3OEK A;  4I62 A;  4MJO A;  4K3F A;  4LZ8 A;  4ZEC A;  5F7V A;  5HM4 B;  1J1N A;  2V4C A;  4F1Y A;  4PDH A;  1JVX A;  1FJ6 A;  2V25 A;  1DK4 A;  1AOV A;  3CSG A;  3PPR A;  1A54 A;  3G3G A;  3SDF A;  4KYS A;  4G68 B;  4AS5 A;  3FXR A;  3G3I A;  1JW4 A;  4OVP A;  3C35 A;  3KOT A;  5K2Y A;  3PMV A;  4OYV A;  4RNS A;  2ESN A;  4IGT A;  4JB7 A;  5ESY A;  3DP8 A;  3UOR A;  2FVZ A;  4F3S A;  1SDX A;  5JK4 A;  2ALU A;  2F7A A;  2WKY A;  1Y20 A;  3IO6 A;  1KZ8 A;  1M5F A;  2PVU A;  4I8C A;  4QFN A;  4N15 A;  3SEV A;  5LOM A;  2OPE A;  3T96 B;  3GZG A;  3D1R A;  3MPL A;  5F1Q A;  3G3J A;  2H4I A;  4AB6 A;  1B5J A;  3EHU A;  1R6Z A;  4EDP A;  2OJT A;  4H5G A;  1Y4C A;  1P99 A;  4JWX A;  4BDO A;  3FZV A;  3HHF A;  3HHG A;  3AXF A;  2E0S A;  3GBA A;  3G3F A;  2XX9 A;  4GBW A;  1JEU A;  4XKQ A;  4HE1 A;  1JW5 A;  3O29 A;  3QSL A;  2XWV A;  5H8H B;  3IFA A;  4QSE A;  4G8N A;  1MQG A;  4NX1 A;  4PC9 A;  3B8B A;  1MPB A;  2B4L A;  3PTY A;  2HAV A;  4P11 A;  3SEX A;  2ZYN A;  2XX7 A;  3H06 B;  4XTC Q;  5AA2 A;  4GF8 A;  2PFY A;  1FQB A;  4H45 A;  1K9Y A;  1XHY A;  1POY 1;  1B0H A;  1N3W A;  1Y1M A;  4FOR A;  3H7M A;  1D9Q A;  5IGA A;  1B5H A;  2Z23 A;  1MM7 A;  5IZ3 B;  1A99 A;  5I84 A;  2H9B A;  4PFB A;  4MF3 A;  2CZH A;  1XS5 A;  4RXL A;  2G93 A;  3LV0 A;  3IOU A;  1II5 A;  3C9H A;  2CZK A;  1XOC A;  3LBS A;  3MQ9 A;  5I58 A;  3SKP A;  2KR0 A;  1FTO A;  1JW1 A;  4X48 A;  4FE8 A;  1GTK A;  1KA0 A;  4LON B;  3KBR A;  3VXB A;  1FQF A;  3R6U A;  3MZB A;  3MJN A;  5KCJ B;  2O68 A;  2R6G E;  4O3A A;  5L8D A;  1MXY A;  2H25 A;  1B05 A;  2NUV A;  3K6U A;  1EYJ A;  1Y3N A;  4NQ8 A;  3FVK A;  2QVU A;  2PBW A;  2ONS A;  4F19 A;  4WED A;  4N07 A;  2HXW A;  3MWB A;  4F3P A;  4R75 A;  3TYH A;  1B2H A;  3MYU A;  2ZMB A;  2F6G A;  4OAN A;  3UA8 A;  4P8B A;  5DVF A;  4IGR A;  4OVJ A;  4ISU A;  2R8T A;  3PMX A;  3TUS A;  2DVZ A;  5I57 B;  1RDY A;  5F24 A;  4U1Z A;  3IOR A;  3B6W A;  2HXR A;  2O6A A;  1NUY A;  2FIE A;  3TEL A;  1URS A;  2REG A;  1ANF A;  1SVX B;  5HPQ A;  5TP9 A;  4ELP A;  1JNF A;  3A09 A;  3LSX A;  4XKN A;  4UA8 A;  3TCG A;  1O64 A;  4PF6 A;  2Q74 A;  1VFE A;  1OVB A;  1SD3 A;  4DXU A;  1N76 A;  1N3X A;  4JBZ A;  1IMC A;  5CMK A;  2OK2 A;  2ONR A;  3N6T A;  1UTB A;  2F8D A;  3OEN A;  2F35 A;  2F3B A;  5KZT A;  1LAG E;  4C0R A;  1DBZ A;  2XXI A;  4I3Y A;  3KG2 A;  5H8Q B;  1HSE A;  5FBP A;  2XXW A;  5EYH A;  2DWH A;  4NWD A;  3L6H A;  4GXS B;  2E1S A;  4FAJ A;  1FW0 A;  4Z0I A;  4QXD A;  1SYH A;  4HXV A;  4FJP A;  4NF5 B;  1TFA A;  3TCF A;  3M3L A;  4G61 A;  1NV7 A;  4QHQ A;  1OMP A;  2Q8M A;  1ZKB A;  3FUZ A;  1IIT A;  2AYS A;  1DTZ A;  1FBF A;  5AA1 A;  4YKJ A;  4UAB A;  2WX9 A;  1P1W A;  3E4R A;  3FV2 A;  3MBP A;  4KD5 A;  2XXV A;  4IB2 A;  4PP0 A;  4IO3 A;  1OQH A;  3C32 A;  1ZTY A;  1D4N A;  3T1B A;  4R9F A;  3CG1 A;  4JDF A;  4JVC A;  1QUJ A;  4RY1 A;  5LDZ A;  1Q1K A;  3V5A A;  2I4C A;  3MVW A;  2Y7R A;  4P0I A;  2WEF A;  5H8N B;  1AMF A;  1B4H A;  1KA1 A;  2NOO A;  3N5L A;  1AH5 A;  3OD7 A;  3PV0 E;  1WOD A;  1GV8 A;  3BBR A;  1FPG A;  4O94 A;  1ZIU A;  4H8J A;  2G29 A;  4RK2 A;  2Y5L A;  4XXU A;  3PPN A;  3FXB A;  4HE2 A;  1YPN A;  4R6Y A;  1FBP A;  3MC2 A;  3R26 A;  2Y7P A;  5J1D A;  3CFZ A;  3K1M A;  5CRY A;  1MDP 1;  3CG3 A;  1LB8 A;  2O84 X;  2H5Y A;  2HZL A;  3EKI A;  2UVG A;  3VFJ A;  3V89 B;  2GQ1 A;  2NWJ A;  1XT8 A;  5DEX A;  1NV0 A;  3EF7 A;  3IOV A;  2QS3 A;  3RPL B;  4GRK A;  1BKA A;  3ZKL A;  3KBZ A;  4NAP A;  2QFL A;  3S9L C;  4EQB A;  4IR8 A;  2I58 A;  1DOT A;  4IO7 A;  1A8E A;  1EYK A;  2VD2 A;  4OA4 A;  4X04 A;  4U22 A;  1OQG A;  3CR9 A;  2XXP A;  3RQT A;  4NF4 B;  2BJJ X;  4NF8 A;  1IMB A;  4Z7E A;  3VXC A;  4TLL B;  4C1U A;  4N17 A;  1IMF A;  3GYY A;  5T3J A;  3C4M A;  4KPT A;  1P1N A;  3E79 A;  1FTK A;  1QUL A;  2X26 A;  3TCH A;  5CMC A;  3BFT A;  1D9V A;  3V83 A;  2XXT A;  4YMB A;  1FBD A;  2R71 A;  5L9M A;  4HW8 A;  1Q9D A;  2UXA A;  4EF2 A;  1SI0 A;  3TZA A;  2XXQ A;  2ZNS A;  3OSR A;  3M8U A;  4QFK A;  4AB5 A;  3FAT A;  4O8M A;  4HCW A;  1GGG A;  2RC9 A;  5IZ3 A;  3Q29 A;  3JV9 A;  1NV2 A;  2QRY A;  3KSX A;  3P7I A;  4LQ5 A;  4AS4 A;  2FA7 A;  4MHF A;  4OVQ A;  3O9P A;  3H4Z A;  1TFD A;  4GOT A;  1EZP A;  4LN5 A;  2OBG A;  2DP8 A;  2YJP A;  2OWT A;  1QKB A;  4F2O A;  2D3I A;  4KQP A;  4N8Y A;  4N4U A;  2M8C A;  2ZYO A;  1JP4 A;  4FED A;  3T9U A;  1I6A A;  3S9N C;  2F3D A;  2DWA A;  3RY3 A;  4P0G A;  1O7T A;  2DE4 A;  1MXX A;  3N94 A;  5ICQ A;  2O1L A;  3Q25 A;  1PB9 A;  4XEQ A;  1Z7N E;  1USY H;  4OZ9 A;  3L6G A;  5AA4 A;  3DP4 A;  4YZZ A;  2UVH A;  1LFG A;  1FSA A;  5I59 B;  3S9M C;  3VLU A;  5CBS A;  1PDA A;  2QMW A;  3K4U A;  5AA3 A;  1M5B A;  2WYK A;  4X1B A;  1USY E;  1N84 A;  1M5D A;  3KZG A;  2B3B A;  4Q5T A;  4DCX A;  4QFO A;  1QKA A;  4H65 A;  1FPK A;  3Q28 A;  3JZJ A;  4DLD A;  3G7W A;  3I5O A;  3MP6 A;  4GIZ A;  4GWZ A;  3IOT A;  2DXR A;  2KQZ A;  3EN3 A;  2BJI A;  4YAH X;  2X7P A;  3E3K A;  5EYF A;  4LAT A;  3O28 A;  1MS7 A;  2P1S A;  3SES A;  3QUF A;  1FTM A;  2UVI A;  3OO6 A;  4PE5 B;  4JWO A;  1MXW A;  4EXL A;  4ZDM A;  3MP8 A;  3RT6 B;  4BLA A;  4XKR A;  2V3Q A;  4PFY A;  4PGP A;  5FTH A;  4MCO A;  1A40 A;  1JEV A;  1LGB C;  2XD2 A;  1BK4 A;  4NMY A;  5I2K B;  3H3G A;  5CBR A;  3EHT A;  1MY4 A;  3USD A;  1I6B A;  5H8Q A;  2PT1 A;  1MXZ A;  1NNT A;  3HN0 A;  4PGN A;  5FHO A;  4H0W A;  3S2V A;  3PUZ E;  1H44 A;  1F9B A;  3FBP A;  5H8S A;  4U2R A;  4EQ7 A;  2DE2 A;  1NMU A;  3PUY E;  3K6X A;  4O3B A;  3RUM A;  3D4C A;  1ATG A;  3QMF A;  4Q8R A;  4ONY A;  2FNC A;  5IZ1 A;  1SI1 A;  2ANJ A;  4FEC A;  3KGC A;  4NGU A;  1FBG A;  3H6T A;  2ABH A;  1MY3 A;  4UAC A;  1NI9 A;  1B1H A;  2ZZX A;  4OEN A;  1Y9U A;  4GQO A;  4NWC A;  3FAS A;  5I2N B;  2WYP A;  3M3F A;  1H45 A;  4P1E A;  4Q0C A;  2XWI A;  5TU0 A;  1TWY A;  4EUO A;  4LUB A;  2OZZ A;  2HEU A;  1B0L A;  1PC3 A;  4I40 A;  1QVS A;  4DE8 A;  5JEI A;  2ZNU A;  5L9O A;  2I4B A;  4KYD A;  4YB7 A;  1PB7 A;  1IIW A;  3FXQ A;  5BWJ A;  1MQI A;  2Z22 A;  3F11 A;  3SEW A;  1JVY A;  2A5S A;  1KWH A;  4M4G A;  1MY2 A;  4ZEF A;  1DMB A;  3T0J A;  5EHS A;  1QUK A;  3JYR A;  1AL3 A;  4OER A;  3PPQ A;  3HCQ A;  3QXM A;  1AIV A;  1NH7 A;  3RPL A;  4OTE A;  2V93 A;  1FQC A;  5JTY A;  1POT A;  1N7X A;  3IJO B;  1IZ1 A;  4YB5 A;  4KYE A;  2FBP A;  5KDT B;  4YKI A;  3VE1 B;  4FIM A;  4E0X A;  4DXC A;  4JSD A;  4OFL A;  1LBC A;  2XXH A;  4MLQ A; 
#chains in the Genus database with same CATH homology
 1LBY A;  4UAB A;  2WX9 A;  1YXI A;  3KC0 A;  5LTC A;  3T1B A;  4JVC A;  4QBA A;  4HE0 A;  5LDZ A;  4YIC A;  2CEY A;  1FTA A;  2WEF A;  4MMP A;  4O7I A;  1KA1 A;  1XI6 A;  1LBX A;  1LEV A;  3SZP A;  5DW8 A;  5EYG A;  1FBE A;  2PCR A;  4P3L A;  4MEV A;  1DCU A;  1FPG A;  4NHB A;  4PAF A;  4O94 A;  4N8G A;  4GWS A;  4GWW A;  2F5X A;  4N91 A;  2Y5L A;  5CM6 A;  3FXB A;  4HE2 A;  1FBP A;  4KXP A;  5J1D A;  2QPQ A;  1FPL A;  4HCY A;  3CHG A;  2HZL A;  2Y5K A;  3EKI A;  3RYD A;  2GQ1 A;  3LUZ A;  1NV0 A;  3RPL B;  3KBZ A;  4GWU A;  4NAP A;  2QFL A;  4PFI A;  2HPG A;  4IR8 A;  1FPB A;  2XA5 A;  1YZ0 A;  1EYK A;  2QVV A;  2WBB A;  4OA4 A;  4XF5 A;  4MNI A;  4X04 A;  5I7I A;  4OVT A;  5ET6 A;  3E78 A;  4GWX A;  1YYZ A;  1IMB A;  3IFC A;  2JJK A;  4GX6 A;  2VPO A;  4N17 A;  1IMF A;  4NN3 A;  3GYY A;  5T3J A;  3E79 A;  4FBP A;  4PCD A;  5EQ7 A;  4PBQ A;  2ZZV A;  4MJO A;  4N6D A;  1FBD A;  1G0H A;  5EQ9 A;  1Q9D A;  2V4C A;  1IMD A;  4PDH A;  1FJ6 A;  2PFZ A;  4PAK A;  1DK4 A;  1NV1 A;  4O8M A;  1FBH A;  4GWY A;  4AS5 A;  5ET8 A;  5A5L A;  4HCW A;  4N6K A;  4OVP A;  4O7M A;  2Q9T A;  3ROJ A;  2P3V A;  1INP A;  5IZ3 A;  1RDX A;  5EQA A;  3ISP A;  1NV2 A;  1NUW A;  4AS4 A;  3BIG A;  5ESY A;  3MST A;  4MHF A;  4I3E A;  4OVQ A;  2FVZ A;  2QVR A;  5JK4 A;  4LN5 A;  2OX3 A;  1KZ8 A;  4N15 A;  4DI3 D;  2DE3 A;  3D1R A;  5ET7 A;  3U65 A;  4N8Y A;  4N4U A;  4F1V A;  1JP4 A;  4MAG A;  1NV4 A;  2F3D A;  2VPN A;  4JVI A;  2DE4 A;  1EYI A;  3KC1 A;  3NOH A;  2XWK A;  4GBW A;  2HHM A;  4XEQ A;  4PE3 A;  4HE1 A;  1G0I A;  1FPI A;  2WBD A;  2XWV A;  4H46 A;  3IFA A;  4YZZ A;  1FSA A;  1QGX A;  1AWB A;  4NX1 A;  2WYK A;  4PC9 A;  3B8B A;  5IZZ A;  2B4L A;  3PTY A;  4GX4 A;  2XWO A;  1FPK A;  5IM2 A;  3BIH A;  2PFY A;  4GWZ A;  4MX6 A;  4H45 A;  1K9Y A;  2KQZ A;  2BJI A;  2HZK A;  1D9Q A;  5IGA A;  2ZZW A;  5IZ3 B;  4PFB A;  4PF8 A;  2CZH A;  4JVD A;  4PAI A;  4P56 A;  2FHY A;  2XXK A;  1FPF A;  3LV0 A;  2V3Q A;  1RDZ A;  2CZK A;  4P1L A;  4PBH A;  4PGP A;  2KR0 A;  4MCO A;  1NV6 A;  3W9W A;  1KA0 A;  3W9V A;  4MNP A;  1BK4 A;  1IME A;  2MKZ A;  1IMA A;  2CZI A;  3B50 A;  4PGN A;  1VDW A;  1K9Z A;  3FBP A;  2DE2 A;  4GX3 A;  1EYJ A;  4NQ8 A;  1NUZ A;  2QVU A;  4F19 A;  4NF0 A;  4P9K A;  2FIX A;  4N81 A;  5ET5 A;  3QMF A;  5IZ1 A;  3MYU A;  4OAN A;  4NGU A;  1FBG A;  4P8B A;  2R8T A;  2DVZ A;  1RDY A;  1NI9 A;  5F24 A;  2ZZX A;  4DI4 B;  2VT5 A;  2HXR A;  2CEX A;  1NUY A;  2FIE A;  2B4M A;  4M1V A;  4OVS A;  1LBV A;  1CNQ A;  2WYP A;  4OVR A;  3HFU A;  5I5P A;  4P1E A;  2XWI A;  1LBW A;  4PF6 A;  2Q74 A;  5J16 A;  4PTK A;  4I40 A;  4PET A;  1IMC A;  2DDK A;  4MNC A;  4X8R A;  2F3B A;  4PFR A;  4NG7 A;  4PDD A;  1DBZ A;  1FPE A;  4I3Y A;  4F18 A;  2P3N A;  1NV5 A;  4P47 A;  1FBC A;  5FBP A;  2L5V A;  3T0J A;  4GBV A;  5EQ8 A;  1FPJ A;  5EYH A;  1FRP A;  2OWZ A;  1FPD A;  1LBZ A;  3RPL A;  4XFE A;  1NUX A;  4QXD A;  4HXV A;  2FBP A;  4G61 A;  1NV7 A;  4X9T A;  4F1U A;  2Q8M A;  1FJ9 A;  5I3S A;  1SPI A;  3A29 A;  1NV3 A;  1FBF A;  4MIJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...