3QMMA

Structure of 6b, a thermostable mutant of bacillus subtilis lipase obtained through directed evolution
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
179
structure length
179
Chain Sequence
HNPVVMVHGIGGSSSNFEGIKSYLVSQGWSRDKLYAVDFWDKTGTNYNNGPVLSRFVQKVLDETGAKKVDIVAHSMGGANTLYYIKYLDGGNKVANVVTLGGANRLTTDKAPPGTDPNQKILYTSIYSSDDEIVPNYLSRLDGARNVQIHGVGHMGLLYSPQVYSLIKEGLNGGGQNTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title In vitro evolved non-aggregating and thermostable lipase: structural and thermodynamic investigation
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
molecule keywords Lipase estA
total genus 68
structure length 179
sequence length 179
chains with identical sequence B
ec nomenclature ec 3.1.1.3: Triacylglycerol lipase.
pdb deposition date 2011-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01674 Lipase_2 Lipase (class 2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3qmmA00
2VF2A 1BRTA 4N8EA 4KYVA 2I3ZA 3WJ1A 1CR6A 4QZVA 1IMJA 1ORWA 2CB9A 5AKYA 4Y2RA 1VA5A 2WLSA 4YX9A 4B85A 4KE9A 5CH5A 3BE8A 1ZI6A 4Y7DA 4Y9SA 1E66A 1XZLA 4ETWA 4UBJA 3DS8A 1FFAA 1GQRA 4H7KA 4OU4A 2Y2VA 3WWOA 4UHEA 3DKKA 3DEAA 5AIAA 4AMZA 4A16A 2PL5A 5AKXA 4PW0A 1ODTC 3FSGD 5LLSA 1E5TA 1LZLA 4Q1VA 3ICWA 3W06A 4X71A 2QR5A 4ZV7A 1DT5A 3FOBA 1CUZA 5JZSA 2PUHA 3DOIA 5AO9A 5AI5A 4RGYA 2HU5A 4J3JA 3V1NA 3R3ZA 2QXUA 5EIHA 4AX4A 5AKZA 4FNMA 1ZD5A 2GBFA 2ZYIA 1UZAA 3WK7A 5ALWA 2DQZA 4AQDA 2EEPA 2WFLA 1QO9A 2PKYX 3STVA 1LZKA 3MUNA 3R41A 1JFRA 3L1JA 5ALLA 5JANA 1EB9A 4BE9A 5JAHA 5ALVA 1VXOA 3QMMA 5ALMA 2PSJA 3WYNA 5LKRA 1U2EA 3ESAA 4MQMA 1LBSA 1VA4A 2OPHA 1XZGA 2BGRA 3VVMA 4AZ0A 4MEAA 2W22A 5FRDA 4XX1A 2GBCA 4Y2PA 3FCYA 5FV4A 2IIVA 4OU5A 1VE7A 4H18A 1AX9A 4YPVA 1ETHA 2ZJ6A 1ZOIA 4D9JA 1GPLA 3WL8A 4F21A 2WU4A 3D2BA 4IQ4A 4G9EA 4PV7A 1H2WA 5DYYA 1SCQA 4AN1A 1AMNA 3R40A 3E0XA 2HU8A 1QONA 4X97A 4YASA 5K3FA 1CVLA 3IBTA 2HA5A 3FCXA 5JALA 4Q05A 1VLQA 2P8SA 3RK4A 1CRLA 2XMZA 2C5FA 4MEBA 4IHAA 4CG1A 3EBLA 4HXFB 3V1LA 2C7BA 1QE3A 2DSNA 2O2HA 1MX1A 1JU4A 4ZWNA 2HDWA 3O4GA 5HFAA 3QMVA 5E4YA 2XUKA 4GEGA 1CLEA 4MWTA 2G4LA 2BKLA 5E2IA 1M33A 1JMYA 4CCYA 1HKHA 4H7EA 3V1MA 2GBGA 1XLUA 1FJ2A 2VEOA 2QJWA 2V96A 2Z5GA 4CG2A 1CUXA 4UUQA 4CI9A 1QFMA 4BTVA 3PF8A 3W2TA 4IO0A 1CUUA 3W05A 5BV7A 4OCZA 5E4TA 4DSZA 1TKRA 3OPMA 4BVKA 1ZGCA 5ALTA 1YCDA 3PE6A 5AOAA 2HRRA 5AKIA 5F4ZA 1EVQA 1UKCA 1AGYA 2G63A 1IUOA 3F9CA 1ZJ4A 1BEEA 4PNZA 5CXUA 4G4IA 1G66A 3AZPA 4J7AA 5DTIA 2ZJ7A 4E11A 3ILSA 3IIIA 3ZV7A 2JGJA 4A5SA 3G02A 1QJ4A 4Y2VA 4FBLA 4EB0A 1GKKA 1W75A 4WJLA 1UOOA 5ALNA 4ZRDA 3HYSA 4J0KA 2V9ZA 5ISMA 3IUJA 2DCMA 5ALQA 4L72A 2BJHA 4AXBA 3O0DA 4XJVA 4BTLA 3AILA 3WA7A 1QIDA 3D7RA 1IZ7A 4UBIA 2XUPA 3QZUA 3ESBA 2WFMA 4Y2UA 3UUEA 1ZD3A 2O2GA 5AM1A 2WSLA 3HSSA 2HA2A 1ZI8A 3LS2A 4QWMA 1MX9A 1EDBA 5A62A 1YR2A 5I7UA 5CBKA 4LXHA 3DLTA 1SC9A 2XUIA 4BAUA 3WKBA 2IX9A 2GYWA 4PO3X 2K2QB 1UKBA 4WY5A 4BDSA 2CMFA 3V1KA 1UKAA 2YYSA 2O7VA 4IH1A 5LIPA 4LYEA 1ISPA 5LKAA 3O9VA 4OPMA 3K2IA 1B6GA 2OG1A 1UT6A 1VXRA 2PSHA 2XQJA 3BJMA 2VJDA 2WJ3A 3K6KA 1ZD2P 5D6OA 1MX5A 2GYVA 4N8SA 2VAVA 1LPAB 5DNWA 3DD5A 2FJPA 1XZDA 4NZZA 1TCCA 3G0CA 2FUKA 1ACJA 2HHAA 1O6GA 3ESDA 4H7IA 1AUOA 5CXXA 4UBLA 4QDTA 4WFJA 3STUA 5JASA 1YASA 4X93A 3PICA 2RONA 5D3ZA 5T4EA 3JW8A 2QRUA 1YS1X 1UK7A 1KEZA 2XMGA 2JEZA 1MNQA 3DNMA 2EDCA 4JYPA 2D0DA 4EUSA 3NGMA 4Y2YA 2XUAA 2WG2A 1G5FA 1EXWA 3SC2A 3MVEA 4JYMA 2OGTA 4QE3A 5DYTA 1EH5A 2JGMA 4OB6A 3AFIA 4KE8A 1IVYA 1WCYA 1A88A 2PSDA 4KJXA 3VISA 4WDQA 3FVTA 2H7CA 1X2BA 2DFPA 1QOZA 4OYYA 4BRZA 3PFCA 1VKHA 5HF9A 3AINA 4J03A 4U2DA 5LZ2A 5D7BA 4B81A 4Y2SA 3HZOA 2CZQA 5AHXA 3D5EA 3RARA 4X91A 5DYWA 3G8YA 4PQEA 5AP9A 4ZV9A 1Q0RA 2WILA 2HM7A 3HC7A 1YA4A 1ZIXA 3B12A 1MO2A 2RGUA 3HACA 5FLKA 1CFJA 5C81A 3C6YA 3WLAA 1UOQA 3WWDA 4FNGA 1XQYA 2PX6A 2ZYRA 2HA6A 5K5EA 2I3DA 2YH2A 2QVBA 3OG9A 3HLKA 5BWBA 1CUVA 1L7QA 1THTA 4F0JA 3E3AA 3QMWA 2YASA 2HA3A 4QDXA 4C6HA 2D5LA 3ICVA 4BP8A 5JAPA 3QH4A 2UZ0A 4W9RA 5HZGA 2H7YA 5DLPA 3SK0A 2XQKA 5HCUA 2VJAA 3N0TA 3WL6A 2XMRA 4H7FA 5AOBA 2OXEA 1Q84A 4W1QA 3V48A 1W52X 3BXPA 4NMWA 1QIHA 2ZSHA 2PBLA 1NX9A 4G4JA 1WOMA 4I19A 4E14A 3AUKA 3I2KA 5T4BA 1ZIYA 1FFDA 2OCGA 3WKEA 5CURA 1YS2X 5C7YA 1SCIA 3QBJA 4S0XA 1XQXA 3R3UA 1GQSA 5DNVA 1ZJ5A 2FX5A 5ALFA 3I1YA 4Q3KA 2WM2A 3JYHA 1QIGA 2I03A 4W1PA 3AIOA 3G0BA 3X3HA 3DL7A 3IB3A 4RNCA 5HKBA 5J3JA 4CIAA 3D2CA 4FHZA 3KXPA 1OCEA 4INZA 1R4ZA 2XUHA 3FYTA 2XDWA 5AOCA 2AJCA 1IUNA 4K6HA 4E15A 1CUFA 2JF0A 2QM0A 3VXKA 3QPAA 4G4GA 3G9TA 2JGKA 3HI4A 4ARBA 1QIJA 1QO7A 1N8SA 1LPOA 2GZSA 4OB7A 4DMCA 4W63A 1XLVA 2NW6A 4U2FA 4DYHA 1XLWA 1AURA 3F8SA 3KOOA 1R50A 4JUIA 4P08A 2GZRA 3EF3A 5AI9A 1EDEA 3PDCA 2DHEA 4QDZA 5ALEA 4CFSA 4UFPA 1JKMA 2QKYA 3PUHA 1USWA 1L7RA 4X95A 4J0CA 3C6ZA 5DTJA 4RPCA 3GA7A 4FFWA 4KAJA 1EHYA 1XZCA 5DWDA 4BE4A 1K4YA 5K3EA 3PFBA 3R0VA 3C87A 4C4XA 1XZHA 3WIBA 2XUOA 3IUNA 2Z3WA 1JJIA 2WIKA 5JAUA 1CUIA 4UHDA 2ZJFA 5AI4A 4BC1A 1T4MA 4U2CA 1R9MA 5CMLA 3TEJA 5HFNA 2HIHA 2C5GA 3DCNA 3RKSA 2WUFA 2C58A 1WPRA 3L1HA 5IVKA 1LPBB 4Z49A 3LIPA 1BROA 4OB8A 1UXOA 2QOEA 2VAXA 2ZSIA 1R9NA 3A6ZA 3IUQA 4MWSA 5KWJA 1BN7A 4GWLA 4WFKA 4BAZA 2R8BA 5ALSA 3SWWA 3LCRA 3QVMA 4QDUA 2WG0A 4UHFA 1EK1A 2B61A 3VVLA 2QT9A 2BUAA 3PUIA 5AI8A 3PF9A 3O4HA 3GUUA 3FLAA 3B3QA 2XQFA 4V2IA 4G8CA 3WIOA 5HF8A 4WY8A 4FLMA 4OUKX 2HFJA 2DQYA 1XKTA 5IVHA 3D59A 3V9AA 3GZJA 1XZAA 1MAHA 2XQGA 3FYUA 4JNCA 2WIFA 4QEKA 1BE0A 4X6XA 1BCSA 3OOSA 5T4HA 4EY7A 4X3CA 1WHTA 5EGNA 2BAGA 4G8DA 3I6ZA 1XRMA 1Q0ZA 1UOPA 2XUFA 5ALOA 2XUDA 4LXGA 3STXA 1HBJA 5AH0A 1TAHA 1CIJA 1BCRA 5FP0A 1JJFA 2ONCA 4YK7A 4AMYA 4G8BA 4GHWA 1WB6A 1QTRA 3AIKA 3G0DA 7YASA 3TGLA 4W1SA 5LZ5A 2G5PA 3WWPA 2CJPA 4LHEA 4N5HX 5HF5A 5KREA 2RAUA 3ZLTA 4UFOA 1LPMA 3CCCA 2AJ8A 3WQHA 3NOXA 2O2IA 3I6YA 3TJMA 2WJ4A 1YSCA 1LBTA 3DYIA 3DDUA 5A71A 1DWQA 3AJAA 1XZBA 1P0IA 5EI5A 4DNPA 4GXNA 4DNFA 4B0OA 3H19A 3WWEA 4BZZA 1J1IA 2I78A 1CUGA 5JARA 5FUMA 4EY8A 2BUCA 5YASA 1DX6A 1Z68A 5CH8A 1CUCA 3PI6A 1DWOA 1CPYA 1XRLA 1YA8A 1E8DA 4MQLA 3WYDA 4UHHA 2EDAA 5ALKA 3VJLA 2HFKA 3H04A 2JGFA 4ZREA 1Y7HA 4X7BA 4KE7A 4ARAA 2O7RA 4FWBA 2HADA 1GXSA 4BCBA 2VT7A 5AKEA 5LZ8A 3ANTA 2PUJA 1HPLA 4B83A 3I6MA 4AB1A 5K3DA 5ALHA 3H17A 3Q8WA 1ORVA 5JZBA 4B80A 5AIBA 3C8DA 5AM5A 2PU5A 3BDIA 1QFSA 1FFEA 1VOTA 1R88A 3AZQA 2GBIA 3G7NA 2CKMA 3D3NA 2AXEA 4OD0A 3CN7A 1SFRA 1PV1A 4AO7A 2X8BA 4U2GA 5HQ3A 3BL8A 4UHCA 5HK8A 4J0IA 4GW3A 1WHSA 3IULA 3SX4A 2VT6A 5A2GA 2WUEA 3MGAA 1GT6A 1BS9A 1CUEA 3FYUB 3HXKA 4BC0A 3CN9A 2WU3A 5I9IA 3U1TA 2VTVA 1CV2A 5JATA 3WKAA 4Y2JA 3CCBA 5SYNA 1X70A 1F6WA 1DQYA 1UWCA 4FOLA 3C70A 2JBWA 1ODSA 3W9BA 2PPLA 1SCKA 3C45A 4J0HA 1S8OA 3FLBA 4A23A 5JD4A 2HA4A 1PJAA 2J4FA 5EIAA 4HTAA 4X94A 1E3QA 5CT6A 2B20A 5ALZA 1IUPA 1C7JA 4MYDA 1ZGBA 1XZJA 2W6CX 2OCKA 1LLFA 1FFCA 3IDAA 1JJBA 3C6BA 1E8MA 4HS9A 1MN6A 3IA2A 4UBMA 2VQ6A 2WHQA 4BP9A 5HKAA 2WHPB 2QXTA 4Y2TA 4L3WA 3I1IA 1XRQA 1J06A 2WHPA 3M3DA 2IITA 5JZ9A 5C8VA 3FWHA 3F67A 2RI6A 1AC5A 2XMDA 3WMRA 4C89A 5FPQA 3QPDA 1CUYA 3BF7A 2R11A 4CCYB 3WJ2A 3VKFA 2Y2UA 5ALXA 3I2GA 3GELA 4B0PA 3H0CA 4EHBA 5IVIA 5AM2A 1R3DA 1H2XA 3R3WA 5H3HA 1QIKA 4OYLA 2J4CA 3ZWQA 5HQ3B 3CXUA 1XFDA 4B6GA 3HABA 3G9XA 2QUAA 1MPXA 4H35A 5LZ9A 5A6VA 1GGVA 1MT3A 3VJMA 4UBNA 2C0QA 4M0EA 1EI9A 4Q3OA 4LIPD 5EHNA 1N5MA 3HEAA 5EHXA 4P9NA 2XE4A 5CH3A 3F96A 3TRDA 4FFVA 1EINA 3FBWA 2BGNA 4LXIA 2V97A 4U2BA 1WM1A 2J3DA 4UPDA 3E4DA 1G42A 2XLBA 2Q0XA 3DYVA 3IUMA 4MYSA 1HQDA 1F0NA 3C5WP 2H7XA 3WZLA 3S8YA 1DINA 4FKBA 4CIBA 1ZI9A 5FPPA 2BUBA 1I6WA 2AJLI 1QIMA 3WWCA 3YASA 1XRPA 3K9BA 2H1IA 4GLBA 4W1RA 2JGIA 2AJDA 3I2HA 1JI3A 4UBKA 1LPNA 3DL4A 4HVTA 5AKLA 1U8EA 4QNNA 1MAAA 3UUFA 5C8XA 2Y6VA 1VJ5A 2QS9A 2HRQA 4C4ZA 4GBGA 2WTMA 1X2EA 4XIIA 1BN6A 1DTEA 4KEAA 3R3VA 5AM3A 3F97A 4BATA 5AM0A 3B5EA 1R1DA 1WPXA 4BVJA 1MU0A 4DMKA 1P0PA 3WK4A 3P2MA 1KU6A 5CTAA 2ACKA 2RHWA 1THGA 4NS4A 2VA9A 5K3BA 1EVEA 2WUDA 1Y7IA 4ZI5A 1FSSA 1TQHA 4HAIA 5E4JA 1YAHA 2G5TA 5AM4A 1CUHA 2PU7A 2ZYSA 3I2JA 4XVCA 3IURA 4GECA 3OM8A 4JEIA 4C88A 2WTNA 1GZ7A 1W76A 1DWPA 3H2JA 3A2NA 4EY4A 3STTA 3LP5A 3WK8A 3WL7A 1EDDA 2ACEA 1QIEA 2VATA 5LZ4A 2Z3ZA 1Q83A 4FBMA 2WQZA 5AKJA 1P0QA 4X00A 2HL6A 4DIUA 4U2EA 3H18A 4LKOA 2WUGA 3IVMA 5AI0A 2QZPA 1XZMA 1FFBA 4B82A 4LYDA 4DNQA 2C0PA 5A7FA 3EQ7A 1A8QA 1GPNA 3BF8A 4KAFA 3F98A 1AKNA 1U65A 3S2ZA 4ZXFA 2WIDA 4J0GA 2JGEA 2OQIA 2CBGA 1K6EA 4E46A 3O9MA 4PSUA 4UBOA 1U4NA 2C4HA 1NU8A 5EHQA 3R3YA 2X76A 4BVLA 3QM1A 3QITA 3A2MA 2WFLB 1XQWA 2H9YA 4Q82A 4RE6A 3O4JA 4H7DA 4KRYA 2X5XA 2ZYHA 3MUOA 5AI6A 2XMBA 4C01A 1A8UA 3I2IA 4MJ3A 3LLCA 3DQZA 1TCAA 2FJ0A 4EZIA 3D0KA 5JAOA 3Q0TA 3C5VA 4PF1A 5ALUA 2XLCA 1LPPA 3G9UA 3FYUC 1JT2A 1A8SA 4FLFA 2Y1KA 2PSEA 4GDMA 4DMFA 3D4LA 3R3XA 5DNUA 3EIOA 5JD5A 1CUJA 5JADA 3NUZA 4B7ZA 2WG1A 1WB4A 5K3AA 3HJUA 5AK5A 1CUAA 5CT5A 3M83A 4KRXA 4CCWA 4I4CA 1TIBA 1TCBA 3D2AA 4BBZA 4C87A 1AZWA 3QYJA 4ROTA 4BB0A 3GBSA 4UFNA 1J2EA 3ZPXA 3STYA 4O08A 5EFZA 1HL7A 1RWQA 3OURA 1N1MA 1D07A 2V98A 3DOHA 5FOQA 3DJYA 3T4UA 4WFIA 2B4KA 3I28A 2QMQA 3KD2A 5K3FB 3C6XA 5JD6A 2B9VA 5CW2A 4DTCA 2BFNA 5ALYA 3QPCA 4PSCA 4H77A 4L0CA 2WIGA 1N5RA 4C4YA 1EX9A 4K2AA 4KACA 2WJ6A 4G9GA 1HDEA 2PM8A 3BJRA 2VJBA 4BCDA 4KAAA 3GFFA 2OCIA 4DNOA 1A7UA 3FLEA 1CUWA 3BWXA 2WHRA 3KWJA 2RIPA 4KR0A 4M0FA 4RE5A 5AKHA 3FNBA 1Y37A 5ALRA 1LGYA 1DT3A 1YB6A 3C43A 5I8PA 2QJRA 3WL5A 1XZEA 2DR0A 3HRHA 4KE6A 1UK6A 5ALJA 2J3QA 1LNSA 3ZI7A 2OAGA 3NWOA 1H23A 2QTBA 4K5QA 4F5ZA 5D3KA 1GKLA 3ZLUA 5JIBA 4P93A 4OSEA 1JMKC 5CT9A 1XQVA 3H2HA 1E89A 1ZD4A 4FMPA 4DGQA 2ES4A 1K8QA 1OXMA 3WA6A 4HZGA 3WKDA 1F8UA 4HXGA 1XZKA 5AK4A 1W1IA 5LYYA 2XB6A 1NU6A 3BDVA 4X90A 2XT0A 2OGSA 3W9UA 4AN0A 5AKGA 4H7HA 4TPKA 1VZ2A 1CQWA 2OAEA 3H2GA 3LIIA 3AZOA 1MJ5A 1MNAA 4N5IX 4X6YA 3VDXA 2YXPX 4DLNA 3RLIA 1XZFA 1XKLA 3EQ8A 5LZ7A 2XUJA 1QIFA 4Q3LA 5EIEA 1YAJA 3G0IA 1H2YA 1OILA 1JU3A 4BZWA 4FLEA 1CUDA 4X85A 4BDTA 5ESRA 4J0JA 4QLOA 5A7HA 1J07A 3O4IA 4G1FA 3AIMA 2CUTA 3WK9A 3I2FA 4JH0A 3JWEA 1VE6A 3W04A 2OCLA 4QWWA 1P0MA 5ALIA 3H2IA 2GYUA 4TGLA 4EY6A 4MXDA 1L7AA 4G5XA 3C8HA 2DHDA 3WKCA 3KWFA 4QLAA 3STWA 6YASA 4DMHA 4K6KA 1BU8A 1XRRA 4QA9A 3E1GA 5DJ5A 2ORYA 2BCEA 4I3FA 1H22A 4X6UA 4B9AA 1PFQA 1F0PA 2XMCA 5AKKA 5FKJA 3N2ZB 3H1BA 1DQZA 5BOVA 4H0CA 5BWCA 4WDRA 3FVRA 3ANSA 3OTQA 4UHBA 5CT8A 1E8NA 5ALPA 1RP1A 1WB5A 1ZICA 2VSQA 4L9AA 5AK3A 3EQ9A 4AO8A 5C8ZA 4Q34A 1ODCA 2Z8XA 5AK6A 1QGED 2Y6UA 3ZLVA 4IH9A 3UMJA 1TRHA 4ITVA 5ALGA 1QZ3A 1MTZA 1BEZA 1VZ3A 1C7IA 4Y2XA 1UK8A 5KWIA 4EBBA 5EHZA 4NVRA 2AJBA 1C4XA 1T2NA 1QIIA 2E3JA 2XMQA 4B9EA 3U0VA 4BAGA 1TK3A 2QUBA 3G9ZA 2HU7A 2PVSA 1W6RA 4N8DA 1SOMA 1H2ZA 5AJHA 1QLWA 3T52A 4X92A 1B41A 4EY5A 4H7JA 4DSAA 1O6FA 1RYYA 3BIXA 1CUSA 3WZMA 1QTIA 1AQLA 1ACLA 3KSRA 2JGLA 5CRIA 3FAKA 3O95A 4P92A 1UFOA 2HA0A 3GROA 4CG3A 3G0GA 2CEKA 2HA7A 2WKWA 4M0MA 3KDAA 5IVDA 1DX4A 1CQZA 2WIJA 2JEYA 3RM3A 2JIDA 5ALDA 2XMSA 3OC0A 4HRXA 4BRSA 4QDOA 4HRYA 2OGZA 3WK6A 5HK9A 3L1IA 1K63A 1EK2A 2RHTA 4K6GA 4XWGA 2ZVDA 1DU4A 3BIWA 3ED1A 1EA5A 1HLGA 4WCVA 4FTWA 5K3CA 5SYMA 3FSGA 5AICA 3H2KA 2XUGA 2VJCA 2XI4A 2Z8ZA 3A70A 1KU0A 3A2LA 4HXEB 1EB8A 4DM7A 1XRNA 4BYMA 4BCCA 1K5PA 4B84A 3M81A 1YB7A 1XZIA 3M82A 2WFZA 3H1AA 5HF6A 1IZ8A 1CEXA 1LPSA 1UK9A 4FDMA 5FXMA 4IH4A 3ESCA 3DKRA 5A7GA 1XROA 2OQVA 1W4LA 4ZGBA 5IKXA 2OLEA 5JYCA 4Y2QA 4AO6A 1GPKA 2ROQA 2LIPA 1CUBA 2XUQA 5IH7A 5LP1A 4EA6A 5KBYA 4PSDA 4J0DA 4GI1A 2ECFA 4F60A 2DHCA 5T4FA 4TVKA 2PSFA 2XQIA 1G4HA 3WI7A 4AZ3A 5FDFA 5CT4A 3VJKA 3WK5A
chains in the Genus database with same CATH superfamily
3KYDA 3L07A 1P7VA 2VQ3A 3IKMB 2VF2A 5KYXA 4OATA 1H3FA 1GDDA 1XG5A 3QF4B 3BREA 3R0QA 4N8EA 3RGGA 1T2CA 4URVR 3EPJA 1NVAA 1T1EA 3TM5A 2RE8A 2XQVA 1H0KA 3WJ1A 4RANA 1IMJA 1ORWA 1Y9JA 5AKYA 5T64A 3B6IA 3QXSA 2OYCA 3X1WA 3SJBA 2QR3A 2XW6A 1BFUA 4LV6A 2IXGA 4I55B 2EFEB 3JSXA 1R27A 4Z1MD 4DKJA 4NMLA 2IOFA 3RTBA 1BZYA 1P77A 2FOIA 2Q9AA 4KE9A 1H4SA 3RC7A 3BRWD 1MORA 1C8KA 3FPEA 3RREA 3UK1A 4IJMA 1KO7A 1NT2A 2CY0A 4BLUA 2N1BA 4R2HA 3SXUA 4E5NA 4B3IA 4E2YA 3I42A 3MCZA 2Q4EA 1JEQA 1XMVA 3D3JA 4YO7A 2BLLA 2QTLA 4DREA 3FUVA 3WBJA 1JDSA 1I36A 3C8ZA 4UBJA 3GDGA 1TZMA 3GJ6A 4EEXA 2ZRPA 3UMVA 4JU9A 4P3PA 3D1VA 5IBCA 2Y2VA 4BQNA 4P83A 5C8YF 3ZCVA 1RCFA 2ETXA 1ZH0A 2OHVA 4RBNA 4AF8A 1YS9A 1LW7A 4TTQA 4TLLB 2ZIUB 4YRJA 4A16A 1T6NA 3A27A 2HREA 4DMRA 1NXVA 3V33A 2N3ZA 3ZHZA 4HH4A 4NE2A 2M98A 4RDXA 3E18A 1SK9A 5CVUA 2AFHE 1X7DA 3FSGD 4OHCA 4YWJA 4A2WA 5BUCA 4L5IA 4B4VA 5FJIA 3EGWA 3O8QB 1L4EA 1LZLA 1PJ8A 3GJZA 3PJEA 5A3VA 3NBZC 4X7RA 3W78A 1JN0A 1E4EA 1TXGA 1WXQA 2OBBA 3CZ9A 3GMSA 4JJFA 3AMVA 3IL2A 2PLWA 2QR5A 2ZBRA 3QVOA 3T3IA 5BVHA 5A3RA 1WWKA 3E27A 3GYGA 4WUVA 1DT5A 3GBPA 3RRJA 4HS4A 2VDLB 2RMKA 3GDHA 2NZ8A 2Z98A 1PCXA 3EBPA 2QUHA 5AI5A 2QRPA 2JRLA 4AUKA 1YD7A 2HU5A 4GO1A 4YONB 2UYQA 2PX2A 1IRXA 1EU1A 4CF5A 5K51A 3R3ZA 1YRBA 2PO5A 2SHKA 2BFEB 5DSXA 2O8NA 1HDYA 2F00A 2VVTA 3DZBA 3H5VA 3O93A 1GCGA 1MDFA 4OGKA 4R05A 3FGPA 3MJRA 1W88B 4H1VA 1DKUA 2ZYIA 1HE1C 2PMBA 3DCJA 3UOWA 4GM0A 4OY3A 3E9MA 3O5AA 4C7VA 2VBGA 1FFHA 2GN0A 2NVUA 1JKXA 2B5VA 3O9ZA 4YJDA 1Y6JA 1TM2A 3ZV3A 4BEBA 4R4JA 2UDPA 2A0FA 1QO9A 2CFIA 3IP7A 3KKEA 3FNEA 4A6XA 4LVNA 2B1IA 1LZKA 3GRAA 5ARCA 4M7PA 1NQUA 1VJGA 1UXHA 2J9XB 1U8UA 2ET6A 3FD8A 4FYXA 3TIXB 3MUNA 3R7SA 4B3XA 1XTZA 4DCTA 4YRMA 3NR2A 1Z17A 1JALA 1JFRA 1PJ2A 3D7KA 3QQ5A 4BLOA 2BMAA 3EXHB 3FNGA 3HVJA 2P2DA 3HVHA 1EB9A 5BSVA 4V3CA 1W6UA 4TT3A 4BE9A 1MW8X 5HJEA 3VYUB 1T35A 4IMJB 4LXUA 5ALMA 4E6PA 5LKRA 1WW8A 4RF2A 1SUIA 3R0JA 1VB3A 1MUUA 4OA8A 4C5CA 2UZ1B 1D1PA 4O25A 1TMKA 3NHJA 4GZMA 1ZAYA 1VA4A 2WRZA 4B79A 3USZA 1C9EA 221PA 2FSSA 2GASA 3PPYA 4HWGA 3L41A 3L82B 3ODPA 4MVCA 4DT1B 4RULA 3TG8A 4RKYA 2LIVA 1XCLA 1DCTA 2P5YA 1T3ZA 2D2XA 5EMNA 1IVSA 2J0SA 5KDLA 4A36A 2VSFA 4Z0NA 5IKOA 1TCUA 2W6PA 5REQA 4YXWA 4EI2A 4OX9Y 4QDJA 5TGDA 2FFQA 2G36A 3LA8A 3LQKA 2ASEA 4JI6B 3SYLA 4RTRA 3TLZA 5EVJA 2WWYA 4J90A 1Z2NX 3I76A 4GNRA 2BZ0A 4QULA 1CQIB 1GN9A 5DYIA 4CF4A 1VLJA 3L7MA 1NJ5A 2C42A 1DBPA 4ZT6A 3THYA 4IUCS 3KUCA 3QVXA 4CL8A 4L5BA 2HWWA 3T4EA 4I8DA 4NABA 2B1JA 2JIRA 1OAOC 4GZ5A 4P81A 4G9EA 4NJEA 3HBFA 3CW2A 1CZRA 2A5LA 3PDJA 4YDRA 1G7CA 4JSRA 2H5JA 1RSZA 2QTVB 4KGDA 4ZYTA 5B3LA 1P39A 3CRRA 1QP7A 4AN1A 1AMNA 2AOUA 3R40A 4LFAB 3C6MA 1XD2B 3EGXA 4RKFA 3BSFA 1CJVC 3I9V1 1N0VC 4X97A 3B9RA 4EO4A 4GL4A 1U90A 5ERXA 3WFIA 4GI2A 2FUEA 1C50A 1GRQA 4TMKA 1RWNA 3ER8A 5HZHA 1T0PA 2P41A 1DKLA 2A8YA 2P9JA 3KSDO 4QU0A 5E1OA 1FZTA 1Z4OA 1P6XA 3P5SA 3HM2A 3L0IB 1SVIA 4MSUA 5D5QA 5AQEA 5JALA 1J00A 4YV0A 3HBNA 3F9RA 3L1KA 5TLSA 2FUNB 3TLBA 2YDYA 4MS3B 2R48A 1R0CA 1ZX1A 2XMZA 2W6QA 4H2DA 3UXMA 4W6QA 5A6SB 3Q10A 1W8DA 5TF4A 2KE5A 3RVQA 2DUUA 2FB9A 1QH8A 1Z82A 4XLTA 1QYRA 5DO9A 2UZ3A 1CR1A 4MAMA 4C05A 3QFSA 1K7CA 1NWHA 3MS2A 3HCDA 1S7GA 2VWHA 2GPAA 3QEOA 3ZUGA 3SS9X 3ZX4A 2BKUA 2ZB8A 1K4MA 4QTXA 3KSZO 4QVKA 3T1QA 2OYRA 2ZSJA 4AK9A 2O8FA 4X84A 2R1TB 1DEKA 2W5UA 3ET5A 3JQ8B 3BK2A 3KHKA 4GVXA 4HNRA 3VR6H 3ZS9A 3IILA 3NRJA 2RG1A 2R6R1 1DJPA 3TLXA 2D5CA 3VO1A 2X2EA 3U56A 1G2QA 1L5YA 1I1QB 2RKWA 3VKUA 2G4LA 1NRXA 3L4SO 4XPIA 5JCOA 5BN3B 2IF0A 5COBA 1M33A 3PQ3A 1ZUWA 2XGMA 1JBKA 3W2HA 1LLQA 4GKBA 4YYZA 4MR7A 3DHNA 4LOIA 3KQVA 3M5PA 1OH5A 2HSDA 1UBMS 5JSYA 1MQAA 2FQQA 5LLDA 3GLGE 5CJPA 2IHVA 3C3KA 1RC1A 5CDUA 4YHHB 1DRKA 4RFSB 3OEWA 4D74A 3P9PA 3DEIA 4EOGA 1A4IA 4FHDA 5JSFA 3KOXA 4HGPA 2JBAB 5DHTA 2YVLA 3M9LA 3TX2A 2AR0A 1IN1A 1D2MA 2GT1A 1D5CA 5C31A 3V4FA 3SMQA 4IGIA 4XIYA 3WBKA 4CI9A 1QFMA 1XR3A 1DTSA 3FMGA 1H8ED 3VU1A 4IO0A 4E1BA 5CDGA 3W7VA 2XE6A 4R8LA 4GKKB 4DILA 2F8MA 2VJYA 4PZDA 2BKXA 1GPYA 4ZT5A 4HX2A 2JPDA 3BSSA 1Y8RB 4RH1A 3OPMA 1O0SA 2PH5A 2IYQA 4HPXB 2CKDA 3EQ6A 4NONA 2WTBA 3FA2A 2YOFA 5FFFA 2SKCA 2A1IA 4PXYA 4B7CA 1YCDA 1OB5A 2VDPB 4XXHA 1FBTA 1U5BB 2CNNA 4WCFC 2Q8QA 3VUFA 1N2GA 4J7XA 1EK0A 5AOAA 1GZUA 1OI2A 3OEED 3FLMA 4GPIB 4HYQA 1N0HA 1G63A 3ZIDA 5F4ZA 4BNHA 1UADA 5AHRA 3RJ5A 1U5BA 5H4HA 1AGYA 3MCVA 1NF8A 5E9AA 3SBXA 5JH7F 1L4BA 2EXXA 3F9CA 1V45E 3G2HA 4KPGA 2F3QA 2GWRA 2E85A 1U8XX 1JR3E 1UKZA 1ZJ4A 1SA0B 2NYVA 1KMNA 4FZ3A 3H6GA 2EQ5A 2IC5A 3M4NA 3O84A 4GI5A 3UMMA 4ECEA 5CXUA 1IFXA 4NPCA 3TTSA 1ECFA 4MZXA 3AZPA 4FI3F 5FQNA 1M1YA 3J7TA 2X1VA 4L5YA 1NVVR 3MBKA 4GRIA 4US0R 4BMCA 2V5AA 1XC7A 2VXCA 1KSFX 4TKMA 4E11A 3DZGA 5EXPA 3PQEA 3EW7A 3ILSA 3BE4A 3K70B 2HZ7A 4R1MA 1NBEA 3IHTA 2FPPA 1ST2A 3OZ7A 3OLZA 3FTQA 2VP0A 5GAJA 3UEOA 5BORA 2NOAA 1Y6GA 1DB3A 4RAQA 4AYWA 4Z3KA 1N0UA 1YZUA 4RPHA 1KWKA 3I9V6 4IGFA 1W93A 1AHPA 4M1TA 4DJJA 1H2HA 4BO2A 4PU0A 1UZNA 3TD9A 2R1ZA 4FBLA 1VIAA 1HFEL 1ECPA 4EGQA 4KH1A 4S0ZA 3VHXB 5AW4A 2G8LA 1W75A 4P7FA 4V2UA 3SZ3A 4BWVA 1TF7A 3E7FA 4CCAA 4ENUA 4ZYZA 2QB5A 4WJLA 1XJWA 1M8PA 3UPUA 1V37A 1KZ9A 1UOOA 4ZRDA 5FORA 2XF2A 5CVTA 3N8IA 2XF8A 2V9ZA 3EISA 1WV1A 5BN5A 4FUTA 3G88A 1KZ4A 3MJSA 1XHEA 3L4EA 5CBPA 4FWTA 2POCA 4NENB 1BS2A 1FSFA 2H0QA 3MB5A 4HWOA 1MABB 1PVDA 2Q6LA 4OH7A 1HZZC 4ARZA 4L72A 3MWGA 4UD6A 5FBHA 2BJHA 4KLRA 4BVEA 3K72B 4BTLA 4K9KA 3WA7A 5KKCA 4CEJA 1Z6GA 2PYZA 3OE5A 2GCIA 1TVEA 2M6SA 2QRQA 4GLFA 3PFGA 4JP8A 4MW5A 4NJEB 5HG0A 3NWJA 1CJTC 1G8AA 1O9BA 2G6BA 2JFXA 4OLAA 4DQ0A 3TWOA 4TS1A 3IEPA 3I8XA 3ZE6A 1X7XB 4UVIA 1RYZA 2ZS8A 5IT4A 1KOJA 1JEAA 2O2GA 4EJSC 1JFVA 2HCBA 3N2YA 1EG2A 4PLWA 1PW7A 1ZI8A 1F14A 1HYEA 1YJBA 2EC5A 2X4LA 2VPQA 1E64A 4ZVSA 4E33A 5IS2A 3DOFA 4LNHA 4NSNA 4TQGA 5F2KA 3W3AD 5LUAA 3QUTA 4U7JA 1YR2A 4ENTA 3R6WA 2O54A 2W9XA 1UT8A 3EWNA 3KT8A 4K1LA 3KU4A 3N2LA 4A03A 5CBKA 2C4UA 1IZ9A 2V55B 1SC9A 1K27A 2YV1A 1Z25A 1RWKA 4RPLA 1PSDA 5JS7A 3UC9A 5MN4A 1UT5A 3FHOA 4IRMA 2GILA 3OKCA 3RVBA 1NUHA 3K1YA 1UBLS 1TOAA 2X1LA 1MO6A 5LVAA 1H6BA 4ILKA 4PRYA 3KEFA 4ZN6A 2CF5A 1YIAA 1Z8FA 2PXXA 4GPAA 1Z39A 3V1KA 2BMWA 1COWD 4RXMA 2O7VA 4MH0R 2R8YA 4FNAA 2F90A 3VHLB 1JA0A 1CB0A 1L7MA 3O9VA 4KWCA 2R8ZA 3DP9A 1O95A 2ON6A 2YN0A 1E63A 5DP1A 4IRUB 4KNVA 4B44A 3WOHA 2BDEA 1UT6A 3NBYC 2P79A 1DKOA 4O2AA 1D03A 4LY9A 2BHLA 3EEFA 3FB4A 3SNHA 4CM7A 1VXRA 2FRDA 2PSHA 1J2TA 5HHTA 2CLEB 4BO4A 2F4NA 4A8JC 3C3BA 3KUUA 4N65A 3EGEA 4PM4A 3WYEA 2V4ZA 1A9PA 4G84A 2FG6C 2F1KA 4HLUA 5FT9A 8ADHA 4JVOA 4XTCS 1VPLA 4J1NA 4WUTA 4AY6A 1N9ZA 1TIKA 1M1UA 1VJ1A 3QPWA 4GR9A 4L27A 2Q6OA 3E6AA 4LWQA 1DG3A 2H17A 2ZYVX 3CEMA 5CCEA 4IQ8A 2RCYA 3L92A 4R83A 2E4UA 4OK6A 1XJQA 4KVZA 2IEZA 3NTVA 1MX5A 1RC0A 7MHTA 2PPVA 4N8SA 1LPAB 5KYUA 3DE3X 1EQAA 2EG5A 1W73A 2W8BA 2WT4A 4P2BA 4PWZA 5HE8A 4UHKA 1SBTA 3K9CA 4AM8A 3HK2A 2PH7A 3TCNA 5IF9A 3QX9A 2KX7A 2AMYA 2CLCX 1J49A 1QJCA 1XCJA 2ZI3A 4XYGA 4DDTA 5I47A 5HYVA 1S3GA 4HDAA 2DTDA 3DZ8A 1ACJA 2BP7B 1Q20A 2HBRA 3ABRB 2NSDA 2WY2D 4V0ME 4WHMA 1AUOA 3DFZA 3GEMA 4ZZ1A 2F8TA 3ELDA 3SI7A 4JP1A 1E3DA 2BV3A 4DCJA 1UZUA 4IIEA 1EYZA 4HH0A 3EXIA 4WFJA 2OV4A 5F7ZA 2CL7X 4RWZA 4ETNA 2ZRHA 2BFWA 2HPZA 4PC1A 5T4EA 3WMXA 4LFBB 1KFEB 3JW8A 3PLNA 4ZT4A 2JH8A 2VHVA 3TD2A 4Z0TA 3I9NA 3DOCA 5BV2P 1UK7A 3Q0EA 1XDZA 2Q29A 4CFYA 2GCEA 4BQEA 1VG9B 1XCMA 5CM2Z 2IH2A 4M9UA 4CR6A 4CW7A 3DNMA 4RVCA 1NNSA 1G3MA 1OJ7A 2R2AA 3PL5A 4JYPA 4KFRA 4PZ9A 5AW0A 4BASA 2O52A 3AHCA 4TLBA 3FOEC 4QU5A 1JR3A 1CVRA 2EL9A 3E9EA 1WTAA 3N8HA 2PWYA 1NE2A 1FRZA 3LX6A 2VPIA 3EVGA 3NT2A 4JBYA 4WNYA 3ENVA 5H81A 1XQ9A 4EARA 3KKPA 4AJNA 5EUBA 3I9FA 3U7EB 2XCRB 4IJWA 1DXQA 3CVOA 5CA1F 1EXWA 4WV3A 3ZV5A 2P0AA 4ABTA 3KJZA 1UXJA 3RWOA 4AJIA 4UTRA 2FW6A 1QQ6A 4YMGA 1ZOOA 3TKYA 5DYTA 2W7TA 1YZHA 3OZDA 4J49A 4Q21A 4YMIA 3EARA 4BNLA 3AFIA 4GE0A 2BMFA 4UPVA 2ZUCA 3INGA 2CGEA 5EE0A 4KE8A 3HVUA 1IVYA 3F5SA 4E1VA 4KJXA 2ZJBA 2JFFA 3ZWNA 4PFKA 3CLUC 1N2BA 2I76A 4Z9YA 1YH3A 2CLLB 4OHFA 1QOZA 1NBAA 1R6XA 3KZ1E 3PFCA 4GQAA 3CF4G 4LQDA 1VKHA 3L06A 4MLZA 4LC0A 1QSGA 2EP5A 5HF9A 1ESNA 2Y66A 2EW2A 2BF7A 4ITRC 4JMPA 4QPPA 4ZGWA 4ZCLA 1GYPA 1ULBA 3WGYA 1YMVA 4ZK6A 4RJKA 1VMEA 2QPAA 3BTSA 4QXQA 4Y2SA 3LSYA 5EQJB 5IH3A 2XEDA 3V8BA 3VR5D 4DIBA 3U7GA 2VWPA 2CE2X 5A2QA 5JH7A 1NG9A 3C3YA 4C76A 4CI0B 3UAGA 4E3WA 4F9TA 3OD1A 1SJ9A 4JNKA 4K1XA 3S8MA 3VYRB 3R9WA 2ANCA 4PQEA 1ZNWA 3AHIA 4GSKA 5AP9A 2EEZA 2WILA 4RMJA 5FTJA 4JK3A 3WGZA 2QMOA 2OO7A 2W2MA 3HC7A 2Z2JA 4IXMA 2G72A 3HR4A 2YQ4A 4KQXA 1V3UA 4MVJG 4PLVA 3TK1A 3VX4A 2H00A 5LDHA 4FMCF 5T41A 3ECAA 2W2KB 3R77A 2QK4A 2V8BA 5EA2A 3GB9A 3ESXA 4RSMA 4X8OA 3AW8A 3PS9A 5FOSA 4C78A 4MTCA 1FNBA 2JJQA 1CFJA 2CD7A 4RTKA 1KYIA 3SX4A 4G8JA 2MSDB 1V3TA 2GK4A 4OHUA 1D4OA 3JWJA 3KRTA 1SXQA 2PX6A 1XDBA 5JBIA 4QO7A 1ADYA 5L6MB 3RROA 3PFFA 5CXQA 4MA0A 1KEKA 3X1KA 1RJ9B 3K20A 5BN3A 3LNTA 4Z4IA 1PL7A 3LY7A 3CNHA 4MR7B 3D7NA 4IP0A 3DUFA 1L5FA 1E6KA 2II6A 1JAZA 4HMQA 4MW7A 4TWBA 1FXSA 4HUJA 4NNJA 5IAKA 1X94A 1ZMBA 1EUYA 1G8YA 3BORA 2QG4A 4XWYA 1THTA 1C1DA 1KH2A 2V6MA 3CVYA 4V1CI 3D3WA 3LFHA 4OBEA 4DLAA 5L6LB 2AYYA 1Q7BA 3SP1A 1ZIDA 3CCFA 3L8EA 4F0JA 1E1MA 2GPJA 1ZINA 4UNSA 2YASA 4D2IA 1PJ3A 5LU9A 2QNRA 1KO4A 1OBVA 2ONKA 1JE1A 2XBMA 5I7VA 4IIDA 1W4CA 2D5LA 1M6WA 2QP4A 3W8NA 4EW1A 2OV2A 5E95A 2OCDA 1F6BA 4HAUA 5HZGA 3DF7A 2FOLA 4JQSA 1ABBA 1T6YA 3CX3A 4I4IA 4DJEC 4QHTA 5A4DA 1H85A 3KBBA 1XK7A 4OQXA 3OHMA 3K4QA 1Y5RA 4KMRA 3SZOA 1S2GA 3S2IA 4BIIA 4BWFB 2ZRDA 2BWJA 3FHCB 2E4YA 2ZI5A 1WO8A 3UJ3X 4JQYA 3SQWA 4ESVA 1PTJC 3KWMA 4W9NA 1CQJA 1XRSB 1SPXA 2BD0A 2SNIE 1NXQA 2PBLA 1BJTA 1IK6A 4W4TA 4OBXA 2PAFA 3JARB 2AEMA 4M49A 5DX8A 2QTGA 1TJ3A 1UPCA 4H27A 4XGNA 2GEUA 4YBZA 2WAYA 3DVRX 4C0XA 5F2NA 2VZLA 5CA1A 3ADOA 1Z8DA 1U9ZA 2PMCA 4F93B 5HZMA 1FLDA 2VP2A 1ZIYA 1DTWB 1YQEA 1VE1A 2FW9A 2J9GA 2MYTA 1E7RA 1OT5A 3CONA 1AS0A 2GGSA 3CW8X 2ZETA 3PQDA 2R9VA 4JSYA 5EMMA 2Q2WA 2P3OA 3N76A 4GZ6A 3E3MA 4BKQA 3CLTC 1M1NB 3PJGA 4OUDA 3QEJA 1WXWA 5HM8A 1OVMA 3KTAB 5CURA 1QTQA 4FFRA 5CFRA 2B5WA 4J1TA 1BE8A 4NBNA 1Z5WA 1LDYA 2WU1A 5LIRA 3QBJA 4DPMA 1U0OC 4DLWA 4LSGA 3GJRA 2HBZA 3UJPA 1PR0A 2A1UA 3U39A 2REQB 2CHEA 2XWQA 1TYEB 2NV0A 5AW1A 5J4VA 5MHTA 3TLGA 3G7SA 3R5HA 3BBLA 1UBUS 1KZ6A 3V8RA 4AJ4A 1PGQA 4LYYA 3JYHA 1QIGA 4K7JA 4ZI2A 3I6QA 3R3HA 2E2WA 4AMGA 1BKYA 3O1JC 4M0DA 3EVZA 3K05A 5F21A 2DTEA 1OW3B 2C59A 3JQ9C 4EKIA 1RVDA 2DWUA 1J2YA 3ENNA 4CIAA 3SEAA 1C14A 1WBJB 3WHIA 4JL5A 1J39A 5BRJA 4HNAB 1U99A 1KI1A 1J0AA 2V7QD 2XXBA 4LYGA 4FVTA 2ZIFA 1RRPA 2O2SA 1MOQA 4INZA 4B4DA 3M6IA 4Y8VA 721PA 3DMYA 1LS1A 1T29A 3C6KA 3SC2B 3LVFO 2J0EA 4BX0A 1JB1A 1DPFA 1VL2A 2XUHA 1IOLA 2GEJA 4PTYA 1X9GA 2AJCA 4U6QA 3TOSA 1JG6A 3TZCA 2JGRA 4ZOQI 3CW9A 4REOA 1LWOA 1X8JA 4UDNA 3T54A 4HB2A 5B55A 3D64A 1TYAE 4E15A 3G82C 3P9YA 1W1WA 2C07A 3EVDA 4LFCB 2FSGA 2YJ4A 4NF2A 2AS0A 2EJWA 4B76A 1K75A 2YVKA 3HI4A 1DRWA 1U2TA 3FGZA 2X7XA 2IH4A 3MPOA 2X7HA 4ARBA 3C7KA 1SVLA 4C22A 2YKGA 2P7IA 5K3SA 5JG7A 2J6IA 5FEUA 3ZU4A 1AT1A 3UHFA 1LJLA 1QO7A 3TJZA 4KIWA 3TLJA 2GZSA 1QFXA 3IPLA 3IO3A 4OFBA 4DMCA 4LZAA 1R5NA 1SUSA 1DHTA 4IZHA 1G5IA 2Q0SA 4TTIA 4W63A 3BMOB 2NW6A 3V55A 4I0WB 4YJHA 1GSAA 4HT3B 2PO7A 3EZGA 2FQXA 4FCVA 3U0BA 2QNIA 3ZKAA 2ODBA 1YQWA 2WTAA 3GRPA 1N5OX 3DZFA 4PFJA 1JVSA 3GOQA 5K2MA 4YRIA 4PANA 4TRNA 3WYGA 4ARVA 1AQ6A 1QZZA 3M6WA 3WWZA 2DHEA 4QDZA 3LGSA 1U7UA 4RLFA 5ALEA 3MMNA 3PNVA 3IGFA 2O7NA 1Z8HA 2GUWA 4MI9A 5IAGA 4EPYA 4PG6A 3UN1A 1JKMA 1V16B 4KHPB 3JQ6A 1IM8A 3N70A 3O3MB 3OFVA 3RVJA 1GUDA 1IL0A 5K0TA 3U1VA 1KMQA 4AAYA 2QRHA 3BMCA 4J0CA 5AW9A 5F9HA 3T6KA 3MIIA 3AR8A 5DTJA 3GA7A 4FFWA 5TEVA 1AQJA 3F49S 2HO5A 2OBLA 1EHYA 1R0KA 1TM5E 2XBUA 4KAJA 5CDTA 1W0KD 5KOHB 1EP3B 4JVMA 4BE4A 3NVKI 3TZBA 5HX7A 4BFCA 3H11A 2GYYA 4BMDA 1DV1A 4LNAA 3R0VA 1P1HA 3UT0A 2NP6A 3E61A 3C87A 3OEEA 4C4XA 2ORIA 4QPCA 1QMPA 5TNXA 2CWDA 1DX9A 1FDRA 1TX4B 3X1DA 5TVKA 2MSLA 4F4UA 4Y3UA 3PE3A 3A10A 4MWDA 2VSYA 3AM5A 2RG7A 3WIBA 3EIHA 4KRGA 1N34B 3VJRA 3RG2A 5AW7A 5EINA 5J1TB 3UFXA 1KARA 2W4IA 4TTPA 4XEUA 5F7OA 3I2YX 1GILA 4LXQA 1LQTA 5H68A 3WJ7A 4XIJA 5DIFA 1Q5PA 1YJQA 2J5BA 2FFJA 1U0NA 2WHEA 1MB2A 2ZRLA 4HSEA 3QP9A 4W8HA 4NJOA 1P31A 3QUAA 1GFSA 4BC1A 4BYGA 4JROA 3G1TA 3IBCA 2BOVA 4LQLA 4RHCA 3SHFA 1TPYA 2ZWOA 4MQUA 4QODA 5EG5A 1XP5A 3H4VA 3UMGA 1QHNA 2IOYA 2HX1A 3KUDA 3OEYA 2D6FA 2OVBA 4YUVA 4WBNA 1Q1QA 2NZVG 4TSFD 2J6BA 3FRHA 2C29D 2GR9A 4JXXA 3VU3A 5HFNA 2XNKA 1JTFA 2HIHA 4JJEA 3WLRA 3KNZA 2FUG1 2R62A 2C5GA 4IYJA 3K9HA 4JAVC 1O87A 1T13A 3VHXA 4N39A 1IBKB 1E6MA 1LRKA 1X86B 1Z36A 2CHUA 2E55A 4LF5B 1KZGB 2P2SA 3FKQA 1TB4A 4CM1A 4R7ZA 3F3KA 3DBLB 4BPRA 1WPRA 2P9BA 3AERA 4G0VA 2O2ZA 5EQDA 2G9NA 5K0EA 1JHRA 1RQXA 2XYPA 3H6KA 1YZFA 3C74A 1QE5A 2VAXA 4OB8A 2ZSIA 3IUQA 2YS7A 3L8DA 4QIHA 4KFCA 1A69A 5C0OE 3K9QO 3WV5A 4AF6A 4P82A 1MO4A 4KX3A 2NNLD 1I4DD 4KIFA 1XP8A 5TV2A 5EJMA 3ELYA 2I34A 2R8BA 3GARA 4CLRA 3HCBA 2P4UA 1X74A 3GLQA 4MKIA 1KQOA 1U7PA 4G3XA 1BGWA 3NHBA 2V7PA 1NYQA 3ID6C 1A8HA 3OPNA 4KC0A 4QDUA 3EXHC 3O91A 1NY6A 4CM8B 3EDCA 1DGQA 3LYAA 2WG0A 4J16A 4GOKA 1CX9B 1AS3A 3GBVA 2B61A 4P5EA 3ROKA 3T38A 3HV2A 5BUSA 3PDHA 5C7OO 5LQCA 3DPIA 2QT9A 4LDQA 4W7SA 1ZO8A 1EEHA 1KI3A 1Y6ZA 2I2WA 2WW8A 2XAAA 3KAQA 4XLLA 2WZDA 2Y4NA 4OLFA 2RHLA 5CVJA 1KJZA 5AI8A 3GUUA 4RDHA 1M34B 1ULAA 3M70A 5FUXA 3GP8A 3UV6A 4OXNA 1JAYA 2FCAA 4U63A 4FLMA 5AW2A 1Z4IA 2HFJA 1ZNYA 2VJPA 3JQ8A 3DQPA 1FFXA 4EDHA 4QGHA 1ZUNA 3EJWA 4FHFA 4IXNA 4RZXA 5BXQC 3Q8KA 3L7OA 5IW8A 5CG2A 5AXBA 4UU1A 3GZJA 3V9AA 4N48A 2GHQA 4P54A 4HAXA 2XQGA 3FYUA 4QAQA 3SJZA 4DWOA 1OI4A 3O8LA 4JNCA 5BYJA 2GFIA 3W1EA 4P3XA 5K2OA 4NCBA 2Q99A 3WGJA 1MA3A 4FS8A 1P8AA 4X6XA 1BCSA 3EPPA 4TXMA 4OMDA 4A7PA 4BVGA 2X9GA 4E51A 3PTAA 4DDMA 2V7UA 3RTDA 1WHTA 1G0NA 4JR0A 1TW2A 2FFRA 3L8YA 2BAGA 1F7UA 1JTEA 1FCJA 3ZJ4A 3JZAA 1UOPA 5KEIA 2HSGA 2XUDA 3SS8A 3T5MA 3STXA 1OHHD 3ANLA 1LQUA 4KHZA 4ER0A 2H57A 5J43A 3SF0A 3GRYA 2R6FA 1CIJA 3HCCA 1JJFA 4ND8B 4RKWA 5CG1A 2WM3A 1P1IA 3QW2A 1JB9A 3GAFA 2ONCA 3NTRA 5FYQA 2P2CA 3OOYA 3QOFA 1HTBA 2FVXA 4HQRA 1RRFA 4G8BA 4YUZA 2IYPA 4G0NA 1XZ8A 1FNNA 2LVBA 4TKLA 4RZHA 3BMNA 3SR0A 3TTWA 5DKFA 5HNKA 1KNQA 3TNJA 3UOAB 3CUSA 1T0BA 2PGIA 1PX0A 2EU8A 2XYQA 3FPJA 4J6EA 1IQPA 3W8EA 3ZDRA 2DLNA 3SR4A 1ZM3A 1KJJA 2HD4A 1NL3A 1PJBA 4ND6A 2QPTA 1K7SN 2XX3A 4ZICA 3CF4A 1VCIA 1AHIA 1S8FA 3R23A 3GRCA 3HY6A 3S29A 2Q3FA 3ZJYA 5KREA 2JHAA 4H0NA 1RBYA 3COYA 4UFOA 4F38A 3PVCA 2YOHA 3CCCA 4FN5A 3BEOA 4Q01A 1EA7A 4YH1A 4YMSA 3S28A 2BL4A 1G16A 1AE1A 3BMCB 4MITA 2BBWA 2J48A 1R64A 4Y6OA 3A11A 1VCNA 4AF7A 1Y9AA 2VZ9A 2FCRA 3A4TA 3K6RA 3LECA 4QJ5A 4DG5A 4TSFA 1WY5A 3VVCA 5DX1A 1UBOS 2J5RA 2Q4BA 4YDSA 5EYPA 1N7IA 1YL5A 4X64B 3UGJA 4ILEA 3DYIA 5FI3A 4MGZR 4AFNA 1H6DA 1KJWA 3PHLA 6AT1A 3U44B 2OGUA 1EZ1A 2DFDA 2V5VA 2AF3C 4ZEXA 3G17A 3JQPA 1OSNA 3M6VA 3TVTA 1H4VB 5EI5A 1O89A 3ITKA 1I1HA 4IVNA 5IDQA 5KVCA 4LJ7A 4G5RA 1CUGA 2IZZA 3AHHA 4H60A 4M9QA 3ASVA 1G291 3FOCA 5CA1B 5YASA 1YDFA 2D2EA 2BN4A 1BGVA 1Z68A 3WHPA 3PC2A 3HB0A 3SVLA 1CUCA 3EA4A 3BEDA 1DWOA 3VO9A 2ZT6A 5J4KA 2R79A 2FJUA 3DE2X 4MKHA 4MQEA 1XRLA 3I32A 3KR1A 4YJ3B 5H7XA 2H1OA 1VKZA 2F6RA 2TMKA 4ZVMA 3AP2A 4IXTA 1LA2A 1NXWA 2DPXA 2JANA 4WW0A 2W2NA 3JATB 3LRPA 4L5JA 3U9TA 4BGUA 2FX2A 3AY3A 4KXUA 2FPUA 3EAGA 3KAPA 1RZVA 2ZPTX 1YS4A 3IC5A 1J9ZA 2EDAA 4KFUA 5BNZA 3DEYX 1U3TA 1C30B 2G7ZA 2O1EA 3CLSC 3P9NA 4MKFA 1H0RA 4C2UA 4R0VA 4ZREA 3LHDA 1FE8A 5LCXA 4DR1B 3CUUA 3DR3A 4H3VA 1Q11A 2C9DA 2DC1A 4X7BA 4YAJA 1X7XA 4P80A 4YI3A 2VT7A 4NOLA 3LUBA 4OQNA 3V8NA 1M0EA 3NJ4A 2ZSEA 5LZ8A 3IESA 1WETA 3TNYA 1NJFA 4EVSA 4IDNA 5IARA 3HFJA 1YZKA 1RM0A 4I2VA 2FWRA 3PG5A 1TUBA 1UKVY 1P1FA 2QTVA 3PQ2A 2ZRAA 1G5HA 3TQHA 1RAFA 1X9IA 2FTKE 3R0ZA 1FFXB 1E1QD 3RBVA 1GU0A 3T1VA 3ZG6A 2QBYA 2BSXA 2WKSA 4U9HS 3RS4A 3H17A 1D4AA 1N9GA 5J9FA 5K4GA 4XVUA 1TO1E 2G1PA 4ZVVA 1A77A 3L7IA 1P4RA 2QP3A 4OAPA 1WVGA 4O2BA 3CWQA 4CGZA 1QH0A 3TBKA 3TTTA 3WDSA 1XAHA 4HNSA 3TAUA 3SBOA 5BW8A 1YRHA 3C8DA 4YI5A 421PA 4GUDA 3BDIA 1JFSA 2XRMA 1SUCA 3W5VA 5F76A 2P68A 1NLZA 2QU7A 1ZU5A 2FMKA 4D9KA 4D0SA 1CKEA 1DO2A 2AXEA 4OD0A 3CN7A 2N0SA 4NCNA 4WMLA 2E4XA 1EM8B 3OUZA 2MYPA 1DARA 1I6MA 1PV1A 2C2KA 1ZDMA 3ZIAA 1XZNA 2Q27A 2UVPB 1Z6TA 1DFGA 1E99A 1ONNA 2RGBA 1U9IA 5J40A 3I4CA 5EWLA 4KXLA 1GY8A 1DKPA 3H9BA 3VU0A 2G71A 1ZESA 4NPAA 3AYZB 3UHAA 1HZZA 4DVJA 1H2FA 5C8YB 3EWIA 4J0IA 1OT3A 2QYSA 4Y2GA 5DP2A 1KZYC 2I4RA 5G3YA 1VSQA 1KH3A 1P3JA 1GT6A 2HTFA 4R1OA 3UKDA 1OIVA 3VAAA 2P6RA 3HXKA 4QOGA 3SLKA 3TECE 1WBBA 3SIWA 3OU7A 2WU3A 4W5OA 1S02A 1DRVA 3S2GA 4HATA 5I48A 3PNMA 1FMLA 2IU4A 5LDGA 5I9IA 3S1LA 1ZYUA 1MV8A 3AL2A 3MNFA 4JI8B 5B3JC 3WSVA 1Z15A 4FHGA 5FL7A 1RAHA 1U9CA 4DA6A 3BSYA 3TVDA 3I9KA 3IERA 3PNBA 1CIVA 1DNPA 3QVWA 4R2XA 5CNIA 3MPUA 3WKAA 4MUBA 3JVEA 4Y2JA 5SYNA 7GPBA 3KOUA 3P8ZA 2V9CA 4WKPA 4KREA 1JLSA 1LLUA 1DQYA 3TJRA 1PQUA 4I8IA 1NMQA 2GTIA 2YZ2A 5ES3A 2J6HA 1EUCA 2W8BB 5TSDA 2PPLA 1TIPA 3FFWA 3N2NA 3H1GA 4KODA 4UMDA 4NG5A 4DB2A 2EYQA 2Z04A 4OQMA 3LKVA 4RPKA 3REOA 1T9ZA 3NASA 3C7AA 4RQTA 4TTRA 1OB2A 4FOSA 4URFA 1OUMA 1WSAA 1RFGE 2RJOA 4Q4AB 2SKDA 2AKYA 1KDVA 1Q1EA 1Y48E 2OD7A 1Z88A 1E4VA 3C2QA 2HA4A 4JDUA 1PJAA 4MIEA 4TUYA 4KQ2A 4CIWA 3CA8A 1OZFA 3A1FA 5JU6A 3N8DA 2IEGA 2GK7A 4U8GA 2B20A 5JWRA 3BCUA 1AZSC 2DFKB 5A5VA 4I5EA 3ZD9A 3QEMA 4Q7MB 2QLFA 1OLUB 1J9EA 1CQJB 2I66A 2MSEB 3UV3A 4MYDA 3H5TA 4HUTA 4GI7A 2Q9BA 4BUJA 5U9CA 2W2QA 4EY3A 2OCKA 1AGRA 3NI2A 2CHFA 3D81A 2Q6IA 3LVBA 4A73A 1FVFA 5EHIA 5IZCA 2YW2A 1JJBA 2R00C 2E6KA 2FMIA 3BWYA 3C6BA 3NJRA 4ZQIA 2CJXA 4GOOD 1NBME 5HBRA 3KOYA 3O38A 4DW8A 2PKQO 4LF7B 2FPXA 3ELBA 4EMBA 4DV2B 4TXNA 4UBMA 1WIWA 3KZXA 3H9CA 3TN7A 3ZOZA 4BO0A 4E4YA 4OGWA 3WLSA 3OT4A 3QE3A 1TLLA 5EZYF 4OJQA 4BP9A 1DO0A 3KIPA 2D59A 4FOPA 4UPEA 3P0RA 4LTDA 3GNTA 4XUCA 2H4HA 4XDYA 1G19A 3ZZTA 4EECA 4L3WA 3I1IA 5I7HA 1FLVA 2WHPA 3M3DA 3RFUA 2YIDA 2OZVA 2RSLA 1CEYA 3N75A 3F67A 4HWTA 1JP7A 3NS7A 1GV0A 3PGMA 1EIWA 5IAJA 5KYVA 1YE3A 1V26A 3ABZA 3L02A 4EG5A 1LJ8A 2GM9A 3PE4A 2H85A 3WMRA 4C89A 4QLBA 5C32A 1TK2A 1XDWA 4RHYA 5ENDA 2X8WA 1BX1A 2Q2NA 5F9FA 1VL8A 3MF4A 5DW3A 1PR2A 1GG9A 3A3PA 1A50B 2EX1A 2HRDA 3Q6MA 2C3UA 3HUTA 4MNTA 5BSMA 1UQRA 4MYTA 2I1WA 2B6HA 1U0SY 4MKGA 2OO3A 1XDGA 4H1UA 4WLVA 3NWBA 4XM1A 1D9ZA 2AGVA 1U1FA 5CVEA 2Q5JA 1F2TB 3AESA 1MLDA 3H0CA 1JHXA 3FNHA 4JUCA 3QJGA 4RZUA 1ONPA 4ZC8A 2EKDA 3VR3D 4LOLA 3TLMA 3HYLA 3V4PB 2C99A 3VNBA 2R6GA 4TMWA 3TD6A 5JSZA 3JVIA 1VYVA 3QX7A 4NBTA 4OXRA 1UMBB 1XF1A 4RFLA 4MJ7A 3PXGA 2QZ4A 5BWOA 4TLDA 3ZWQA 2FEKA 2V3WA 1D1SA 4PZAA 2I4LA 1XFDA 2EHDA 1UWKA 3HABA 3ASUA 4Y1RB 4B6GA 4CLHA 5IJWA 4I9GA 1YULA 3OX2A 4C1NA 1MPXA 3FTCA 3VR5H 4C0BA 3A28A 2WP0A 1GGVA 2BMVA 4FHEA 1KYQA 1M8KA 2DWPA 4NTZA 4DCCA 1PK7A 3QUSA 5HQJA 4ZHQB 5KTYA 5IC5A 4A91A 4D92A 2O1XA 4JR1A 1HH4A 1VIYA 4LVOA 1IY8A 2Z09A 4RVUA 4KH0A 4RF5A 3ZOKA 4EP1A 5EHGA 1RZRA 5EUMA 4LIPD 3VR2A 4JLUA 5J4LA 3UWOA 4K26A 1N5MA 2MSWA 3H8JA 2A3NA 4E5KA 3ZDBA 3ZZ0A 4Y7CA 1N4AA 4BGEA 2J6CA 1O0BA 1ADJA 2JLYA 4Z53A 2IPOA 4ER6A 3ZDXB 1P7ZA 1WMDA 3DDOA 3MBOA 5AW8A 1RWWA 1UINA 1PQPA 2F55A 2OUKA 3ORSA 3NKLA 2J3DA 3G5UA 1M2OA 2Q7XA 3ISTA 4J29A 4TKVB 5D1HA 2NU7A 4OHZA 2J8ZA 4EGAA 5EJ9A 1NX6A 1JR4A 2KPOA 1PJRA 3V4OA 5L53A 2BFBA 1QC5B 4DZRA 3PIDA 3INYA 5H4GA 1CNFA 5KVSA 4HB3A 3B8EA 3LHSA 1DINA 1MXFA 4RGQA 2AUMA 4CIBA 4MWGA 3RIHA 1I6WA 4UTNA 5MDHA 2IEYA 3D4OA 2NSHA 3OQPA 3WWCA 1WF3A 4YJFA 1XRPA 4NFLA 1Z5ZA 5ADUS 2GS9A 4JSTA 4CN8A 3HA2A 4A2QA 4C21A 3A4YA 4ZV4A 2YWCA 5JQGF 5CJ2A 5LN1A 4D25A 2VYVD 2JGIA 4BU1A 3L7LA 3EEOA 3BUSA 1TRKA 2AJDA 3FHTA 1U6JA 1Y8CA 3L8GA 3KB6A 4UAGA 2QW0X 2FMTA 1UJMA 3BAZA 4L57A 2A9JA 3DMNA 3MJDA 3W8FA 1K2WA 2CWWA 4LHZA 1PLJA 2LKDA 5DLDA 5BWMA 1YT5A 3OMLA 2W71A 4DT1A 3KJNA 5BWNA 1MAAA 3UUFA 4C4PA 1Q19A 5A3SA 1KO1A 3GK3A 3NC4A 3QF4A 1QB7A 4LKRA 5LXTB 2QS9A 1SBQA 2HRQA 2IVFA 1U3UA 3DDNA 5JW6A 3OZEA 1ULSA 5AVYA 3N59A 4HDRB 1QO0D 4RD2A 5ENZA 2QTFA 2EX4A 1DTEA 1DMRA 5JZMA 5J2UA 2W6JD 3C8UA 4DQXA 2WYWA 3R3VA 4BLTA 3F97A 1IZZA 3AUTA 3BK1A 2G9RA 4XFJA 4BATA 3BE6A 3RRMA 1VE9A 3HXLA 3NYIA 2I7XA 5AM0A 2YMPA 821PA 4MRVA 3IUYA 3IQXA 2OBXA 1E3LA 1RJGA 1NW7A 1KPHA 1MU0A 1JECA 2BTQA 3PWZA 4W5HA 2H11A 1IB0A 3WK4A 3O7MA 4OAOA 1KU6A 4XEHA 2ACKA 3C98A 2FPMA 3V8MA 3L0SA 1N0WA 5L51A 4NS4A 5DM4A 2VSNA 2VA9A 1MR3F 3HP7A 3QUCA 5LMUB 1EVEA 1VLMA 1Y7IA 3OE4A 2QZZA 4B6QA 1J5XA 4Z5XA 2CFCA 1HMPA 3E05A 3GHHA 1BHO1 4QUHA 4JUAA 4L5CA 1R4MB 2Q5CA 4WEQA 3DD1A 3KLOA 1T8UA 2RC6A 2WSIA 5M3BA 2QSJA 4S1VA 3SE7A 3D54D 3KVRA 3VDMA 4HK4A 3M6FA 2SKEA 4MHSA 2Z6QA 3K8YA 3M5WA 4XVCA 3PFHA 1YQTA 5JRDS 3MT9A 1OBHA 2BSAA 3H87A 3RUDA 1WXXA 1K8XB 4C88A 2NSYA 1IPFA 1W76A 2ZRKA 5A6SA 1ZHOA 3N3AC 4JCCA 3STTA 1VQ1A 2D13A 4MV9A 3RYFB 3FPCA 1C4KA 4AXXA 1GAXA 3LP5A 2R6AA 1FYVA 3WK8A 3MWEA 2OB1A 1RWOA 2I9PA 3E81A 2X5KO 5DF1A 3LUPA 3G13A 5LZ4A 1L7PA 4I9UA 1D7AA 1P9OA 1PR6A 3N2IA 1Q83A 4DQUA 1SHTX 1DQRA 2AW5A 2ZAGA 3K5HA 2WQZA 3OOEA 4FBMA 3OSUA 2D4HA 1D0SA 3AOGA 3BS4A 3GEHA 4M0PA 1P0QA 4QTZA 1G9XA 4UU8A 3DE0X 3PB3A 3SIRA 1SQGA 3P0IA 1C3EA 1U0LA 3SYKA 1PG0A 1Z06A 3JQ7B 1YF3A 4YS6A 4E5PA 4MGHA 1EQUA 4MQFB 4PZEA 2P27A 3H18A 4AI6A 3IJPA 5AYVA 4M1WA 1NXPA 2Z3VA 1XKQA 4TXLA 3BERA 3A1CA 1L5KA 1PAUA 4E22A 2I1LA 1NPDA 4EYEA 5LYJB 1W88A 2A3RA 4N18A 3IR5A 3SM9A 4BLQA 1FP7A 2Z57A 3HJNA 1QS0B 2W43A 3OPXA 2JFBA 1JTVA 1OREA 1S2MA 4HNGA 2PT5A 5EJIA 3T5AA 5J5AA 1LSSA 1M2VA 2HUPA 2PS1A 3B3JA 2OAP1 5FNZA 1TQ2A 1VI2A 3ZJTA 3DXFA 3GVHA 4ZYUA 3O3OB 4KAFA 1BHQ1 1MZVA 2Y9MB 4D81A 1U65A 1VI6A 2RHHA 1CBUA 3MTJA 4DV4B 2WIDA 3QQPA 3QVKA 2B3DA 4Y9UA 4Q93A 1FU7A 2JGEA 2OQIA 1GIAA 1NAIA 2CBGA 4S1TA 2Q3CA 2I6QA 2NZJA 2XSZD 3DSRA 3TMKA 2A5FA 1N4DA 3HJRA 4PSUA 4UBOA 3WRYA 1IBMB 1U4NA 3V3TA 1N57A 3PEEA 2GAOA 1ESMA 2I3AA 5EHQA 3R3YA 3PFNA 1ZMTA 4IUYA 5FWXA 2GEFA 4WI1A 1UEJA 1YJAA 3SHVA 4TMVA 3IAS6 4JJAA 1Z4PX 5CHYA 3TZQA 4EUFA 4FZJA 1Q7RA 4PYOA 4QBKA 3O4JA 1UJ2A 4RD4A 3LLVA 2V7VA 4I8XA 4QGAA 2H2IA 4BO6A 3MUOA 5I4CA 5AI6A 1YVRA 4C01A 1YRYE 4RGVA 1MB3A 3IAS1 4ZEMA 1DEHA 3GW8A 3EFBA 4I5IA 3BXGA 4ZCRA 4N9WA 3RASA 3Q0TA 4Q1DA 4UQLA 1VPWA 2WAAA 2H1WA 2FSHA 4RHXA 5F1OA 2OBFA 4BS9A 1Z4KA 3LK7A 3R5SA 4PF1A 1ML3A 1NW4A 2GAAA 3EDMA 3IELA 3N9IA 1ZC3A 3G9UA 1IY1A 3EEYA 1T8PA 3PNLA 3FYUC 3U26A 5AJVB 5EPOA 1KEEB 3T3DA 1DUSA 4X20A 2Y1KA 3PFIA 4EF4A 3RUHA 3MS4A 3LY5A 4GDMA 4B3GA 2FZWA 1BW9A 3T3MB 2BGJA 3R3XA 2FETA 1G1AA 3V2HA 1BJRE 1KFKB 4EQ6A 4IIGA 1HLFA 1S1MA 1EGQA 2QDKA 2IHBA 5JADA 4F4DA 2DUNA 2WG1A 5K3AA 3S5JA 1UAAA 1VPDA 2G06A 1LW6E 4FR2A 2PGAA 5K01A 3ICEA 3HGQA 3LLSA 1ISMA 3M83A 4RHUA 1ECCA 3CRNA 5G40A 4KRXA 4RA9B 4LTNA 2K4MA 2X5OA 3BHNA 4R9VA 1M2GA 1N6NA 4FGKA 3VPXA 3LW8A 2VHZA 4D9NA 1FYXA 5JS8A 1ZN8A 3TZKA 4ROTA 3PHGA 1CZOA 1QM5A 4B34A 4CUKA 1V8PA 2PSSA 3BA1A 5DMXA 5JPDA 1O4WA 3ETGA 4O08A 3STYA 1KJNA 4Y67A 1T0IA 2QVLA 1RWQA 4MUXA 3VH3A 1DI0A 1L1EA 4GPEA 4R68A 2EATA 3FETA 3KJEA 3WOVA 3ZGXA 4CR8A 1TPZA 5TX7A 3HTXA 2OTCA 1KQFA 3O8RA 3EH1A 1AKUA 4PX5A 3E9DA 1JDPA 1D07A 3HKBA 3QKIA 4KU4A 5CNKA 3U49A 3CRZA 1ZVJA 3NHMA 4IGAA 4QC2A 4AD8A 3PCTA 3TTXA 3EIXA 3DJYA 3MUEA 1LX6A 3IAXA 1ES9A 3UNXA 1NXSA 3I28A 3VDNB 3C6XA 4J43A 2NWQA 4YACA 5HJ7A 2TYSB 2O6LA 2QZ9A 1S3SA 4ECAA 4MGKR 3ZWWA 4KKVA 3KKZA 2VI5A 1F20A 1YJ8A 2IVZA 1AKWA 2MR5A 2WT9A 3EDRA 3QNMA 3MJVA 3H16A 1WHTB 4Z4QA 2B9VA 3CLRD 2FWJA 1R9GA 1UBNA 4AY4A 2VHQA 1W8IA 4CLEA 1F0KA 3MRXA 3OJLA 3QPCA 2V4MA 2HDHA 3KYCB 3RIYA 4L0CA 2ZGVA 3MGBA 2PX4A 4D3ZA 3RBAA 3KJQA 4OQPA 3CTMA 1DELA 2WIGA 4AMVA 1JDUA 3U62A 3DLPX 4CM6A 1PHRA 1WZNA 1YBFA 2IQ5A 3HB9A 4G1MB 4S1WA 4KGXA 4BV9A 4EJ0A 3HCOA 2W4QA 4TRRA 3BJRA 1QRDA 3CRMA 3NIDB 4JT8A 1N6LA 3NDPA 2LZ0A 3ZQKA 3UJDA 4DNOA 3WXBA 7REQA 2FMUA 2WAMA 2IUEA 4EHDA 2N9UA 4LGYA 3COPA 1N6RA 1WR8A 4KR0A 5FOUA 4M0FA 5TGTA 2GAFA 1NQ5A 2YWBA 3FNBA 2WWXA 3LZCA 3PA6A 4HDNA 1FSPA 2DE0X 2Q5HA 1DLIA 3BILA 1YB6A 2AEFA 1OWPA 4OHVA 1H1LA 1QCYA 1Z16A 5I8PA 2XDYA 2QJRA 3GGOA 2BE7A 2HDNB 2PEYA 3JYPA 3LP8A 3N2EA 1R7RA 3QVJA 4FFMA 4V3BA 5FHQA 2O3UA 2QQFA 2J3QA 3C41J 1LNSA 2JFNA 2AE1A 3MW8A 1P7PA 2QL6A 4HNVA 2NU8A 5K7SA 2ZW9A 1R2QA 1Q2XA 3OEHA 5BNIA 4K87A 2VPPA 2PTGA 2YVQA 3FHJA 2AXPA 3PD7A 3L7JA 1GZ5A 4F5ZA 4RH0A 5KTOA 1H5NA 3IP1A 3NTQA 1URPA 3O0TA 1GKLA 4CF7A 4NH0A 4P93A 1I7DA 3BCHA 3ZKWB 1RKVA 3X1XA 3HB7A 4KOAA 4M1YA 2H65A 5A02A 1XQVA 2AXQA 3GLHB 3UWMA 2BH9A 4Q4DA 3DHVA 2BELA 1YJXA 4AKTA 4FMPA 5FTNA 4BMNA 4UM9B 4IDPA 1IYZA 1QLHA 1A7JA 4C0LA 1E5QA 3WA6A 3WKDA 4HXGA 4K28A 1XZKA 2GZMA 2CUNA 1W1IA 4F45A 3QYFA 4GSYA 1SBCA 1IVNA 2Q50A 4R31A 3BDVA 1SUWA 1C3OA 4CU2A 3E22A 4AN0A 2O2YA 2Q5LA 4BKOA 2R5NA 2VDUE 3I0MA 1ZRSA 3TI9A 4OHXA 5F1YA 5JY1A 4HX5A 4XR4A 4E07A 5FWYA 4KW7A 2OAEA 3H2GA 5FD8A 4Y6GB 3EVNA 2MJLA 3LIIA 2A0YA 1IEXA 4P3OA 4N5IX 2IYFA 3JWPA 1OFUX 2AQIA 2G25A 4RV5A 5C3UA 4X6YA 4W8OA 3TAXA 3AR3A 4EHHA 4I9FA 4LE2A 3VDXA 621PA 3ADBA 4DLNA 4MX8A 3PUZA 4M9CA 1Y8QA 2BFDA 4YREA 1N2CB 3OF5A 5ADHA 1NG1A 2P77A 5EGSA 1L7BA 1IONA 1C30A 4Q3LA 4X61A 3DAYA 1E5XA 4R9RA 1XAGA 2X0DA 1GITA 3FZYA 1KQPA 4UTZA 1SBIA 2BM9A 3FUCA 3TQCA 3CLRC 1D04A 1SCUA 4DR2B 1YZNA 4Z9XA 1RYDA 4L51A 1EFPA 2BFFA 3B60A 1RDFA 2QTMA 4J0JA 1NJSA 1RXEA 4GH5A 1J07A 2XITA 4G1FA 3AIMA 4N7JA 4LYJA 3KC2A 3SEZA 1QHXA 4LJRA 1ONBA 1PZNA 1UC9A 2VP6A 4Q18A 5CFNA 5JJBA 1T8TA 1MJGM 1ZITA 3K2BA 2ZU0C 2HGSA 1P6UA 3I2FA 3GMIA 1J1ZA 3HR8A 3JWEA 4N76A 1B6RA 3LWBA 2BBSA 4GC5A 5B57C 2HSEA 3W1VA 1TAUA 2IUYA 4WZAA 4YRGA 3Q6NA 2C9CA 2CVFA 2AOTB 4Q4HB 2P2YA 2R6CA 3ONDA 4TGLA 5F7JA 5CIWA 3K1JA 4M1SA 2BMDA 4D4JA 1AO3A 2C5SA 3LGXA 5BMOA 4BNVA 1KHHA 3ONNA 3MK31 2YWRA 3C8HA 5E2BA 2DHDA 5JAQA 2IA5A 3B7WA 3GT7A 1IH8A 2OWDA 1VSTA 3TE6A 3T3GA 3K0SA 4G0ZA 4YAFA 4QLAA 3STWA 3CZQA 1IQUA 1H0HA 2C4NA 1G21B 4D57A 4EFKA 2HRBA 1TM1E 4CTNA 4RU1A 1HFJA 1K0FA 4HQKA 2CJYA 1R0XA 4NAUA 1IEWA 1MHPA 4MVJF 3UK0A 1EWRA 1QPGA 3CX6A 4HO1X 4ZAXA 1HTWA 4QA9A 2WV7A 4BO7A 4H1HA 1OI3A 3MWYW 3UW1A 3WGNA 2PUFA 4FXOA 2GVZC 2ZJAA 4TXJA 3DW3X 2PMEA 2XNJA 4J91A 4GI3A 4KGVA 4TL6A 5DK6A 3WB0A 3ZLBA 1D2EA 3QBVA 5E7MA 4YRCA 5IDYA 1KC3A 1ZSNA 4LJAA 4X6UA 4GS5A 4D4LA 5AVUA 4H0FA 2B9EA 3V4RA 3MA0A 4B3FX 5KJCA 1NIPA 1A9TA 1E2FA 1NVTA 3Q88A 3LUDA 2D8MA 1DQZA 3U4IA 3KV1A 3RC3A 5BOVA 5GPBA 3Q7PA 1CDZA 3QLEA 2JJ8A 4I1RA 3PXCX 5BWCA 1O96A 3FVRA 2IHJA 1E2QA 1FP2A 1R10A 3HHPA 3OTQA 3PXXA 3W4JA 4AJ1A 4UHBA 4DA7A 2EFJA 3DE1X 2QPOA 4IIVA 1WUHS 5CT8A 1D8TA 1WQ4A 3T9BA 2WYUA 3EQ9A 4FSXA 4AO8A 1JQJC 1JKIA 1XAJA 2QTZA 2WC1A 4QGBA 1NI5A 1O08A 3OZFA 4KAXA 1P17A 1YJCA 3IV7A 4L8GA 3NETA 4TM7A 1PGOA 1Z28A 1SEPA 5TJHA 3U5ZB 3QU4A 2GNPA 2HSZA 2OHJA 1SHZA 1T3TA 2Y6UA 1P18A 1VKOA 2GRUA 2WAOA 2BFBB 4I50F 4UE3S 5JAZA 4EPWA 4ITVA 3CZMA 4BX2A 3FZNA 3SQMA 1MTZA 3CO0S 1M6NA 1GPH1 2PKRA 4LOKA 4M2LA 2KLBA 2V0NA 3K0FB 4J1QA 1A82A 1RJWA 5KU1A 1S9HA 2YNMD 3OC6A 3JYNA 3HA5A 3HFSA 2W2TA 3LC0A 4L15A 3GMDA 4LYAA 3WGOA 4F6RB 5T7BA 4R69A 4W5NA 1LFDB 4Y2XA 1GG5A 4AJ9A 3JD4A 5KWIA 3DEKA 1V95A 2WOOA 4RK7A 1O6BA 4EBBA 5EHZA 1QO0A 3AIIA 1X9HA 1NRJB 4DR5B 3DE6X 4POOA 1T2NA 3OTHA 5CVDA 2E3JA 2QSZA 2DQKA 2XMQA 1P7YA 4Z54A 5L7TA 1KXJA 3BFKA 3SEQA 3U0VA 3A6PC 3KSUA 5B37A 1E2LA 1G7SA 1YUNA 3MINA 4GGOA 2KHZA 2CF6A 2TRSB 1W1UA 2WJJA 3B20A 3CX7A 4I55A 1N2CA 2PR7A 2PVSA 4TLMB 5JSKA 3NDBB 5TPZD 3A1SA 2ORED 1JAXA 1ZJ6A 2DPYA 1H2ZA 3T35A 1GGNA 1H5UA 3LWZA 1P4SA 3D0RA 4MV4A 1K6JA 2GEDA 3T52A 2E9SA 3JWHA 3L5KA 1KJ9A 3P4YA 1SD2A 3HB5X 1L8LA 1KVRA 1O6FA 4BMOB 5CDFE 1VE5A 2HMSA 1P74A 2Z30A 5IZCC 3VOTA 1PJLA 1NNLA 3WZMA 3BTOA 3QPBA 4OAQA 4D3FA 2JARA 1HV8A 1WXEA 1RBZA 4ROSA 1R4NA 3DGFC 4TUYF 3TM4A 1VE3A 1U8AA 6GPBA 1N3IA 4JASB 3WMWA 4P7KA 1CEQA 1MO3A 2TMGA 1FTGA 2QAJA 4P92A 5FFMA 2HA0A 4ZDKA 4G86A 5DM60 1HQCA 2OL4A 3RH0A 4EMUA 3GV0A 4JQOA 3WS7A 4JVNA 2B2CA 4UNPA 1NM5C 3UA4A 2CEKA 2CJWB 1DCFA 5MFZA 1M2NA 4LJ5A 3VTAA 3SM3A 3W6OA 2XKBA 3GMTA 2JK0A 3PP8A 4HN9A 2YXBA 4IDEA 3ZXIA 1WMEA 4AUMA 2DU8A 4KO1S 3L8ZA 4KQKA 4PVCA 1I8TA 4QOSA 5JJ5A 4IINA 1CQZA 2A35A 3NBFA 3P2JA 5D8DA 4N49A 3KQMA 4G36A 4JB3A 1FOEB 1QG6A 2QN2A 1GQFA 3H4TA 1XO1A 2QAGC 3W8RA 5IJ9B 2JIDA 2J0UA 4XWTA 3EC7A 4JDPA 3WTCA 3UKOA 1P9NA 3H86A 5FA8A 5JLAA 5T57A 1E7WA 1CG6A 5BUQA 4XFDA 2V45A 5EE9A 5K6AA 1YK1A 1L3IA 3BOSA 2WDZA 2C61A 4EUNA 5I3CA 1E1DA 3QA9A 1EXDA 3HV0A 1BD3A 4GP9A 2YCBA 1XL1A 4RV4A 1L5RA 2I65A 3C3EA 5HK9A 3UXYA 1CSEE 5DEIA 3WAJA 4G56A 5G4KB 3MD0A 4LF9B 1K7FB 3KO8A 8MHTA 5EJFA 5FFNA 3H9JA 3OWOA 5CEEA 1XXHE 4Z2YA 4COKA 4NBRA 1DKMA 2P1DA 1R00A 3N2KA 3BGIA 4L4YA 4PCVA 1TUGA 2VNHA 5BV0A 2ZVDA 2B8NA 2QLJA 1R5JA 3HU2A 4QVGA 1RRCA 2GD0A 1EA5A 2Z2ZA 5EWMB 3NQ41 2PT9A 4FTWA 4W9MC 3IOEA 3NKFA 2YWHA 1HNZB 3FSGA 3AY0A 4RIGA 4WN9B 2CXXA 3UUWA 1XVAA 1PJ4A 3L5OA 2AFHB 3WIVA 4TLEA 5JMTA 1XK6A 1E94E 1JYFA 1KDZA 3SMVA 2A1TS 3ASYA 4ARUA 3ZBUA 2CW5A 3M4XA 2V7EA 1O2DA 2CVOA 3A70A 3OF3A 2I1QA 3AUSA 3IAM1 1IN5A 4XYBA 5DHSA 5HGJA 4HXEB 3RK0A 4OJMX 1H69A 1Q50A 1XA0A 4I99A 1L8XA 1A2QA 1EB8A 3PDIB 3QU5A 3N87A 4YJFB 1QH9A 3SPXA 3CXRA 1SRRA 3JD3A 4PS0A 1X39A 4XOUA 1TZBA 3FTNA 5KQPA 1ZM7A 5G1NA 4WXPA 2YY6A 3AV3A 3DV2A 1DBRA 4BNIA 2HHJA 1ZIPA 1AF7A 4OKIA 2DP4E 2C83A 1WNFA 1XB2A 1FQKA 1UPXA 3QKSA 2BGGA 1KDTA 1D9XA 4NJMB 4LHXA 3RQIA 3K71B 1GQOA 1U0EA 3P27A 3QG1A 3LKZA 3FUXA 1XROA 3Q2IA 4GXQA 1FNCA 1W4LA 3Q12A 3QF7A 4LRWA 4IDHA 2OQVA 4AU1A 3VA7A 3ETHA 5NULA 1J8QA 1YRLA 2Z83A 3UENA 4ESHA 2Y77A 1EDOA 4S12A 4QDKA 5JI2E 2ZB3A 3OX4A 1V7QA 1NA5A 2P9HA 1FK8A 2IEDA 3EGDB 1MX3A 1PT8A 1NBMA 2IP2A 2XVXA 3CF6R 1GPKA 1QQ5A 3Q5EA 3PUXA 2M32A 5SV2A 5A1TA 2Z9CA 2LIPA 2YHBA 4BQOA 4CKCA 1FA9A 2PZJA 2VJNA 1BXZA 1G98A 1CUBA 2C96A 3KQTA 4HDKA 3L49A 2WKPA 4RZQA 3SSAA 1V2GA 5EL0A 3TLCA 5IH7A 4GXRA 4TSRA 3I30X 2V54A 2VJKA 5JBNA 1FXWF 2C8JA 2IYXA 4KSCA 4Y9TA 1OR8A 1QFZA