3QMMA

Structure of 6b, a thermostable mutant of bacillus subtilis lipase obtained through directed evolution
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
179
structure length
179
Chain Sequence
HNPVVMVHGIGGSSSNFEGIKSYLVSQGWSRDKLYAVDFWDKTGTNYNNGPVLSRFVQKVLDETGAKKVDIVAHSMGGANTLYYIKYLDGGNKVANVVTLGGANRLTTDKAPPGTDPNQKILYTSIYSSDDEIVPNYLSRLDGARNVQIHGVGHMGLLYSPQVYSLIKEGLNGGGQNTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lipase estA
publication title In vitro evolved non-aggregating and thermostable lipase: structural and thermodynamic investigation
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
total genus 68
structure length 179
sequence length 179
chains with identical sequence B
ec nomenclature ec 3.1.1.3: Triacylglycerol lipase.
pdb deposition date 2011-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01674 Lipase_2 Lipase (class 2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3qmmA00
5JD5A 4W1QA 1CUYA 2OLEA 3RARA 5CTAA 2PSEA 1L7RA 2CB9A 4BDSA 1W75A 1USWA 1YB6A 2GYWA 1XLWA 3CXUA 3B12A 2EEPA 4LHEA 1ETHA 3IUNA 3M81A 3HXKA 2QR5A 1HQDA 3L1JA 2BGNA 2JGFA 1XZMA 1DQYA 2K2QB 3DQZA 4ARBA 4FLEA 5ALWA 3ZV7A 3CN7A 3H2JA 1UXOA 4AO6A 3ESDA 3BJRA 1X2BA 3BF7A 3E0XA 4G8BA 4FOLA 4U2DA 3F98A 1YAJA 3NOXA 4EZIA 3GZJA 1MX9A 4KE7A 3WMRA 2WHRA 3H19A 4WDQA 5BWCA 4HAIA 5HZGA 1HL7A 5IH7A 2VAXA 4UHBA 2ROQA 1YS2X 4DYHA 1ZD4A 3C5VA 4BBZA 5AK4A 4X6UA 5ALIA 5JASA 3DD5A 5T4HA 5IVKA 1QLWA 3WL8A 4K5QA 4Y2UA 3I6MA 3JWEA 3STXA 4EY5A 1XRLA 5IVHA 1E5TA 3O4JA 3H2KA 4N5HX 1UWCA 1J06A 1MNAA 1JJBA 3G9ZA 4B9AA 4MWTA 1UKAA 5A62A 4NZZA 1EA5A 1BS9A 4OPMA 3HI4A 4W63A 2OCIA 2QXUA 4GWLA 4F21A 1FFCA 3OPMA 4TGLA 1VA4A 1UK9A 1UOOA 4IHAA 1QOZA 1TCBA 3HSSA 2XQJA 1BEZA 4WDRA 3FLBA 3NGMA 3HJUA 3FAKA 4U2BA 1WOMA 3DLTA 3QPAA 3WK8A 4QWMA 1KU0A 2DSNA 2RIPA 2R8BA 4C87A 1CV2A 1QIDA 1SCQA 2OQIA 1LPMA 1CUZA 5FV4A 4DNFA 2OCLA 4UBKA 3C6YA 5BOVA 2HU7A 1X2EA 4OD0A 2ACEA 1U2EA 1YAHA 1I6WA 3W9UA 3VXKA 3WKAA 4BZZA 1LZLA 2XDWA 4Y2TA 1EH5A 4B7ZA 1IUNA 2WJ3A 5FDFA 2PL5A 3WLAA 5A2GA 4DM7A 5SYMA 3D3NA 4K2AA 3G0DA 1CUGA 3O9MA 3FBWA 4W1SA 3AILA 2DHDA 2PSFA 3ZLVA 5HFAA 5FXMA 1TAHA 1AZWA 2G4LA 4XVCA 4J0KA 2R11A 5LZ2A 1ISPA 2PUHA 4IH1A 2CKMA 3C6XA 2XMSA 4JUIA 2BJHA 5EHNA 2WIDA 5CH5A 5AI5A 1AURA 3ICVA 1JFRA 3QYJA 2ZSHA 4JYPA 3C87A 2H1IA 1XQYA 4B6GA 3TEJA 3V1NA 1P0PA 1MX5A 2WUEA 1O6GA 3AZOA 1ZJ5A 3WL5A 5LZ7A 2C5FA 5AOBA 4UFNA 5JYCA 4H7IA 1ZD5A 5K3EA 5ALUA 3T4UA 5HF8A 2DQZA 1CR6A 4U2CA 5T4EA 2B4KA 2ECFA 1THGA 5CXXA 4XJVA 1ZIYA 2JGLA 2VSQA 2O2GA 1BROA 1EINA 5D3KA 4CG3A 1XRPA 2QT9A 5A6VA 1D07A 1F8UA 2CZQA 5AKJA 3WKBA 3C43A 1U4NA 4L3WA 3WIOA 4A16A 4Y2XA 5EIEA 5FKJA 2WHPB 3IULA 3F67A 3C6BA 2OQVA 4RNCA 1CUWA 1K5PA 2B20A 4MYDA 1FFBA 3UUFA 1HLGA 5JADA 3DS8A 4ZGBA 3HYSA 1BCSA 4UHFA 1P0MA 5C8VA 4G4JA 1DT5A 4CG2A 4KR0A 4QLAA 4N8DA 3OOSA 1ODCA 4X92A 4X91A 4J03A 4DTCA 2HA2A 3FCYA 5AIBA 4DGQA 3VJLA 1QIIA 3DJYA 1JMKC 4KE6A 3LIPA 4Q82A 1BEEA 4Q05A 3O4HA 1GGVA 5AKLA 2HA3A 4BRSA 5ALXA 1MU0A 5ESRA 5JAPA 5C81A 4I19A 2WG1A 2Z8XA 5JD6A 1CUVA 2RHWA 1YCDA 3R3VA 5AKZA 4N8SA 1R3DA 4B9EA 2XUOA 1LPNA 5AM1A 3EBLA 3V9AA 4DLNA 3C6ZA 2DHCA 2HA7A 2XUJA 3QMVA 1A88A 2QZPA 5AK3A 3RKSA 4EHBA 1FFAA 2AJCA 3BWXA 2DQYA 5HK9A 5AH0A 5HQ3A 1TKRA 4KRXA 1EK1A 4AXBA 3G0IA 1RYYA 4U2FA 5K5EA 1W6RA 1ZI8A 2VAVA 1H23A 3EF3A 1SOMA 2Z3WA 2JEZA 1HKHA 4Q3OA 5JATA 2C4HA 2WFZA 3ZI7A 3VJMA 1CQZA 4E15A 3D4LA 5CT4A 3I28A 5HK8A 5BWBA 3L1IA 4BCCA 2HA0A 5CW2A 3LP5A 1R88A 5DNWA 4EA6A 3DEAA 3VISA 3F96A 2H7YA 2VT7A 4ITVA 1IUPA 5AICA 3G7NA 4HRXA 1R4ZA 3FVTA 4YASA 5ALVA 3STVA 4IH9A 5LIPA 3R3YA 1GKKA 2WU3A 3VJKA 3TRDA 1MTZA 4HXGA 1QIEA 1P0IA 1XZHA 4K6GA 1CUUA 2BKLA 3WWPA 4QDOA 4LKOA 4P08A 5D6OA 1AGYA 2HU8A 1EXWA 2VATA 2WFMA 1T2NA 4FDMA 1MNQA 4BVLA 5E4JA 2PKYX 3BDVA 3ZLTA 5JAUA 2XE4A 3GBSA 3EQ7A 5LZ5A 3R0VA 2OGSA 1G4HA 3MVEA 5AKKA 5A7HA 4MYSA 4J0IA 2OAEA 5AI8A 1W1IA 2YYSA 1XZIA 2PUJA 4L0CA 4LXGA 1AC5A 2ZYIA 3PF9A 4EY8A 1WM1A 2VJDA 3S2ZA 1JKMA 1AQLA 1NU8A 5JZ9A 4FTWA 3W06A 3Q0TA 4ZXFA 1ODSA 1Q84A 1XZFA 4EY7A 1BE0A 5KWJA 3I2IA 3RK4A 2AJDA 2IX9A 1JI3A 2VEOA 3B3QA 4Y2VA 3GFFA 1Y7IA 3WKDA 5AM5A 2Y2VA 2Z3ZA 3BXPA 3FYUB 3ICWA 5AKXA 4C01A 2VQ6A 4J7AA 5ALSA 5AKYA 4DSZA 5JANA 2QVBA 1JU4A 4PNZA 4P92A 3WWEA 1Q83A 1R50A 1QIFA 2XUFA 3FVRA 5AP9A 4BB0A 2ZJ6A 4WFIA 3W04A 3BJMA 1EHYA 2WKWA 3QMMA 3WA7A 3WWOA 2HU5A 1GPKA 2JGJA 2XUHA 2VJCA 5HQ3B 4KAAA 2C0QA 1AUOA 4C4XA 3AIKA 4PQEA 1NU6A 2LIPA 3AZPA 1LPPA 4GDMA 1EDDA 4X6YA 2XMGA 5EGNA 4X97A 4KRYA 4BZWA 3IBTA 1THTA 1CEXA 3DYIA 2V97A 4BTLA 3I2JA 3DOHA 1VE7A 4NS4A 5HF5A 5BV7A 1XRNA 1BRTA 1QE3A 4X71A 4FLMA 2OCGA 1ZI9A 1TCCA 3O4GA 4MQMA 3FYUC 4BAUA 4UHCA 4GECA 4HS9A 4GBGA 1C7IA 2Y1KA 1RWQA 4FBMA 4BP9A 2ACKA 1QTIA 3I2KA 5FOQA 4H77A 4J0HA 5AI9A 5C8XA 1QIHA 2YH2A 1FSSA 4HXEB 4J0DA 5JALA 1CVLA 1GQSA 3EIOA 3IUQA 2WUFA 1U8EA 2C58A 3KWFA 1K6EA 2QUAA 4O08A 4A23A 4G4GA 4RPCA 3ZLUA 4UFPA 4GLBA 1QJ4A 4DSAA 2ZYSA 5HKBA 1AMNA 1GQRA 2H7XA 1EDEA 1GKLA 3C70A 4UHEA 4J0GA 4G1FA 3HACA 3ZWQA 3WZMA 2HM7A 5E2IA 1CPYA 1LGYA 2PM8A 2WQZA 1TQHA 4B82A 1YSCA 5T4FA 3SX4A 4W1RA 1A8UA 4X95A 2J3DA 4Q3KA 4B85A 3DYVA 3IIIA 2PX6A 5HKAA 2HIHA 2QUBA 1BCRA 4FNMA 2WG0A 1MX1A 1ZOIA 5EI5A 3FLEA 4FMPA 1DX6A 3IB3A 1IZ7A 2XB6A 4DNPA 2WHPA 2ORYA 3MUOA 4FBLA 1CQWA 3MUNA 4LYEA 6YASA 3N0TA 4QE3A 1CUXA 5AO9A 4B83A 2OGZA 3WI7A 3DKRA 4I3FA 5IVIA 2I78A 1MAAA 3SC2A 2ZSIA 1MT3A 2BUBA 1XQXA 3S8YA 1FFDA 3O0DA 4FKBA 5ALPA 3WK4A 1VE6A 3FOBA 1T4MA 3BIXA 3WK7A 2XUIA 3VKFA 2BGRA 4QDXA 4GW3A 1N5RA 4DNOA 4WCVA 1W52X 3IVMA 4GXNA 5AI4A 3D5EA 4V2IA 4ZV7A 3PFBA 2JGKA 3G0CA 3C5WP 4UBNA 3NUZA 4QDUA 3WL7A 1VA5A 2I03A 3I1YA 2VJAA 1XZJA 4H18A 5F4ZA 2VF2A 4P93A 4DIUA 5AM0A 3H18A 4OU4A 1UOPA 4UHDA 1TRHA 2J4FA 4W1PA 5K3AA 5YASA 1DQZA 3IUJA 3R41A 5LZ9A 1OCEA 1ACLA 2XMBA 2OXEA 2DFPA 4MWSA 3DL7A 1CUBA 4PV7A 3PDCA 2HA4A 1GT6A 4DMFA 2VJBA 2GZRA 2Q0XA 1QGED 1XLUA 2FJPA 2OGTA 1VZ2A 5E4YA 3OTQA 2HRRA 4EBBA 4WY5A 4KEAA 3WQHA 2D0DA 3A2NA 4KE9A 4YX9A 5ALJA 1XRMA 4ZRDA 1ZD3A 5AKEA 4AO7A 2WM2A 4Y7DA 4TPKA 1Y7HA 3OG9A 3WWCA 1DWOA 4X93A 4D9JA 4BDTA 3WK5A 2H7CA 5C8ZA 1G66A 4C88A 5ALNA 2PPLA 4OB8A 1H2XA 4BATA 2OCKA 1H22A 1QONA 1N5MA 2IIVA 3HABA 2BUCA 3R3WA 1TCAA 1A7UA 3AZQA 2XUDA 3DDUA 5DLPA 2W22A 3BIWA 2GBGA 1SFRA 4JNCA 3ZPXA 4B80A 4WY8A 2WIJA 3QPCA 5ALHA 4HTAA 3IA2A 3N2ZB 1HPLA 3P2MA 1UFOA 1DTEA 4JYMA 3WIBA 1YB7A 5AM2A 3I6ZA 2G63A 1NX9A 3K6KA 4H7HA 3WJ2A 4XWGA 3H2HA 3A2LA 5ISMA 3D2AA 5K3FB 4QWWA 2PSJA 5J3JA 3FSGD 4F0JA 1M33A 2Z5GA 2VT6A 3T52A 1E8NA 2QJRA 1QO7A 3WZLA 5AM3A 4UBIA 2ZJ7A 2Z8ZA 3FYUA 2WUDA 1ODTC 4ZV9A 4AMYA 1DT3A 3PE6A 1FJ2A 2QM0A 4E11A 1AKNA 1QFMA 4J0JA 1ZIXA 2CJPA 3NWOA 3EQ8A 5T4BA 2G5PA 5ALDA 5K3CA 4H35A 1WB5A 4H7JA 1ZGBA 2OPHA 3X3HA 4K6KA 1ZI6A 2WJ6A 2B9VA 3FCXA 5CRIA 3A2MA 2GBIA 1BN6A 2X76A 1EVQA 5HCUA 1N1MA 5A7GA 4FHZA 3PICA 2RI6A 4X00A 3D2CA 1FFEA 3F9CA 5AOAA 3FSGA 4WJLA 2JGMA 2DR0A 3R3ZA 4N8EA 4BYMA 3D7RA 3V48A 4BE4A 5K3BA 1QZ3A 1EB9A 2HA5A 4OUKX 2XT0A 5CH3A 1UK6A 5ALOA 5SYNA 4AO8A 1XLVA 2JGIA 3R3UA 1VXRA 2EDAA 1S8OA 4BC1A 3U1TA 1K4YA 1R9MA 1SC9A 4EY6A 1Y37A 3WA6A 4MQLA 3E3AA 4QEKA 4ROTA 5ALEA 3M3DA 2QOEA 3GELA 1MAHA 3LCRA 4Q3LA 4OB7A 1UT6A 3LLCA 5E4TA 4ETWA 1HBJA 5ALGA 1WHSA 5EFZA 4CIBA 3W9BA 1CUJA 2GZSA 3GUUA 5C7YA 3STTA 2JGEA 4AN0A 2PBLA 1YA4A 5FRDA 1GZ7A 3DCNA 3G9XA 1U65A 4H7FA 1WCYA 4AN1A 1GXSA 4Y2JA 4U2EA 3B5EA 4BRZA 4UBLA 1YR2A 1EB8A 3K2IA 4B0PA 5AIAA 1CUIA 4I4CA 1P0QA 2G5TA 2D5LA 2AXEA 2XUGA 2ZJFA 5EHZA 3VVMA 3WK6A 2O7VA 4E14A 4XX1A 2AJ8A 1WB6A 2XMCA 2EDCA 4UBMA 1EVEA 1L7QA 2WHQA 1X70A 2XMRA 3D0KA 5LKAA 2CBGA 4QDZA 2QKYA 2QTBA 3I1IA 4X6XA 2WTMA 1CIJA 4B84A 2XMQA 5CT6A 1G5FA 5HF6A 2XMZA 1UZAA 4HVTA 2WIFA 3L1HA 1IUOA 1XRQA 3HZOA 1XQVA 4KYVA 2BFNA 1K8QA 2CUTA 2RHTA 5AK5A 2W6CX 3QITA 4BAGA 3LS2A 2HFKA 4PSCA 4M0MA 1YS1X 3PUIA 3QVMA 4CI9A 3DOIA 2WLSA 1XROA 4F5ZA 1F0NA 2ZYRA 1JT2A 2WSLA 5FPPA 4G8DA 3AIOA 5LKRA 3HRHA 3UMJA 2IITA 2ES4A 3M82A 5HFNA 2V96A 4X7BA 2XUQA 4X85A 5EIHA 1C4XA 1XKLA 1MJ5A 2HFJA 5H3HA 2CEKA 3QM1A 4LXHA 2HHAA 4CFSA 2XI4A 1H2WA 1BU8A 2OAGA 1YA8A 3MGAA 1XRRA 3PF8A 4Y2RA 2WG2A 1JMYA 2QRUA 1WPRA 1KEZA 2B61A 5HF9A 1CUDA 5DWDA 2JEYA 3DKKA 4MXDA 5DNVA 3O95A 4KAFA 2ZYHA 4IH4A 1VKHA 2XQGA 1CUCA 2VTVA 4DMHA 1MO2A 1XZEA 1Q0RA 5CT5A 1XZAA 3JYHA 2UZ0A 3AINA 3G8YA 3G02A 1E89A 5AI6A 3G0GA 4LIPD 1JJIA 4Y2QA 5AI0A 2GBFA 3QZUA 1XZDA 3M83A 3KDAA 4UHHA 1VLQA 4X90A 5EHQA 5JIBA 4E46A 3V1KA 4RE6A 2BAGA 4FFWA 2RAUA 5KWIA 2C5GA 2JBWA 4PW0A 2WFLB 2BUAA 4H0CA 1DX4A 3ILSA 4C89A 3ED1A 3STUA 3ESAA 1IVYA 4JEIA 4RGYA 1XZCA 2X8BA 2JF0A 3R40A 3AIMA 3A70A 1DU4A 2HL6A 1J07A 4BC0A 1PJAA 3WJ1A 3YASA 5FP0A 3W05A 5LZ4A 1LPBB 5ALTA 3AJAA 4H7DA 2FX5A 4IQ4A 5DYTA 1QIMA 2AJLI 3E4DA 3CN9A 1JU3A 1F6WA 4DMCA 3U0VA 1K63A 1E8MA 1E66A 1QFSA 2YXPX 1LZKA 1XZKA 3H2GA 1UKBA 4L72A 4INZA 4GI1A 1YASA 2WIKA 3I2GA 2I3ZA 4BE9A 3TJMA 1ZJ4A 1B6GA 2J4CA 2WILA 5AHXA 3O9VA 2QMQA 3V1MA 2V9ZA 3ANTA 4NVRA 5K3FA 2FUKA 4EB0A 4BP8A 1G42A 4BAZA 3GA7A 2E3JA 1L7AA 4CIAA 3E1GA 7YASA 5JD4A 4OYLA 5DNUA 1DWQA 4WFKA 1B41A 1R9NA 3KWJA 3VDXA 5CT8A 3C8HA 3V1LA 1MN6A 2HA6A 4AZ0A 1IZ8A 3BF8A 4QA9A 3D59A 4J0CA 1XZLA 3AUKA 4GHWA 5I8PA 4ARAA 3G9TA 1SCIA 4IO0A 1ZD2P 4MJ3A 4A5SA 1QTRA 4K6HA 4JH0A 4CCYA 5LP1A 3VVLA 1QIGA 5IKXA 2YASA 1ACJA 5ALFA 1R1DA 4Q34A 4GEGA 2I3DA 3QMWA 4C4YA 4PF1A 4AQDA 3RM3A 3PFCA 5AOCA 3Q8WA 5A7FA 2Y6UA 3H2IA 4H7EA 5CXUA 4DMKA 4FNGA 4BVKA 2WU4A 5LLSA 5CURA 5FLKA 2NW6A 3WWDA 1BN7A 1EK2A 1AX9A 4KJXA 5KREA 1ZICA 4UBOA 3EQ9A 1W76A 1A8QA 4BCDA 1QIKA 4QLOA 1ORVA 4CG1A 1LBSA 4B0OA 1XZBA 5ALMA 1EI9A 1CUFA 4L9AA 2QS9A 1XKTA 4OSEA 5JAOA 4WFJA 3G9UA 3BL8A 4HRYA 3ESCA 2BCEA 1OILA 3UUEA 1QO9A 5AKIA 5JZBA 1CFJA 4LYDA 4Y2YA 3OC0A 4EY4A 5ALQA 1MPXA 1LBTA 4AB1A 2PVSA 3H0CA 1GPLA 4PO3X 1EDBA 1CUAA 1DWPA 3QH4A 4H7KA 4OCZA 4PSDA 1UOQA 5EHXA 3KD2A 3H17A 5AKHA 2FJ0A 4U2GA 4FWBA 2PSHA 4Y2PA 5CH8A 1VOTA 5JAHA 4PSUA 2ONCA 4KACA 1Q0ZA 4UBJA 5D3ZA 1A8SA 3TGLA 1TIBA 2C0PA 1SCKA 4Q1VA 4QNNA 1LPSA 2GYVA 3F97A 1EX9A 4Y2SA 4FLFA 3SK0A 2XUKA 5AJHA 3KXPA 1UKCA 2AJBA 3GROA 4UUQA 2WIGA 4G4IA 4X3CA 5D7BA 3WL6A 2J3QA 4BVJA 1LPAB 3HC7A 3FLAA 2O2HA 4BCBA 3WK9A 4CCWA 4CCYB 1H2ZA 5KBYA 3K9BA 2XLCA 4C6HA 5I9IA 4UPDA 3PUHA 3H1BA 2PSDA 2Y2UA 4C4ZA 3FNBA 3O4IA 5FUMA 4F60A 4LXIA 3LIIA 1XZGA 3G0BA 4FFVA 1PFQA 4G9EA 5CBKA 4W9RA 4ZREA 3I6YA 1XQWA 5ALRA 2XQKA 3KSRA 3AFIA 3PI6A 3HEAA 3IURA 1N8SA 3HLKA 4Y9SA 2HADA 1CLEA 5DYYA 3IUMA 1UK8A 1KU6A 4EUSA 5ALLA 2ZVDA 3R3XA 3I2HA 1LPOA 2DHEA 2PU5A 4ZWNA 2RONA 3FYTA 5LYYA 1QIJA 2C7BA 1C7JA 1JJFA 2CMFA 2QXTA 4Z49A 2V98A 2GBCA 2HDWA 3FWHA 5DTJA 4YPVA 3RLIA 3IDAA 3WKCA 1ORWA 2GYUA 2OG1A 4G5XA 4S0XA 1VJ5A 4P9NA 2XUAA 3WKEA 1TK3A 1WB4A 3BDIA 1GPNA 4TVKA 4QDTA 5ALYA 3BE8A 4KAJA 1IMJA 4M0FA 3WYDA 1CRLA 3I2FA 3QBJA 1E3QA 1WHTA 1LLFA 4OB6A 2X5XA 2WFLA 1PV1A 5AKGA 2XQIA 2XMDA 4AMZA 5LZ8A 5DTIA 4HZGA 2WJ4A 2HRQA 4MEBA 5AK6A 4AZ3A 1W4LA 2P8SA 1F0PA 4OU5A 4QZVA 4OYYA 1HDEA 3WYNA 1DINA 3JW8A 1O6FA 4G8CA 3D2BA 4RE5A 4YK7A 4ZI5A 1VXOA 1LNSA 3A6ZA 1CUHA 4B81A 1J2EA 5A71A 3H04A 1J1IA 3SWWA 3F8SA 1E8DA 1XFDA 4AX4A 5JZSA 2H9YA 1CUSA 2WTNA 4DNQA 2QJWA 3KOOA 2XLBA 3OM8A 4BTVA 5EIAA 5IVDA 2JIDA 3DL4A 1ZGCA 1OXMA 1WPXA 1Z68A 1RP1A 5JARA 4HXFB 4KE8A 2XQFA 2O7RA 4MEAA 4NMWA 5DYWA 3C8DA 3ANSA 5ALZA 3ESBA 3W2TA 4J3JA 2WUGA 1CUEA 2XUPA 3CCCA 4M0EA 2RGUA 5K3DA 5CT9A 5AM4A 2PU7A 5CMLA 2Y6VA 1H2YA 1VZ3A 3STYA 1UK7A 5I7UA 2O2IA 3STWA 4N5IX 5ALKA 3DNMA 3C45A 4UFOA 2VA9A 3CCBA 4X94A 3OURA 5FPQA 2DCMA 3QPDA 4G9GA 5DJ5A 3H1AA 4XIIA
chains in the Genus database with same CATH superfamily
1I14A 5G0SA 1R0WA 4MARA 4PTZA 3FGNA 1V1RB 3QNMA 2IEZA 1Y4UA 4DWVA 4LMPA 2R00A 3SICE 1X13A 3KJFA 3REQA 7REQA 4BNJA 4UREA 4URUR 5CTAA 4AZTA 4EHLA 4DDUA 1V4NA 4LAFA 4CQJA 4ZEMA 1TT5A 4WLVA 1QHHB 4NZOA 4GWGA 1VHWA 2WB4A 4AQYB 1QHNA 2RCNA 3GEBA 3H97A 2O5VA 4BDSA 3HHPA 4DIBA 4G1BA 4P32A 4IDPA 5IJWA 2XCRB 3EULA 1YB4A 1YB6A 1TU4A 3JWIA 1T5TA 3UBMA 4E2ZA 2YOGA 1T9DA 2FFQA 3N74A 3B12A 3R7WB 2EEPA 1AZSC 4LHEA 3K70D 4A6DA 1HE3A 3GAFA 3IUNA 2HF7A 2REOA 3HXKA 4GMXA 1GDTA 2QR5A 1HQDA 4ZT6A 1C2YA 1NQAO 1SC3A 2BGNA 4MYTA 3CVOA 3U3MA 4YUWA 2UUAB 1NW3A 3JQGB 4EPRA 5IMBA 3DQZA 3KE9A 3MWEB 4ARBA 1WL8A 4FLEA 3PT5A 5JLAA 2FPPB 4PSVA 4JA0A 5F4BA 4POOA 5BV1A 4QGHA 1U2DA 2YWDA 4WA7A 3ZV7A 3AB7A 3KQQA 3ESDA 3JALA 2BRUA 4EHKA 4R81A 1YHNA 3BJRA 4MI3A 1S7CA 2MMGA 4LW8A 3CY6A 3PNKA 1XMOB 1R5NA 2H4YA 5CHEA 3PJGA 3PKJA 3F5FA 1YAJA 1O9BA 2BHNA 2X3YA 1WDLA 3NOXA 4GRDA 4L51A 3DE6X 1DAMA 5EQJB 5H68A 1H6CA 1SZPA 1YTUA 2DF8A 1CFZA 2VRWA 3GLVA 1B0AA 3VPBA 3WMRA 2BMJA 2HF9A 3KYIB 1VLZA 3DFIA 4Q66C 4BLOA 5GM2A 2HJRA 4QT4A 2GKSA 1RYZA 1GKYA 1M1UA 5C1OA 3WL4A 2O1WA 2BGWA 4TQAA 2IBSA 4GKBA 3MOSA 3QBTA 1RJDA 5ADUS 4IIEA 1KKUA 1Z6YA 5IH7A 5IJZA 4F7DA 1ECPA 2DPGA 2JFUA 3HCNA 3KT0A 4JQSA 4GVPA 5J5CA 5BMOA 1A9PA 1YS2X 1XAGA 1ZD4A 1ZY2A 4BNGA 5KTSA 1JDBB 5T3UA 4GI5A 3D6TB 4X6UA 5LFAA 4NENB 1DV1A 1PLJA 3T6KA 4YHHB 4L9SA 2XRMA 4MR9B 4Y6SA 5CAEA 5JASA 2Y0BA 4TT3D 1OQAA 2HRBA 1KZHA 1LSSA 5T4HA 3IKJA 5IVKA 1TYEB 3Q8KA 2N75A 4TRJA 2G82A 1R4NB 5KX5A 5BWNA 1VG9B 1MC8A 4V3CA 3R23A 1E2JA 5UKDA 2DR3A 2ZXFA 1FDIA 4ZZ3A 2CSXA 3H8WA 1TM1E 2HLPA 4K9LA 3ZY3A 1KOJA 4FQ7A 1POWA 1KJZA 3ZEIA 4ENUA 5KSWB 2NNLD 2EKZA 4CF5A 4TRNA 4MZDA 1WUJS 3LT5A 1ZD9A 1KDVA 1TCVA 1U11A 1O4WA 4IUBS 3E70C 1RRKA 2GESA 1YE5A 5KYUB 5DM4A 1XVUA 4UVGA 4BWYA 1TECE 1XRLA 2VHEA 3GF4A 3WVNA 4RVFA 4QUIA 4YMHA 1UDBA 5IVHA 3ENKA 3O4JA 4E7OA 4N5HX 1HQCA 1E6UA 1OTYA 1II8A 1RRFA 2BN4A 2X2EA 3DV0A 4EL5A 1UKAA 3GHYA 1RWOA 2B4AA 4A91A 3OP1A 1EA5A 3V2HA 3GMSA 1ZS9A 4RZIA 1OC2A 3MELA 2DUMA 1YFKA 2BMAA 3HI4A 3TIXB 1Z0ZA 1JSLA 3CE9A 4MW9A 1BC5A 3L6RA 3HMKA 2BM0A 5TB5A 4GWLA 5FUQA 3RAEC 3QVKA 4YJGB 1H2BA 1FFCA 4OA5A 3I61A 1ULTA 4RA9A 5I01A 2Q3JA 2PL1A 3A4IA 4JKYA 4K46A 4ZZIA 2QD1A 2X8LA 5E1MA 5D2CA 1HRDA 5ILQA 4EB6A 4YMTA 3KC2A 1V6CA 1UPCA 1NP6A 1UDWA 5DGCA 3L8ZA 3FUVA 3CW2A 3PC8C 4HPJB 1QOZA 1TCBA 1GAJA 3HSSA 5A5DA 2XQJA 3KLOA 4K26A 3AO0B 4MW4A 4HAUA 5C8YB 2D8AA 4WDRA 1Y8ZA 3KKQA 4C4PA 3HRIA 4TT3A 3HFSA 3L8HA 1E92A 4YMSA 2E4WA 3RC3A 1DBQA 2C2GA 1FFSA 2G04A 3HJUA 3FAKA 3DLTA 4L85A 4MCJA 1L4HA 3E84A 2P9JA 3JQAB 1JS1X 4MI6A 1OFVA 4QWMA 3RU7A 1KU0A 2DSNA 1T34A 2HB6A 2Q4DA 4AXXA 1AS3A 1YFZA 2R8BA 7GPBA 1ULBA 1O5TA 2DPXA 4NP6A 2DTXA 1Y4DE 4U6QA 5CFPA 2E82A 1FNSA 4U1RA 1DJMA 2HYIC 2R5FA 1FSZA 4TKZA 2Q5OA 1P3JA 1F5SA 2OQIA 4CQMB 3SYNA 2XKKA 1SG0A 1YKGA 3NYQA 3B3FA 5IWAB 5KMGA 3AM3A 1BG6A 4J1TC 1GVNB 4HWTA 3GPLA 3FF1A 3NH9A 5DW0A 2BJVA 4OFZA 4EG6A 4UBKA 2ICAA 3KJNA 3CPSA 2BR4A 4I1UA 3W4IA 2MYNA 2G07A 2Q6OA 2RHRA 2QU7A 3VKHA 3G1WA 2H9AA 2J6BA 8ATCA 2C3PA 4GF5A 2V4MA 1O4VA 2E9SA 2A7QA 1ISGA 2C54A 2QL7A 4CM5A 5D86A 4ND1A 3RF6A 1DKMA 2BZGA 1Z9BA 4CCSA 1YC5A 1Y34E 4LOHA 1TUEA 3VHLB 4ZP1A 3KFXA 1UDXA 5CP8A 1EDZA 1QZUA 3R7SA 2EJUA 3W9UA 3U7HB 1EGQA 3CJRA 4OL9A 5CJJA 1OZAA 1CY7A 5LLTA 4IV5A 1E2UA 4DT1B 3DFKA 3A1VA 3AL3A 3QK7A 3TIIA 2C2MA 1MQ8B 2PL5A 3ZBUA 1IEQA 5A2GA 3EZXA 4J6FA 1WMFA 5B3JA 3CRQA 4PXSA 2VIIA 2J3KA 4K2AA 5H3CA 2FG6C 4WJKB 4YEDA 1XA3A 3FBWA 3RWMB 1V95A 3HP4A 4R98A 2VYNA 5FFNA 2P2YA 2FRDA 3OTGA 1KDPA 2NO6A 2RGWA 3BRCA 3LT2A 4MCHA 1SC6A 2A3RA 4M7PA 1X38A 3CB2A 2GT1A 3CKLA 2JJ1A 2G4LA 4B6FA 4BKOA 4XVCA 2VHVA 2WE8A 3KZOA 5CA0A 5FQNA 2GFHA 3UK2A 3LM8A 1P7PA 2CKMA 4NBUA 5AUPB 3OCCA 4GLFA 4UQOA 5KVVA 2QYOA 2XMSA 4KN8A 5H82A 2OWEA 4BLUA 2TS1A 2YCLA 1S7GA 5EHNA 2EC5A 1QHIA 1TRKA 4L8YA 4NMMA 5AI5A 2BKXA 4R2HA 4AJJA 4KPFC 3ZCVA 1C50A 3BSFA 2C7PA 1MC5A 1E0KA 3RTBA 2FMKA 3ICVA 4Q4DA 4YRQA 4O4LA 3IAEA 3L02A 2H1WA 2H3EA 2VBGA 3HZHA 1GQ2A 5DZSA 5D3MA 3SZMA 4ZVLA 6GPBA 5LQDA 3CNEA 1P1RA 2ODTX 1UIRA 2AFHA 2GM3A 2WW8A 3C87A 3MTQA 1SHUX 3FZYA 3VAYA 5HXAA 2RAPA 1WBBA 2ZU6A 2H1IA 4E88A 4AG5A 3FMFA 4Q3NA 5LLDA 2UZ1B 2IDZA 1USKA 3WLNA 1EXVA 1MX5A 1TZBA 1EU1A 1UDCA 3DBLB 1NBWB 4OLFA 2OM6A 4HDRA 5IAKA 3E1SA 2QSUA 3Q6MA 1C3VA 1P6UA 3SOPA 1OV4A 4NCIA 3SOZA 4O4JB 2CHEA 2WYIA 3R75A 4UFNA 1GAWA 3UK0A 2OBMA 2CFOA 2QLLA 1FTYA 1YJAA 3BHIA 2J59A 1XTJA 1ORRA 4ZODA 3AWIA 4E5VA 3AVPA 4Z9AA 3HBMA 2YWBA 1OFUX 1P5RA 2Q3DA 1OR8A 5FTJA 5HF8A 5JQGA 3W9SA 4TUYA 3AUYA 3P9NA 1C7FA 1E3IA 1T5SA 4K8OA 4URHA 1E7QA 1QH1B 3C3PA 4CLHA 2YV1A 3K8QA 3ZE1B 3BCRA 1YJCA 2EQAA 2ZZKA 2O3UA 4G8JA 4JLUA 3R6GA 1D0SA 4W5WA 4YCAA 4LOAA 2VSQA 3N2YA 5IMSA 1EINA 4NQRA 4AYTA 3TLJA 3RTEA 2IZ0A 4CG3A 1N0IA 4ENPA 2HGZA 1FYFA 2J30A 3FNRA 2ZJOA 5A6VA 1KJ9A 1F8UA 3JD4A 4O59O 3V7YA 2OORA 2OFFA 1G3IA 2CL7X 2ZIAA 5TS2A 3RU2A 1P39A 2QIOA 3DOJA 3QX8A 3IQDB 1S3SA 2O8DA 4M8IA 4OSPA 5FUWA 1GTMA 3WIOA 1LSUA 1QVAA 2IYOA 3DDSA 4YJHB 1K2WA 3LD9A 5EUMA 1US8A 1II8B 4ZDWA 1GLGA 4ZVUA 4D8XA 1KVUA 2BTEA 3ETDA 2G76A 3JASB 2IS1A 3G7UA 4RNCA 4RKFA 4JOBA 1CS4C 3WLFA 5BURA 1K5PA 5AHKA 1NP3A 1FFBA 4IIJA 2YY7A 4Z0HO 3KDSE 3E3NA 1KY3A 1UPTA 2CHGA 2BM8A 4PCAA 2XA9A 4KU4A 1WXGA 3Q3IA 3ZU5A 2KJQA 4ZYLA 4AKTA 1GTG1 5LP6C 2J31A 2OILA 3M1LA 1IHUA 1MRSA 4NCHA 2P6MA 2QY9A 2P6UA 1T1JA 4AY5A 5KKCA 3N3BC 3ETHA 1Z35A 2V5VA 3I09A 5KTMA 1X87A 4RA9B 4N8DA 1Y8QA 1GGNA 2BMDA 1ODCA 3O2NA 1T9ZA 1Y81A 4X92A 4YONB 1FF9A 1JP7A 3U4CA 3UWDA 4MYRA 2WPNA 4D8VA 4MKFA 4X91A 2OHIA 4YCCA 2HX1A 4GMDA 3L2OB 4J03A 2C78A 2PANA 3LF2A 4M49A 5DSXA 4QBFA 5EE5B 2XECA 1E0SA 3N3AC 3OC6A 3QU4A 4W5RA 4LC1A 5C5DA 2P0EA 4FDLA 2R8OA 1F6BA 4DGQA 1ZL2A 1NXPA 3WMWA 4DEXA 2AQ8A 3DJYA 4GMHA 3S2GA 2DR2A 3K70C 4RD4A 1T35A 2ODEA 5FO0A 4QO8A 1UH5A 1J2JA 3AX6A 3NLLA 3V8QA 5JJBA 4KE6A 2CHUA 1RJGA 4TMKA 2JBHA 1T29A 1GGVA 1ZU4A 1U99A 4JBNA 4L76A 5FLYA 1W8DA 4I8XA 3A6DA 4L3VA 5B1YA 4DIOA 3NWEA 4NCNA 5KMGB 2Z6QA 4I19A 4FHDA 1KP3A 3MWKA 4I36A 2WG1A 2PE5A 2PA3A 1RSZA 4J0EA 3U5TA 1JF8A 4JI5B 4KFSA 4Z4IA 1U4SA 2GEFA 1JLKA 5ERYA 3WNVA 2PKEA 3N8GA 2YXNA 5DO9A 2VPTA 2PZEA 6ADHA 3MCVA 4UNRA 3L7AA 4D41A 4B9EA 4Y6RA 1MC1A 3PX2A 3FKSA 1CG6A 1ZNXA 2R1UA 3MAGA 3GVPA 4DJEC 4CF4A 3C6ZA 1MJFA 2DHCA 4RABA 4UDYX 4FSHA 5REQA 5AUOB 2HA7A 2GAFA 2VHCA 2XUJA 4D45A 5EIWA 3BBPA 3AETB 5I5EA 4EA7A 4JUDX 1SA0B 3F49S 4DJAA 3RKSA 1W1WA 2CFRA 4C7VA 2FLKA 3OZCA 3NP7A 2DEUA 3UYLA 5G40A 2AJCA 3CIFA 1JEJA 4D43A 2G9ZA 2JFBA 5HK9A 4MJ7A 3RCBA 3UANA 5AH0A 721PA 2YQ4A 1TKRA 3N8DA 1KO4A 3VYVA 4GNRA 1LB1B 4IOMA 4AROA 1RHUA 4KRXA 2P7IA 1RKBA 4RACA 2FMTA 4LNUA 1BHJA 3PVSA 4JJAA 4BYGA 1XCOA 1ZO8A 3GRCA 3PXXA 3OEYA 4AXBA 1JE0A 3PQ8A 4CKEA 3KQMA 2ZETA 3FNFA 4F5YA 2GHIA 4Y1FA 5FB3A 5SY4A 2LE0A 3H0KA 4U2FA 3OKPA 4LRXA 3UXEA 1W6UA 5K5EA 4GGPA 2J0UA 1J2RA 2NTVA 1SVWA 2V6BA 5KVCA 1FXUA 1Y48E 2ZI3A 2VAVA 3EF3A 2EL9A 3HJCA 2QE7D 1RE0A 3HDJA 5I9TA 3VPAA 4DRYA 4HV4A 5C7LO 2PWBA 5ED0A 2Z3WA 2RD2A 1Z4IA 2IQIA 2ZSUA 1GQOA 4FFNA 4IR7A 1Z36A 4OXIA 4FNAA 2V6IA 4WXMA 5TMEA 4C2AA 3Q88A 4EQ6A 5JRDS 1CY0A 4MJLA 5D3MB 5ERGB 1J0EA 2EBHX 3HQ4O 2X4GA 1MA0A 3CW8X 3HVKA 2DGDA 3NALA 1MD9A 2JCBA 4N3AA 3TUIC 2OL4A 2J7KA 2O50A 1E6KA 3O4FA 2WP0A 3NHLA 1L1RA 4KQXA 3BC1A 4ND2A 5BQOA 1BDBA 1XZPA 1LK0A 1U8AA 5FBZA 5CCEA 5DN9A 1HTBA 1Z29A 1BZYA 2GA9A 2BLLA 2FSVC 2X9GA 4KK3A 1UIMA 4OIMA 2OT3B 4TLEA 4BP3A 3PCTA 5DNWA 3DEAA 1FYXA 1J90A 3F96A 2VT7A 4DUGD 1IUPA 2PIDA 2RHBA 2VJMB 3FPHA 2EIXA 4ACBA 4A73A 3FVTA 4QXOA 1KBQA 3IP3A 1YRYE 4I4TA 3UFBA 3WHPA 5LIPA 4FGLA 5C7OO 1IEXA 1R6VA 1GKKA 3K9CA 4AY2A 4E3ZA 1E2DA 1IZ9A 4FIZA 1S2IA 3T7TA 5JQGB 5L3VA 3R5HA 4J3FA 3AEQB 4Y6OA 421PA 2YZGA 1OIWA 3HCWA 2LCFA 4OREX 4UPEA 4ZI7A 3VU0A 3F6EX 3AOGA 4GGMX 1I7QB 2VPQA 4QUBA 3D3QA 3QVOA 5CM9C 5EQTA 5G3YA 5BMVF 2REBA 4F6RB 3DVQX 3QTBA 1E9BA 2HK9A 2RGBA 3MXTA 3N9IA 4RVSA 4XIYA 4XASA 1FU7A 3O82A 1ODKA 2R79A 4BVLA 3OD5A 3PUXA 4AMGA 4HYTA 3D6UA 3DKVA 4Z8XA 2O5EA 2O8DB 4RD6A 5GOTA 1G8FA 4JOQA 4NH4A 1PE0A 1SBZA 2ZPAA 3AR3A 4AP6A 1G5PA 4YFVA 2BGKA 4N48A 3GNSA 1AV6A 1X1EA 1XTZA 4YFYA 1EE9A 2IOQA 3GBSA 5E8RA 4A7PA 5K0CA 5G0UA 1S9DA 1VI2A 1YDHA 2OGSA 1E6LA 1G4HA 1YJ8A 1NUQA 3MVEA 3RJTA 4AZ3B 3LCMA 5ADHA 4IIJB 3EF0A 1TAGA 5IM4A 1P9LA 2AR0A 2K5UA 4JJ7A 5CEFA 3EODA 2CXRA 4QUGA 1UBEA 2OAEA 5AI8A 4KITB 2VHXA 3C3AA 4DUYB 1Y5LA 1UMCA 4KOEC 3F2VA 3B3GA 2WJPA 4C3VA 5DPMA 4YDQA 1XZIA 2OP0A 1U9IA 1F20A 2AFIA 1NE7A 2I6XA 4KX3A 3JQ6A 3SCZA 3QVSA 5JI3E 2ZRGA 3LJKA 1OVGA 4YT2A 1JSRA 1M6HA 2P9EA 4GPZA 4EL0A 3T0IA 5JRJA 3RVJA 3L1KA 3KOXA 1FNDA 5DP2A 3RO7A 4HR7A 2ZUBA 5EJ2A 4LISA 3TAHA 3OECA 2CDNA 4FM9A 1ID8A 2VJDA 1SHKA 3AB8A 4PHTA 1F3LA 2EARA 5TQ2B 2N3ZA 2VAMA 3NTXA 3TSZA 1P1KA 5F7OA 2JK0A 1CLUA 2LDBA 1IL0A 1M6VB 4FTWA 3VKUA 2NVUB 3CBGA 3ROFA 4HO1X 4B4OA 3I32A 3LT4A 4NMXB 3U40A 4BJ6A 2QUZA 1Q84A 3ONFA 4EY7A 4PLTA 1PDVA 2VQ3A 4M76B 1NATA 3VH2A 5HWSA 3EQ2A 3I2IA 3RVBA 1RCTE 4GNKA 3ACBA 3VR2A 1XVIA 4MTLA 4N5NA 1RZRD 2QM8A 2WWWA 5SYAA 1JFSA 1JQAA 3LX4A 3NKFA 3SDZA 3B1FA 1LV8A 1VKOA 3L4BC 2P75A 4PC3A 1U0JA 1SOUA 5A2QA 4OMDA 3VR5D 2J6IA 3GFFA 2IE8A 3ST7A 1H42A 5AM5A 3O8CA 3GAMA 3A6EA 3FYUB 3HHEA 3K09C 3BJEA 4P3KA 3V9PA 4G5OA 3CONA 1PEYA 1EHCA 2ZRCA 4QC2A 4Z3DA 2V55B 1NNSA 1PSWA 4C01A 5BRJA 5EJ5A 3LLMA 1TAQA 5AKYA 1KH3A 3I64A 4DSZA 3HWSA 3TLXA 2CNLA 5JANA 3C24A 3VSCA 3TUZC 2B5OA 4AM8A 4LYJA 1IWOA 3Q2KA 1RMQA 1SN7A 4EG7A 1VHLA 4FC7A 4P33A 3HYTA 1PLLA 1TEVA 2TYSB 1LEHA 1I2DA 3FUUA 4JR0A 4ENSA 1R50A 1S8FA 4R4JA 4G5QA 3FVRA 4OJYA 5AP9A 3WGTA 4AKSA 5FNZA 3CUYA 4JOCA 1EHYA 1AQNA 1U1FA 2B1GA 2PJZA 2FUCA 4I81A 4BQSA 1TM2A 2OHGA 4AF8A 5F2NA 1QK4A 4HQ6A 3RAJA 2HU5A 1ZISA 3ECSA 3BULA 3FI0A 2P11A 4KAAA 1RLOA 4LJLA 2Q4RA 1XPUA 1K68A 4M38A 5AVRA 1UPAA 3QVLA 3S55A 4ES6A 1NU6A 3M33A 4LNUB 3DLIA 1N2GA 3CMCO 3J81A 2QRJA 1U6IA 1YHZA 3PXEA 2FX3A 1GVHA 1XDSA 4CLXA 1Y7PA 3D7LA 3ONDA 1EDDA 1LU9A 3TBFA 3TQTA 1YQQA 3OKAA 2YUIA 3QHPA 3QKTA 4UE3S 3GCZA 4P83A 2IYUA 4KRYA 3MIZA 1QS0B 2J6HA 4BZWA 5FWXA 1S2DA 3AT1A 3A05A 4RYLA 1C14A 1D4OA 2V97A 4XARA 3I53A 3N87A 4OL0A 4A2WA 4OUDA 1RZRA 1VE7A 5JNTA 4EZEA 4GPAA 4MVJP 4MS1A 4NAVA 4KVFA 3JWHA 4QYIB 5B1HA 1PJRA 1XRNA 3VSDA 5B3AA 1J97A 1S6YA 5LWQA 4YMUA 1NQXA 2ENWA 2G1UA 2VNSA 4ZTUB 1IEWA 2P4UA 3FYUC 1JJVA 4OFXA 5KDLA 2LCQA 2YHBA 4JZKA 3PX7A 2NT3A 3TUJC 3TXAA 2NU6A 1XG5A 2CW5A 3GNLA 1QTIA 3GH1A 1N9GB 1G9SA 4M6WA 3V8BA 1FPMA 5FOQA 2F8MA 3DBIA 3T1YB 1HYHA 2GK4A 3CZAA 2GHRA 3HN7A 4I3HA 5AI9A 2FEOA 3A1FA 1B6SA 3KXIA 4ON9A 4NNJA 3FXAA 3DONA 4ZQHA 1K8ZB 1B8PA 3CTPA 3I6IA 4UXJA 4J0DA 2XHZA 1E94E 1LA2A 1E6MA 3GLUA 4YJ3F 2WUFA 1U8EA 2C58A 3BTOA 1E2KA 1J8DA 1MENA 5HPYB 3E53A 4NV1A 2D5BA 5AVOA 2QUAA 3QKSA 1I7PA 1E2QA 1E3DA 1G9TA 2GD6A 4LOKA 3S8EA 1L8AA 4ZDKA 1T5DX 4A23A 1EM6A 4G4GA 1OWPA 2OZEA 1UBRS 1DCKA 3GY0A 3UT5A 4ZI7B 5JFTA 4YRPA 1BX3A 3D64A 3HM2A 3ZLUA 4BMDA 4UFPA 1HFEL 5BSHA 1NVVQ 2A9PA 4IJUA 1DJPA 4GLBA 4DSAA 1HL3A 1JXMA 3D7MA 3K0EA 1X0XA 4I0WB 4MZXA 1KC3A 2B4TO 4OGLA 4KQJA 4WX2B 5EKDA 3VO2A 2PYDA 3W1WA 3I30X 4ZANA 2EFJA 2H7XA 1AMNA 1G3QA 5BT9A 1QGZA 2R60A 3T7AA 4C21A 2AKEA 3FFXA 3A9WA 4XVUA 3SY8A 3GJXC 3KL4A 4A2QA 1GKUB 1OXBB 3AEXA 4J6EA 5KVQA 1NHWA 3Q10A 4TWRA 1RCUA 1T2AA 1TM3E 5B30A 1W36B 3FTEA 3HTXA 4R3WA 1IN1A 1C7RA 2CNKA 2XGOA 1QOPB 4H0FA 4IG9A 4OATA 3HACA 4RMHA 2ZKIA 4FYWA 5SZKB 1M3SA 3OWXA 3W8EA 3WZMA 1ZHOA 1BOFA 1YB1A 3ETJA 2XRZA 5C5EA 5LM3A 5F98A 2ZIVB 4IVNA 1QRUA 3NJ4A 1TQHA 3RIHA 4U8HA 1L3IA 1YSCA 4JFAA 5AOVA 1UMCB 2ZOSA 3F71A 3DMPA 1U0HC 4W1RA 1JFLA 1U6KA 1V8FA 2OAP1 4LG1A 3X1YA 1JAXA 2ZITA 3GFRA 2ASEA 1UAAA 1J21A 3MJHA 2QX4A 4X95A 2V45A 2H0RA 5KTNA 1J5XA 1SKQA 3DYVA 1XMPA 3GG2A 3PX3A 2P4HX 4HAWA 2GHQA 3RABA 3RKUA 3THOA 5HKAA 5KTTA 2QUBA 3GFQA 2GQ0A 3IMGA 4EJ2A 4JWTA 1MX1A 2IYSA 3ZD9A 3MS4A 3O94A 1IQUA 2XCUA 3BA6A 3FLEA 1T2VA 2HSDA 1FLNA 3QG1A 3LY8A 5JXIA 4OH7A 2ZQZA 1I10A 3OAAA 1CVIA 2WIBA 3KSMA 2ORYA 1A5TA 4G81A 4R1LA 4L5CA 2GCGA 2B8JA 2PO5A 2B5VA 2BFDA 2OFOA 3FH0A 1DJOA 3K6RA 3Q4GA 1XX6A 4FBLA 4LYEA 4M1WA 4XGKA 4ZK6A 2H16A 1J70A 2FEWB 2F43A 3R0ZA 4QXMA 4R8SA 3WNBA 2GYYA 3RRMA 3R6WA 5C52B 3CGWA 3TL3A 4HQRA 2GWRA 2GD1O 2CLEB 2FPMA 3D6MA 5AO9A 4M9CA 3QVXA 4XM1A 3RC8A 4OM8A 1QGUB 4F3RA 4UAGA 2ILVA 3UQZA 4QUAA 4F5EA 1E9VA 3RYCA 3CLHA 1A98A 5IVIA 3A3NA 2EBWA 8AT1A 3S8YA 1KQGA 1T1SA 5F5NA 1W36C 1FFDA 3O0DA 3VZBA 3FNHA 3UFXB 4YRJA 4CQLA 2A8YA 4HZIA 1Q1BA 2R66A 4B7CA 1R5JA 3EYWA 3C3DA 3F9RA 2WR8A 3BIXA 2XE8A 4JR1A 1KRXA 4B6EA 1EE2A 3IQIX 2I1WA 3NAQA 3OCYA 4BO0A 4KR6A 1QFZA 3MOIA 5DBIA 4DNOA 2REXB 2JG3A 3KPUA 1XYVA 3OJFA 3QKRA 1RI1A 1YS9A 4ZJYA 1R9JA 3LVRE 4DQLA 1RPTA 1SCJA 1PGJA 5K09A 2CXTA 1NGSA 2IXFA 4QXPA 1UXGA 1VRCA 2QG4A 2NAFA 4QRIA 5FD8A 1ZFNA 4UBNA 4ZQEA 1VYUA 1DEHA 2IIPA 2R7NA 4LWZA 3HXQA 2RGAA 1QQTA 2Y99A 3JQRA 3OF3A 1VA5A 4LJ8A 3CNNA 3SM9A 2HSGA 4ACAA 1UDAA 3DBHB 2B6HA 2OCYC 1L0BA 3L93A 3OF2A 3I1YA 4DR5B 2JCSA 4UUMA 4UDOA 2IHTA 2RHJA 1E3EA 1VJ0A 2VF2A 1JAHA 3OOJA 1BAPA 3VOBA 4MKHA 3H18A 4M0LA 1ADFA 4OU4A 3RQSA 1EUCB 1GYPA 1IOVA 4PZDA 5FL7D 3P9ZA 3ZVLA 1I4WA 1E4YA 2CVQA 1N1EA 4OV6B 2PYZA 3OOHA 2J4FA 4LQ4A 5KNDA 4KCGA 4W1PA 5AJVB 2Y4OA 1RW4A 3PDWA 3GPBA 5PNTA 4MIYA 3DEIA 3SX0A 3TR5A 3B6MA 1MO6A 3EK2A 4IJVA 3H8VA 3KEGA 3HR8A 1HLFA 1JEYB 4YAGA 4V1CI 5DTQA 3S27A 3DFMA 1ZRNA 1TZMA 1QMPA 1XZ8A 5J47A 4GZ6A 3COJA 2AT1A 4HY3A 1SUCA 2WU0A 3IUJA 2NU6B 3V00A 2WTAA 1ND6A 3I2YX 4GICA 4D3FA 1S3FA 2R6GA 2XWBF 3O2SB 2WYWA 4RPJA 4EYEA 3HU3A 4DY6A 4EAQA 1XMXA 2DFPA 3L6OO 1E9RA 1C3OB 5J58A 2Q07A 1W44A 1RQXA 1AGRA 4MV0A 3GDFA 3ITNA 3PDCA 5KYYA 2IYFA 4Q7QA 1NIPA 4JNKA 1BIFA 3EPRA 1F8GA 3DO8A 1QYRA 4C07A 2WF6A 3C98A 2QN2A 4D9NA 1V11A 2ZPUA 3MWFA 1VP3A 1DKLA 2X9NA 3FZNA 1XLUA 2O57A 1JHZA 5C7IO 3PC4A 1FLDA 1FMLA 2BJWA 2OGTA 1VZ2A 2XE6A 3OH8A 1LW6E 1T8TA 2D1TA 4QPNA 4RAOA 1IAQA 5ERXA 5THXA 4E5YA 1IOLA 1Q7GA 3VDRA 3OMLA 3L7YA 1E1KA 2MTBA 4GOJA 3B82A 4IHJF 2Z9CA 1R5BA 1T9CA 1YCFA 2GSDA 2PKWA 3DBRA 1A5SB 1WJGA 5HMMA 3UJBA 4L5BA 5FOSA 3FE2A 4ZMBA 2VTBA 1SKYB 1QUEA 4KQIA 3CU5A 1SQ5A 3VYRB 1VCNA 3DAHA 1MKYA 5C80A 1Z88A 3IOEA 1XTSA 2FWRA 3N6XA 3NIFB 1VPTA 3A2NA 4ZMRA 1P9OA 3LYUA 3HFJA 4QJIA 5A9SA 1NG1A 5ALJA 3GRFA 2YHSA 4ER7A 1AA6A 1THZA 4U7HA 2JI7A 5ECWA 2H1FA 5ITZA 2PRIA 4KFUA 2E85A 1X8LA 2FOLA 1BX0A 4EJMA 4GOLD 4TPKA 2WVGA 1L7PA 2ONJA 1K7EB 3LUGA 3T94A 4BN0A 3GFVA 3QNWA 3HO6A 4X93A 2OB1A 4CTKA 4MB2A 1Q74A 3GLIA 2OVFA 1JDZA 2G4VA 1RVDA 2ZIXA 2YR0A 1VBMA 4J7XA 1ICIA 4K28A 2PVPA 3OIFA 1P2UA 3RHFA 2XSZA 1QYIA 5GPBA 2NTJA 3DCIA 4IX9A 3A1UA 1WUHS 2YZNA 1NVGA 4NFYA 5C4MA 5K2OA 3UMYA 1V9SA 4K3VA 1CJMA 3GEPA 2P0YA 4GR9A 2Z6AA 3WV4A 2R6HA 3M5PA 3M4ZA 4FOTA 4K86A 4QBKA 3L92A 3EVGA 3B6KA 3P0JA 3PR1A 4EBFA 1CF2O 5EA2A 1ZRHA 1L5NA 1D2HA 1BMFD 3BWCA 1H2XA 1LLDA 3B3JA 2E5WA 4PX9A 4UUPA 4LZPA 3VPGA 2X0NA 1EDOA 1E3WA 3S2UA 1QONA 4ZMSA 4KMSA 2HZBA 2Q3BA 3H9EO 4PXAA 4BN5A 3HABA 1K66A 2DKOA 3PFNA 3DTTA 1QK3A 1TCAA 2RGNA 4HDNA 4JYCA 3DUFA 3G17A 3M6LA 3ZCUA 3I8XA 2XUDA 1BD3A 4FC6A 3QEMA 2CLCX 2F43B 1NSTA 1V8OA 4LWPA 4C6RA 3A4TA 1DIBA 2PKQO 2V7QD 1ZRMA 4LOIA 2GBGA 1LDGA 1W5TA 1SFRA 1Z4NA 2ANBA 1N8TA 4RD1A 2AMYA 4B80A 3OSZA 4E5NA 1WCWA 1Q12A 3QPBA 3QKIA 2OXFA 3ML1A 1D2CA 2ZRJA 4XX0A 4Z9FA 1KEKA 3FNEA 3GGDA 3IA2A 4N40A 4NFSA 4TKUA 4W82A 4EPWA 1KI6B 3BH6A 4BO5A 1WETA 4QX6A 3E7WA 1ZVJA 1LF0A 3ZKAA 3IT1A 2ADMA 5AJZA 2QEQA 3JD0A 3W1EA 5AM2A 3TG8A 3STHA 3V2IA 4ER6A 4WLEA 2CNNA 2YW9A 5EJGA 1OLXB 4PLHA 3QU2A 3RHZA 2X58A 4DYVA 1N9ZA 1Q7BA 4GAEA 1NX9A 5TQ0A 4N4AA 3F6CA 3LRTA 2PCLA 1NBEA 2SNIE 1E9CA 2B99A 3C7KA 1OYVA 1PLKA 3CZ5A 3K8YA 2O2SA 3EZ9A 1JXQA 3JQQA 2B5WA 2QRPA 1QLHA 3D2AA 3MS7A 5FORA 3WGLA 2IOYA 1ZN7A 2HWYA 3FSGD 3NH6A 3MRVA 5HOQA 5J3JA 3G3EA 2O52A 2HPAA 1KSHA 3PUVA 1DAEA 2XMPA 2IY8A 1L4FA 4PXYA 5AJTA 2AZMA 3TFQA 3WDKA 3WRXA 5DWVA 3CZ4A 4P8RA 3T52A 4OKNA 1ONOA 1CNFA 3MSCA 1U28C 3HB7A 3OPXA 4B5KA 1R27A 2GJ9A 4YRKA 4UD2A 2NV2B 3PSHA 2BKUA 4L73A 4YV0A 4LN1A 3WZLA 4BVAA 5AM3A 3V4RA 1NUUA 4OQNA 1PX0A 1FNMA 1M0WA 2ZBRA 5LA6A 3E9RA 2ZJ7A 3FJOA 4Q0MA 2QTAA 2WUDA 1WZIA 2I71A 4L28A 2PWYA 4AJ9A 2HTEA 4Q9DA 3PJRA 2JLVA 1U02A 2IXAA 4NU8X 2XNSA 2GZ3A 5JD3A 4KXQA 5T41A 3TW6A 4DSOA 3KUCA 5JMWA 2QM0A 1N0HA 4NYJR 4QTXA 3D2LA 2Q1YA 1AKNA 4P7BA 1QFMA 1VG1A 2QRLA 3PWSA 3MT7A 1D1QA 1WQ4A 3Q3EA 4FCTA 4CW7A 1TTQB 1WXXA 4R1OA 3ROXA 4ESHA 1T9BA 2QM3A 2B7LA 4TMXA 2AZ4A 1ZONA 1PG2A 3EQ8A 2G5PA 2AW3A 2QYSA 2WF9A 4PG5A 1EMDA 3VNRA 1T24A 4BLWA 4WQMA 3RAPR 4HX2A 5I7SA 1L4EA 1WB5A 1Q0LA 3IAS1 4H7JA 2OPHA 1AK9A 4RY9A 3MQ4A 1LK7A 1VSTA 2QAGB 4JDPA 3VOSA 4GMKA 3OVMA 1VE9A 2WJ6A 4F3NA 1DIHA 2HIAA 1MTOA 3LGAA 4GOOD 5CRIA 3A2MA 4MLPA 5BQPA 5BN5A 1NXWA 4IV0A 1JILA 1I2ZA 3ZDDA 3ETGA 2GBIA 1BN6A 3ZBQA 4Q9HA 2MWMA 4NI5A 1IONA 4GOKA 1GZHB 1PV2A 1VPEA 5CX1A 3RYIA 4HUQB 5K8IA 1SVUA 1N1MA 3HBFA 1SVKA 2HU2A 1Q7EA 5A7GA 1KZ1A 4JC0A 1JIJA 2RI6A 3RH0A 3CPJB 4QOIA 4OYRA 3RFVA 3PFKA 3MC1A 4KYIB 3U13A 4DRXB 5JJIA 1FFEA 3PHJA 5AW6A 5KYYB 1Z7BA 5FR1A 1THMA 1PFWA 1WW8A 3FSGA 3QU7A 2IUEA 2JRCA 2LIVA 2WOOA 3N70A 1KVRA 4TLBA 4QELA 4CDMA 4WJLA 2EHDA 2HHHB 4HBGA 4N3CA 4RTPA 1NQOA 3AF4A 1YS4A 4LNAA 4BQIA 5ER6A 2P2GA 4YH1A 3V48A 9ABPA 1PW5A 1K3UB 1QZ3A 5JS1A 3A3YA 3KTDA 2XNKA 4EEZA 3N8KA 4HYYA 3LUKA 3OY7A 4RPIA 2HA5A 5CH3A 3H2BA 1UK6A 1H0SA 1TU0A 3HKCA 5CDFE 4QFDA 1VE1A 5EESA 3SKYA 2GDJA 5EP3A 3CF6R 5ALOA 2HGSA 3KJQA 4JBGA 2G1JA 4G85A 3ROQA 2IHUA 3K1JA 5C3UA 5IHPA 5IZCC 4EJ0A 4BC1A 4TSRA 2KHZA 5BT8A 2FK7A 2KLBA 1T9GS 4RK4A 1TAUA 2PAFA 5C37A 1SC9A 2AMLA 4EELA 4Z0NA 2J41A 2ZJ1A 1Y37A 1FRFS 4UD6A 1JEQA 3UXYA 3AHCA 3EX7C 4EO9A 5JBIA 2I2CA 1Y1QA 3AF3A 1Z33A 2QAGC 2O0KA 2CCJA 3ONNA 2FVXA 3TE6A 1NSFA 1Y1KE 3A11A 1H6AA 5ALEA 2TRSB 2V7TA 3GELA 4EW1A 4Q18A 4XLLA 5DBFA 1GUFA 2W2PA 1VFPA 1Z5NA 4M0CA 4Q3LA 4RSHA 2X0RA 1UT6A 1U81A 2VF7A 4I9UA 5FX2A 5IUJC 1YVPA 2VTEA 4ETWA 2QTCA 1BE1A 3H2ZA 4ARSA 2BH9A 2Q8QA 4DNXA 4O1IA 1U90A 3ZGXA 5KUTA 4JKOA 3E22A 2P2DA 5EFZA 1P80A 1WA5A 3CX6A 2JA2A 2PGOA 4EP1A 1NI4B 5CYGA 1DPFA 1BDHA 2H2GA 3L0YA 1C30A 2XZOA 2A2ZA 3PS9A 3V4ZA 2GX6A 2NYRA 3QVTA 3WP1B 3KETA 4QYMA 4AN0A 4RLQA 1E3WB 4FUTA 4ID3A 3KFLA 4JLDA 3T5TA 1NYTA 2RHGB 3AKCA 5EWJB 1YA4A 4I6GA 3QXGA 3U09A 4ZYYA 1E62A 4HLUC 1U65A 3H7AA 1T6ZA 5IARA 2E4ZA 3K9LA 4LYYA 2QGZA 4R1TA 3I39X 3P0HA 3S28A 5CYOA 5EKTA 3UWOA 2QUIA 2ZU0C 1SKAA 3ABZA 3L0CA 3FFTA 2RH4A 1Y3CE 3C3JA 3JTMA 4JVLA 4UBLA 1YR2A 3K2IA 1L5HB 3SS9X 1YZVA 1TE2A 3D0QA 5FH9A 3IEMA 5A0TA 1PD1A 3EZYA 2JFNA 2YIMA 1I51A 1N0UA 2G5TA 1U3WA 4KN5A 4L6IA 4FI3C 2PZMA 5FF9A 3QKWA 2UVQA 4XX0B 1K7XB 1BDIA 1SXHA 2QW8A 4KIGA 4TKUB 4E5PA 4QG3A 2EWVA 3K96A 4NABA 4ZK2A 3AVQA 4E14A 3W2IA 4JLPA 2ZCJA 2BFCA 1XCJA 2IIQA 3K73O 2XMCA 2EDCA 3VMFA 1JVSA 1RHRA 3NHRA 4LJ5A 1L7QA 2Q5HA 2XJ9A 3OJ0A 4ZVTA 4DLLA 3OIDA 5KJ1A 2CBGA 3EMKA 2XAUA 4QDZA 1LSOA 4RPKA 2QTBA 3JQFC 5L4NA 3I1IA 2AVNA 2FP4B 1NVKA 2DLDA 4B84A 2XMQA 3LC7O 4JL6A 2F1HA 1KDZA 1HR0B 3HU1A 4EJFA 3R5JA 4FOPA 1BKYA 1G5QA 1LSJA 2CGEA 3DQQA 4YVFA 1KBZA 1M5UA 5BVGB 1E1LA 1WXWA 5ECDA 1Z63A 1UZAA 4HVTA 4D9CA 5KSOA 1R0CA 3OLCX 1VMAA 1IUOA 2NXCA 1ZLXA 5I4IA 4YAWA 1FLAA 1JQ5A 1CS0B 4PLWA 1E2PA 1N2CE 4ZQBA 2A5GA 3ZHOA 1J4AA 1I3LA 1WY5A 1JNXX 3GJZA 3IO5A 1DPGA 2CUTA 2W6CX 4BAGA 3UMFA 3QEBZ 3S5JA 2ZCVA 4PSCA 4TOIA 1QP8A 2VDMB 5ILGA 1PFYA 2IHJA 4REMA 4RDXA 1M0EA 1QAMA 3VHQA 4D0NA 1UJ4A 2G80A 4KQHA 3LL7A 3SEQA 4O2AF 3ZQJA 1B8OA 1I4TD 3Q98A 2O1SA 4EB3A 2HJSA 5FPPA 4LY0A 3PXDA 1DQRA 2ZI7A 1SXGA 4G8DA 4OP1A 4D74A 5AVWA 2O7QA 1JVNA 3PRHA 3L04A 3HRHA 2BFEB 4YXWD 3EDQA 3UCFA 3DV2A 4EKGA 2ES4A 4U3JA 2V7UA 2YWHA 2AQKA 1NDUA 2NPOA 3TVYA 1W5BA 5F7XA 1UBLS 1RAGA 3OE4A 4RLSA 1YU9A 5EIHA 5BN5B 4LZZA 5B55A 4DR3B 4UTPA 1MJ5A 2HFJA 1UR5A 1Y7LA 2NP7A 1ESCA 3EFBA 3VUEA 2AF4C 3WHLA 4D3YA 3RYIB 2RHOA 2ISQA 3QQPA 4MMZB 2Q9CA 5GIPE 1EKXA 1JBEA 5HG0A 1D04A 4DDHA 1BU8A 5KX5F 2W2LA 2VQSA 5E4FA 2OAGA 2VPPA 1YA8A 3C5HA 3NBKA 2QMEA 5K45A 3WLIA 2GK6A 4NYMQ 2E7ZA 2RDMA 5FADA 4C0BA 1WPRA 2FG7C 3C6KA 3GJ5A 1NUHA 3LPMA 3BH0A 5LQSA 1ZW1A 2A5YB 2GBLA 4IQ8A 3R76A 2Z09A 3WRXC 2IPOA 3HCOA 2B61A 3IL2A 2Q2NA 3QUBA 1FFHA 2ZBEA 2QA5A 3EGVA 4XD2A 1JSCA 2VHZA 3D6VA 1P0FA 1CUDA 5CDGA 4X54A 3U7RA 5C4IA 4QYXA 2VP6A 1NPTO 2C5SA 3BFKA 4WVLA 2Z2KA 5J9FA 1H4QA 2VUUA 3N2NA 3HKDB 3O95A 1VHJA 4IH4A 2AC4A 4OXNA 3NHWA 3OQNA 4LF8B 1Q16A 4MAMA 3DD1A 2CJXA 2BBTA 1LX7A 4TTIA 4BRUA 4CBVA 1QXSA 1WVIA 2J09A 4DV7B 3AF6A 1USGA 1YONA 3DWEX 5G1NA 5C31A 2VTVA 5HQJA 2BHSA 2W2XA 3K0KA 1BJKA 2NVBA 4S0ZA 4GOND 2VXOA 3I12A 5IEBA 2GPNA 3HXLA 1W9MA 3QIVA 3DWIA 4E0BA 1NNI1 1E6CA 1L5GB 1A2QA 3E7DA 1FL9A 1OX4A 3U62A 5DM70 4I9GA 1H0KA 5J2TA 3HU2A 1Y5NA 1YBMA 3PPVA 2JLUA 3BOSA 1HXHA 3PPWA 2VG8A 2IU0A 3DOEA 3OJOA 1VL1A 4FYJA 2I6QA 1MR3F 3BMQA 1QZTA 3OZFA 1Y3DE 3GN1A 1N9KA 3RRBA 2I6UA 4BKRA 2P2LA 4TTTS 1JJIA 1KAEA 2DMRA 4KXNA 5AI0A 3UAGA 2VR1A 1X77A 2HR1A 4M1ZA 3W78A 5KTYA 3F3YA 2ODQA 2Q9UA 3ISVA 1A76A 3E23A 3DM5A 1XZDA 2PS9A 3M83A 3SIWA 5HTKA 1FQOA 3Q8XB 2WTUA 3VNQA 3B70A 1HG0A 2O0HA 4DDWA 1VLQA 1EFUA 3MBKA 2W98A 2DUUA 5EHQA 3V1KA 2BAGA 5BWMA 2RAUA 3NBQA 1RBYA 1VCOA 2A5LA 1DEOA 1KAMA 1T43A 4PYLA 1A9TA 1QV6A 1PSZA 5CCBA 1NNEA 5CDFA 2DY1A 4KVGA 2E6UX 3JQBC 4B73A 2CCGA 3RYHA 4PGMA 2IYYA 1PDOA 4PW0A 1CVRA 2Q41A 3QFHA 2WFLB 2ENUA 6Q21A 1DX4A 1VKJA 3WTCA 4C89A 2JA1A 1FDOA 1PDWA 1FP1D 2WJZB 1XBTA 1P4GA 3RT7A 3V80A 3ED1A 1TC2A 5DXFA 1R74A 3VH4A 4AJLA 1DL5A 4E31A 5AVUA 1GNVA 4EA8A 2ATCA 3WOHA 3WGMA 2R1ZA 3VU9B 4TWJA 4MB0A 3I9V1 3LNCA 4RGYA 2R6DA 2IH4A 5AMXA 3FETA 3JQ9A 3VH3A 1PSDA 5K3SA 1VG0B 2QG9A 3AIMA 3M7IA 3OQJA 3PC6A 2NUTA 2AEMA 2NPFA 1Z08A 3L7CA 2AZTA 3A70A 4IDHA 3B6IA 1DU4A 2HSWA 3KDPA 1G59A 1KIFA 3RUEA 2KWIA 2PTHA 3SLGA 4IKEA 5ICEA 3LK6A 2CXQA 5L3SA 1UZUA 1X9HA 3L6UA 1KC1A 3C0KA 1E5LA 3QELB 4WOKA 5FP0A 3W05A 4FWIB 4KBFA 3ONWA 4NOMA 3TSWA 3WFIA 2IHYA 2PD3A 5ALTA 1CY4A 4YAUA 3B9PA 4EUFA 2EGHA 3LL4A 1XPJA 3N8HA 2FX5A 4IQ4A 4UTOA 1ZSNA 3FNQA 3W7AA 5DYTA 4OGFA 4QVGA 3WBJA 1XLTA 2ZIZA 3E4DA 3AGQA 2ETXA 3U37A 2G8LA 2GN8A 2Q8PA 3HKBA 1K63A 1TX4B 3PRKE 3U48A 3FJ1A 4CN8A 1T36A 4M9ZA 4KKXB 3AR4A 1JZSA 2PZ8A 4D6YA 4MROA 3QLTA 4NQZA 4O4HA 1NNUA 2YXPX 3PCRB 2XXAB 2PMWB 3H2GA 5KWSA 4L72A 4JBYA 1MA3A 1TQ8A 4WCFA 4II7A 4N1AA 3NZEA 1UJNA 3G79A 1HT0A 3PQ4A 1BHSA 3P1JA 1MBZA 4QOFA 1VYTA 4IJWA 4EAAA 1ZJ4A 3E4CA 3MGKA 4QPPA 3U9SA 4XCQA 3SG0A 1JL3A 1QGDA 1U8TA 4D98A 2ZB8A 4K05A 1KO8A 1U80A 1T4CA 4F8EA 3FR8A 2W00A 1FC0A 1I9GA 1VSVA 1UFVA 5EE1A 3H8JA 1MEEA 1RR6A 5CLFA 1T4GA 1M2GA 1ZNYA 4PX2A 4A0RA 3KKEA 5D1NA 5DGDA 3COSA 1RCFA 3KS9A 5H16A 5AYVA 2ZT8A 4BP8A 1Y63A 2I8LA 4M36A 3VR6A 3BMNA 3GA7A 4BAZA 1SKUA 1XVLA 2HDNB 3JQ8B 4RO0A 4V2UA 4ZICA 5TLSA 4IJKA 4CIAA 4CIWA 1R0XA 5JD4A 5FOTA 3D3WB 2D7DA 2O0LA 3G85A 2YL2A 5ADWA 1QC5A 3AYXB 3PWZA 5FEUA 4QOJA 1DWQA 4TUYF 1QGAA 1FRVA 4WFKA 3OCXA 4HRVA 2QVZX 4OLHA 4AZ0A 4BL5A 1IZ8A 1V6SA 4QPJC 3Q9SA 4CF6A 3ZNNA 4B2PA 3N2KA 1G20A 3MW8A 4GS5A 4J0CA 4C29A 2PMEA 1T5BA 4WSOA 1XZLA 3GRZA 3P9KA 1JHRA 1ZVMA 2E4XA 3OEHA 1CD5A 3QY9A 4BMOB 1F7UA 1IDOA 1JHYA 1IIBA 1OGYA 2V4ZA 3FX2A 4V0ME 5E6UA 4ARAA 1SCIA 4DJDC 1MPTA 2NZXA 1E3JA 1JYEA 1ZD2P 2HXYA 3QBVA 4LGVA 4X45A 2YKGA 2NV0A 2AKAB 3A6HA 4TLDA 1E63A 1WDWB 2Q4BA 5HKOA 2BHRA 1TUIA 2PGXA 2OHFA 3LV8A 2FOIA 1UBCA 3OCUA 3PV0A 4PFKA 3RRNA 2F62A 1RYHA 3EQZA 3IAM6 1XU4A 4OMCA 1YQTA 3WGKA 1P5HA 4D0RA 3OX1A 4JH0A 4GWKA 4Z7OB 2B82A 2NU9B 1QHYA 1D5WA 4L8WB 2GKOA 4EVQA 1BYIA 3EOZA 4MQBA 3ND7A 3ZY6A 3OU2A 3VVLA 3ZWXA 1UBKS 4OHRA 3I9V6 1J9GA 3UAVA 4EFNA 2DT8A 1PJ8A 1NBAA 3DAFA 2YASA 3OQ6A 4NOLA 4YV1A 5F52A 1ACJA 4DXDA 3MMPA 2QRGA 3EWAA 1WUKS 3GFSA 5DVZA 3TKLA 3VNAA 1VI5A 3VMMA 2EJVA 1DAKA 4GSYA 4I1VA 5LOVA 3QMWA 3IRVA 5JVDF 3MHTA 4BEVA 9LDBA 4MUJA 3LWBA 2NM0A 2GXSA 3UY4A 3H86A 1D1TA 3N6VA 5DOZA 2BEWA 3EGXA 3MD9A 1JEDA 1W1UA 3JVIA 2IU3A 4CMIA 5B5SA 5I8WA 1E3SA 2Y6UA 5DTRA 4EQZA 3H2IA 1R5OA 4QUJA 1CTQA 5L45A 4H7EA 5J40A 1RM0A 2FWMX 1D0VA 3DBVO 5HQTA 5I7WA 3ZD6A 1Y9JA 3F5QA 1BWQA 3GLQA 4HH4A 2WU4A 2BI4A 4E09A 3V4FA 2E55A 3CG4A 4L2IA 1DBVO 3CUVA 3I34X 5CURA 4F06A 3AP2A 1JZTA 2QV0A 1CE8B 1XD2A 3FOZA 5F9HA 1G4AE 1U9JA 4TZ6A 3FY4A 2HKIA 1BN7A 2FXIA 4DVJA 4M0KA 4QGSA 3NBAA 4EDHA 1M2FA 3EQ9A 1KI4A 4ESOA 4GSLA 4BCDA 4HH0A 3PVZA 5GM1A 3ND6A 4EM6A 5DYIA 1GTZA 2OBBA 1O5OA 3ZVRA 4ZZ2A 3F3SA 4RIFA 5EYPA 2Q6VA 3UMGA 3UK6A 3CB4A 1CHNA 3D4OA 4J1QA 1OZHA 1SBNE 4JVOA 1J23A 1Z83A 1EI9A 2CDBA 1CUFA 5HRAA 2H4HA 2M6KA 4HWRA 4QDKA 1UAGA 2JAHA 3A6FA 3A9RA 1XOIA 1ULHA 3PGXA 4WWHA 4Y67A 2GXAA 3R5SA 5FI1B 4B33A 1QCCA 5EAIA 3TW4A 3S40A 4QULA 2ZATA 3FCOA 3G9UA 1NXQA 3DZBA 2RKBA 1P29A 3NM6B 2NGRA 2FWJA 2XKBA 1W88B 3TVDA 2BCEA 1QH8A 3UAZA 1VIVA 2RGGA 3DNPA 4ECAA 1XU9A 1Q0HA 1A9OA 5FNVB 1T3ZA 2GOYA 4OA8A 2J9YB 5JS7A 4RU1A 4P54A 1EQUA 5IAOA 3OC0A 4EY4A 5IWCA 5FUBA 2N46A 5ALQA 4LJSA 2Q9BA 3E3MA 4Z2AA 4HGYA 2C99A 1A8IA 1UZNA 2C9OA 2P6NA 4CFZA 4AS1A 4JXZA 1GGEA 3IT0A 3NJ8A 4RY8A 5CW1A 1J09A 1UBJS 5DOVA 5EE0A 4IHKA 2PVSA 1C41A 3AJ9A 3AQIA 1KERA 3FF4A 3F8WA 4YV2A 4P0PB 1HORA 2EJWA 2OV2A 2CYCA 2O48X 2IW3A 4JLVA 2RCYA 3HB5X 1N0VC 2WNIA 3L0ZA 4KXVA 3T7DA 2RB4A 3TLGA 5CNJA 1X14A 2P65A 2IOFK 1T36B 2PZJA 1N2JA 2PUTA 3N0WA 3OE7D 4FFBA 5AR1A 3TQIA 1U63A 1IY9A 1Y8RA 4D96A 4O4HB 3WGJA 2Q4OA 2W4IA 3OHSX 2BGGA 4ZJPA 1E0DA 2V7XA 1ECJA 1YRAA 3QV2A 1D2NA 4NE9A 3SI7A 3MWLA 1GA4A 3GN2A 4XWTA 3VOAA 1UOQA 1ZYUA 4B2LA 4GXRA 4BMVA 1IZ0A 2YYYA 3UVEA 1FDWA 1RWVA 4BNLA 3IO3A 1BGWA 1P6QA 4FCCA 3GLRA 2XOEA 1HRKA 3K1ZA 2GVNA 3PKIA 4PNHA 3UJ9A 1ZM9A 4BU1A 2Y0CA 5F7ZA 2GM5A 1Y6JA 3T7IA 1EGMB 3ZDQA 2PL9A 4BQRA 3A9SA 1UBTS 1QHGA 4CM9D 2ZULA 1IY2A 4PSUA 2ONCA 4RGQA 1G0NA 1S4QA 3DHEA 4RHFA 5K6TA 1QYDA 4N01A 1N3YA 4IJQA 2J3JA 3C7TA 2P6OA 4MRAA 5K8LA 3TYXA 3USES 1PD0A 2FQYA 2PUWA 2VNIA 4CWAA 4RKEA 4CKCA 3W1VA 1NFQA 2I6TA 2QTVA 4KJZA 1A8SA 1BVYF 2YQZA 1TFUA 2WJVA 2Z8YA 3PGVA 4I4TF 4YI3A 3E8XA 4XDHA 4E13A 1WZEA 4JK3A 2PGNA 3HCPA 1T4DA 4X6LA 5DLYA 5DM60 5JDIA 2C0PA 4TS9A 1Z2CA 3VZDA 3C3MA 4G3XA 2WMDA 2R5WA 1H05A 4QNNA 4Q7EA 2GYVA 2SECE 3F97A 1E7MA 3B52X 5COBA 4AZ0B 2CLLB 4EPXA 5BN3A 1ONPA 4FLFA 5CB4F 3TOSA 1YBFA 1RBQA 2Q5EA 3LZ6A 4HAXA 4D4KA 2ODBA 5JCPA 4AP9A 3CISA 3VJRA 5AJHA 3KT8A 4WRRA 4ZAYA 1X86B 1IPEA 1N2CB 2CF5A 1TD1A 3K0AA 2AJBA 1REQB 1U0TA 1V3UA 2REQA 1MOSA 3OE7A 2QTWB 1V25A 4YP6A 3R9WA 2AEFA 3K0CA 2WIGA 1YS7A 1GZ5A 2VPXA 3C4VA 4ENWA 4PSKA 1XCLA 3G8AA 1D7AA 4KO3S 1YDWA 1Q0PA 3NFYA 4KG7A 2CUNA 1T2UA 3UTCA 5JRZA 2GZMA 4MX8A 1QDUA 3HC7A 2F8SA 2JI8A 3L8MA 1M67A 2F3QA 4EEXA 2DKNA 3C74A 5GONA 2Z4RA 2Y9PB 3M5DA 1ENZA 5KYGA 2DPLA 1DZ3A 1E20A 3GRAA 4UJ5A 2NQ8A 4P31A 1B8NA 4C22A 1PGPA 1G7TA 1KSGA 4OFBA 3VYUB 1A8HA 5HGXA 1P2GA 1O87A 4H1UA 4RBNA 5KDDA 4MV5A 2XLCA 3GFGA 4MDHA 3RT9A 3IDZA 1OFHA 2VT3A 1Z22A 1E1NA 2YZMA 3A31A 2F4NA 3EAGA 2FSGA 4DA0A 1CJCA 1R0ZA 3OKFA 1WDMA 3IUEA 5DI9A 3LIIA 1EM8A 3CMMA 3DKIA 4BQNA 1X15A 1QYWA 1N3LA 2D6FA 5DNDA 1G2PA 2DLNA 4G9EA 3IILA 4OBXA 1AGNA 1Q57A 4X7PA 4E6EA 5CBKA 1NUAA 1TGVA 1RHQA 2ZSKA 3CEMA 1U98A 3Q9NA 4HG2A 2I4TA 2TSYB 2W83A 2R8RA 3P9IA 1UJ6A 4NECA 4G5YA 2WYOA 2GNOA 2Q5FA 4XR9A 3KTAB 3NM4A 1RZ3A 3PI6A 4PS0A 2R25B 3PHCA 2A0KA 1KNQA 1YQUA 1FE8A 4MW2A 4H27A 2XD9A 2ZRIA 4MIOA 4RZUA 5I7RA 1QYVA 3AF0A 2HADA 1CLEA 1MX3A 3L77A 2HWXA 2NN3C 4J2TA 4RUKA 1OX5A 4IDNA 2HCJB 4ZC8A 4EUSA 4RD2A 2ZVDA 3DMDA 4ZRMA 4Q3AA 4C4TA 1I2BA 3R3XA 1QGYA 2B34A 3LQYA 2VUIB 5GTDA 1LPOA 2QNBA 1ST2A 2Z04A 3HJBA 4BRZA 5FFFA 4F4CA 2IBTA 1QIJA 5MHTA 3NW9A 2MINB 3U19A 3RNOA 3ICQB 2QTZA 4V0NA 1C7JA 2WF5A 2VNJA 2ZRPA 1YRLA 3S2SA 3WADA 4O1MA 1AA9A 3RB8A 2YY6A 1QH0A 4CHGA 4X0EA 3BA1A 3HP7A 1PWYE 2YVAA 5IC5A 3UMCA 3ZIAA 3GOHA 2ZRFA 5I9SA 2J46A 4QJ3A 3BK2A 2EXXA 2FPIA 4R3NA 2NO0A 1TVEA 5L3QA 3OETA 4EKYA 4GKKB 3P9QA 4FFSA 2FPSA 2NO4A 2HO5A 4ZO7A 3U26A 1A50B 2O0MA 1N6OA 1V5GA 1CZLA 5DM1A 4KPUB 3SJZA 1X7ZB 3OTOB 2JVKA 1GNLA 5G41A 4D82A 1WB4A 1QH8B 4K9DA 1RYNA 5ALYA 3BE8A 5FWYB 2IYNA 1T8SA 1XCBA 3EVBA 3L6CA 4M0FA 1J6UA 1LRKA 3FBGA 3WYDA 4RTQA 4K9NA 4KXYA 4C6TA 1HO3A 3NCHA 1WIWA 3S6JA 3WLRA 4EEKA 1BDJA 4XM2A 4JLJA 1T8RA 3EISA 3AY6A 4KAXA 5IKEA 3ZDXB 2QMYA 2YVQA 4B40A 2A35A 2ZI4A 1K88A 1LTHR 1OI4A 1TW3A 1OKKD 1IM8A 1WHTA 3PDJA 4OHCA 4QNRA 4DA6A 1XWWA 5KHOC 2ERXA 5IK2A 2UYQA 5AKGA 1C0IA 5DT2A 2A4KA 4G36A 1U2QA 2YWRA 4JU8A 3TLGB 1QYCA 3TSAA 1W0JD 2PO7A 3BCUA 1VL2A 2NUAA 4FFBB 4M9UA 2A3NA 1QNFA 2EQBA 2HRQA 3KSUA 1WQ3A 1BE8A 4J4TA 4IIFA 4OU5A 3S7ZA 4K2HA 4CUZA 1HDEA 3FHLA 1DE0A 5C2JB 1GZDA 2B1JA 3OT5A 4MQEA 2J33A 3M49A 1S2NA 4LJ6A 1DXQA 5REQB 3UJ6A 4E4TA 3JW8A 3T0GA 4DLYA 4FHFA 1FVOA 1EEHA 2YYAA 1ZH2A 2V74B 2Z30A 1Q20A 3MJVA 3W2EA 3K1AB 2QPAA 4M2LA 2HJHA 3L49A 5T8KC 4QPDA 1HOTA 3VC7A 3NKLA 4D57A 4D81A 3R7AA 5L4SA 1JDTA 5JXJA 3PJFA 2W6ID 3D2BA 3IGFA 4L1KA 1DFIA 1T5OA 4P4SB 3N7TA 4QTUB 3UXMA 1JNYA 1CRPA 5G0TA 1I3NA 4YK7A 1B2RA 2Z2XA 4ZI5A 5BPFA 5HTOA 1KOFA 2C61A 5TV2A 2M32A 3JVVA 4P5EA 1LNSA 3K5PA 1RXSA 4CV2A 2IQ5A 3AEZA 2H4XA 3GPCA 1BQ3A 2XRFA 5M2QA 2YS6A 1NLUA 5EMLA 2NUPA 3ZWYA 4CKCB 4DQ0A 3THRA 1E9SA 2QTVB 3GCWA 4Q9JA 3H04A 3EPPA 1J1IA 2AMFA 1NLMA 3CO5A 4MRVA 4UXIA 2VCYA 5JPIA 3ICEA 1GUYA 2VRCA 2GSWA 3F8SA 2V1UA 4IYJA 2X4DA 4X84A 3WE7A 3O2JA 1ZAKA 1Q0TA 5JAIA 1V1MA 1WEHA 4AX4A 2W8BA 1RE1A 2Z9BA 1IATA 3KRTA 5JZSA 1Y3BE 2C9BA 3NPMA 3OQVA 4HB2A 4DNQA 5BN3B 3ODPA 4JEMA 2PHZA 3A1TA 2MSLA 1HLDA 5L95A 4WKCA 1Q11A 2XUZA 5C1BA 5EIBD 3FPCA 1TYBE 2P68A 3EVCA 3BS4A 4EFMA 4REQA 1IVSA 1VG8A 1SQ6A 2G7ZA 3W6PA 1ZGCA 2QVYX 3MTDA 3Q6NA 1OXMA 1Z68A 3GFPA 4Y18A 3K0AB 4EG3A 5KC9A 5CDTA 1FP2A 2REQB 2PV0A 3O2QB 3V7FA 3VRHA 3LQQA 4D4LA 4MV6A 2GN6A 4B6RA 2E48A 1ADYA 2HHCA 5AD1A 3HEMA 3FYDA 3QPWA 4RCYA 1NN0A 5I7AA 2AC2A 3ANSA 5EE9A 1FSGA 3IH5A 2UZIR 3I62A 4PLCA 3T8YA 1DRUA 2WWXA 3L0BA 3SE7A 1EK0A 5GONB 3W2TA 3WLPA 5KOYA 3ICCA 4GQBA 3ZJTA 4QXQA 3CCCA 4M0EA 2GWHA