3QMMA

Structure of 6b, a thermostable mutant of bacillus subtilis lipase obtained through directed evolution
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
179
structure length
179
Chain Sequence
HNPVVMVHGIGGSSSNFEGIKSYLVSQGWSRDKLYAVDFWDKTGTNYNNGPVLSRFVQKVLDETGAKKVDIVAHSMGGANTLYYIKYLDGGNKVANVVTLGGANRLTTDKAPPGTDPNQKILYTSIYSSDDEIVPNYLSRLDGARNVQIHGVGHMGLLYSPQVYSLIKEGLNGGGQNTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lipase estA
publication title In vitro evolved non-aggregating and thermostable lipase: structural and thermodynamic investigation
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
total genus 68
structure length 179
sequence length 179
chains with identical sequence B
ec nomenclature ec 3.1.1.3: Triacylglycerol lipase.
pdb deposition date 2011-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01674 Lipase_2 Lipase (class 2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3qmmA00
3C8HA 1QIJA 2PU7A 2XQFA 4I3FA 3E0XA 2Z8XA 2CZQA 1QIFA 3HZOA 5E2IA 1LBSA 1MNAA 5J3JA 2FX5A 4X6UA 1R3DA 2ZJ7A 2QKYA 4ZV7A 1QIIA 1ZI6A 4FLFA 2XUJA 3SC2A 3WK7A 4ZXFA 2JGJA 4BP8A 3IA2A 3WJ2A 3QMWA 1CUVA 2OCKA 2QUAA 4QZVA 4PF1A 3H17A 4CG3A 1ZIYA 2PSFA 5LP1A 1UK8A 2V9ZA 1Q84A 3IUJA 4DMHA 2ACKA 1JMYA 4KE7A 4C4XA 2RIPA 4NS4A 4DIUA 3I1IA 3LIIA 1CUIA 3V1MA 3ESCA 1IMJA 1E8MA 3N0TA 3WKCA 1TKRA 3QZUA 2GBFA 5C8VA 3VVLA 1X2BA 4KRYA 3G0CA 1UOQA 1XZLA 1ZD5A 3HACA 2WU3A 4FNMA 3EF3A 4JUIA 5KBYA 1XRPA 1GGVA 1ZJ4A 5JZBA 1LPSA 4JYMA 2HA4A 1XQVA 5LZ4A 1C4XA 4BTLA 2HRQA 3IUQA 4C4YA 1XZBA 2O2HA 2ZSIA 5A7GA 3WA7A 1UKBA 3A2MA 2WKWA 1VZ3A 4Q05A 2XQJA 4UHCA 5FP0A 2ZJFA 1W75A 1XZFA 5BV7A 2WUEA 1Q0RA 4KACA 1B6GA 2QZPA 4HXGA 2BCEA 1MT3A 5JD4A 1AGYA 4HAIA 3N2ZB 1EX9A 2GYUA 3QPAA 4PO3X 1I6WA 1VXOA 5ALOA 1GXSA 5AI4A 1TQHA 4AO6A 1PJAA 4MYSA 3U0VA 1YB6A 3K2IA 3D2AA 5CT4A 3OURA 1NU6A 3DNMA 5AKGA 3M82A 4LXHA 5F4ZA 2C7BA 3G0GA 5AOAA 3VXKA 4DNQA 1UOPA 4MEBA 1LPOA 5JARA 3W06A 5EHZA 2WUFA 3ZV7A 4Y2QA 3GZJA 2WFMA 1QOZA 3P2MA 1HPLA 3W2TA 4BCDA 3KOOA 2VSQA 2BKLA 4L9AA 4HXEB 4BP9A 3F97A 4CCYA 1P0MA 2DSNA 2QVBA 4G8BA 3GUUA 4P08A 4BATA 4Q3OA 3IB3A 1ISPA 2RHTA 5AM3A 1ACJA 2ZVDA 1G66A 5FDFA 4UBKA 3W9BA 1XZKA 3WI7A 1BN7A 5HFNA 5I7UA 1ZD3A 4GI1A 3W9UA 1MAAA 1Y7HA 4WY8A 1TIBA 1UK9A 1BROA 1EDBA 4I4CA 4MQLA 2QJWA 5JADA 1BEZA 3V1LA 2XMDA 2PSHA 4QLOA 1DWQA 1GKKA 1YS2X 1MTZA 2XUFA 3QPDA 1EDEA 4UUQA 3QMVA 2AJ8A 5A71A 4S0XA 4GEGA 3Q8WA 3R0VA 5ALNA 1A8QA 1MNQA 1ZGBA 4ZGBA 5FXMA 1HKHA 1DQZA 2OGTA 4LKOA 4GWLA 4HXFB 4JYPA 1XZMA 2OPHA 1AC5A 5ALXA 5K5EA 5T4FA 5JAOA 3KSRA 4LYEA 5ISMA 5LZ8A 4K2AA 2VT7A 5AKLA 4DNOA 1FSSA 3C43A 1GQRA 1JT2A 3H2GA 2H7CA 5LZ2A 2AJCA 3G9UA 3RK4A 1FJ2A 1G5FA 4F60A 2DQZA 1EA5A 5DTJA 4IHAA 3WK8A 5HF5A 5EHXA 5LZ9A 1CLEA 1UWCA 2DCMA 2YXPX 2OAGA 4Q3KA 5ALVA 4H35A 2JEZA 2WFLB 4X3CA 3FAKA 1A7UA 4F21A 3VVMA 3D2CA 1AUOA 1YAHA 5A2GA 3PUIA 1J07A 3WKEA 4EHBA 2WIDA 4HTAA 4B6GA 2GZRA 2HM7A 4ARAA 3F67A 2AJBA 5K3EA 5ALIA 1ZI8A 4DSZA 2JIDA 2WUGA 3BIWA 5LIPA 4EY8A 3KXPA 5FUMA 4AZ0A 3ZI7A 3T52A 1B41A 5FLKA 5K3BA 2P8SA 1CUGA 3ZPXA 3EBLA 1DWPA 3AINA 4GXNA 1QE3A 5FKJA 3C6BA 3FVRA 5LKRA 2PM8A 5DNWA 2WTNA 4PNZA 3I6YA 4ZRDA 1YS1X 3JW8A 2WHPB 3I2KA 1CUAA 3QITA 1RP1A 4HS9A 3C8DA 2QJRA 4BDSA 5DWDA 3AIMA 1CUFA 3KDAA 2C4HA 1GZ7A 4Y2PA 4H0CA 4EBBA 3V48A 1JU3A 4X95A 4UBJA 3L1IA 5ALFA 2PSJA 4X90A 1XZHA 2PPLA 3TRDA 3BXPA 4PSDA 5BWBA 2YYSA 5DJ5A 5K3DA 4AMYA 4WCVA 3VKFA 2CBGA 4TPKA 4QEKA 5K3AA 2VEOA 1WOMA 5CH8A 5HF6A 5DYTA 3LIPA 3KD2A 3IBTA 3WL8A 1L7AA 4Y2SA 5I9IA 3L1HA 2QXTA 3I2IA 1D07A 4MWTA 3EIOA 3W04A 1CR6A 2OCGA 1MAHA 4K6KA 3HJUA 3G9TA 2QTBA 5EIEA 1R50A 1ETHA 4AO7A 4B85A 2BGRA 4DM7A 3DDUA 5KWIA 3R3YA 1XZJA 4HRXA 2Y6UA 1JI3A 3DKRA 2VJAA 3DOHA 1VE7A 5HCUA 5ALHA 4KE6A 4M0MA 4DGQA 1R88A 3I6ZA 4LXIA 3R3WA 3C5VA 5AJHA 1L7QA 2WJ4A 4J0JA 1SCKA 3G0IA 2BUAA 3DOIA 4N5HX 2HFKA 4OD0A 3STYA 4X93A 2Y2VA 1CV2A 1TCBA 2ES4A 2G5PA 2DQYA 4FLEA 1OCEA 3M81A 3NOXA 4J0KA 4C01A 5ALGA 4BE9A 5SYMA 2ONCA 1THTA 1DQYA 4FNGA 3RLIA 3WIBA 1TCCA 4OB7A 3ICVA 3O9MA 1G4HA 3IURA 2GYVA 1EHYA 3RKSA 4ZV9A 2H9YA 4WFIA 1AQLA 3UUFA 2EEPA 3HXKA 2AJLI 3PFCA 2XMQA 4MWSA 5JASA 1XRQA 1BE0A 1K5PA 2XUIA 2JGLA 1F0NA 3STWA 1CUSA 4Y2JA 3VDXA 2RGUA 3FCXA 1DTEA 3TGLA 2XLBA 4QDZA 2HL6A 4G4GA 3K9BA 1CEXA 3OM8A 4UFPA 3FNBA 3DD5A 2WHRA 4FLMA 3I2FA 2QT9A 1CPYA 4KEAA 3ESBA 2VJBA 4QE3A 4BVJA 1N5MA 5AIBA 4GHWA 4OB8A 1VZ2A 3ANSA 3IDAA 2JBWA 3HABA 3ILSA 4JNCA 3G02A 2ORYA 4B84A 1MJ5A 1WB6A 3RARA 5DLPA 2JGEA 2VT6A 3TJMA 2I3ZA 2O2IA 2X5XA 2OQVA 5E4YA 6YASA 4FFVA 2JGKA 2R11A 1XRRA 5YASA 4LYDA 2XUKA 2O2GA 3S8YA 4UBNA 2OLEA 3K6KA 2XUQA 5FPQA 2XUOA 4BAZA 2CKMA 4XVCA 4AB1A 4N8DA 2XMGA 1TRHA 2CUTA 2H7XA 4Q3LA 5JAUA 4K6GA 3FVTA 1WHSA 4C87A 3I1YA 5AK5A 4GDMA 2V96A 2XMSA 1QIMA 4BCCA 3LCRA 2OG1A 3FYTA 1FFDA 3OG9A 4J0GA 4U2EA 2Y1KA 1H2ZA 2BGNA 4UPDA 4WDQA 3HI4A 2QM0A 3DL7A 3WK6A 3ICWA 4M0FA 1AURA 3STUA 4CCYB 4B0OA 3GA7A 5EFZA 3STVA 1YSCA 1VKHA 2AJDA 3A70A 3PFBA 4UHHA 3FYUA 5ALJA 3WLAA 4OU5A 1WM1A 4G8DA 1CUBA 2EDCA 1RYYA 3WWPA 1IZ8A 1T2NA 2XLCA 4X00A 1A8SA 2HFJA 2ZYIA 4HZGA 1X70A 3OC0A 4CI9A 5IVHA 3MGAA 1DX6A 4XIIA 4W1PA 4AQDA 1QIKA 2C5GA 5SYNA 4UBOA 1XZGA 4AN1A 3H18A 1E8NA 3B12A 4IQ4A 4AMZA 4FHZA 4OU4A 4B9AA 1E89A 5CRIA 2VAXA 1MX1A 5ALRA 1EINA 1LZLA 3CN9A 1LPPA 2I03A 3PE6A 5JYCA 1XQXA 2X8BA 1EVEA 3DYIA 1VE6A 4ARBA 4ZREA 1DU4A 2WSLA 3AZPA 1R9MA 1TCAA 4PV7A 3WIOA 3MUNA 5LZ5A 1EVQA 2K2QB 1XLWA 4J0CA 4UBLA 5CT9A 3FBWA 4H7IA 2QUBA 3R3XA 4UHBA 1NU8A 5A62A 4MXDA 3HEAA 1TK3A 1UKAA 2AXEA 3L1JA 4BDTA 3E4DA 2YH2A 1U4NA 5CT5A 2PUJA 2W22A 1SFRA 3D7RA 2NW6A 1BRTA 1QO7A 5K3FA 3F98A 3YASA 3R3UA 1A8UA 1BEEA 4MEAA 3DCNA 1P0IA 2J3QA 4BCBA 3BL8A 1ZGCA 3D59A 5AHXA 2RONA 2GBIA 1F0PA 4QDXA 1GQSA 2XB6A 4J7AA 3NGMA 4OCZA 5FV4A 4WY5A 4Y2VA 1QIDA 1L7RA 3GFFA 3R41A 5AM4A 4EUSA 2I3DA 1R4ZA 2DFPA 4P9NA 1CUJA 5CMLA 2PL5A 4Y9SA 3STXA 2C0PA 1XQYA 3BJMA 5FRDA 2B61A 3A6ZA 1K4YA 2B4KA 4J0HA 3STTA 4ETWA 5JALA 2E3JA 5LLSA 2XQIA 3IIIA 2ZYRA 5ESRA 1H2WA 2V98A 2QRUA 1XKTA 2W6CX 4QLAA 5C7YA 4X6YA 1CUCA 2WM2A 1CUHA 2Z5GA 5A7HA 3BF7A 1MPXA 1XZAA 5ALQA 1AKNA 5ALMA 3O9VA 2HA3A 5HK9A 3HC7A 5JAHA 2O7VA 1Z68A 5ALWA 5AM5A 4C89A 2HA6A 1ORVA 1SCIA 1XROA 1Y7IA 2XUPA 5CT6A 1JU4A 4K5QA 3ZLVA 2Z3WA 4CCWA 1UFOA 1CUYA 2JGIA 1ODTC 1JMKC 1ZI9A 3HLKA 3GBSA 3WK9A 4QA9A 3PDCA 1QTRA 3C5WP 5DYYA 4G9GA 1DT5A 5KREA 4BE4A 1XZIA 5E4TA 1FFCA 2HDWA 1JFRA 5IVKA 3PI6A 5HK8A 4J3JA 5T4BA 4W1RA 1NX9A 5BWCA 1THGA 1DX4A 3LLCA 2XT0A 1VXRA 1T4MA 5C81A 1Q0ZA 3H0CA 1U2EA 5ALYA 1XLVA 3SK0A 4QDOA 5H3HA 1EB8A 3ANTA 5CW2A 3QYJA 1ORWA 4FBLA 1YA8A 1IVYA 4AN0A 4OUKX 3G0BA 1C7IA 3IUMA 1KEZA 4RE6A 4EB0A 5DNUA 1XRNA 4MQMA 3A2LA 3V9AA 2OGSA 1FFEA 1HDEA 3X3HA 4HVTA 2PSEA 5EIAA 3AIOA 3M83A 2HADA 2ROQA 2HA0A 4Q1VA 4UFOA 4FWBA 2C0QA 4CIAA 5CURA 4J03A 4PSCA 4BRZA 4H7FA 3OTQA 1N5RA 2WG2A 1Q83A 3S2ZA 1EI9A 4F5ZA 2WIJA 3WWCA 1LPNA 2BUCA 1PV1A 2WHQA 3O4GA 1R1DA 3DKKA 1H2XA 2GZSA 3WQHA 3F9CA 1EB9A 2CJPA 4EY7A 4YK7A 3AZOA 1EH5A 2XUAA 4U2CA 1LPMA 3GELA 2HA7A 5HFAA 5AKEA 5EI5A 1CUUA 2Y2UA 3C45A 1M33A 4ITVA 3U1TA 4GLBA 3IUNA 3RM3A 5HQ3A 1YASA 4A23A 3OPMA 3DS8A 5C8ZA 1LPBB 1SC9A 3AUKA 3CN7A 5AM0A 2Z8ZA 4KE8A 2ACEA 2C5FA 4FFWA 3EQ9A 1IUOA 4C6HA 4Y2YA 2WTMA 2WJ3A 5A7FA 2QXUA 4G1FA 4X94A 4CIBA 2RI6A 4UFNA 4BC0A 2GBCA 1J06A 3T4UA 3MVEA 3NWOA 4X91A 2D0DA 1QO9A 4G4JA 4GW3A 4M0EA 2WFZA 1N8SA 5JIBA 1U65A 1IUNA 5AOCA 4BAGA 2IIVA 4H7EA 2QOEA 4OPMA 3UMJA 3FWHA 1MO2A 3V1NA 4Z49A 3BDVA 3BE8A 3ESAA 3WKBA 2DR0A 3BJRA 1PFQA 5ALEA 2VJCA 3QVMA 3PUHA 3D2BA 5AI5A 2EDAA 2HU8A 1LBTA 5DNVA 4B80A 3CCCA 4UBMA 2VQ6A 2XMZA 3DQZA 1QFMA 1QTIA 5EHQA 3DEAA 1BCSA 1CVLA 1ZOIA 2G5TA 4CFSA 4X71A 2HHAA 4W9RA 4YPVA 3FYUB 1GPLA 1JKMA 2HU7A 5FPPA 2ZYSA 1F6WA 3G7NA 2D5LA 4OSEA 4DSAA 1DINA 3I2GA 4W1QA 1UKCA 3D3NA 4EY5A 4RGYA 1KU6A 4FTWA 4V2IA 4W63A 4B9EA 4EZIA 4FMPA 3ED1A 4G5XA 4RNCA 1QGED 4P93A 1OILA 2J3DA 1VLQA 5T4EA 4INZA 4EY6A 4KE9A 4AO8A 4L0CA 3HSSA 2ECFA 3Q0TA 2FJ0A 3WWEA 2FJPA 4X92A 5D3ZA 2J4FA 2VATA 5EGNA 2H1IA 5FOQA 2WUDA 4U2GA 3H1AA 4N8EA 4B83A 5IKXA 5ALDA 5ALZA 2LIPA 4OYYA 2HU5A 2XMBA 4BVKA 7YASA 1ZD4A 5AKKA 5AKXA 2UZ0A 3O95A 1HQDA 3H2HA 1SOMA 2WG1A 5JATA 3WK5A 1QLWA 4WJLA 5ALSA 1XZDA 5K3FB 3VJKA 2QMQA 4BB0A 4P92A 5DTIA 3I28A 4J0IA 4H77A 3WK4A 5AP9A 3M3DA 2VF2A 3G9ZA 1BU8A 2PSDA 2PVSA 3WKAA 4G8CA 1JJIA 1EK2A 1TAHA 3BWXA 4H18A 1LLFA 2WIGA 3WL5A 5LYYA 3G8YA 4B82A 3ESDA 3LP5A 4FDMA 4X97A 5AM1A 1VA5A 1DWOA 1YAJA 3CCBA 2RAUA 1UOOA 1H2YA 1JJFA 3WWDA 2HIHA 1W1IA 4UHEA 2PUHA 3VISA 1VJ5A 3WZMA 1EXWA 2IITA 3AZQA 4Q82A 5LKAA 1F8UA 4AZ3A 1E66A 4L3WA 1LNSA 1AMNA 1CUDA 1J2EA 4GBGA 5LZ7A 2WU4A 5CXXA 2G4LA 1EK1A 3I2JA 1MU0A 3C6XA 4WFJA 2XI4A 3H19A 4U2BA 5CBKA 4Y7DA 5ALLA 4LIPD 5EHNA 5AKZA 2DHCA 4DMCA 2BAGA 2BUBA 3I2HA 1YCDA 1YR2A 4N5IX 2RHWA 1UT6A 3C6YA 2XE4A 4WFKA 4ZI5A 5JD6A 2CMFA 2VAVA 4JH0A 4IH4A 3SX4A 3EQ8A 4XX1A 4H7HA 4NZZA 5HF8A 5AKHA 3WMRA 3D4LA 2B20A 5CT8A 1R9NA 3ZLUA 5IVDA 4XWGA 4IH1A 1W4LA 4JEIA 2O7RA 3H04A 3B3QA 2JGMA 1ODSA 1ODCA 1AX9A 4RE5A 1GPNA 5AKJA 1OXMA 2X76A 1UK7A 3EQ7A 2VA9A 3G0DA 1YA4A 3QMMA 4XJVA 1N1MA 2BJHA 3FLAA 2JGFA 4H7JA 4H7DA 5AH0A 4BZZA 2ZJ6A 1WPXA 2PX6A 2OAEA 3D0KA 2XUGA 4DYHA 1GT6A 1LPAB 1S8OA 5AKYA 5JZ9A 1XZCA 1CFJA 4QWWA 5JD5A 1XQWA 4OYLA 5JZSA 3WL6A 2WIKA 4J0DA 4TGLA 4UHDA 1WCYA 1GKLA 4YX9A 1XKLA 5HF9A 1XFDA 1SCQA 5I8PA 3FSGA 1CRLA 1ZD2P 2WLSA 3FOBA 4C88A 3H2KA 5AKIA 5HKAA 1WB5A 4F0JA 3PF9A 4KYVA 2XMCA 5CXUA 4BVLA 4ZWNA 1K63A 2VJDA 2OGZA 1JJBA 4UHFA 2WJ6A 4NMWA 2WQZA 3GROA 3WYNA 3E3AA 1O6FA 4MJ3A 3BF8A 3IVMA 2WIFA 3G9XA 1IZ7A 4OB6A 5ALTA 2H7YA 1VA4A 3FLEA 1CUEA 4X7BA 2QR5A 4BYMA 4QDUA 3TEJA 3BIXA 3V1KA 4EY4A 3A2NA 4QWMA 5JANA 3QH4A 3MUOA 4BBZA 1W6RA 2GBGA 4PQEA 2YASA 4X6XA 1HL7A 2HA2A 5ALUA 1GPKA 5AI6A 1EDDA 1O6GA 4IH9A 5HQ3B 1CUZA 3OOSA 4C4ZA 2J4CA 4DLNA 3WA6A 2PBLA 3DYVA 5E4JA 1XRLA 2JF0A 4DNFA 3FSGD 4BTVA 3WL7A 3KWFA 3H2JA 5ALPA 2WG0A 1BS9A 4DMKA 4QNNA 3O0DA 3HYSA 4GECA 4AXBA 5AI9A 3VJMA 3WZLA 4KJXA 3I6MA 1ZIXA 3WJ1A 5AK3A 1USWA 1XRMA 2PKYX 4DMFA 3O4IA 4U2FA 2HRRA 5D6OA 1K6EA 4D9JA 4Y2UA 2XUDA 3KWJA 1MX5A 1CUWA 5T4HA 3AILA 2ZYHA 3R3ZA 1E8DA 2DHEA 1W52X 4E11A 2OCLA 3QPCA 4E15A 3O4HA 1WB4A 1E3QA 2JEYA 5ALKA 3ZWQA 4B0PA 3DJYA 3H1BA 1KU0A 2Z3ZA 1XLUA 3DL4A 5CH5A 1ZICA 4BZWA 3QM1A 1ZJ5A 3HRHA 4QDTA 1DT3A 1BCRA 4K6HA 3JWEA 4BAUA 1W76A 5CH3A 4DTCA 5D7BA 3WWOA 2Y6VA 2G63A 1UXOA 1HBJA 4YASA 5HZGA 2XMRA 1H22A 4KAJA 5AK4A 4G4IA 1QIEA 1QJ4A 4G9EA 4L72A 4U2DA 1CQZA 3H2IA 1FFAA 1HLGA 3WYDA 2HA5A 2OCIA 1Y37A 4Y2TA 4A5SA 4I19A 4A16A 4W1SA 3C87A 4N8SA 5A6VA 3AIKA 3WKDA 1MX9A 5C8XA 1CUXA 1ACLA 1QONA 4O08A 3ZLTA 1UK6A 4FBMA 5IVIA 3UUEA 3AFIA 2CEKA 3IULA 3SWWA 1RWQA 1E5TA 2WFLA 5AICA 3D5EA 3C6ZA 2PU5A 1WPRA 5AOBA 1YB7A 3DLTA 4CG2A 1CQWA 3PICA 4AX4A 1IUPA 2GYWA 5AK6A 4FOLA 4KR0A 2XQKA 5AI8A 4BC1A 1P0PA 5KWJA 2C58A 5D3KA 4TVKA 3F96A 3F8SA 4RPCA 4LHEA 4Y2RA 5DYWA 3R3VA 4PSUA 3B5EA 4E46A 3LS2A 3FCYA 4E14A 3W05A 3AJAA 3O4JA 1C7JA 2R8BA 3R40A 4KAFA 4B81A 2VTVA 3E1GA 5AM2A 2B9VA 1G42A 4EA6A 4CG1A 1P0QA 5IH7A 1WHTA 2WHPA 2WILA 1QFSA 2XDWA 3C70A 4WDRA 4NVRA 1VOTA 4UBIA 1J1IA 1BN6A 2OQIA 4HRYA 5AI0A 1XZEA 4BRSA 4KAAA 5HKBA 2CB9A 1UZAA 4Y2XA 2XQGA 4MYDA 4FKBA 2DHDA 3QBJA 4IO0A 3PF8A 1AZWA 3NUZA 4ROTA 2OXEA 3VJLA 3BDIA 5EIHA 2FUKA 1A88A 1LZKA 5CTAA 1QZ3A 1QIHA 3CXUA 2IX9A 4KRXA 5AO9A 4X85A 2I78A 4H7KA 5BOVA 3JYHA 1H23A 4PW0A 4DNPA 1CIJA 1K8QA 3FLBA 3FYUC 4B7ZA 1X2EA 4LXGA 1FFBA 2V97A 4Q34A 2ZSHA 2BFNA 2XUHA 5AIAA 1MN6A 5K3CA 5JAPA 1QIGA 2Q0XA 1LGYA 1U8EA 2QS9A
chains in the Genus database with same CATH superfamily
4EHJA 2HTEA 5JCZA 1ZUHA 2ASVA 5ESWA 1T3ZA 4PLCA 3STHA 4RK0A 2Q1TA 3E03A 2WKPA 1G8HA 3NTVA 3LUAA 3L77A 1LQUA 4I3FA 1WA5A 2IUFA 2YFKA 2QV7A 3E9ZA 3H86A 5B1YA 1QOQB 3ZLBA 5CEFA 1TKBA 3NBUA 4N0EA 4J76A 5G3YA 1N77A 3QG1A 2ZPUA 4AJNA 4OXXA 4I2NA 1QK3A 1MNAA 1GL9B 2NU7B 4JCOA 3ZY5A 5HUQA 2FXVA 2BH2A 3FPAA 1PG2A 3ZVLA 1KC1A 2CVOA 2FX5A 4Q9LA 2OZLA 3BMCB 1XVAA 2V7VA 4I5IA 3NH9A 4X24A 4NE7A 1TO2E 4IFEA 1QC5A 4C7BA 3AF2A 1WNTA 4XIJA 4DHWA 1QLJA 1AKYA 1B0ZA 3F7MA 2XIQA 8ADHA 1V6CA 4ZVTA 1FRFS 2Q4RA 2NXNA 4PZAA 4D9HA 4S1TA 4TSRA 4B2PA 5ICEA 3I53A 4ZQHA 3V33A 1PR2A 2YL2A 3O3MB 1QGAA 4MH0R 3SC2A 2D74A 1U3TA 3C97A 2HLDA 4W5QA 1G20A 2ZJZA 1A5ZA 3F47A 3MN1A 4BHTA 3AHIA 4EH1A 3FGZA 3IKLA 4LOLA 2DTXA 3BE6A 2BVNA 1KYYA 4JZKA 4KU4A 1JG1A 2VNIA 4AYXA 3T5CA 1RI4A 3BMXA 5HX7A 2ZFUA 2H2HA 3V1UA 3MMZA 2JATA 2WFAA 2PS9A 4EG0A 1OBHA 3SZ3A 4J1NA 4QVKA 4PWYA 3RUPA 2JIOA 4YCAA 5IEBA 4EG7A 5EIOA 4RTJA 3EZFA 1T9BA 3PGA1 4RZ2A 4BWFB 5DM70 5ADWA 1AS2A 4PF1A 1YDHA 4LJ4A 1VFNA 3H17A 4M83A 5L7YA 2ZCJA 2Q1WA 1YVRA 3OFSA 4QO7A 1ZIYA 2AUNA 1CERA 3EZLA 3B3FA 3PJRA 4QQFA 4EJMA 2GX6A 4CCAA 3NKLA 3ZWAA 2GM4A 3E82A 4C4XA 3PUVA 5TARA 2C3YA 5DE3A 4JBHA 3PXUA 1M1YA 2XY4A 3IQFA 4NE9A 2INGX 4PONA 3W7BA 4DIUA 5EXTA 1NKSA 3TTUA 3KAQA 3SZUA 4F46A 2H0QA 2G25A 3I9V6 2P2SA 1K6XA 2DBVO 5GM2A 3N3AC 3LIIA 2AI2A 4ZT5A 4A4DA 4OXRA 3COSA 4RPIA 4XGRA 5I8WA 3OZEA 3VR2D 3V1MA 3N39C 4ZDIA 3LPCA 5KTMA 5ED4A 1IMJA 2QU7A 2R6GA 1E7YA 1HFEL 2X8LA 2NZYA 2CVZA 1DAGA 3ETDA 3W8DA 1XCMA 3WTCA 1Q0LA 2GBFA 5E38A 2C7GA 3P9YA 2XZTA 2H07A 4XJTA 5TRTA 3ABOB 4DVGA 1E3MA 5C34B 1J09A 3CEPB 4D02A 4YV0A 4JMPA 1KO8A 2GZMA 4C7MA 4D8WA 3IKTA 2C5BA 5PNTA 4D4KA 1O9HA 5SYAA 3DBLA 5D8DA 1TTTA 1V3UA 2OESA 5HVNA 5GONF 1IIBA 4EGSA 2JIMA 3CLTD 3ETCA 3D1VA 1ML4A 3HCRA 3MUEA 1IN4A 2QUIA 5F2KA 3WHKA 1L6IA 2VNKA 4PG4A 1BH6A 3IVRA 5G3ZA 1FFGA 1D09A 1RPAA 3KT3A 1XRPA 1NSTA 3RUDA 3HPRA 4YCLA 3ZKWB 4XASA 2JJ2D 2QTMA 2A92A 2E4YA 5GIPE 2WWHA 1QOPB 2YJ3A 2BOVA 4MVJF 5LZ4A 1C4XA 1JILA 1OTYA 3R5JA 4BTLA 1ODIA 2HRQA 2JAOA 1W94A 5ENZA 3ZHXA 5DGTA 3WA7A 2UKDA 4LEIA 4BV3A 2WKWA 3UTDA 4DLLA 2W2QA 3N2YA 1HLPA 4XQ0A 2FZGA 5E9AA 3K1YA 4JI3B 4AECA 5BSWA 3LLMA 2AZDA 3PU6A 1VZ3A 4LZJA 4C2BA 2E2WA 4NATA 4UHCA 1Q1QA 3T7RA 2YHSA 3NT2A 2NZJA 2IVFA 4BUCA 3CQ9A 1FNCA 1W75A 5CUQA 2WUEA 1Q0RA 2QTVB 1OU4A 4E3ZA 1C0LA 1CZKA 3KRTA 7AT1A 1TF2A 2RCNA 2WTXA 3K6SA 1VJGA 3WADA 1QF9A 1WWKA 3D7LA 3FNQA 4CKWB 4B47A 1QMGA 2BCEA 4BLQA 1MT3A 1RQXA 4FFBA 3WIVA 1GILA 4AP5A 4YYZA 1NN3A 1UBKS 4TZ6A 4JSRA 3S1LA 5JNLA 3N2ZB 1SD1A 3C6KA 1M10A 3PUWA 1EX9A 2GYUA 5DTQA 3SYLA 4ZI7F 3M6UA 1JAYA 1P18A 4PR3A 1P7ZA 4RV9A 5ALOA 3HB1A 2SCUA 4ZI7B 2FG7C 4GI3A 4U0JA 1G64A 5BWMA 3RUEA 2H57A 5A0TA 1PTJC 3U0VA 2OFOA 4IJVA 4HDCA 5DHFA 5FBVB 4PSVA 3D2AA 2X7JA 2O2SA 2ZG6A 3PDIB 3A9WA 1ZKDA 1NU6A 2AQHA 3BXGA 3KZNA 1B42A 1BHQ1 1W87A 1GL3A 1Y9EA 1C7ZA 2GLUA 2UZ1B 1EUCA 1SBCA 2Y1LA 5TPWB 2VWGA 5F2EA 5AWFC 4ALMA 2BFFB 2BZ0A 2KW5A 5IKMA 5IT4A 3K70C 1NW8A 4MYTA 1IY0A 2BCGY 4H3HB 3MTBA 4WGGA 1N5JA 3NC0C 5C8YA 1V5EA 4PTLA 1A2OA 3J81A 4RTQA 4KR7A 3IFSA 3KUDA 3O1IC 6AT1A 1LC3A 4YT8A 2V03A 1NJFA 1K88A 3RWMB 3IP8A 4BYGA 2UDPA 3U80A 2XA1A 4A8JA 3GMDA 4FP9A 4U2KA 5KNCA 2PLNA 2X7HA 3ORSA 1RWVA 4KQKA 4Q9JA 5M7EA 4KR2A 2X42A 2JCSA 3WO0A 2CMKA 2G4VA 2Q7DA 1E1KA 1SA0B 2AK3A 2C2XA 4CKZA 2O06A 1YQXA 2RCYA 3DVQX 3QTBA 4XQCA 5CLLA 1ZC3A 3I0ZA 4IV8A 1QOZA 3H9CA 2OZPA 3HXTA 4C7JA 2NMVA 3U3ZA 1LVHA 4IHJF 2P8JA 3P9RA 4BCDA 1M0EA 4WBSA 4GVLA 3MXOA 4IHJB 4RLSA 1QDEA 1DCTA 1N78A 5D5HA 3KOOA 1XTZA 4QUGA 4KN6A 1QK5A 4M76B 1QRDA 2M9MA 3K5PA 1TJPB 4FDTA 4F5YA 4DDWA 4BN4A 4EKYA 4G63A 4M9XA 1D6MA 3VA7A 3SVZA 4UMFA 3A36A 4YYEA 2ZRBA 2I3AA 2BLLA 3KDPA 3EW7A 2FWNA 4JVNA 3F97A 5CB6A 1ZK4A 2BT4A 4Y9TA 3ZHBA 3PHLA 4YCBA 4ECAA 4E09A 4DJTA 4DDTA 1PNOA 5MN5A 1DQPA 4IILA 4BWVA 4QXQA 4QOJA 2R8XA 2WYUA 3PXGA 3OU6A 4FOPA 4Y6SA 2VDWB 2WPDA 4DZZA 1DP4A 8LDHA 1G6HA 4FCCA 2IDKA 3RODA 4PN7A 1H05A 3ROMA 2OB2A 2ZVDA 1JVBA 1F7UA 1WV1A 1TFUA 5FDFA 1K08A 4KNWA 1SGWA 5DFAA 5LA6A 3WLHA 4O2LA 1LTHR 1CF9A 1L4UA 5HFNA 1OWPA 2X2FA 3C5CA 1N34B 2RAVA 1NT2A 3VPBA 3W9UA 1U8XX 4OMUA 1ORTA 1ONSA 1PWHA 1SU6A 2V0NA 1SG9A 2PUVA 4WY8A 2FN9A 4DYVA 3MGKA 5BMVF 5IULC 1LVUA 3FMIA 5LQCA 4XTRA 1ZXLA 1KI6B 2A4MA 5BMVB 1EFRD 1XMVA 3DTVA 4KLAA 3WMEA 3MQ4A 2REOA 1FRQA 1REQA 2WWIA 4N47A 3ETNA 1WXDA 1NWHA 5CW1A 3C3MA 4HY3A 1ZHOA 1A5AB 1C29B 4GMFA 1J20A 3KL2A 4NCHA 1RWWA 4I5DA 1LJ8A 1UKVY 3NJ4A 4QQNA 4BO9A 5KYWB 2NO1A 2ZITA 3TW8B 3L7OA 4ZMBA 4YUWA 4OXKA 1OW3B 1O9GA 2XMDA 2PSHA 4HL6A 2C2BA 2FVXA 4QLOA 4B6JA 1AGXA 2HUNA 1MTZA 2LW7A 2PZLA 1EDEA 3H5NA 3RABA 3WJAA 2X4DA 3NHMA 1JV2B 2A7XA 3CR3C 3QMVA 5IDQA 4PAGA 2JFFA 4TM8A 5ED0A 1RBZA 2QLJA 3R2JA 4GEGA 5GAJA 3IEMA 5TQ0A 1UQUA 3GT3A 4HNAA 4XAQA 5ALNA 3OJWA 4PQGA 4Q47A 4NAHA 3GYGA 1CWUA 1DAKA 1I2AA 3FWYA 1IYZA 1ZGBA 4ZGBA 3LG2A 1MF7A 1UXJA 5K9ZA 2ZIUB 1WZCA 2ZUBA 2OGTA 1OX6A 2XDAA 5JXWA 2EGUA 1QVVA 2A86A 4JYPA 4WESB 1XZMA 2RAPA 1O3YA 3B7GA 1FXUA 1AC5A 4D2IA 5AUPB 2II6A 1HSOA 3N5CA 3D31A 3UGJA 3TFQA 2PTGA 2VT7A 5AKLA 3PHJA 3O8DA 2BDTA 1BHJA 1DAMA 1IXRC 4S2UA 3SXUB 2PX5A 5DB4A 1FSSA 3WDKA 4RHXA 1OH7A 3SHVA 2GEVA 3U37A 3CSDA 4E4TA 1RIIA 3ND5A 5LDDC 2KLHA 3HG7A 4C3UA 4X60A 3AEKB 4JDPA 4XRGA 3JR3A 1JT2A 1NRXA 1M1UA 1H5QA 2H7CA 3H2GA 4IOJA 3VPFA 2CNOA 7REQB 1T2FA 5LZ2A 3UAXA 1E7QA 2AJCA 1YTUA 4U63A 5L3QB 1WSBA 1T24A 1FJ2A 2Z2KA 3NM5A 2WHYA 2VDKB 1G5FA 3KKPA 4IIBA 5BN4B 2B69A 2MR6A 1USUA 2QROA 3E5RA 4FYPA 5UKDA 3VGJA 3AF5A 4MDYA 5JV5A 1ZKMA 2CJWA 3AO0B 1K7EB 4JYBA 1G8JA 5CAEA 3LY8A 3QXSA 3WK8A 3V7WA 1BJTA 2I7TA 4RLQA 1FTSA 3PWSA 1NVXQ 3N75A 1F12A 3GW8A 3INGA 2DCMA 2YXPX 4GXQA 1NVVR 3FVVA 4JOSA 3LC0A 3OE1A 5CDFA 2OY0A 4Q02A 2ZRKA 1UFVA 2AUTA 2JC3A 3IP7A 4TTPA 4LZLA 4ENUA 2C5HA 3FAKA 1UT5A 1X7GA 2EYQA 1GTVA 2J3EA 4XOIA 1DIGA 3BJEA 4D0SA 5C1PA 4F21A 4ENRA 5A3RA 4NDAA 3DV0B 2QRMA 1BU5A 3R1IA 1AUOA 1Z28A 1GPMA 2XNCA 4RO0A 3TW4A 1GY8A 3AL0C 1XTUA 4U7WA 2PCLA 2QRZA 4ZJUA 9ATCA 2XDQB 1J07A 3WKEA 1PDVA 2P90A 3B9BA 3KEQA 3SQLA 5HZKA 4V03A 2F1RA 4KNVA 4CM4A 2WIDA 3LUHA 4DS3A 3P9IA 5KHLB 1AO0A 4OHXA 3CJRA 4JP2A 4B6GA 1SXIA 1TQ4A 2GZRA 2QRGA 2N3ZA 3C16C 3C7KA 1TYZA 4DM4A 3ONDA 2ZWAA 4NPCA 4DWOA 2G6BA 2HM7A 2PT7A 3WHIA 4ZP1A 2BONA 1U8CB 3LP8A 3CNLA 4ENTA 4WAUA 1SIWA 4BNDB 5F9FA 2JBAB 4WMLA 3OPQA 3EDCA 4A8TA 4MB6A 5F5LA 2GSDA 2Q27A 2RC6A 2WUGA 3AR7A 3O94A 1P73A 3DEZA 2IPMA 5KVVA 2OBLA 4D45A 5LIPA 1JEEA 721PA 3HJHA 4BZPA 2G36A 5FUMA 3QVTA 1ZUNB 3SZMA 4PIMA 4WK6A 2AG6A 2VS1A 4F7WA 1EFTA 3T52A 1B41A 2XCUA 1U7HA 2OB1A 3R7WA 1QG2A 3BB3A 4M8NE 4PC2A 1CUGA 1MV5A 2GTIA 5JY6A 3QWHA 1PRYA 3AINA 5K6AC 4P7FA 2NYAA 3LXXA 3VM6A 3SF8A 5FKJA 5EA2A 2ZJ3A 1F60A 1ZJYA 2RDMA 2ZDHA 3C6BA 3W9SA 2IUTA 3FVRA 2G6TA 1W36B 2ZZMA 1XTSA 1K75A 1U3WA 3JAKB 4P3OA 2AT1A 2WTNA 4B7CA 1S1CA 1WHTB 4AKIA 5JSZB 3JW8A 4TKZA 4GZMA 4YJ2A 4QD3A 5BXQC 3AUFA 2RHOA 3P94A 3PQ3A 4K2HA 1N2ZA 1CUAA 2O7NA 1RYHA 3QITA 2D1FA 3T61A 4WL0A 3TO5A 3CEAA 3OE7A 2QJRA 2CV0A 1T9CA 1ZVMA 2IEIA 1IMOA 4ECEA 4ZIRB 3A3YA 3A1UA 3KDAA 1UCFA 2BGIA 3VHRA 5AVWA 4XVHA 3JWJA 1HURA 3LFHA 4LJAA 1V8ZA 2JJYA 2UVPB 1Z3IX 4HN4B 4QYIA 4TTSA 5F78A 2WP8J 2KLBA 4EUFA 1NW5A 2CVQA 1GA4A 1E1CB 2FHSA 2QNIA 2DLCX 1LFAA 1US8A 2CLSA 2Q2NA 3O2QB 4D4MA 1GCAA 2VP2A 3SSMA 3PR1A 1Q7GA 2EHJA 3KQMA 1GCOA 2IXDA 2WVGA 2AMVA 2H2WA 4LRWA 4UBJA 5ALFA 3UPDA 3ZY2A 1J5EB 3OUTA 4TQAA 3BA6A 3JYQA 5M04A 1XMSA 3PNLA 3SJBA 1FTNA 5GVRA 3ADDA 3BXPA 3FDFA 2K6GA 2I66A 3HGMA 4UNPA 4F85A 2V3WA 1I32A 5EVCA 2BTEA 3WQBA 2ZI3A 5K3DA 1S2LA 4HS4A 3I73A 2I7VA 2C5EA 5E2AA 5SY4A 2XW6A 4HGZA 4BKPA 4CIVA 1IXSB 4M1SA 4QEKA 2AKEA 1G21E 2Q2VA 5GJCA 1QZUA 2J5XA 3GEPA 3WFJA 1GNSA 3VHQA 1UOEA 4TMTA 2Q5FA 1L5SA 2ASEA 4PXAA 5JNSA 3SSAA 4F91B 4Y9RA 4GI2A 1P5ZB 2GF2A 1BXRA 2JLSA 3JQGB 1L7AA 3L7DA 2OV1A 4GVPA 1Z17A 2OC9A 2X22A 2XYGA 3ISTA 3W4IA 4P3YA 3L1HA 5BRNA 4E5VA 1ZH2A 5DBGA 5A9TA 1GN8A 2W2MA 2MYTA 2O05A 4N40A 1M2WA 2VH1A 4UVIA 2D4AA 2HNKA 1D7OA 3GPBA 3SKYA 2YRWA 3W04A 4MB0A 1KQ3A 1QDLB 4G5GA 2IKQA 4KAXA 3WL3A 2QUKA 1VSVA 1FDTA 2OCGA 2V7QA 3PDUA 4DLVA 1E92A 2RB5A 2BJWA 4MUJA 5KPJA 4W9MC 3SBEA 4DABA 1T1EA 3S7TA 1YR3A 4AMUA 5C1OA 4AQYB 1ETHA 1BXZA 1J8YF 3VNAA 3U4CA 1FYVA 4JSTA 5C0OE 1M9NA 4JWTA 3RSCA 1G1MA 4R8KA 2CVHA 3G5MA 2BGRA 3A11A 1OQAA 3T4EA 3PV0A 3ZDRA 4BLSA 4BLVA 1SUAA 4QRIA 3VOTA 4I55F 3IILA 4RVNA 1M2KA 1U0SY 4WFQA 4IVPA 4XUEA 2A9FA 1ORIA 1GNQA 3SE0A 1LW6E 1M8FA 3EGEA 1AHNA 2H4JA 2ZROA 4B3JA 1WABA 3DKRA 3T0IA 2YN0A 4R8MA 1Z62A 4RZ3A 3ZYCA 5ITZA 3OCVA 1G0NA 1NI4A 2GJ8A 3DOHA 4TYWA 4WVLA 4DIMA 2NO7A 5ALHA 3SM3A 5LQSA 4O5OA 3OQJA 3ILXA 3G1WA 4FZRA 3A3OA 3HHEA 1R88A 4IEEA 2QU8A 1MORA 2P79A 1C3LA 5HA5A 4HH0A 4CMEA 4DV3B 1YDMA 2CXPA 1P2SA 1WL8A 4MPJA 2PX3A 1XUOA 3H11B 4CQMB 1SHJA 3BE4A 3P2IA 3VZPA 2EBHX 2BFOA 2WJ4A 3R7AA 3TSZA 3HDGA 4J0JA 1L1QA 2ODBA 2JLXA 1JG2A 1TVKB 1P19A 1KNXA 2M32A 3IBGA 4KL8S 3I12A 4PZPA 5HJEA 1E61A 4PHHA 3U39A 4Q1AA 3E9DA 2J9XB 4CT4B 2BJVA 1CJVC 2FPSA 3DO6A 3KQPA 7MDHA 2BKXA 2C2HA 2JGRA 3U16A 1BX1A 1PUIA 4X93A 4LZAA 3T8YA 1TMGE 4EYEA 3COJA 2G72A 4ZQBA 2CJFA 4CETA 1A04A 4LWZA 3V32A 5LNK1 1B23P 4KBGA 4YMGA 1WD7A 3THXB 4MJLA 4XUCA 1JZSA 3OJ0A 3X1XA 5L4NA 1FU8A 1OI3A 3TLYA 3EG9A 2G1UA 3TOZA 2J0SA 4TYQA 4TMVA 3KEMA 2CLMB 2XCIA 1TZJA 4G1EB 2Q1XA 1MHPA 3EMVA 2WBLC 1NQXA 2GK7A 1EVKA 5MFZA 5JBQA 1V1MB 1YZ3A 5KIAA 2OEPA 5BVGA 3CX3A 4BE9A 3MBIA 2BMWA 1G9SA 1XAGA 5SYMA 5COBA 2KBEA 3JD1A 2V1XA 3ON5A 4B3CA 4QNRA 2E82A 3T0GA 2XITA 1RM0A 1YZFA 5KINB 2QTHA 2GNPA 1KZ6A 2R4TA 4Y6OA 3DGFC 3V4PB 3WIBA 2GXQA 5FOSA 1ZJ6A 3DZIA 1PJ8A 2FQ1A 5AJZA 2B5VA 3OQ6A 1M7BA 2FQWA 3O9MA 4YRPA 5C5EA 4EG5A 1DTWB 2JI9A 1PFYA 3FYHA 3KLNA 4L5YA 2HDOA 2C1EA 2MSNA 3IURA 2FK7A 3LOPA 1YBHA 1M6EX 5EZYA 3WZ2A 3WYCA 4XM1A 1KMMA 3RQSA 3BULA 3DEHA 1TK9A 1JAZA 2JKZA 3BGSA 1MO5A 2BFCB 2PGDA 1SB8A 1K4KA 2PZ8A 4KGVA 1WOYA 4FE7A 3W1WA 4R71A 3C7DB 3QQPA 4II3A 2DPYA 1DXHA 1BGXT 3GQBA 3IAM1 4LC1A 3RTDA 2AJLI 3FJYA 4JYZA 1A72A 4MWSA 2ATCA 4ZCIA 1QRTA 1CR1A 3KBBA 3ZZUA 1D2NA 3IUPA 2R62A 3D6HA 1K6JA 5JT1A 1F0NA 3ASVA 4MGHA 1MENA 3QYPA 4US2R 4LXYA 1NYTA 2RGUA 3FCXA 4FDUA 4HAYA 4NULA 3V6LA 3E81A 5FR1A 4R9VA 4HDMB 3WP0A 2XLBA 1RC8A 1CZOA 2J6BA 3BEOA 1Y9AA 2H16A 3L79A 4JLUA 4QDZA 5HRUA 1OI2A 5B4VA 1VCMA 3K9BA 4UFPA 1XVUA 4D3ZA 2YTZA 2C29D 2WHRA 1BC5A 3P2JA 1SHLA 1ABEA 1T0HB 4FLMA 4LRXA 1CJCA 2F64A 5FB3A 3B9RA 1ZBQA 3ESRA 1YZQA 4FX5A 5F12A 4Q7LA 1IQPA 4EQ6A 3ENVA 4I81A 4D9IA 2PGJA 3DAPA 5DTRA 1L4EA 1Q3TA 2PWYA 5E6UA 5HJ2A 3N9IA 5IP5A 3ROKA 2EX1A 3A10A 2VSYA 1DC7A 2O50A 3ANSA 1GRCA 3ASUA 3IDAA 3P0JA 3QIVA 1EFVA 2MINA 3ZV3A 1FVFA 4C5AA 2DR2A 1YO6A 3L0OA 4TXJA 1EKXA 1MJ5A 4IWXA 1LK7A 1UBOS 4DSTA 4BO3A 4E6EA 1VRWA 3CVUA 1CD5A 4F6RA 2J32A 5AVTA 2JGEA 1A9PA 1IBKB 2VT6A 2CE2X 2QF7A 1M75A 2Q1SA 3WXMA 1I94B 4FEGA 4Y67A 3UM9A 4C0HA 1RYZA 1N6IA 3VPAA 2JFWA 4FYVA 3DQQA 4AUMA 3LCCA 5G4KB 1DEAA 1POWA 2F1JA 2FDRA 3V8NA 1GXSB 2X9GA 4PG8A 1UDXA 3KFXA 2R11A 3GJXC 4RFVA 1ISJA 4WEQA 3E9NA 4LYDA 5EQJB 2O2GA 2XF8A 2OLEA 2VG8A 4HXYA 1T29A 4ZYWA 3GGPA 4ZTZB 4NAVA 2P1RA 2JLAA 3E2MA 4DPKA 1JA0A 5B7NA 3V9PA 2AUMA 2PAFA 1ZYUA 5JFTA 1II9A 3WR5A 4A15A 3L8ZA 5JNUA 5DCYA 3THOA 3U44B 1ZPDA 5FBLB 3FOWA 3LFTA 4AB1A 1X1TA 1Q7BA 3EDMA 2Q9AA 3FZYA 1TRHA 2R5WA 1U90A 3FLMA 4LSWA 5FPHA 1LLCA 4KB5A 4L5BA 1ZXBA 3L6BA 4LSZA 2YWXA 3FVTA 4PQRA 3P9QA 3DAFA 1BVUA 5DISB 3I1YA 3PDHA 3U7GA 4GDMA 1QG4A 1HRKA 1JEQB 1LSOA 3GRKA 4YMHA 2XMSA 5E1OA 2IXAA 1JPUA 1NDQA 1EGVB 3ZOKA 3KYDA 1DV2A 1VB5A 1RAEA 2M1XA 1E9BA 2Z43A 3GA5A 3RU7A 4BRWA 5TMEA 2PRYA 1CY7A 2VP4A 1XTBA 4UU7A 1D9ZA 4G36A 1BMFA 4ZHSA 4CLOA 1DBVO 1VGVA 1YHNA 2AFIB 5AW6A 3VKGA 2JGNA 5JTUA 3JY6A 4PZYA 4A6EA 2W8BA 2BFDA 2IPAB 1Z5UA 2YCLA 4Z4HA 4J0GA 5F2NA 3ZWBA 4LMRA 3D7MA 1SQ5A 1QE0A 3VUFA 3KDSE 2Y1KA 4IUYA 2FLVA 1XF1A 1QK4A 3FZQA 4CM9A 4DLRA 2P5YA 1HC7A 3HI4A 4P2BA 2VDLB 1ESDA 3AVPA 3S2SA 2O59A 4C0KA 3ICWA 1RBQA 1ZU5A 3IAS1 3TLGB 2NU6B 3STUA 4DLPA 5DHRA 3UC5A 4E3WA 4EJSB 4JJFA 3MTAA 2G5CA 2VPWA 1NMYA 4TV8F 1S3GA 4OJKA 3GJ7A 1K7YA 1M0TA 1NULA 4L4UA 4TV8B 1PNQA 5EFZA 3RKRA 2MR5A 1IVSA 2JAPA 5KHOC 4OLAA 2WA2A 3PNYA 4HNQA 4J07A 4ZVVA 5ALJA 1NF9A 4D9MA 1WXGA 3RR2A 3WLAA 1HL3A 2Q99A 3ZE0B 3OKFA 1UMDB 4OU5A 2FRVA 2CNBA 4G8DA 2AR7A 4LTNA 2IEZA 7MHTA 4HGQA 4M0CA 2WDZA 1QHSA 4NNPA 2I8AA 1GUYA 3HYRA 5HWSA 2XLCA 3VMMA 2W11A 2QRVA 2NTJA 4HQ0A 2ZYIA 4HZGA 3MJHA 1EBFA 4FOTA 1BE8A 4F6LA 3I58A 3OC0A 3RJMA 3MGAA 2CDBA 4RMGA 1SKYE 1SXJA 4NBSA 3Q7QA 3TSYA 2NUAA 3O8NA 1DX6A 1GG5A 2PT9A 3CR7A 3CU5A 4UZSA 4AQDA 2OXIA 2QMUA 2AOUA 4RS3A 4ER0A 3O38A 5KYYB 4RVDA 3CUYA 3M4XA 5IMSA 1L7PA 5I7FA 3NANA 1IK4A 1BOOA 1SWVA 1L5WA 3R3SA 3I5XA 3T3HA 1L5YA 3NQ41 4E08A 4BJHB 4DHEA 2NVOA 4DRXA 4MW4A 4MQ6A 1HE3A 5FORA 9ABPA 2AEMA 4ZAWA 1E89A 2CF5A 4E4YA 3D3WA 2OT3B 2P2LA 2VA8A 3N8NA 1LSJA 5AVQA 1TO1E 2W6QA 4YMSA 1EINA 3IQGX 4HTFB 2QX4A 1P60A 4OQFA 2VZ8A 2W42A 4RW0A 4YI5A 1JDBC 2ZBGA 4YDHB 1SK8A 2OSBA 1IBSA 3OCYA 3EGDA 5JDCA 2NU9A 4KXFB 1T1GA 2ECQA 4NFHA 1Z8HA 1QQ7A 4JEMA 3USZA 3M4ZA 4PZEA 1OA0A 3O73A 5GINE 3BRWD 2DUNA 1DU4A 1ZN2A 2ESRA 3VTZA 5DNEA 1KYVA 4KWTA 4ZODA 1TCAA 3S2FA 1BE6A 1O8BA 4OHUA 3WIOA 5LZ5A 3CF0A 2VUHB 1YKSA 4OK6A 5K8UA 3AHDA 3NWEA 4OIMA 1V7QA 3M6MD 4M1MA 4IMRA 4C05A 3U60B 5EQFA 4F3KA 4QARA 4DQXA 2RK3A 1UZMA 4OKNA 4J0CA 5BSHA 3IUBA 3FBWA 2M1ZA 2ZS8A 4H7IA 2OXTA 1M8JA 4C0AC 3V5NA 3PC3A 4CVNA 3OAAA 1SOVA 2WWXA 3OF3A 4JJKA 2RGRA 1T8TA 5HQTA 1PWEA 4FE4A 3RVKA 1I6MA 3OLXA 3HCOA 1RM3A 2XCLA 2ONZA 1RPJA 1XRSB 2V7UA 2VDNB 3CLKA 4JU9A 1XWFA 4EYGA 3U7FB 2QN6A 2M6KA 3RREA 4ZO7A 2YH2A 4HBGA 1NVDA 1U4NA 3ZWMA 2WZCA 1I1QB 1XZQA 5CT5A 1I0ZA 4FFSA 3H6GA 4HH1A 3FZNA 5IAOA 3WLRA 1TGVA 1DBWA 3IVGA 3MIIA 3D7RA 3JD3A 3RW9A 1WULS 1HXHA 3ZGYA 4D4HA 3BAFA 1T35A 3DOUA 4F5WA 4R05A 2E4AA 3ESXA 1ZUD1 2PXCA 3KTAA 4PLFA 3U7EB 1M54A 4LBVA 6ADHA 3R3UA 1B93A 3W3AA 1A8UA 4K26A 1BEEA 1NE2A 3HCNA 4FN5A 3TN7A 1IN1A 3V34A 1J2JA 1ZL2A 3DCNA 4URYR 4YVFA 1B15A 1VBFA 2GI4A 3EXHB 1QHYA 2F3PA 2J3QA 1M8PA 1AF7A 3GFGA 4PXSA 1MZVA 4P3NA 5B6JA 1TTPB 3TR5A 3ZQ4A 1SKBA 1F4LA 1TAQA 2FZ4A 2C9BA 3D59A 2RONA 1O0SA 1IOVA 2P6PA 2ZIFA 3L92A 4LUCA 2NX2A 2XB6A 1C8VB 1N5IA 2NZUG 1UDBA 1U4SA 1B3BA 1E96A 3K96A 2JGDA 3QLJA 4FGSA 5INTA 4WLUA 3NYIA 1E5QA 3PVSA 5CX4A 3CZ4A 5D2CA 5FWXA 3FNGA 1RKXA 4YECA 4C9BA 1QIDA 1KZ7B 2O3QA 1L7RA 1QYDA 4KTTE 1E1QA 3T7KA 1I10A 5HM8A 2VZ9A 3FFBA 3WGJA 1UKYA 5COQA 4ZCQA 1JHZA 1M67A 1VKOA 4QOIA 4BJ5A 4XH9B 3QJYA 1R4ZA 2PZFA 3A14A 2HR1A 4GX2A 2O1XA 3EZ9A 3TOCA 4YCJA 4L9SA 2RGEA 4XQGA 2YIVX 1U8FO 3D6VA 4M1QA 4Y9SA 1QP0A 1RBYA 1IL0A 1VGRA 3FMPB 4QYTA 4QXOA 1NE7A 4B3TB 4BL5A 2B61A 1IHYA 1LX7A 2ZTHA 3CYFA 5AUQA 5G1OA 3JQDA 2B4KA 1O5IA 4XLZA 1R27A 1D5WA 1SBYA 3GEHA 2A58A 4J90A 4TRMA 4U7GA 4OQXA 1WPGA 3STTA 1FYWA 1YQDA 3LQKA 4DJDC 2LBPA 3X1YA 5KDDA 1BDIA 3RT7A 3OSUA 3C8MA 3L7YA 4O33A 3MGGA 4GZ6A 4CKBB 1NW4A 5HEKA 4GF5A 4AXXA 1ECBA 4ZCPA 3GFRA 1KDTA 1I30A 4HLCA 4YRSA 3PIRA 5FLXA 1Q7TA 2OBBA 3HGQA 1D1PA 1ABFA 3RC2A 5BPFA 5ESRA 3C39A 3C5HA 4P5DA 1EM6A 1H2WA 2CHQA 4G1VA 2JCBA 1XKTA 2QRUA 5FTNA 5JVDF 4MUHA 1G63A 2YV2A 5AW9A 4EO4A 4QLAA 2CT8A 2H00A 3AOGA 5JVDB 1VJCA 4CV1A 4TS9A 2FUG1 1BS1A 4YUVA 4FFMA 2EFEB 4LGCA 2ZBVA 4KW7A 2ZIXA 4E94A 5TX7A 4HDKA 2OWDA 4ZTBA 4CMIB 2OK8A 5JS8A 2NTYC 4HN9A 1TM4E 2Z5GA 3N53A 2Y66A 5E7QA 2BEKA 2QQ5A 4M1OA 3SBOA 1XZAA 3GQVA 2ZIEA 4J29A 1AKNA 1N57A 3RAPR 2VPQA 3IJ5A 3QSGA 3O9VA 4F4IA 2NUTB 4O4JB 4KXVA 3V2UA 1XNJA 4ETMA 2GCIA 4DOMA 3LQRA 4RXMA 1I3MA 1MIHA 1R8SA 3INNA 4ZKDA 4Y1EA 4TYNA 1L4BA 3TM5A 1MGPA 1BIFA 2BDEA 2HJRA 1O97C 4YWHA 2NWQA 2EX4A 2IS6A 3GUYA 1E2NA 2C98A 3AFOA 2GYYA 1EA7A 1OAAA 1SCIA 1Y7IA 1QWSA 2XUPA 3E70C 3FVQA 3HDTA 4RFSB 5KI6A 1VLMA 3V2GA 5I7AA 1PBTA 3ZLVA 5JPCA 2JGIA 2PQ2A 1ODTC 3CH7A 1ZI9A 3GZNB 3L04A 4HZUB 4NCKA 1FNBA 3DH0A 5LC1A 2FF7A 3A9TA 3PDCA 3JALA 4QA9A 3T9CA 2OR3A 4E2ZA 4GR5A 1KMHB 2P9HA 1TECE 1VL0A 1FFHA 1H3NA 1KI8A 1RYFA 2EKZA 3GNQA 3LXMA 4G9GA 4RADA 1XXHE 4MLZA 5G02A 2Z9BA 4CTNA 4EABA 4QU9A 5E95A 5KREA 2JJMA 5BNIA 3MINB 3NIGB 1EQ2A 4GLFA 1FFCA 1HTTA 1T8UA 5DM2A 2C96A 4CQJA 3DB2A 2UUAB 2AFHB 2BELA 4Q4AA 4RELA 2OBFA 5JRDS 1XYGA 1RVDA 1ZRNA 4AJOA 4I7EA 1IAVA 3AKZA 3KKQA 2I1QA 4UU8A 5HK8A 3SXPA 5EEHA 4Z5XA 2ZIAA 4I1UA 4JIGA 1L5MA 3OICA 2HJ9A 2R8YA 2PYIA 2XOEA 5F76A 4L78A 4MCHA 3LY7A 1JI0A 4XZ3A 3U3KA 3VFDA 5B55A 1THGA 2ZR8A 3PTZA 3LLCA 1FA9A 3GP3A 2XT0A 1VXRA 1VRVA 4UPEA 2WB4A 2P91A 3UAWA 5ILQA 4XM0A 1CRQA 5C81A 2C5LA 4D46A 5F77A 3IE2A 3OT1A 5ALYA 4C6TB 4MW6A 3Q9LA 4ZOLB 3W5IA 3EARA 4HN2A 2B94A 3OLWA 2HBZA 1IEQA 1X8LA 3G5TA 3ZR4B 3EIXA 2DFVA 2F7SA 2GCOA 5H3HA 1SVMA 5B1SA 1EB8A 2VHJA 2P2NA 3A9CA 2DKFA 1Z6ZA 2Y8EA 3FPBA 3JQBC 3L40A 3ANTA 4FGLA 2A5FA 2D8MA 2CFOA 5DWQA 4BO1A 1EFLA 1YB5A 4H3KB 5TGTA 4FBLA 3L06A 1Z45A 2VHUA 4KVGA 4KWHA 1NBMA 4AN0A 4F8JA 5C46F 4QRDA 1OR8A 1LW7A 1XNGA 3I09A 4PG5A 4FMCF 1B8VA 3EOBI 1D7AA 2FMIA 1Z2CA 2R2AA 3BMNB 5AVZA 1KF0A 5DNUA 1WW8A 1H4TA 3KNZA 5LL6P 4AKSA 5LB4A 2SKEA 3ABQB 3T41A 1P4GA 1UXIA 1CJSA 3A2LA 4OHYA 2EF0A 4HYTA 4BQRA 2OGSA 3A0RB 1XNQB 4QBFA 1NBIA 1YFLA 1GT91 1BG6A 4HEJA 2QYHA 1S3SA 1P8JA 1WKCA 3MERA 2Q6LA 3GIDA 1H8HA 1JVNA 1AK1A 2K5UA 2HADA 2Q1YA 4IOLA 4KIWA 5FX2A 1BVHA 3P20A 3PQEA 2QTRA 3WOVA 3IOYA 4B31A 4CIYA 2IZZA 4ISCA 4M55A 5HKKA 3TQHA 1L8XA 1NPYA 2BR4A 2IVZA 2VDPB 3HA2A 4YJ3B 3F49S 3H0EA 5HQJA 1BYUA 1OX5A 4PYLA 3AVWA 4JJ7A 2DUJA 2YDYA 4LWPA 4RXUA 4RH3A 3NCTA 1L3BA 5CURA 2NV0A 3BMOA 5A3SA 1OWMA 3VR5H 4CV2A 2ADMA 1NV9A 2IPXA 4J1TA 4I9FA 5ADHA 3ZVKA 1RXIA 2BISA 3AUJB 5BY2A 3OTQA 4G0NA 1N5RA 2WG2A 4HMPA 4Q4HB 4W5NA 1Q83A 4HPXB 4XQ9A 3HU3A 3WWCA 1DMRA 4JJEA 2O7QA 2ADOA 2FMHA 1TZ2A 3IBYA 3HHPA 2FXIA 3KPJA 3MMSA 3PJFA 4Q4JB 5JNWA 1ID8A 1TQ2A 2Z9CA 1J5PA 4ILEA 2NQTA 2OHGA 4P33A 1N0WA 4X7RA 3HCDA 3PQCA 1UDWA 1D4ZA 4ZYTA 5BSMA 1EH5A 2VF7A 1OF1A 1VIYA 2HA7A 5HFAA 2IS4A 1JBQA 4D8XA 5EI5A 2PMBA 3JQCA 4BUZA 4ZYUA 3ENNA 2RGNA 1JG6A 3BYZA 1XKXA 2Z1NA 1M33A 1OX4B 2VJNA 4MQEB 4Q6BA 5K0EA 4Q12A 2FZWA 2I87A 2E6UX 4GLBA 4RD0A 2VTKA 2IQ5A 5AJWA 5K2OA 4YMWA 2QAIA 1B7GO 1U8ZA 3K30A 4L2IB 3CZ5A 5CFRA 5HQ3A 3SYMA 1GAJA 2IHZA 3LY5A 4A23A 2E89A 2V6FA 5FV7A 3DS8A 4UOZA 2PFGA 3VR3A 2WYVA 4NR0A 1SC9A 4C4TA 1YZTA 1MJGA 2CLOB 1Z7GA 2GBPA 2ZUCA 3JQ7A 4PAMA 5M29A 2X0KA 3BORA 3HWX1 4FEEA 3UFXB 4FZ5A 3ZGLA 5C5IA 1KI1A 2ZANA 1U04A 3IR6A 2OVBA 1GL7A 3ANXA 3HN6A 4JC5A 2UYOA 2IP2A 4W9NC 3ONFA 2GASA 4NHEA 4DCPA 4LJLA 3JXEA 4IF6A 1U0OC 4CHGA 4BMNA 5L7WA 2PGOA 2YYYA 4LOAA 1IUOA 3RSSA 5DHQA 1BXGB 1XJ5A 4P86A 2GS9A 4UDXX 5DM1A 5EJ6A 2VJPA 2QXUA 3T1QA 4RPKA 4G1FA 3L2OB 1H2FA 2P41A 4JLBA 4OQQA 1P4AA 1IONA 1W35A 1HT2E 1E79A 1PWYE 2GBCA 5KVAA 1J06A 2C1XA 2FJUA 4UNQA 1FNSA 1SC1A 1EEHA 2KS6A 2W2LD 2CDRA 4BGUA 4HX5A 2G67A 1F8YA 4LY0A 3GJ6A 3T4UA 4B3DA 3BERA 5KYTA 1W88B 2P6RA 4DY6A 2MOKA 1V4VA 3TUJC 1U2SA 2GCGA 3NV7A 3OBBA 1C50A 1QO9A 4EJFA 2NACA 4LSMA 4YIHA 3PTAA 3UGTA 4GW3A 1SMKA 2XPCA 2WFZA 2JIQA 4WQMA 5AHKA 2AXPA 1I4TD 4N0PA 5IJ0A 2FGKA 3BBPA 4DCSA 4DQDA 3N2NA 3ZWOA 1YQWA 2XAUA 1NR7A 1IUNA 1LDYA 4RD1A 3F5MA 4D3XA 2IIVA 1AUXA 2D00A 3PNKA 1JIQA 2XKJE 3CJTA 1YH3A 4N5LA 2NV6A 1EIWA 4ZHQF 3GJ5A 1UMCA 3UMJA 1BA3A 4OPMA 5L51A 1V9LA 2VK8A 1XQ6A 1O77A 2GD2A 1H6BA 1QGUB 3BDVA 4IFBA 3AETA 3OZTA 2V8BA 5ADVA 1FYFA 3VZDA 5AVOA 3O1JC 3WKBA 2DR0A 5ALEA 1PFQA 2W93A 1TVCA 1EG2A 1Y1QA 2CXQA 3Q87B 3PUHA 3TD2A 3V2HA 1Y5MA 4BNHA 3AESA 2NUPA 3D2BA 2A7QA 2BEUA 3OWXA 3C0KA 1M7GA 4RZXA 2HWXA 4EB6B 1HZZA 1RQNA 1VG8A 4H17A 1XN4A 4HLUC 2RB4A 5REQA 5LQAA 3FVWA 2HU8A 4EOGA 2X8WA 3V6MA 1U7PA 1Y82A 4I4TB 3JATB 3NMUF 1NHGA 2FN3A 4PC3A 3SG0A 5TLSA 1AU9A 3NWPA 5D7NA 3WQQA 4BJ3A 4I8DA 5EXSA 4B80A 2E6KA 4E21A 1BX0A 4UBMA 5TT0A 3SYRA 2VK2A 2GCEA 4D4GA 4RS4A 1Z5GA 4TRNA 4DBZA 3L05A 2X15A 3V8RA 2VDQB 2AOTA 1YV9A 2QI9C 1PG0A 2Z4SA 2WUWE 3VR4D 1NJGA 3RJ5A 1QFMA 3RSQA 4KRFA 1QTIA 1FLNA 4F5EA 3WLKX 1W47A 1ILWA 2IUUA 1ZCAA 4P4TA 1JTVA 1ZOLA 3VHLB 1BCSA 2G9ZA 1UM9A 2EBUA 1DL5A 1JP7A 2Z8YA 4KO4S 1U8AA 4TLBA 5TJHA 1JAHA 3UOGA 4XIYA 4ABYA 4CFSA 3EZGA 5CDYA 3KT8A 5JR3A 2QVCA 2QN2A 2M98A 1GADO 1IM5A 1WDTA 4G1UC 3QWFA 3R0JA 2FX3A 4JLJA 3M70A 4U3JB 4X71A 4EARA 5CA1F 2JLYA 2IFTA 1XL1A 3RC9A 5CA1B 2BGJA 4W9RA 3FYUB 4MI9A 1IZYA 2AWOA 3QLUC 2B98A 4Z8YA 4BFSA 1KDPA 5HPYB 5IF9A 1JKMA 2UV8A 2PANA 1WF3A 2HU7A 2Y1OA 2O4UX 3LYHA 5DV9A 1WV0A 1CZRA 1Z22A 2G04A 3PL1A 4P7GA 4PBSA 2PL1A 2PLAA 2GPTA 3QW2A 1XD9A 2Z08A 4XUGB 4DV4B 4PZZA 3B1XA 1A2KC 4DPMA 4AIRA 1P2GA 1YOVA 3SDBA 4AG5A 2XB8A 4C30A 4F84A 1ECJA 3REQB 4CGZA 1TM5E 3ML1A 4ZPJA 1GTMA 4W1QA 1BGWA 3HY4A 2RFLA 1SBZA 2Q5LA 4FTWA 5DVZA 4PYNA 3MXTA 3QHAA 4KV7A 5E1DA 2JEOA 3BAZA 3CZMA 4HUJA 3UJ6A 5BSKA 1APBA 3ROFA 1PW5A 4EZIA 1WQ1R 1RC0A 1D2EA 2A9KA 4YEDA 1Y48E 5DGIA 3CNEA 2FN8A 1Q91A 3CWCA 4JQSA 4F4JA 3I83A 4JI0B 4LTMA 2XE7A 1YKFA 3HXQA 5DLDA 5T4EA 4MYCA 3OJOA 4Y0NA 1XU9A 4GRAA 5FJIA 4AO8A 1ICEA 1PK8A 2FGJA 4YRCA 4C0BA 4C20A 4NC9A 2YKGA 4DCNA 1PJ3A 1PT7A 3HBJA 1FJXA 2VBGA 3SQXA 1CQJB 2NT4A 5B2EA 5BQPA 4IL5A 1TRKA 3L6EA 3FIJA 3WWEA 3QXJA 3PHCA 3FDXA 2V3VA 2EJWA 1FP4B 3DMFA 2J4FA 3EEBA 1RS0A 4QLBA 4YR7A 5FIUA 2NP7A 2B8NA 2PS1A 1SBIA 2H1IA 4Y1RA 3AUXA 4K9OA 3OC6A 4G1MB 3T15A 2FWPA 2H3HA 1TXGA 4UNSA 1JHRA 3H1AA 2NADA 4N8EA 4QHYA 4CODB 4B83A 4F1KA 3S3TA 4YRAA 1G6Q1 1PJZA 5KVSA 1NASA 3A28A 2OUIA 2I3BA 3QBVA 5ALZA 5EWMB 4PG6A 1J4AA 1RAFA 3UH0A 1IN8A 1TI7A 4CU5A 5IBRA 5IJ9A 3IELA 3TOSA 2IHKA 6GPBA 3AVOA 3EC2A 2IEAA 3OZUA 4JC8A 2RH8A 3IPLA 1QBKC 3GLFB 3T5AA 2JI8A 3L0BA 2HXYA 2ZSEA 3EZNA 3GY0A 3KSMA 5G0SA 2QD4A 2YHIA 2AG1A 5SZHB 3ZCSA 1U0FA 2NSHA 3RANA 3RUAA 4EEXA 3ITNA 1ZP6A 1KJWA 2UZ0A 4TN1A 3ZX4A 1AN0A 4BMDA 8ABPA 4CIAA 2PWZA 2ZJ5A 5JDCC 1JX6A 1YFZA 3S2YA 1D0IA 5TPZA 3SGLA 5KOIA 3VNQA 3G5LA 3H2HA 1TZMA 4JVLA 2IV2X 4UUPA 3EWNA 4EEZA 4L4YA 1ENYA 2CNNA 3S4YA 1I7PA 2YMQA 2YFYA 4IV5A 3RYHB 3EOAI 3FTDA 4OX9Y 4YLEA 1KAQA 4P7BA 4PSAA 3GA0A 3P2OA 2RIRA 4OYHA 4HQ6A 2WQ6A 4BB0A 2DWPA 1KDOA 3NBQA 3MHPA 3LVFO 4AURA 4AX8A 1QCZA 3GLKA 4MV7A 5EY5B 3PKIA 1KOFA 3URKA 2GRUA 2O8NA 3X1DA 4H77A 2XVAA 2PMDA 3BICA 3LQ1A 4GPTA 2QLNA 3ZVRA 4B33A 3E05A 3VSEA 3M3DA 3DA8A 3K7EA 4GPZA 4M22A 2VF2A 2WW8A 1BU8A 3NNNA 2JAHA 4BJ1A 5HYVA 1WCXA 2A88A 3EGWA 1Y3FE 4MKXA 1QHHB 1QP7A 1KZGB 2UYHA 1EK2A 5CDHA 3DONA 4KODA 2HSEA 1YGYA 3IQXA 1UPFA 4KPUB 3ZZMA 4ND8A 4CQMD 1N92A 4EGFA 4EP1A 1BFUA 1Q50A 5JDIA 2OO7A 2Y3IA 4KIJA 4RC9A 1TCUA 2I1LA 4BB5A 2OCYC 5J58A 3VDNB 3GRZA 1WZ2A 2F59A 3MOIA 1X7DA 4FDMA 4BX9A 1RWBA 3PGJA 4NQZA 1MEOA 1VA5A 2EZ9A 3IIMA 3P1JA 1MABA 3PRYA 5CJPA 5IN5A 3UK2A 1U0LA 3W78A 2UUOA 1SO8A 1YAJA 3AR9A 3CCBA 3OZ7A 4YREA 1N0UA 3PYXA 1YF3A 2QPAA 3HXLA 1UOOA 1I7LA 2PX0A 3CRVA 4AI6A 1JJFA 3WWDA 5IW8A 4BLWA 1DG3A 3UV7A 2HCRA 1PFWA 2DZDA 3H83A 1M3SA 2PUHA 5KYUA 2QQ0A 4KDEA 4M7PA 4TUYF 3QBTA 5LXTB 2M6RA 1ZNZA 1EXWA 1GFSA 3OMLA 8GPBA 3AZQA 3LK7A 3Q8XB 3EPPA 4BVGA 1G55A 3QNUA 4KXYA 2HQBA 2BKVA 2FFBA 3AY0A 4U7JA 5ARDA 4AZ3A 1LKZA 3DXYA 3GRPA 1KJ9A 1E66A 4HHEA 3T7JA 1PT6A 3H5RA 1LNSA 1TD9A 1JIVA 2Z5LA 2YZ2A 4JLVA 1MG5A 4KFUA 4RZHA 3RYCA 4IIXA 2VRNA 2ZT6A 2PH1A 3K70B 2WU4A 5CXXA 3CRQA 1GPYA 2BF7A 1X3SA 3B1ZA 1EK1A 1QLHA 2A30A 2CF6A 1NJ6A 3D4PA 4PNHA 5BOSB 2FX2A 2O14A 5BWOA 2B0CA 2XRYA 3FNIA 3C6XA 4WFJA 2VJLA 2BY4A 2Y1XA 3T5BA 1Q1GA 1FUUA 2CBZA 2XI4A 3H19A 3H99A 4JMLA 4YIKA 5FTMA 2NU7A 5HMLA 4D0LB 5H70A 2VQFB 2NPOA 2A8YA 2YWCA 4LIPD 5ALLA 1JFVA 4G97A 2EWMA 2CYCA 2HHJA 1OFTA 3BMCA 4OK3A 4TWZA 4KVAA 4QKQA 1PVOA 2GH1A 3I2HA 4FQ7A 2IZ5A 3LOUA 5EJEA 3ONVA 3CH6A 3PGLA 5LJLA 2YDXA 2CCGA 1ZHFA 4AT1A 4BFYA 3SC4A 1F14A 3C6YA 3ZGVA 2XE4A 2VL7A 4KITB 5C18A 5E8JA 2O2CA 4ZI5A 4ZK2A 5JHHB 5JD6A 5LLDA 3I0MA 3AM5A 1CJMA 3KYIB 4K7JA 1F0KA 2VHQA 3T3PB 2C4MA 3K09C 1FU7A 3Q3JB 4BO6A 2R8PA 3G17A 1LI5A 4IH4A 2FWIA 3S1SA 2VJKA 2Y1WA 4FQ8A 1V3TA 3IOMA 4IXNA 3E4CA 4LQLA 1B16A 1T6ZA 2ODQA 4QPCA 3ZBPA 3AVYA 1ZVKA 5AKHA 1HE5A 1SAYA 1T6XA 3QWAA 5LPNA 3TSOA 4MWDA 2HMWA 1FUYB 1DO0A 1YIOA 4V0SA 4D9EA 2VAWA 3AEYA 4N5NA 3O75A 4RGQA 3A6DA 4HB2A 4XWGA 1MUUA 2CGEA 3F6SA 4IH1A 3NHKA 1X8KA 3KOUA 1N0HA 1W4LA 1OLUB 2QIPA 5FLEX 3SSNA 3UUGA 1JPVA 1V7ZA 1OLSB 2YZKA 3OCCA 5EL0A 4A5OA 4Z4GA 5H4HA 1BS2A 4PFJA 2JGMA 3V8MA 1XZPA 4PG7A 2WVHA 3NX4A 4R54A 4D7AA 1GQ2A 2CE7A 4TKVA 4E22A 1OTXA 3HKEB 1OXMA 2X76A 4JS0A 1G8YA 4JT2A 2F1IA 3H6KA 4WK0B 2ACWA 2RHJA 1P1HA 1M1ZA 1WD5A 4NAUA 1NM5C 3OD5A 3EQ7A 2VA9A 4G0MA 2B1IA 4MMZB 3EWAA 3QMMA 1T1SA 3A4YA 5CLGA 4AICA 2GHQA 3GN2A 4EI2A 1W19A 2GWRA 3BPSA 2VCHA 4OBBA 5AH0A 1KMCA 1F4PA 1D2AA 3R5XA 1DBPA 2CVFA 4A0HA 1C14A 3CRNA 4US1R 2UYGA 2Q1UA 3CEHA 4O8CA 4DYHA 4BQSA 4ZGGA 2ZRNA 3I72A 5JZ9A 1VKNA 2VHZA 3QQ5A 1XZCA 3OUZA 4WOKA 3W6UA 2LCFA 2UZAA 4IZHA 4QWWA 1EXVA 4XWAA 1NP7A 1U3UA 4Z51A 2JIZD 3CS3A 1HH4A 2MT9A 2Z0MA 3LQYA 4BWYA 4DA8A 3RCBA 1T91A 4FT4A 4Y0VA 3RS3A 4OHMA 3HVHA 2F1OA 3ICPA 2G4CA 4KIFA 4BO8A 16PKA 1JDVA 3BGIA 3N70A 3TKLA 5K8IA 4AYTA 4CU2A 3O26A 4NCAA 3JTEA 5DCLA 1WCYA 2Q41A 1T9KA 3CUVA 3HR8A 2QTAA 5I7HA 4UDOA 1A9RA 4MVJA 5JCJA 4MYUA 4O4LB 4BQOA 2DGDA 1N1GA 1SCQA 4ZEOA 5I8PA 2R87A 3IPAA 3BT7A 1ZD2P 1A69A 1NXOA 2H31A 2I34A 2JFQA 1F2TB 1K97A 1AHHA 4TQ9A 3EW9A 2HREA 5A5FA 5MHTA 2TRSB 5TF0A 5KMGA 4EITA 4F0JA 3EEFA 4RIGA 2KI5A 2RBGA 1JFLA 1UJ4A 4J7CA 3G3EA 2HPZA 4JLAA 3TINA 1HMYA 2V7XA 2RC5A 2FZVA 4U0KA 3ZU4A 2QTVA 1F3OA 3AWDA 3TR6A 5CVEA 3SMVA 3U5TA 3Q3GE 1KH3A 1K63A 1UDRA 1VLHA 4G84A 5F2OA 5SY6A 2YRFA 3WBKA 5KOJB 3HVUA 1ZG3A 4CKWA 1P2VA 2VZ0A 4WCFC 4F92B 1IXYA 2XZLA 4C3OB 3E84A 2OGZA 1P1JA 3BS4A 2ZJBA 2WJ6A 5K99A 4MK4A 1DBSA 2WQZA 4J0FA 4LDNA 4DREA 1AT1A 3E3AA 3M1LA 3GVPA 1L7DA 2RGGA 5ER6A 2Y9PB 3WGKA 4F38A 3MAJA 2ZT7A 4ZI7A 3KPWA 4PICA 2A0WA 5CX1B 1X92A 3ZJTA 1E2IA 3G9XA 1X94A 1R0SA 4ZVOA 4L0QA 3P2KA 1NUAA 1KOGA 2IF0A 3PDIA 3PIDA 1VA4A 4I50F 3ZNQA 4X66B 2ILTA 4DARA 2UZ1A 3DNFA 5NULA 5TPWA 3QGMA 4I50B 1NXTA 2QR5A 2BFFA 1I3LA 1GGJA 1J0DA 4Z0PA 1XEXB 3AERB 4DMUB 1YIDA 3BTVA 3E3OA 2FN4A 4MAMA 2R6ZA 3EIWA 3RSFA 1DAHA 1LXCA 1UJCA 3BCHA 3D8RA 1VPDA 1QB8A 3KSZO 3PC4A 3D43A 3ISVA 3ETJA 4RAQA 5EZ5A 3UV6A 4EY4A 1N2CB 2PR2A 4QWMA 5FUBA 1F6BA 1W25A 4OV6B 3QH4A 5ERGB 3U9LA 4BBZA 1DBIA 3REFA 2WKSA 5CIWA 1T5TA 4RMHA 2AYXA 2CXTA 4PWZA 1GITA 3MC1A 4PFQA 3PLAE 2CXNA 5TS2A 4MQBA 2FZEA 2FSHA 4H4CA 4J1TC 5ALUA 1KOLA 4AK9A 2REQB 1FTWA 3RT9A 1QCCA 4GYKA 5DASA 5LQJA 4R1PA 2O2ZA 3OFNA 3D7NA 3WRVA 5IABA 2I29A 2NNWB 3PJDA 1PEAA 3T3EA 5B1DA 3LRTA 2QX9A 1K4MA 2ZQYA 3SJCA 3TZ6A 2HC9A 1Y33E 4YACA 2D13A 4DNFA 3FSGD 1SBTA 4IHJA 3H05A 3IRUA 2PPVA 3KWFA 1NC3A 1RYEA 2KMLA 3M0EA 2FPWA 4G5HA 5ICSA 2HN9A 4CEHA 2Q5IA 2CFCA 4H15A 4MRSA 4RIFA 1Z75A 2NXJA 3LUFA 1QUFA 3PHBE 2ZRIA 5I5EA 1NMZA 4QNNA 1VYHA 4ITRC 4JLDA 4F3CA 1QQTA 2Q49A 4UASA 2FETA 2R4UA 4QBHA 3HYSA 5IAKA 4B79A 4GECA 2LZ0A 4B3IA 3QMPA 4GM4A 3E7DA 4WERA 4LG1A 4ZU1X 3K0AB 3UA4A 3AEXA 1N5LA 4A6XA 2RGNC 3P0RA 1JGTA 3OFKA 4TS1A 4JI1B 3ZYZA 3ACDA 1UBNA 4BNNA 1RQGA 2EX0A 1P7YA 2VDWA 3I6MA 1PK7A 1O4VA 4D81A 2CBXA 3FUWA 2AZTA 3P9KA 3U49A 2C5SA 2EZTA 3O4IA 3GCZA 4U2FA 2O8VA 1B8NA 5IYZB 5D6OA 4CMJA 2PRJA 2CFTA 2C7OA 3GDOA 3HJTA 1XDDA 1OI4A 1S9DA 2PKXA 1E5LA 3GUVA 3NG1A 3NTOA 4GPD1 4HH3C 1KIAA 2BE9A 3OWOA 2GB4A 3FYSA 2CLKB 1VIAA 1JIXA 1H6AA 3KTOA 4Q7JB 3TCNA 3WYGA 5JH7F 5D00A 5AW5A 4R1QA 1IC6A 5JH7B 1I4WA 5EJFA 1KTVA 3RS9A 1KI6A 2ZYHA 3R3ZA 5BMVA 2DHEA 2ZCUA 1W52X 1ZCBA 1T10A 3GYBA 5KJ1A 3FI9A 3PNQA 5GJBA 2OCLA 4FPXA 4JIMA 2VYQA 3O4HA 1WB4A 3DUFB 4NG4A 2R96A 1E3QA 4HOYA 4QJIA 1VL8A 3SP1A 5DEIA 3ENZA 4QM6A 3PKZA 1QVZA 1KU0A 1ESNA 2LVBA 1G7CA 1NUHA 3DL4A 4MP6A 4S2EA 4WNAA 1MMFB 2QZSA 1YC2A 1J2UA 1TA9A 3A1SA 2FR1A 1J22A 2P75A 5ULLA 1ZH4A 5JYBA 5DBFA 3BIJA 4XFDA 1CIPA 1I4OA 2XCTB 4ZT7A 4K6HA 1L4FA 1OFIA 1U98A 4P2GA 3SLKA 4QGSA 1GG2A 3PZRA 3C1AA 1HYBA 3OOEA 4LWOA 5AVRA 2XBUA 4EYSA 2H7VA 5HILA 1GTSA 1LEHA 3EEYA 2ZBPA 2VUIB 3GEBA 1J9EA 5C80A 5K7SA 1SQSA 2F1KA 1L4GA 2RHGB 1VE5A 2WF7A 2Y6VA 5F5NA 3ZCUA 3FUVA 3TD6A 2OVFA 4WESA 2QM3A 2B8JA 4BXOB 1HBJA 4XGNA 4N48A 4QJ5A 3IMKA 4YASA 4ADSG 3RTCA 3P4UA 3UAGA 3PE4A 3RRMA 1DJLA 2B0JA 4C4PA 2YMPA 1Q16A 5FADA 3SXUA 5C4IA 4JBXA 3C3DA 3OPYA 3SSOA 1QIEA 1QJ4A 2HBQA 4G9EA 3UIEA 3ZWPA 1W29A 3ND6A 3UT5B 1IAQA 1IQUA 3WIDA 4O1MA 1CB0A 3AEKA 1ZR2A 2IZOA 1N4DA 3T3MB 4DUGA 7REQA 3FNFA 1W1UA 3TAUA 2VPPA 3JYNA 1KEKA 4JOCA 1NMSA 4N9WA 5L3QA 3CZPA 3G2PA 3GG9A 2YWRA 4DXDA 1W49A 2WMOB 4GX0A 3P5SA 3LHIA 3UOWA 1YQQA 2QRLA 2ZT5A 4I9HA 1J9ZA 4W1SA 2H4HA 2IYWA 5FWYB 3ZHTA 5A6VA 3AIKA 4WZZA 4F06A 5SICE 1QONA 3BB1A 2EXXA 3AKYA 1JR3A 3HBMA 4MUNA 3UUEA 2Q4EA 3ZLTA 3QVGB 1E98A 3PXAA 4PBTA 2KB0A 1WDMA 4PCAA 3CB4A 2I55A 3HDYA 2JI4A 2VTBB 3SQMA 1VECA 2COEA 5HUJA 2X14A 4GRIA 3WRWA 4YRBA 1TU3A 1RWQA 1IHPA 1O94D 3EIEA 1HY3A 1E5TA 2GF0A 2YJ4A 4NHOA 3G8AA 2YIMA 5EWJA 2RE8A 4EELA 2LD4A 2P40A 2ZRQA 1LLQA 3FMGA 5EYPB 1L1FA 4YMVA 2PU5A 3DV0A 1WPRA 1Z33A 2VVTA 1Q22A 3I42A 3IOEA 4V0QA 2Y4NA 3DLTA 1DDOA 4CG2A 2C4UA 4ASUD 1HNXB 2XDQA 3W5UA 4YLYA 1U0BB 1THZA 3CUWA 4W6ZA 3QPWA 3BOSA 3I1FA 4TMXA 1IUPA 4BASA 2GYWA 3OESA 2VPTA 1XCOA 1Y4SA 1XFAA 4RUKA 5FOWA 2XQKA 3V4OA 2JRLA 1R6XA 2CZCA 1IZ0A 2OFFA 1COWD 3DAHA 5KOHB 3N76A 1QFZA 4FS8A 2PLRA 3NBZC 3WLIA 5C1BA 1U7XA 4IV0A 4RHEA 2C58A 3BSWA 5DU2A 1WTAA 3K8YA 4WECA 2XCQA 2I4TA 2JBAA 2AS0A 2IIQA 3AOEC 3F96A 3LV8A 4Q4DA 3L7BA 1ZSYA 3ZXIA 3QELB 3F2IA 4I8XA 4RPCA 1YU6A 2EP7A 1Q1BA 3LF2A 4G9BA 1ZMTA 4LHEA 4CNBA 3R3VA 2XGSA 1XYYA 4J0EA 3IYLW 3UMRA 1FXWA 3UTCA 4Q3AA 3LS2A 4EJ2A 2DHRA 3FCYA 1ZUNA 3IVAA 3R74A 4F4FA 4BUJA 1Q12A 2EBWA 4U7HA 1C3XA 3GHYA 2PKRA 4LN1A 4TL6A 1PJ4A 1MT0A 2V5AA 4UUNA 3E27A 2PNJA 3O4JA 621PA 3LW8A 1A77A 1E5XA 2RJ3A 4KAFA 2A35A 4M49A 3KQKA 3HB4X 2XF2A 3ZDFA 1PS0A 3WB1A 1U5BA 2FPPB 1GEGA 5DP2A 3SZRA 1P80A 4F71A 1H8EA 2N1BA 2GN9A 4Z2YA 3OOHA 1RACA 3TX6A 2J9FB 5F7ZA 3RIMA 2J3HA 3JAKA 3LQ2A