3QMMA

Structure of 6b, a thermostable mutant of bacillus subtilis lipase obtained through directed evolution
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
179
structure length
179
Chain Sequence
HNPVVMVHGIGGSSSNFEGIKSYLVSQGWSRDKLYAVDFWDKTGTNYNNGPVLSRFVQKVLDETGAKKVDIVAHSMGGANTLYYIKYLDGGNKVANVVTLGGANRLTTDKAPPGTDPNQKILYTSIYSSDDEIVPNYLSRLDGARNVQIHGVGHMGLLYSPQVYSLIKEGLNGGGQNTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title In vitro evolved non-aggregating and thermostable lipase: structural and thermodynamic investigation
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
molecule keywords Lipase estA
total genus 68
structure length 179
sequence length 179
chains with identical sequence B
ec nomenclature ec 3.1.1.3: Triacylglycerol lipase.
pdb deposition date 2011-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01674 Lipase_2 Lipase (class 2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3qmmA00
2I78A 1U4NA 3G0BA 1QIHA 1FSSA 4FNMA 1VXRA 4H7FA 4MXDA 3H0CA 4GDMA 3D2CA 3W06A 4KYVA 3A2NA 4M0MA 1FFBA 2RI6A 3DLTA 5E4JA 1ZD5A 2R8BA 3FYUC 1GKLA 5HF8A 4DMKA 4AB1A 1WB6A 4J0KA 3O9MA 3DQZA 3FSGD 3UUEA 4K2AA 5ALIA 5CW2A 3FOBA 3M3DA 3DNMA 4DM7A 1QTIA 4Y2TA 1MTZA 4MJ3A 1QO7A 5AOBA 1MO2A 1DT5A 5ALHA 5ALTA 1HLGA 4X3CA 1BCRA 2OQVA 1IUPA 1EK2A 2CKMA 2RHTA 1TKRA 4B81A 5DJ5A 2DQYA 2WLSA 4KE8A 4FLEA 2XUHA 3WK5A 3V1LA 3AIKA 3UUFA 3WKDA 5D3KA 4UBMA 1LLFA 4B9AA 5JD4A 3K9BA 1NX9A 2OAGA 3IUMA 3BIXA 5CXUA 2QMQA 2HA6A 3ZV7A 1LBTA 5C8VA 1TCCA 4J0CA 3WYNA 2P8SA 3ESBA 1C4XA 1CLEA 4BTVA 2WHRA 1IMJA 2GBCA 5FPQA 3WWCA 2H7XA 2WIFA 1CQZA 4YASA 2XUPA 4NZZA 5EIEA 2QM0A 1R88A 3F67A 3C5WP 3H17A 5JYCA 2ECFA 4GI1A 4L0CA 3PFBA 5JAUA 4X92A 4WY8A 4WFKA 1N1MA 4H35A 5DTIA 3CN9A 3SWWA 4HRXA 5AKYA 1YSCA 4NMWA 2PL5A 2HDWA 5AOAA 3VVMA 5LZ8A 4QNNA 3ZLVA 1SCIA 5IH7A 1IUNA 5ALFA 4AQDA 3WMRA 2VQ6A 4N5HX 1BN7A 1UKCA 2JGFA 1CIJA 5CRIA 4CIAA 2PPLA 5EFZA 4X95A 1G66A 2HA5A 3DS8A 4ITVA 4OU5A 3WKEA 1WOMA 3CXUA 4W9RA 1MN6A 1LPMA 5ALQA 4W1PA 1CFJA 1VLQA 3AINA 3STYA 3I2HA 1YAHA 1PFQA 5JD6A 3O4GA 4JUIA 4A16A 4FLMA 1W75A 4P92A 4Y2RA 3N0TA 4B85A 1EVQA 3QZUA 2D0DA 4MEBA 4EY5A 1QIDA 2XQGA 3ZWQA 3R3UA 1E5TA 2EEPA 5CH8A 5FKJA 4W1RA 3BE8A 5J3JA 5ALEA 2GBIA 3E1GA 3EF3A 3ESAA 1X2BA 1YB6A 5KWIA 4DTCA 5AM3A 2QT9A 4ZXFA 4E46A 3NUZA 5K3FA 2WUGA 1GQRA 4AXBA 1Q0RA 2ACEA 5AI8A 5H3HA 5AOCA 4H77A 3O4IA 2OXEA 1CUXA 5CT9A 1MX1A 5AI9A 1JJIA 3WJ2A 3L1IA 4ZWNA 3R3ZA 1EA5A 2OLEA 5LP1A 2X5XA 1W1IA 3CN7A 2B20A 4EHBA 5ALYA 4HXEB 1QFMA 1XRQA 3SK0A 3WWPA 1A8SA 3IB3A 4BZZA 3VDXA 4MWSA 4RE5A 3R3XA 4BRSA 3E3AA 2XUDA 3C6ZA 1ZD3A 5AK3A 2JGIA 1ZOIA 5BWBA 4FNGA 2BKLA 3HACA 1T4MA 1Q83A 2HU8A 4ZV9A 5AM0A 2VJDA 3G0CA 3R3VA 4QWWA 4PSDA 1CUFA 2WUEA 1NU8A 4UBOA 3AILA 1CUGA 2XLBA 5IVHA 2ORYA 1RYYA 1ORVA 2VA9A 3AZPA 3A2MA 3KD2A 3QPCA 5IVKA 1CUEA 4KAFA 3WI7A 1YASA 3S8YA 1KEZA 3WYDA 2O7RA 4FDMA 3W2TA 4HRYA 4FWBA 1K8QA 5AI5A 4QWMA 4Y9SA 1VZ3A 3FCYA 1MNAA 2I03A 4PSUA 3WWEA 4EY7A 3HEAA 4PW0A 1CUVA 4LHEA 3V48A 5ALWA 1GZ7A 1P0QA 4CG3A 2PVSA 4UBNA 4AO7A 4OUKX 2CUTA 3H2KA 4G8BA 1K5PA 5JZSA 4N5IX 4I19A 2XLCA 2Q0XA 4KACA 3U1TA 4NVRA 3IUQA 5ALVA 3KWJA 3E0XA 1YA4A 2Z3ZA 3WLAA 5AHXA 2QUBA 4DYHA 3F9CA 4Y2XA 1A7UA 5AH0A 1XZGA 1XRNA 2JIDA 4JYMA 1J07A 5BV7A 1WHSA 1ZJ4A 5ESRA 2BGRA 4UBKA 1H22A 5D6OA 3OTQA 1YAJA 2J4FA 1VA5A 4YPVA 5AIAA 5DYYA 1ODSA 2IIVA 1BEEA 3FYUB 1GPLA 1YS2X 1QIFA 1QO9A 4BE9A 5A7FA 4UPDA 3UMJA 3ZLTA 2DQZA 3W9UA 4XX1A 1JJFA 1ZIYA 2Y6UA 4OD0A 4AZ0A 2WJ4A 1LPNA 1GT6A 2BGNA 5JALA 4DIUA 4AO6A 3BWXA 2PUHA 3QPDA 3AIMA 1BN6A 4W1SA 4OB7A 1QIMA 1QE3A 1QIGA 1MAHA 2WFZA 1P0PA 1ODCA 3A6ZA 1J06A 1LPSA 2HL6A 1XROA 3PFCA 5ALPA 3WL8A 4H0CA 5HF5A 2HRQA 1U65A 1DWQA 3WA7A 2FJPA 2X8BA 2WFLA 1E8DA 1XKLA 5I7UA 1TRHA 5JZ9A 3STWA 1UFOA 1WB5A 1XLWA 1I6WA 4B83A 1ZGBA 5CBKA 4ZV7A 1EI9A 4IQ4A 4X00A 4ZGBA 4J0IA 1CUCA 3BIWA 5HFNA 2XMQA 5DTJA 3R41A 3OURA 4KE6A 2QOEA 3M83A 1CUYA 2Z5GA 4IH1A 1H23A 5AK4A 5YASA 4BTLA 1QLWA 5K3DA 5LYYA 1WCYA 5AKHA 1LGYA 1DQYA 2XQFA 3V1KA 3F8SA 4QZVA 3WA6A 2GYVA 1F8UA 1JT2A 1CUWA 2O2GA 2AJLI 2XMBA 4UHEA 3I2IA 3DJYA 3TEJA 1QTRA 1E89A 2QZPA 1Y7HA 1LPOA 4FFVA 4JYPA 4GW3A 5K5EA 1YS1X 1OXMA 4PSCA 2OGTA 4G8CA 2O2HA 3OG9A 5AKXA 1EB8A 4GBGA 3B3QA 1F6WA 3F96A 5HK9A 3GA7A 5AM2A 4X90A 1AC5A 6YASA 2C0QA 1BE0A 3QMMA 4H18A 1OILA 1JI3A 2XE4A 3STUA 1TCAA 1DX4A 1XZAA 4I4CA 4AN0A 1DT3A 4X91A 5ALUA 3FYUA 3OPMA 1EDDA 4AZ3A 1KU0A 3O4HA 2J3DA 2OCGA 2BFNA 1AQLA 3O95A 3WK9A 1DTEA 4S0XA 3A70A 3I2KA 2CEKA 2Z3WA 1CEXA 4G8DA 3O0DA 4ETWA 4UHFA 1VZ2A 2QXTA 2Z8ZA 4QA9A 1H2XA 3VXKA 2PU5A 1P0IA 5E2IA 4FHZA 1TIBA 2VTVA 2WG1A 3WKAA 4EBBA 4B7ZA 3A2LA 4BP8A 3VKFA 1XZMA 1CRLA 5JAHA 4K6GA 4E14A 5FOQA 4WJLA 1UK9A 1WB4A 4OSEA 2PUJA 4YX9A 1N5MA 2GZRA 2QTBA 1QIIA 5CH5A 3TRDA 2JEYA 3D3NA 5I8PA 2OG1A 2OPHA 5AKIA 1BS9A 4KR0A 4LXGA 2PSDA 2ZYSA 1LNSA 4XWGA 4QLAA 5DNVA 3BDIA 3RARA 2C58A 1FJ2A 5D7BA 1H2ZA 5FV4A 1ZIXA 4MQMA 3TGLA 4TVKA 1E3QA 3HYSA 4Y2VA 5CURA 3H04A 5EGNA 3EIOA 5ALMA 2HA4A 1F0PA 1XRLA 4Y2PA 3FVRA 5JANA 2XMGA 1QOZA 2WQZA 2K2QB 1MNQA 4C4ZA 4CIBA 4EZIA 3EQ9A 4X7BA 5CT4A 2OQIA 2BUCA 4OU4A 1X2EA 3K6KA 4W63A 3ZI7A 4BVJA 4W1QA 1XRPA 4B80A 5JD5A 1JJBA 2H1IA 5JARA 5ALRA 2PBLA 2YXPX 3DOHA 1UWCA 5EHQA 1A88A 3F97A 4ZREA 2EDCA 2CB9A 3K2IA 3OC0A 4C01A 4Q3KA 7YASA 2HRRA 4DGQA 4QDOA 1HBJA 3B5EA 4X71A 5JASA 2CMFA 1YA8A 4AN1A 2ZYHA 2PSHA 2C0PA 1W4LA 4X6XA 1DX6A 2IX9A 3I6MA 2HA0A 4D9JA 2WG2A 1IUOA 3QPAA 2XUOA 4F21A 2DFPA 2C5FA 5IVIA 1ODTC 2DR0A 3WWDA 2HM7A 1UT6A 1MX9A 1VKHA 5AKLA 1LPBB 2WHQA 3ESCA 2C7BA 1XZDA 1EK1A 5CT5A 2ZJFA 3FVTA 4JH0A 4M0EA 1MT3A 1X70A 3DL4A 3D2BA 2JGEA 3PF9A 4UHCA 4UFNA 2B4KA 3AFIA 4RGYA 4UHDA 4FLFA 3SX4A 1E8MA 4DLNA 2HA7A 4AMYA 1E66A 3ESDA 1XZIA 2AXEA 3I2FA 4XVCA 1QIJA 5HF9A 3KOOA 2OCLA 4Y2YA 4GWLA 2WHPB 3HABA 1JFRA 5DLPA 1SFRA 4J7AA 3DEAA 1VE7A 1Q84A 5AKKA 4KEAA 2GYUA 4UBIA 4CCYA 3WWOA 4IHAA 1DU4A 3FBWA 2VAVA 4DMHA 5F4ZA 5HKAA 3IUNA 4PNZA 4DNPA 3C8HA 1K4YA 1CUDA 1R9NA 5JZBA 2H9YA 3D59A 3WJ1A 5FLKA 3WL5A 2DCMA 3PDCA 4DNQA 3C43A 1A8QA 2JBWA 4DNFA 2ZJ6A 5ALKA 5ALNA 1TQHA 4OPMA 2HU7A 4FTWA 4C6HA 2W22A 2E3JA 4OB6A 3OM8A 3FLEA 3FSGA 4KRYA 4N8SA 4OB8A 1TK3A 3M82A 1HKHA 4EA6A 2VT7A 2G4LA 2XUAA 3L1HA 4H7JA 4UHBA 1XZBA 1XQXA 5FP0A 3CCCA 3ZLUA 2W6CX 5LKAA 4EB0A 5JATA 5ALSA 1DWOA 1GPKA 1CUIA 1T2NA 3IDAA 3D7RA 5CH3A 1EXWA 3G0GA 1EHYA 2J3QA 4BDTA 3H2IA 4O08A 4CCYB 1MAAA 3DKKA 1R3DA 1HQDA 2RAUA 3GUUA 5AO9A 4BCCA 1LPAB 1IZ8A 3KDAA 4QEKA 4KAJA 1W52X 1CUUA 5LZ9A 2Z8XA 5K3CA 3R3WA 4OCZA 4WDQA 1ACLA 4FMPA 2G5TA 1RWQA 2WU4A 1JMYA 1XZLA 2QJWA 1UXOA 1AUOA 2JGKA 2WG0A 5LZ7A 2WIDA 5FUMA 3V1MA 1SC9A 1PV1A 5JAPA 1OCEA 2XUJA 3MGAA 4ROTA 1J2EA 3G9TA 5FRDA 5ALXA 4QLOA 3DOIA 4INZA 3NWOA 3FWHA 3LS2A 2AJBA 4LYEA 3WKCA 1H2YA 4BVKA 3VJKA 5E4TA 2PX6A 2Y6VA 3RKSA 5T4FA 4LXHA 1W6RA 4G1FA 1A8UA 2H7YA 1SCQA 4UBLA 5JAOA 1QJ4A 4JNCA 4BYMA 4BC0A 5C8ZA 3DYIA 4BAZA 2VF2A 2BUAA 4C4XA 3G0IA 4Q1VA 3EQ8A 1ZI6A 3C8DA 4B6GA 2V97A 1ISPA 1XZHA 3JW8A 2VJBA 1XQWA 1EVEA 1MJ5A 4G4IA 4C89A 3DCNA 4J0DA 2XI4A 1UZAA 2HA2A 4UFPA 5ALZA 5AI4A 1GPNA 1VOTA 1TCBA 2JGLA 2QXUA 3D4LA 3HZOA 4KE7A 3IA2A 4EY4A 4I3FA 3W05A 4HZGA 4Y2JA 4F5ZA 4X85A 3HJUA 1MPXA 2XUIA 3WK4A 4GEGA 1Q0ZA 4GLBA 4UBJA 4MQLA 2GZSA 3DDUA 3JYHA 4G5XA 4WCVA 1ACJA 4PQEA 2HIHA 4EY6A 1ZI8A 5AKEA 3VISA 3BXPA 3D2AA 3G0DA 1XFDA 4K6KA 3G9ZA 3H1BA 4HTAA 4B0OA 4Y7DA 3C6YA 3FLAA 2VSQA 4FFWA 1VXOA 2OCKA 4BBZA 4LYDA 3MVEA 2B9VA 5AM5A 3WK6A 1QGED 1VE6A 2RIPA 4C87A 2HFJA 2QKYA 2XUKA 1AURA 3RLIA 2WIGA 2WUFA 2WIJA 5AP9A 3QVMA 5AIBA 3G8YA 2Y2UA 1BROA 2HADA 5JIBA 3HC7A 1EDBA 2LIPA 3G9XA 3H19A 4JEIA 2HU5A 1B41A 3ICWA 4Q3OA 2PSFA 3PUHA 2HA3A 3I2JA 4UUQA 2ES4A 2XDWA 3N2ZB 4GXNA 2PSJA 3ANSA 5CT6A 1F0NA 4J0HA 5A71A 5C81A 2WSLA 1G4HA 5EHZA 2O2IA 3WQHA 5HQ3B 3CCBA 1S8OA 2XQIA 3MUNA 1SCKA 1THGA 3FAKA 4X6YA 4H7KA 3AJAA 2ZVDA 2JGMA 5HKBA 1ZICA 5AICA 1H2WA 4P9NA 1ZD4A 3ANTA 1D07A 3ED1A 4CCWA 1WPXA 4KE9A 2DHDA 1BCSA 5AK6A 3U0VA 2VEOA 1N5RA 1ZI9A 4GECA 3YASA 2B61A 1EH5A 3KSRA 5DWDA 3C6XA 1JMKC 1N8SA 5BOVA 1C7JA 1G42A 3WK8A 3H18A 5T4EA 2J4CA 3I28A 3ICVA 1U2EA 4BE4A 4F0JA 2AJ8A 3EBLA 1WPRA 2I3ZA 5HCUA 3STVA 1XZJA 4X94A 5AK5A 1GXSA 3IUJA 2GYWA 3RM3A 3H1AA 3QYJA 3RK4A 2RHWA 4M0FA 2WIKA 3WZMA 4Q34A 1UKAA 1R1DA 5AM4A 2ROQA 4L3WA 4QDZA 4L9AA 5ALOA 1SOMA 3R0VA 1PJAA 3X3HA 5LLSA 5LZ5A 3FLBA 2WU3A 3T4UA 1UKBA 4U2FA 1AMNA 5FPPA 1CUSA 4Q82A 4BCDA 4BATA 4BRZA 4J03A 3C6BA 4YK7A 2YH2A 1AZWA 3I1YA 2XMCA 2ONCA 2WM2A 1ORWA 5A2GA 4K5QA 3BJRA 3LP5A 4KJXA 2D5LA 2XMSA 3D5EA 1MU0A 1L7AA 4LXIA 3ILSA 5I9IA 2X76A 4V2IA 4E11A 2XMRA 4BC1A 4QDXA 1LBSA 2PU7A 4BAUA 2WUDA 2QVBA 3PUIA 3D0KA 4NS4A 2QRUA 1FFDA 3QBJA 1EX9A 1UK7A 4FKBA 1ZGCA 5HQ3A 3W9BA 4MYSA 1L7RA 2Y1KA 3I6YA 5HFAA 1XZFA 4B0PA 4WFJA 2C4HA 3EQ7A 2YASA 4ZRDA 4QE3A 4BDSA 3IURA 1XLUA 3BF8A 5LZ2A 2R11A 4ARAA 3NOXA 3SC2A 5AKGA 2XUGA 1QIEA 2NW6A 4IH4A 3WKBA 4HVTA 2XMDA 1WM1A 3H2GA 5A6VA 4N8EA 2BUBA 2WTMA 3W04A 3G9UA 1FFAA 4B82A 3B12A 4OYYA 4U2GA 1CUBA 4PF1A 5D3ZA 5KREA 5T4HA 3HI4A 5K3FB 2BJHA 4G4GA 3T52A 1Y37A 4B9EA 2ZJ7A 4PO3X 2JF0A 1FFCA 5EIHA 5ALGA 4BP9A 1XQYA 3HXKA 1GGVA 3HLKA 4HXFB 2QS9A 1XZEA 3C5VA 4B84A 2Y2VA 3BF7A 1JU3A 1FFEA 2WJ6A 2GBFA 4LIPD 1ETHA 3H2JA 3HRHA 4UFOA 1DWPA 4G4JA 2WFMA 5KBYA 5KWJA 1K63A 1QFSA 1E8NA 5K3BA 5AKZA 5IVDA 4PV7A 3G02A 4FOLA 2DSNA 4U2DA 3V9AA 2BCEA 3STTA 4HXGA 2QR5A 4XJVA 4J0JA 2ZYIA 4AX4A 4GHWA 4U2BA 1GQSA 3AUKA 1YR2A 4A23A 5CMLA 4C88A 1JKMA 4Y2UA 5JADA 2XT0A 1DINA 1IVYA 3WL6A 3HSSA 5EIAA 1Z68A 2VT6A 5IKXA 3GBSA 3QMWA 5DYWA 1YB7A 4K6HA 3DL7A 1UOOA 5FXMA 4BVLA 1ZD2P 4E15A 2OGSA 3R40A 5DNWA 2XUQA 4FBLA 3QH4A 3BL8A 3V1NA 2AJDA 4HAIA 2V98A 4C4YA 1K6EA 4BB0A 4IO0A 2XQKA 2PSEA 5E4YA 1MX5A 4LKOA 2C5GA 4BAGA 3DKRA 4CG1A 4AMZA 4DNOA 1NU6A 3QMVA 3WIBA 2OCIA 1VA4A 3S2ZA 4BCBA 4TGLA 5AM1A 5AKJA 3H2HA 5C7YA 3GFFA 2VAXA 1USWA 2IITA 2BAGA 1XKTA 3DD5A 2WKWA 4U2EA 3LLCA 1CQWA 4MWTA 4QDUA 4EY8A 1UOPA 1BEZA 3BDVA 5EI5A 4RNCA 5AI6A 2WFLB 5SYNA 4BZWA 4MYDA 2HFKA 1AX9A 5FDFA 2O7VA 4Q3LA 3BJMA 1AGYA 3STXA 1EINA 3PI6A 1R9MA 2I3DA 2FUKA 5ALDA 3O9VA 1KU6A 3WL7A 2EDAA 3GZJA 1VJ5A 1XRMA 4KRXA 3M81A 4IH9A 3AZQA 2WILA 2PM8A 4EUSA 1W76A 3P2MA 4FBMA 5LZ4A 3VJMA 2ACKA 3R3YA 1HL7A 4TPKA 4F60A 2QUAA 1CV2A 1ZJ5A 4Z49A 4N8DA 1THTA 4P93A 1XQVA 2PKYX 4Y2SA 2AJCA 1UK8A 4QDTA 5HK8A 4UHHA 5T4BA 1RP1A 4OYLA 5EHXA 4CI9A 3FYTA 2HHAA 3E4DA 4X97A 5AI0A 1LZLA 4CFSA 3WZLA 3LIIA 2OAEA 4Y2QA 1QONA 1Y7IA 3KWFA 3O4JA 4X6UA 3DYVA 1QIKA 3AIOA 3IIIA 3ZPXA 2OGZA 3JWEA 4DSAA 2VJCA 1XLVA 2G5PA 2CBGA 1CPYA 1G5FA 3Q0TA 3PE6A 1BRTA 2WHPA 1J1IA 2WTNA 4RE6A 2UZ0A 1AKNA 3IVMA 2GBGA 1HDEA 4J3JA 3G7NA 2XUFA 2WJ3A 1GKKA 2CJPA 1CUHA 5CT8A 4WY5A 4P08A 2QJRA 5A62A 3KXPA 5A7HA 4H7EA 5BWCA 4ZI5A 1CUAA 4ARBA 5LIPA 4XIIA 3IULA 3TJMA 5HZGA 2CZQA 1C7IA 1XRRA 1R50A 3L1JA 2RGUA 1M33A 1EDEA 2FX5A 1DQZA 3Q8WA 1HPLA 2DHCA 2H7CA 2XMZA 2G63A 4AO8A 5CTAA 4G9EA 1BU8A 4CG2A 1UK6A 3I6ZA 3WIOA 2VATA 4KAAA 5DYTA 2XB6A 5LKRA 3IBTA 3C87A 4J0GA 1LZKA 1JU4A 4WDRA 4Q05A 3QITA 5DNUA 3LCRA 3FCXA 3OOSA 1CVLA 4U2CA 2ZSHA 3GROA 3FNBA 1XZKA 3I2GA 3VVLA 2VJAA 5ALLA 1P0MA 2ZSIA 4H7HA 3I1IA 1CR6A 2RONA 1TAHA 2JGJA 1O6GA 5C8XA 3C70A 1B6GA 4HS9A 5CXXA 3QM1A 1UOQA 1CUZA 3PICA 4DMFA 3WK7A 2ZYRA 1EB9A 5A7GA 4DMCA 2YYSA 4WFIA 5K3EA 1XZCA 2JEZA 3AZOA 4H7IA 5EHNA 4G9GA 1QZ3A 4H7DA 1U8EA 4DSZA 1L7QA 2V9ZA 2DHEA 3VJLA 1YCDA 3PF8A 5ALJA 4RPCA 5SYMA 1O6FA 5ISMA 1IZ7A 1LPPA 3MUOA 1WHTA 5AJHA 3F98A 4L72A 5K3AA 5HF6A 2FJ0A 1CUJA 1R4ZA 3LIPA 3NGMA 3C45A 4MEAA 2XQJA 4A5SA 4X93A 2V96A 3GELA
chains in the Genus database with same CATH superfamily
5EUQB 5IVPA 1YT5A 1T43A 1VLLA 2FMUA 1FSSA 3RS5A 3T5TA 2IDMA 4MXDA 3WG9A 3H0CA 3UFXA 4HX2A 3IE1A 3OZSA 3EFBA 3I9KA 4UMFA 1T8YA 2GO1A 1YBMA 4UAVA 4B6FA 2BFDB 1M7GA 4TYYA 2XADA 2VXOA 5FFFA 5JZVA 1AVTA 1BQEA 1ZLXA 5KJEA 2XF2A 2RI6A 4Q3CA 2C29D 3DLTA 2PUBA 2VDPB 3NEJA 2R8BA 3PKIA 3S8MA 2DLDA 2MSEB 2OT3B 3AF4A 1PFVA 1YI8A 4DLVA 1TYAE 2PGXA 3EWIA 4BN0A 1FNMA 3O9MA 3RUFA 2KMLA 1MG5A 3JALA 1L7VC 3UWPA 5GM1A 3LU1A 3F74A 5IAJA 1PFYA 2YHAA 5LN1A 1QPZA 4EPTA 3SDSA 4V39A 4IHJB 3WBBA 3LFUA 1TIKA 1YDFA 5BMVA 3OEWA 4K2AA 3O91A 5ALIA 2H2WA 4JUBA 3I53A 2NACA 4FYVA 2FCRA 3DNMA 3OZGA 4YJ3B 3QBEA 1QTIA 5E6SA 2GK6A 1KRXA 3LBHA 2WF8A 2PA3A 3MN1A 3PGMA 3SVTA 3WRYA 4Y2TA 5CA1B 5KQPA 1RYNA 1P4SA 1K5DA 4IJUA 3VR4A 4JJKA 3NFRA 4N39A 3ZDQA 1DT5A 3BCHA 3K8OE 2A5GA 4RHFA 4B7UA 1D04A 2FY8A 3RC2A 4X3CA 4QUJA 2ZAMA 2ZWVA 3MTAA 1I2DA 3WZ2A 1SUAA 4AG6A 1SBZA 1BCRA 3D7LA 2NSDA 4FZJA 2AZDA 4NEGA 5DMHA 5MN5A 3C74A 1ILEA 1JDNA 5GJVC 1TW2A 4B34A 5GIPE 3VNUA 3UJ3X 5D51S 4FMCF 4ICIA 1OH8A 3A6HA 2Z1NA 5KYWB 1XUOA 1I2AA 1SBCA 4A8HA 1QRTA 1MQSA 3I76A 4UCQA 4BNVA 5I4KA 2EKLA 1DIGA 2VHEA 3RCBA 2CNBA 4I50F 4CM8A 1L3CA 3PNBA 3DAPA 3GEEA 3OZRA 5JMTA 3JQFA 2ZJAA 1E7WA 3BMQA 3M1IA 4PPYA 4BWYA 4YRRA 2IVZA 3BWDD 4KE8A 1J33A 5GPBA 2Y92A 1J20A 3QNWA 1RWPA 4FLEA 4IXWA 5AR1A 1NDHA 4FFSA 5FTMA 3U6KA 2P4QA 1QS0B 1YRQA 1XEAA 1ZJJA 3EIHA 3NB0A 1A50B 4JMPA 1V3VA 3UUFA 3S1AB 3NDRA 5E1DA 4YXWD 5D3KA 2CHQA 4TUYB 5KKNB 4UBMA 5JD4A 3LT0A 3K9BA 1IWOA 2HWXA 4BGEA 1XTVA 4PO1A 3DZCA 2ZAYA 2C99A 3QXXA 1XZNA 4FIDA 1VHTA 2RG1A 4P84A 3WLPA 3D6HA 2FP4A 4G0VA 3T15A 4TRNA 4QUAA 2DF8A 4D3FA 1NG1A 1Y1SA 4YRGA 1E3MA 1YS4A 2PSSA 1XO1A 2HA6A 4O2AA 3CRMA 1E94E 4QIHA 1L7BA 5AVSA 5ERGB 4BUCA 1P6QA 3D0OA 5CA0A 1LBTA 2VUUA 4NAHA 3WB9A 5C8VA 3AHFA 1TCCA 4J0CA 4J7UA 4MVJE 4IOLA 5HDQA 3SHVA 1ZR4A 1IOWA 2BTQA 2I2AA 5IEBA 4D02A 3NRJA 4HUQB 1SCUB 3BGOS 3L05A 4BV2A 5KYYA 5SY6A 4MP3A 4WSOA 1P2GA 5EZYB 2ZI5A 2R47A 3MCAA 3UUWA 1EEXB 1ENZA 1YQ9A 1MV8A 1QDLB 3F1KA 1QZTA 4NICA 4ODIA 3KTAB 5FIUA 3H7IA 2D06A 1ZK3A 3E22A 1JA0A 1NUHA 3WWCA 2A9VA 4B6PA 4IDOA 4YASA 3QA3E 4RA9B 5FA8A 4BPRA 3ZNNA 2AHRA 4UNRA 3CR7A 1JG2A 4NZZA 5D5QA 1IEWA 1PTJA 1WAMA 1JG6A 2H7VA 2JIOA 3BULA 3LPAA 4V3BA 2YVKA 3V42A 4CLRA 4A5OA 1A8PA 3CWQA 2P27A 1MOZA 1GADO 1YI0A 2E49A 2ORED 3F67A 3LDHA 4A92A 4KFCA 4AS2A 6ABPA 5LIRA 2X0IA 5B1IA 2IEIA 3UAGA 5ICCA 1R5NA 2YV2A 3K31A 4X92A 4XJTA 3SXUB 4JY7A 1EQUA 3A9RA 2V6JA 4MI3A 4RS3A 3VPCA 3X2EA 4A0GA 5KNCH 3A4MA 1YZQA 2VDQB 4KPGA 3VJRA 1PQ4A 1WD5A 2J3KA 1OJLA 4ZDKA 3X2FA 2XKBA 1VSBA 5K3OA 4DMGA 2AFHB 5CW1A 4HRXA 3TPZA 3NTLA 2G77B 3W7BA 4Y6SA 1KHHA 3PX7A 4LF8B 1K1EA 4ZP1A 5D8DA 4Z4EA 2CHFA 2LDXA 2NXNA 2HDWA 1JGTA 1LD3A 4UHJA 4GAEA 2E5FA 1YZNA 5AJZA 8LDHA 2B0CA 5GQSA 3T35A 4ALMA 2O6LA 4GU5A 1JHVA 3T3MB 3EY9A 2BR3A 1W9HA 5IH7A 3S29A 4O59O 3GMTA 1C3JA 1QAMA 4AQDA 3KPVA 4ND1A 2IEBA 4AY2A 2WWHA 5FYDA 5IJXA 3K0KA 1QKJA 3IX7A 4N5HX 4D74A 1AMOA 1HK7A 2AG0A 4RZIA 2R1UA 1UKCA 3JSAA 2JGFA 2XTNA 4HGQA 1P8JA 4LGVA 1KH1A 2EZUA 1EP3B 3N8NA 5EFZA 2O3UA 2BFWA 2X8AA 1Z7BA 2H2HA 3FYDA 4X95A 3HZHA 3I4CA 1HZJA 1JR3D 3G79A 1N8KA 3IHTA 3DS8A 5KSPA 4RTQA 4OU5A 1GTVA 4RIGA 3WKEA 4DWVA 5JQGF 3B6IA 4O2BB 4INJA 3PFWO 4RESA 4OQEA 1R4MB 2PT9A 1A3CA 1P6UA 3FWPA 3MJVA 5KTOA 2VNHA 4A2QA 4XZ3A 1ZBDA 3ECSA 5CR9A 4RCYA 2JKYA 3UK7A 3DM5A 3LXUX 4W1PA 1FS4A 1PJSA 2CDBA 1L1QA 3L4BA 2GKSA 2WP8J 4DSNA 2XNDD 3BMCA 1ICEA 3L5KA 3M5CA 1EUDB 3N9IA 3C41J 1L4KA 2O8DB 3WLLA 2CHEA 2JHFA 2B1RA 2XEXA 4IQGA 3I2HA 5LPNA 4HDSB 4U3JA 1Y3BE 2IYWA 5DEOA 3LQFA 1PFQA 1IWBB 3EXG2 3MJHA 4HDQB 4KU4A 3U4DA 2KSQA 3WLOA 3LY7A 5JD6A 3S81A 2KI5A 4MV9A 2V03A 1BX1A 1KZ9A 2EXXA 4GSLA 4IDBA 3N2GB 5DGCA 2VBCA 4W4TA 1NJ6A 2BI8A 5EUBA 3W2EA 4QSMA 3FRIA 5I48A 1U28C 4ZT7A 3OE1A 2XGOA 2JJQA 2YFHA 1D1TA 5FR2A 2I2CA 1E2UA 1SK8A 5BPFA 2I7DA 3AHDA 3SC6A 2D0DA 2JFWA 2W98A 4BJ1A 1QIDA 2FZWA 2MSWA 2XQGA 4BV8A 5BSVA 5I7RA 5LQRA 5JSZB 2OD9A 4DRZA 2I6QA 3Q7IA 4EX6A 3CVJA 2BLNA 3PA8A 4KXUA 3BGSA 3NJ8A 4LE2A 3LYLA 1F8YA 3MS7A 4J3FA 3TLKA 5IUNC 1P0FA 3BE8A 1UXIA 3SBEA 4B5LA 1R4AA 4UTOA 4US2R 3D1JA 1E59A 3FM9A 3WYCA 1W34A 2I7XA 3HJFA 5J47A 2ZUVA 3KBOA 3HRIA 4RA9A 5B2ZA 2VSFA 1CJSA 4DTCA 5KJ6A 2QT9A 3C0KA 5AVYA 2QBYA 4E46A 4B3SB 3MJ4A 4BGUA 3FPGA 3AR5A 1NBME 3NUZA 1M2OA 3DC2A 2YVUA 1E3LA 5K3FA 4KGZA 2GT1A 4A10A 4AXBA 2QQEA 1XDBA 2R87A 5DP2A 3VU9B 4YALA 2X6QA 3TBHA 1UMDB 1B23P 1OT5A 2HF9A 5LJIA 2G08A 1E4OA 1WVGA 1K92A 2OXEA 2W6QA 5CT9A 1MX1A 3TUIC 5AI9A 5HSGA 3SN6A 2B1GA 4ZZ1A 4GFDA 3LRTA 2V7EA 1L5GB 5H7XA 1UBEA 4Z5XA 2AEFA 2Q50A 1IY9A 3KTOA 3PI7A 2JFVA 5JNTA 3M4NA 4I4IA 2QU7A 1UJMA 3UMYA 4BNFA 4X8MA 5AW7A 6NULA 3Q7PA 4UNIA 4FN5A 2B20A 2N75A 1U7ZA 4XFJA 1U9JA 2V59A 3A32A 3BXHA 3FPAA 4Y8VA 5HFJA 1Z83A 5GJBA 1GN9A 4HXEB 1VG8A 1XRQA 4L28A 3ZHSA 4YT8A 1YFLA 2J9ZB 2VNIA 2GD2A 5IKEA 3OQ1A 2GTHA 1RKXA 5KOJA 4JP5A 4NENA 1TX4B 3VDXA 1RYMA 3C2QA 5AK3A 4OH7A 1OTYA 3OJWA 3UCEA 3I6QA 4OQDA 1A9QA 3KQVA 4P4NA 1QHSA 4FNGA 3L0BA 5FUQA 2W6PA 1OBOA 1ID8A 2IEGA 1Q1AA 4WZBE 5AVQA 4AUEA 1RAGA 2P2GA 3ESQA 5TGZA 4W5QA 4C0QC 2BTOA 2H5EA 3FTNA 1I4DD 3IQEA 3RUHA 3U7GA 5C34B 2XYQA 1FX1A 3K8ZA 3K8QA 4LISA 3UV6A 1O94A 3AR6A 3W34A 4F4DA 3OX3A 4PYRA 3R3VA 2HRCA 4Z3KA 1UC9A 3ZWCA 2DTEA 1CUFA 3HJAA 1OJ7A 1DQPA 3S3TA 4ETIA 2B5VA 4RQUA 4UBOA 1N6LA 1WR8A 3B5JA 4NECA 3T38A 3M5DA 4DA7A 2IHVA 2QAGC 4CIWA 2Y4OA 3N0WA 2WT9A 2ORYA 3PFNA 2O2EA 2AC7A 3OD5A 3VH3A 2EWVA 5ERYA 3WV4A 2BZ1A 4DEXA 2NPOA 3PRKE 3ZVKA 1PNRA 5E6SB 5DP1A 5TXGA 1KERA 2ATEA 4BOYA 3QEKA 3I9NA 4ZI3A 1G9SA 1JZTA 4XOUA 1P2BA 3WI7A 1KRWA 3K6JA 3LG2A 3S8YA 5FWDA 3UAXA 4PZUA 1NTOA 4V24A 3KTFA 5GINE 1T5OA 2EKBA 3LX6A 2O7RA 3A3PA 4LQ4A 4FWBA 1KY2A 2Y77A 1NDUA 4CM9A 3ICEA 5TMEA 3KQNA 2QRLA 3GMSA 4X7PA 4B1FA 1MNAA 1KMIY 3BWBA 1XDGA 3NRBA 1RC8A 1ULBA 3WWEA 2WUVA 4MUHA 4TN1A 3U60B 5EKXA 4JKOA 5BN4B 4PW0A 2GUGA 1CUVA 1LXCA 2NV0A 4QBFA 4KIFA 1GZ7A 1P0QA 3T7KA 2JFHA 2O3JA 1YXMA 2PVSA 2J07A 2VJOA 2XWPA 4LV8B 4NEQA 4Q66C 2IUFA 4QXPA 3O2JA 2FUCA 3QE4A 2AQ8A 2BEUB 3VBEA 4YRNA 1WKBA 4MUFA 2HLPA 3H2KA 1I01A 3NTQA 3OFNA 5JZSA 1WW2A 4OQLA 2JI8A 4FX5A 3UGKA 4DBVO 3HKBB 3PWZA 2R6JA 1MJGM 2HBQA 4Z9YA 4IQFA 4FR2A 1BC5A 4QLBA 2HMYB 1EXDA 3O75A 4Z9BA 2ZIAA 1ISHA 2BISA 3CX6A 4I4NA 4QTTB 2QUBA 3QJYA 1V71A 2ZRCA 2Q2NA 2RGNA 3HJHA 5GOZA 1GPWB 5CEJA 3JQ8A 1JN0A 3OQIA 4FZ5A 5KCMA 2PWZA 3KB8A 4Y2XA 3NMUF 1A7UA 2D00A 3DTYA 4EJSC 4BLRA 3CW9A 1XRNA 2AXQA 3RAPR 3ZI4A 4A0HA 5EG5A 3S2EA 4UU7A 5DI3B 4ZJYA 2FEXA 4NJEA 3KT8A 1FVXA 4ZAWA 3N8KA 1J07A 5FA6A 2NU8B 1ABEA 5JRDS 3Q7EA 4PLWA 5DNEA 1GJRA 5ESRA 1GD1O 4UBKA 4D9IA 3J80A 4OX9B 3GYGA 2JRCA 5D6OA 4TKLA 2LV8A 1P0CA 3MG9A 2PVCA 2QVZX 4R8SA 3ZHVA 1YAJA 5AVXA 3CG4A 3BQMB 5JVDA 2R44A 2JJMA 2WHYA 2IIQA 5ER9A 3X1WA 2O6HA 3G7SA 3CEHA 4L22A 1QFXA 1BAPA 2NIPA 4MR8A 4PR0A 3QE9Y 2FW8A 3HS3A 4NE2A 1ODSA 1E6MA 4IV8A 4ZAZA 3FYUB 3LQ4A 3WIVA 4NZYA 3VU1A 1GXSB 2V9PA 4C0WA 1QIFA 1OB5A 4YY3B 2REXB 1LLDA 4UPDA 2PFGA 1W0JA 3DO8A 3H5NA 3ZLTA 3HBJA 2FZEA 2DKOA 1X0XA 4PS0A 1LTHR 2V6MA 1FS6A 4XX1A 3REQB 5BWNA 1KPHA 1V9SA 5IJWA 1H05A 3VPXA 2Y6UA 1KK3A 1WXFA 2WJ4A 1VG0B 4MR8B 1HURA 1P1HA 1H1DA 3AY6A 3DB2A 4ND4A 4YV1A 3FRHA 4G07A 4IQ0A 1GT6A 5H4HA 5C2JB 3ZTWA 2BGNA 5JALA 1NOJA 4G85A 2VDOB 1E3IA 1Z73A 5KNCA 2C9ZA 1Z25A 1U11A 3RC9A 2GCPA 3V5NA 2HH9A 5TVGA 2BM9A 2CW5A 1TW3A 2FI1A 1C1HA 1ECFA 3F5SA 4GUDA 4LMAA 5TX7A 1FFXA 2BFEB 3ISTA 3KSDO 3L9XA 3V4OA 1GFSA 3P8ZA 4E1AA 1EM8B 1FY2A 2G4CA 2NZYA 1EX6A 4W1SA 3WGZA 1QH1B 4E0BA 2WMDA 3SYLA 2X2OA 1FK8A 1WSDA 3T3IA 1QRDA 4A91A 1QE3A 5K20A 1P0PA 1ODCA 1OBCA 1YVDA 5JG7A 3Q41A 1VJ1A 2YMQA 3EW7A 4ZQGA 4Q6WA 4HNGA 4P0QB 3DVQX 3JQAA 4LCBA 5ED0A 3AM1A 3H4IA 1WZCA 3K5HA 2BP7A 1KORA 1P9WA 5ALPA 4L5JA 1R9GA 4BKOA 3S1SA 5BVHA 3SP1A 3DT6A 1DFIA 1M76A 3EQZA 4G97A 1OPXA 2OZPA 2BELA 3BTUA 3MINB 4NEHB 1JTFA 4H0CA 4O8ZA 5G3ZA 5HF5A 3S99A 3VYTB 2V7GA 3HCDA 5IANA 1YBFA 2IHJA 3C4QA 1U65A 4ZAVA 4H6VA 1DWQA 3A14A 2FJPA 3JASB 1TMGE 1DBVO 2YWGA 1QR6A 4C0JA 3FOFC 4EPXA 1E8DA 4U00A 1KEWA 3W77A 4TMYA 4TQAA 4QQNA 3ILXA 1XKLA 4RVOA 1H9AA 5JZ9A 1G41A 4CDGA 4BXOB 4CEIA 1D9XA 1RMYA 3UMVA 4LBZA 3MTDA 3PZRA 4KFTA 2Q7DA 3COSA 3QTBA 5E7JA 1EWTA 3SGLA 3IVCA 1BCRB 1GAJA 1FTYA 1EFTA 1I6WA 2OYRA 3TIXB 1UL1X 3N2IA 4HQNA 2GK3A 1QQ6A 4L6IA 3U49A 5H83A 3KK0A 4EHLA 1W4BA 2E4UA 3FFXA 5FOWA 3DMTA 4LNHA 4XWAA 2PJUA 1EI9A 4ZKDA 3Q8MA 1XCBA 3HO8A 4KL8S 3DXZA 1L6RA 4ZVNA 3ZCQA 3L0PA 5KYUA 2PZFA 3WY9A 3WVNA 2FZKA 3M4YA 4J0IA 3WTCA 1GGNA 5HE9A 2ZM6B 2FR8A 1KDRA 2DAPA 2E4ZA 2P0YA 1DRWA 1QVWA 2PH5A 1BMTA 2Q1UA 4P5EA 3ZU5A 4BB5A 2IK8A 2QX6A 3AY0A 3OO1A 2C2BA 4KE6A 4JX9A 2BM8A 4UUAA 3OUZA 1XF9A 1XG5A 3HB5X 1MHTA 1PQWA 2XODA 2B7CA 2C61A 4HY3A 3R7FA 3AVWA 2BMJA 1TPYA 5CP8A 3M83A 4FFBB 1WV0A 4HDOB 4M1TA 5ARDA 1OV4A 4F97A 1Z74A 2O48X 3TLMA 4DB2A 5A2QA 4JP8A 1N6PA 1Y7TA 1ZW6A 2LZ0A 4D5GA 2GN2A 2W6JD 1Q7GA 4I5FA 2DY1A 2JCVA 3NXKA 2KBEA 3PQDA 2YZ7A 1V1JA 3TN7A 2YRXA 4IAOA 4K9DA 3T0GA 2EW1A 5FH9A 3HYTA 4UCWA 1ADYA 3CZCA 4GOOD 3EZ6A 1WCYA 4U1RA 5AKHA 2NSJA 4EJFA 3IKJA 2C7PA 4JVSB 3IVRA 2B37A 3WA6A 2VRBA 4ZU3A 3GRYA 3AUJB 5EZQA 2IV2X 3CRVA 4YCMA 1JT2A 1O9HA 1QCZA 2I55A 1CUWA 1TKAA 2AJLI 3HFJA 2HK9A 4JVNA 1JIKA 3AP3A 2PMBA 1O0BA 1FUIA 3GZNB 4DA4A 1JA1A 3GGSA 3EWNA 5T5QA 3GPBA 3QVJA 5G3YA 3L82B 5AQ1A 1JB9A 1DJNA 5EMNA 2X8JB 1YZYA 1N1EA 1PYGA 4JYPA 4GW3A 3BE4A 3RIGA 3UM9A 2PMWB 3ZGYA 4TTPA 4EABA 4JVMA 4CGYA 1NI4B 3KUKA 1H2BA 3RAEC 3EVBA 1VLMA 2ACVA 5J23A 1CKEA 3DFFA 1TC2A 2BKAA 2D5BA 2Z9CA 3S2IA 2JH3A 2FPLA 1Y8ZA 1QQ7A 4HHEA 4ZVOA 5FFNA 2D1YA 3ESYA 4HNSA 1UBRS 4Y9RA 2EG5A 2YMMA 4JLJA 1C0KA 4WT7A 3W5VA 4CEHA 5KTYA 2NU6A 4PIPA 1P61B 1RQLA 3GR6A 4ZQHA 3WQSB 4GKKB 3SMQA 5I9LA 2XNJA 2CL0X 1MVOA 2R8XA 2DEUA 3ZJUA 5EE9A 4X90A 1AC5A 1NQ5A 4BNLA 3WADA 3P4XA 4RDXA 3JD1A 2YHBA 1BYUA 4EB8A 3AH8A 1FDOA 1T9DA 4H18A 1JI3A 2XE4A 1BE6A 1SC6A 2PGJA 4I66A 1C2TA 4F38A 5I8WA 4EI2A 3E2PA 4AZ0B 2G6TA 2HQRA 3O94A 3C1UA 1JEQA 2QHXA 2FPGB 5G4KB 1E2HA 5I7AA 3DXFA 4RMJA 2ODTX 2PS1A 1JECA 3G6WA 2NUPA 3LLVA 1MB0A 3MPOA 4IG9A 1UJBA 2WSIA 4M2LA 5ALUA 5KYVA 1IU9A 3DZHA 3FYUA 3RQSA 3PK0A 1EDDA 2WT8A 1ZGJA 4XB6B 4XH9B 4ZJUA 3EPKA 3HE3A 1H4QA 3ETJA 1SXIA 1QYIA 3L1KA 1PSWA 2D8AA 4K86A 2GPNA 5CAEB 2ABWA 1IY2A 3O95A 4GS5A 2A9FA 3NM6B 3TAHA 3WK9A 2J3LA 1ZUHA 5JC8A 4WKPA 1E0JA 4Q4HA 5G0SA 2JVJA 2AX3A 1CEXA 2Q62A 2O2ZA 3O0DA 4RADA 3LMKA 3JQGA 1QB7A 2AGVA 1NULA 2QXTA 1POWA 5DI3A 4RF2A 4DLBA 2Y1DA 3ZHTA 1H2XA 2Y67A 3HO6A 3ZVNA 2PU5A 1TUBA 4JJEA 2QLTA 4WV3A 2CL5A 1XEWY 2YYAA 5E2IA 1R8YA 4H2DA 1E2JA 1XDWA 2A8YA 5CNKA 4TYNA 3H0KA 2BL4A 1IXRC 2JGDB 3NHYA 3TL2A 3TD9A 4B7ZA 4H31A 1PT8A 3RRZA 3A4LA 2MOKA 2QTRA 3KCNA 3GJ0A 2ASEA 2X0RA 1K7CA 4C08A 1CRPA 3S2UA 4RTSA 2VN8A 3DCIA 1CRLA 1ZJWA 4NG4A 5DB4A 3G5LA 5KINB 1TFUA 1COWA 4IEEA 4MV0A 2QROA 1Y81A 4LJSA 4KODA 4E14A 2V1UA 4WJLA 4B79A 4INOA 3GEIA 3OCYA 2OESA 1GYRA 1WB4A 1E0DA 3LX8A 4OSEA 3NS7A 5IG2A 2VHCA 4G37A 2XZDA 2NZJA 2PUJA 2LD4A 3AFHA 1PG2A 4GMXA 4BFWA 1EFAA 5WRFA 1QIIA 4R0VA 1QGOA 5CH5A 3M5WA 3D3NA 2JARA 4M3NA 4NTZA 5J9FA 5K0NA 1BDHA 1E5VA 5DXFA 5I7EA 4KR0A 1HI9A 2IUUA 5JNWA 2YXDA 5IBCA 1WA5A 4G5HA 4D0SA 4YIHA 5KYXB 4IJQA 3E8SA 1IK4A 4YN3A 1B3RA 3GJ6A 4QLAA 4IIJF 5JAMA 1G2QA 4DABA 1A9RA 3O8LA 3PGLA 1FNCA 3LW7A 4QC2A 5BNZA 3KU1A 2BC9A 4L5CA 3FE2A 2O14A 2QTWB 1MF7A 5D7BA 2IYPA 3KEQA 4GPIB 2GPYA 1E6EA 3L0IB 1NXVA 4UEJA 3U80A 1GZSA 1QV7A 1S8FA 2A9KA 3KC2A 1DEHA 3L3BA 4DY6A 6REQB 4EB3A 3TGLA 1T4CA 1RXVA 1EYZA 2H17A 2OZLA 2FPUA 3F2VA 3HJTA 3EGEA 3MTGA 4G5SA 3UHAA 2EX0A 1Y6JA 4PRLA 3OA0A 5EGNA 2IDJA 4KQ6A 3FMVA 2OORA 2P79A 2FZCA 3AHIA 2HQSA 2WTXA 4K81B 4RHUA 3GLIB 4FE3A 4JLBA 2DECA 2OECA 1JRLA 1NE7A 1OU0A 2QZSA 3FVRA 3FYSA 3P94A 4JLNA 4MW7A 4BYGA 4CF7A 1T36B 2AE1A 2XMGA 2RHCA 2V7BA 4PN3A 4OHYA 1T8PA 3GFPA 2G70A 2P2YA 3MCVA 2WQZA 3WISA 1GRQA 4HB4A 2OBFA 2LP4Y 4OQPA 4ACBA 2ERYA 4EZIA 5KNDD 2IZ1A 4BJHB 4X7BA 3A3NA 4CDRA 3CH5A 2EKQA 2QD3A 2V7QD 2XGGA 3D4OA 5KNDH 1B00A 1U2SA 2ZSFA 3LUJA 5CT4A 3WRWA 1ZSVA 2CLMB 4DJFC 4M54A 1OIVA 4DC9A 2XCUA 3MTQA 2OQIA 3NYIA 3EZYA 3EG9B 4UARA 2CLLB 2FOXA 1X2EA 1E20A 2I2XB 2ZU0C 4JOBA 1LW7A 3RTDA 3UO8B 2WHXA 1Q0UA 3CLHA 3NALA 4M38A 2CSXA 1N5IA 1Y8CA 5HGXA 2FMFA 3V4RA 4M7OA 1PL6A 2QMZA 3JWGA 3W2GA 4K6FA 2N42A 3FPCA 5BVGA 1QNLA 3O1LA 3O3OB 3RF6A 1SY7A 2CK3D 4IHQA 5EIFA 2WSSA 1VTKA 3DOHA 5ALRA 1YVRA 1UWCA 2WD7B 4B40A 1KZ1A 1ZCZA 3DOJA 5D3QA 4XM2A 1WBDA 1PJCA 5LOVF 2CB9A 3TSWA 3VKVA 1KH3A 3MBIA 3OC0A 4C01A 3UENA 5I4IA 5DBOA 4DV2B 1IHDA 4RTNA 4BO6A 3OE7D 4F5WA 3IJ5A 1Y34E 1PAUA 1SD1A 3HXTA 1NVUQ 4V0KA 1H65A 1KNQA 4X71A 3RIEA 3P9IA 5DTQA 5E8RA 5G4LA 1BVUA 1YA8A 2CMFA 2ARKA 3GLFE 2QMYA 1F5NA 4G5RA 3DKIA 4H4DA 1WSAA 4RTKA 4CPDA 4AYWA 5BYKA 3DVAB 2D7JA 4XWOA 1JR6A 4PCAA 2DFKB 3PQCA 5DIFA 3BXGA 3K1AA 4MOWA 1CS0A 2VDRB 2EFJA 4U7TB 3U5TA 5KUTA 5ECGC 3ZWYA 1O03A 2E7ZA 1DBSA 2IX9A 1GRCA 4KN5A 1LJUA 4D4KA 3S2FA 1AJEA 1J24A 5EQTA 3Q7RA 3T3GA 3ENVA 1ZOLA 3IOYA 4FGSA 4YDSA 5A9TA 4UOZA 4YROA 4HWTA 1MQAA 2XUOA 4CMAA 1FU7A 3L0SA 1IJKA 4RKFA 3S68A 2O59A 1DIHA 5EWMA 4G25A 1GZUA 1UT6A 2BMVA 5AKLA 4RJTA 4MA4A 3H2SA 8AT1A 1L7MA 4GZ3A 1ANKA 2C7BA 1XZDA 3PX2A 4PZPA 3AI3A 4L2IB 5CT5A 1PVOA 4MS3B 1XD9A 3FVTA 3W9SA 2ZBPA 1GZVA 4NHOA 3JY6A 4I1IA 4M0EA 1PR6A 1CDZA 3HN7A 4XE5A 1LVUA 3LSYA 4Q9JA 2B69A 3DR5A 3WSTA 1SUPA 2JGEA 3D2BA 3DD1A 1AKVA 1NVTA 4UHCA 5FLEX 3TB6A 4KWTA 2F00A 4CETA 1R6UA 4CIYA 4ZMBA 2APJA 3IAFA 4QBIA 4R1OA 4WACA 1BKSB 1J2TA 1YRYE 3AFIA 5EJMA 4QTUB 1SCJA 5SYAA 4FLFA 3SX4A 4A9AA 3IDSA 1RBQA 3LCJA 2HA7A 1M6EX 3OPQA 1C8LA 3QVTA 4Q0MA 3UG7A 1U0SY 2ZBRA 5CM8B 1QAQA 4A82A 1IZYA 1KVTA 1DG9A 3NW9A 3PPVA 1GCGA 1J2RA 3IAS6 4RJKA 5AJXA 1K8YB 3P20A 5KDDA 1XLTA 2SKCA 4Q3EA 2UUOA 2BFDA 4YDRA 3IDZA 1NNLA 1QLJA 3OCWA 3WRXA 1FLVA 1GRRA 2E82A 1L8QA 2FW9A 3N74A 3RYIA 1V39A 3QF4A 3ND5A 4GPTA 3K05A 3O3CA 4YMTA 1KAMA 3K0BA 3AERA 1JFRA 2Q99A 5DLPA 5FTKA 1GPUA 1CETA 3ZZNA 3BQNB 3S2YA 1N1DA 2IXGA 1Q84A 1T2EA 5CVDA 3RVJA 1P5HA 1SEVA 2WD8A 3HDVA 1YVEI 2Z2KA 4UMVA 5TC4A 2FPOA 2YNMC 4KEAA 3JR3A 1WBBA 2BMAA 3RVSA 2XVAA 1G7TA 5GJCA 4IHAA 3ZTTA 2R6GA 2FR8C 2FQWA 2NQ8A 3TAXA 4NBLA 3DAHA 4L8WB 4OP2A 4PQRA 3DBLB 2VA8A 1SUCA 1VFNA 2C4TA 3K1ZA 3PXXA 2PJDA 1B8UA 5E4FA 5GVSA 5CG1A 5JT1A 3L4EA 1RIFA 3MCZA 4QDKA 3JRWA 4ZAYA 1Q22A 3H99A 3WQBA 2UYYA 2VTBB 5G53C 1R0XA 4UAUA 1QGUA 4WUTA 4EKGA 1RBYA 2Y0BA 1RC1A 1IC6A 2AKEA 3AP1A 1Z88A 4LSZA 1K4YA 2QD4A 2NLOA 2FYTA 1OLXB 3Q4GA 1GZ3A 1CUDA 1PT5A 1YZTA 1E3WA 1HFKA 1M8FA 1R9NA 2P5YA 3KYCA 4MIEA 5KAPA 1CF2O 3WHKA 2J9FB 2P11A 3RTEA 1X7ZA 1KFJB 4JHXA 3TR0A 1OV6A 2VDWA 4JT9A 3WL5A 2E5LB 5BXYA 1DL5A 3C4VA 4QTXA 4CW7A 1Y33E 4J0EA 3JTEA 3IRVA 4F4UA 4IUCS 3DPUA 3RKUA 3KKLA 3C43A 1A8QA 1NOIA 3P96A 4BLWA 4E13A 2WV7A 4DNFA 2GFHA 1ZM4A 5A5GA 1YB4A 2CGEA 5JCJA 1AMUA 2WINI 4BMZA 2ZJ6A 4XX0B 2D3WA 2AZ4A 1E5QA 3NAGA 5ALNA 1RWMA 1TQHA 9LDTA 4YRBA 1B1CA 2HU7A 3LKZA 4ZOAA 3EZ9A 2G83A 3NGXA 1M6YA 2WZCA 2W2MA 3PQ4A 2WC1A 4D6YA 5IBPA 3FLEA 5AK0A 1XMPA 3LT1A 3IR6A 4UTNA 3KTDA 5JNRA 1UJ2A 2C5SA 1E1CA 3NEAA 4FOSA 2VDWB 4TTVA 4KQFA 3WB0A 1M10A 1IPHA 4BNDB 1H5UA 1HXHA 1SC4A 2GM9A 3CRQA 4HUTA 3DOOA 2P75A 3BH7A 4JWTA 4ZRMA 2RHLA 2BBWA 1NA5A 1JX6A 1XQXA 2TSYB 3AUFA 4A0RA 3CCCA 3ZLUA 5DPMA 1A5SB 5LKAA 1Z5VA 1LFAA 4F4CA 4AIIA 1DPFA 1JNXX 1C1DB 2H1FA 3TQCA 1OH6A 2HT1A 2MSDB 4I5GA 1WABA 2YKGA 1VLHA 5ALSA 5KQRA 1SU8A 2FSVA 1JIQA 1QVZA 4IJVA 5JNUA 3CRW1 2WWIA 4MUBA 4E94A 1FUYB 1P2VA 1N34B 4FBGA 5SZKB 1JXAA 2PZGA 3L41A 2KJQA 2HBYA 4Z4GA 1X7XA 1E7MA 4IV0A 3TRJA 1R4NA 1SUIA 3R3HA 3HVHA 3IKLA 3INTA 2EBUA 4JA0A 5GAJA 3THWA 4MGKR 3UJ7A 1M1YB 1LKZA 1ZW1A 3DFMA 2QNRA 2VQDA 3G0GA 3T0FA 3WP0A 5BP7A 3HXQA 3KHKA 3TLZA 4LJ4A 1IJFA 4BNYA 1KO5A 1QFJA 2NTJA 1N3YA 4ND3A 4CM8B 1J0EA 4JI2B 2ANCA 1HETA 2JAHA 3FR8A 3PEWA 3LK6A 1TCUA 4H0NA 2QTVB 4IJ5A 5TNXA 2JCSA 4QHYA 4PYNA 3D4NA 4BCCA 3RVQA 4OKSA 2QVYX 4QPDA 4QEKA 3II6X 2PUCA 3TVTA 1DO8A 2JIBA 1L4BA 4QJBA 2W70A 2VKQA 2QRHA 1SIBE 4CIVA 2VXCA 2OO3A 3R3WA 1E1MA 4UEKA 1KJNA 1RXWA 1A76A 1W85B 3D54D 4XX0A 5F2OA 2C3MA 1D9ZA 4A03A 4GL2A 2IU6A 3N07A 1OWPA 2D2XA 4EHJA 3NVMB 3TB4A 3U48A 4WVFA 4FOTA 1TU3A 2ZRLA 4ZK2A 1CP3A 2WMYA 3LC1O 5HJ2A 2IS1A 4F3YA 1ORIA 1DBIA 1PYOA 1NE2A 1JMYA 2WU4A 2X13A 3HB0A 4JIGA 5CDFE 5J43A 5DYIA 1UFQA 1N2ZA 2IOQA 3CKKA 1EGHA 3DE1X 1KS2A 3JRNA 2WPNA 2IXAA 4IM7A 4CCSA 1UXOA 2JGKA 4J1NA 2W8BA 1TT5A 1IL0A 3AFOA 3MWEB 3QVXA 2HXYA 2ZI9A 5LZ7A 3TQTA 4BLVA 4EARA 1O5IA 2WIDA 2WSSD 4D8WA 3F49S 2QZZA 3I64A 4HRAA 1YJXA 5HS4A 4IFTA 2VPWA 5AW5A 1IN4A 1LK0A 1YZHA 3C3PA 4AWAA 3QELA 1OCEA 4GZMA 3VYWA 4X65B 2BRUC 2A5YB 3MGAA 2QLJA 5ABPA 5IU6A 2IYXA 3OE7A 4OKNA 5TT1A 4AJOA 1OYVA 4PYJA 4ROTA 4JI1B 4OBWA 1YIAA 5DK6A 2G06A 2CLDX 2P3LA 4UW9A 5ALXA 3GNLA 4GPZA 4INZA 2QTGA 2QUIA 4D8XA 3SZGA 3QWFA 1LTKA 1XV5A 1PWZA 1P7PA 3NWOA 2BFFA 3FWHA 2ZUWA 4MDYA 1G6Q1 2ZJ8A 5M2QA 4BLTA 5KNBH 3ZDDA 2GZ1A 2GZHA 4LJLA 3T3DA 2NZUG 4CKWB 5KAMA 4BVKA 3SJ7A 3R7NA 1MABA 5E4TA 1V16A 2BM0A 4DR6B 1VJCA 1UEJA 4I9GA 3UHJA 1W6RA 5BT8A 5H82A 1MB3A 3BK1A 4KVAA 1H2RS 1M9NA 3F8TA 2GBPA 2P62A 3KJQA 3QJGA 4KIJA 4UHKA 4H60A 1I32A 1T8UA 2FKAA 3UXHA 5FWYA 3UKJA 2IY9A 4X7MA 3PXCX 1T5HX 2XB9A 3KLPX 2R8YA 3GGGA 1NXOA 4GZ6A 3SHTA 2ZWAA 3CSSA 1QJ4A 4YCNA 5H9WA 2QTHA 4JNCA 1IYZA 3PT9A 3DYIA 4BAZA 1TECE 4I50B 3P2IA 2EP5A 3ANYB 1EFUA 3W5HA 3W8NA 4ARZA 4DL9A 5DOZA 5CDYA 4B73A 1CY7A 3SF0A 5CLHA 4LRWA 1M6VB 1K6XA 2BEWA 4Q1VA 5DNAA 3DWEX 3N8GA 2EZ9A 5JLJA 5K03A 4BO9A 3EMKA 3HQ4O 3COPA 1Q6ZA 1Q14A 3GJ4A 3F5DA 4KQJA 1RXCA 2C98A 2NXEA 1Q50A 4BO5A 1G8GA 1L5LA 3A1VA 4DM3A 3C8DA 4RTOA 5EXSA 2EHJA 3CIFA 2CVPA 3IEVA 1ISPA 2OBNA 3EG9A 3CLTC 4BGIA 1XZHA 2B21A 1YQTA 3C16C 2H0AA 4R71A 2VJBA 2YZMA 1KWKA 1XQWA 5HUQA 1R6TA 2CXPA 5KVQA 4CN8A 2UZIR 4U7HA 3FX2A 2EV9A 2O1EA 3KOXA 4IGEA 4Y6GB 2XI4A 1AQIA 1WDKA 4PR3A 1LU9A 5DFAA 5ALZA 4UFPA 2B4YA 1ND5A 1QZUA 2ZRAA 5CX4A 5AI4A 4IYRA 3LUKA 2BMDA 2C2YA 2QXUA 2VL7A 2H4WA 1FDWA 4KE7A 3T9BA 4BBPA 3HVKA 2AS0A 2FFJA 4XASA 5AW4A 2B5OA 2AOXA 2OV1A 3P26A 1YJCA 3S27A 4HZGA 4DW8A 5F35A 2WFAA 4FSDA 1NXXA 3IP1A 4N1AA 5DGHA 4CL8A 3ER8A 3QELB 1YCFA 1QG4A 3NGLA 3SBOA 3F5FA 1UBCA 1IY0A 5FWAA 3VNAA 3HA2A 4TV8A 1II8A 5AFSA 4X85A 2XNCA 2X3FA 4GMKA 2XUIA 3RDPA 2NO0A 4RGBA 3PNOA 3WGMA 4CL3A 4RWZA 2BH2A 2DHRA 3HNRA 4MQ6A 1E1LA 3WXMA 2RC6A 2DPGA 4I36A 2J6HA 4Y6OA 2SKEA 4GEGA 5JUWA 1EVYA 1N25A 2EW2A 3CJRA 1PSZA 5BSTA 5LDHA 4JN6B 2XTMA 5CPBA 4BNKA 4IEFB 4OQQA 2CDCA 1JAIA 3ITNA 4YQFA 2X4IA 3Q12A 2GZSA 4EENA 4Z54A 2LCIA 4RY0A 1U98A 4J2OA 3A25A 4MUJA 1VRCA 3CX4A 3B5IA 1ACJA 4JXKA 3K2BA 4Y9TA 1VP3A 4JU8A 4EY6A 1ZI8A 1U1DA 3EOZA 2ZSDA 2H9AA 2Y1XA 1WCWA 3GGOA 2WPDA 1EFKA 2Y93A 4IZOA 2ENUA 1JDJA 4YJGB 1CY2A 4TXNA 3T12A 4WLVA 3M49A 1P1CA 2O06A 3L04A 1NC3A 3HB1A 1K66A 5E7MA 2HGSA 4FZRA 4J16A 1AKUA 3MB8A 1K9VF 1ECJA 1K6JA 3G9ZA 1Q21A 2TECE 3HP4A 2Z2JA 3VPDA 1RJGA 4U2KA 3ZK7A 3C6YA 3KALA 3WBFA 3SVLA 2YUIA 1PHPA 4AUNA 2FW6A 5BY2A 4YMUA 1T9ZA 2EZ8A 2IKSA 1VXOA 3D6FA 2X1LA 3OX1A 4LXTA 4A8JC 4JLSA 4D8YA 4FI3F 4JP3A 2W2XA 3DT8A 1U8AA 2ZI7A 4S1TA 3EBPA 4YJGA 2WNSA 1YHYA 2P68A 5AESA 4XGIA 1ISIA 2HDNB 1OTXA 1UQTA 2RIPA 4DQ0A 2GYYA 1JE1A 1SB9A 4EG8A 1R4NB 1Q74A 2CDNA 1CTQA 5JBQA 4BVFA 3K4QA 3OI7A 3P9CA 3AR3A 5JAQA 4B4KA 1M74A 2WIGA 4HAXA 3UWOA 2Z6AA 1VSVA 2WUFA 3CR3C 5BSGA 4PICA 3V8MA 3QVMA 2PL1A 2H0RA 1E1RD 5LC1A 3AF5A 1O7JA 3P9QA 2G82A 5KTTA 2XXAA 1OH5A 1NURA 3KFLA 1J0BA 3EGCA 1R8QA 3REFA 2JL1A 4RJJA 1H9CA 2E0IA 2UUAB 5KTPA 1RZ3A 3GUCA 4KR7A 1HE4A 4XQ0A 1MHPA 3RPEA 4EGJA 7REQA 1YDMA 5HZKA 1NBWB 2UZ1B 1GQQA 3F90A 4WLUA 2IZOA 3I2JA 2WKSA 2GZDA 4KXWA 1X3LA 3ASUA 3OF5A 5EQFA 4E1BA 1Z7WA 2BJWA 3N2ZB 4GXNA 3KVVA 2BDUA 4DJDC 1YVPA 3PQ7A 3KKNA 3TRIA 1AQJA 4MCHA 3CGWA 3IDOA 2B5WA 3EBOA 3LLSA 2QN7A 4EVQA 3RVRA 2WSLA 4MV3A 5C81A 1G4HA 3IUYA 3I04M 3RK0A 3WQHA 4BVBA 4L16A 2GD6A 2NP7A 2ZANA 1S8OA 2J4DA 5IS2A 1ZGAA 1W4AA 5FUVA 1DC3A 3SF8B 4L74A 3LOUA 1APBA 3PDIA 3FAKA 3DOUA 3QUSA 2I4MA 4CEJA 2XBMA 221PA 1YRHA 1E3WB 2QJTA 5KEIA 3D6AA 3TS1A 5HKBA 5AICA 4TKVB 4UOQA 3OPYI 1ZP6A 2R1ZA 3RFUA 1PK7A 2BDEA 3E27A 5I7FA 1G63A 3BA6A 1JB1A 3W1VA 2NYAA 1R3UA 1Y6QA 4HDCA 2BHNA 4WCFB 4WOJA 2HCTA 2QG9A 2WZDA 3COYA 3HJCA 2XOKA 5AK6A 1U31A 3U0VA 3FSEA 2TS1A 4P3PA 5L3RA 1OZHA 3HGMA 4HDNB 3NP9A 4TMVA 1CIPA 1PNVA 1N5RA 4GECA 4DCTA 2HYIC 3IQXA 1NLYA 2JJ1A 4EBFA 4GX2A 1KFCB 3IS3A 1XPJA 4WLNA 1J4AA 1O9BA 5DWDA 4F96A 3Q7QA 1JMKC 1N8SA 1EFVB 5LB2A 1C7JA 3PJRA 1STOA 3KOWA 4W9NA 4ZHQA 1T2CA 5GZ3A 3UMMA 3QE3A 3CEPB 4I81A 2VF4X 1XVAA 1YJ8A 4XI9A 4BQRA 5C8YB 2PZKA 4JLKA 3KQTA 2ZIGA 5C8YF 2C1EA 4AQ7A 3I28A 1J8MF 3FXAA 2A0YA 1XDZA 1H2HA 2WZBA 4IXNA 3DDOA 3THWB 2Z6QA 1RYEA 1K6MA 1JBEA 2I3ZA 3PDWA 2V4MA 1KVQA 1XA4A 3GVCA 4MWCA 4QO8A 4Z3DA 4B6OA 3VR2D 3BT7A 1WP4A 2CV1A 5T7BA 5K05A 2VJKA 1BS1A 5EL0A 4YAWA 4XARA 4XIGS 3IUJA 1FQKA 2IZZA 3D3EA 1VGQA 3AVTA 1LSSA 4H6XA 5EXXA 4ETNA 1KTIA 1S7CA 2X4LA 3QKIA 2RHWA 3JD2A 2QQGA 4GYKA 1GGMA 4M87A 4I6JA 3WZMA 3ETCA 3ZXIA 1LC0A 2IDKA 3LDGA 4XJXA 4BQQA 3ZGVA 2HK6A 4D41A 1H2AS 1JXOA 1M2VB 3UANA 1Z63A 1NATA 4L3WA 4BQFA 4MH0R 3GRKA 3EFOB 5CBPB 4L9AA 1IXSB 3Q98A 1IN1A 1WNFA 1E2DA 4XSGA 3SLRA 1PJAA 1QTNA 5D5PA 4AMBA 5IDVA 4CI0B 1CQIA 3NTRA 5IKPA 1Z0JA 1DHRA 4NIMA 4DJAA 4WI1A 2HQOA 1R8SA 1F8FA 1YKSA 2VK4A 5FPPA 5JE8A 4ZVPA 1OFTA 4HX5A 3GZ4A 4O4HF 4Q82A 2DZDA 1KS9A 4FX2A 1RHJA 1RTKA 1SUBA 3AC0A 4BATA 4J03A 1I7LA 4F9TA 3MCTA 1QDEA 1Q15A 2RH8A 4G67A 3C6BA 1M8GA 2IHKA 2FETA 2VHUA 4GI5A 5E3JA 3BHMA 4CM4A 2YMLA 2C9DA 3WO1A 3GGDA 1NASA 3I1YA 3CZ5A 3ROXA 2LGJA 1PLKA 3WAKA 1PUJA 2GPTA 1OZ0A 2HLHA 2XYGA 1U02A 1JZQA 3PLNA 4MVJA 4TLCA 4MVJP 4EG3A 2ZW9A 2WM2A 1RTTA 4KLNA 1NQOA 1CJUC 2CBZA 2EX4A 4K5QA 3BJRA 4IZIA 2DPHA 4ID3A 2FTKE 4DOMA 1CERA 1BKYA 2GAJA 2IELA 3MQFA 4HDNA 1UH5A 3RUAA 4ZARA 2KQUA 1ESEA 5FI0B 1TUIA 1RPJA 1Z75A 3SSMA 3D5EA 1ZK2A 1BWRA 3JYQA 4EP1A 1X7XB 3ROPA 4FB5A 4ND7A 1ZUWA 1P1JA 1E96A 4IJ6A 4IMJB 2BT4A 4IINA 2RGNC 4YCDA 1I80A 4QYMA 3BB3A 1N6NA 4V2IA 1NP6A 4GR9A 2PG3A 2XMRA 1CY4A 3CVOA 3MWEA 1LBSA 3Q8KA 1P5RA 3IEKA 3KP1A 2WUDA 4Q3DA 3INYA 4F6RA 1U7OA 2IU4A 4TTJA 4ZO6A 4ZYUA 4P3XA 2WYWA 3PUIA 1D2GA 3ONDA 5ENVA 1US8B 4P82A 1EX9A 1W94A 3FY4A 4P36A 3INRA 4Q19A 3IPXA 1TD1A 4RK1A 1UEXC 2ZM5A 3KLOA 3K0CC 3L6RA 1LW6E 1YDWA 4XDHA 2Q6TA 3W9BA 1NV9A 2ETXA 2B4RO 2IHBA 3ZD8A 1FFYA 2OMEA 2Z2IA 4ZYWA 3G2QA 2XAUA 2BN4A 4D9HA 2BKEA 1YUBA 4C5BA 5KX5B 5TLSA 2ZE6A 4RCZA 5DTEA 5H5JA 4ESVA 1XPUA 2CXHA 2A9OA 2Y1KA 3H9GA 3HSYA 2FEMA 3I6YA 1EP1B 5F7ZA 3LPCA 5HFAA 4B0PA 2JBAA 3QTTA 3E4CA 1T5TA 2BKUA 2C4HA 4R40A 3PC2A 3U7IA 4D4LA 1R6DA 4BXOA 2C2WA 2W00A 2YASA 3MMXA 4O1HA 4ZRDA 1FLNA 1HYGA 4QE3A 4URFA 5CNJA 3WDLA 3DLCA 3FCEA 1SQSA 1N7JA 2VK2A 4EDHA 4EKYA 2LR0A 4Y1RB 1C8BA 2PHZA 3L9WA 4TSKA 2GVNA 5HQJA 1J39A 2XV1A 4L4XA 5HE8A 5LZ2A 2OZKA 3FIUA 2LUOA 4IFEA 1QP8A 2ZUBA 5L6LB 2WTEA 1RPZA 1QGUB 3AV0B 3C1TA 3HPRA 3I9JA 3V7NA 3ESRA 4MKZA 1G8FA 1UP7A 2I2WA 3FB4A 4R2LA 3SSNA 1N6KA 4DKXA 2FSGA 2XMDA 1WM1A 2QRGA 3FCCA 2C2OA 2G5CA 3ABIA 4CLXA 4NZNA 4FQ5A 4J4HA 1GDTA 1G3MA 1YHZA 2G1UA 1FDSA 3FWZA 3I6IA 4ROSA 1DJLA 1NSYA 4N9QA 4HJRA 4D0RA 2WTMA 1W73A 1LBQA 3OTGA 5EEGA 5ELXA 1ZNQO 3C7TA 4BNDA 4AP5A 2ZK7A 5AHWA 1FFAA 3JS5A 3SJAA 2VP2A 3LHDA 1BNCA 2NTNA 1WUYA 4DLUA 4FB4A 1BZYA 4PZCA 2OENG 1CUBA 3DLAA 3VTFA 2HO5A 1RI4A 4JQZA 3AK4A 4LHYA 4R5MA 5JDCA 1U0RA 3AVYA 2FE1A 1IFXA 4JJIA 5T4HA 3HI4A 1SWWA 3C3EA 1K3UB 5FBVB 5LOVA 2PE5A 2X14A 1EGMB 2BJHA 5IJ0B 1SB8A 3LK7A 3T52A 3QLJA 1P72A 1M7BA 3LNCA 3WAJA 3SNHA 2N9UA 3ET5A 2ZJ7A 4DSUA 2WTUA 4PO3X 4Q12A 4WBXC 2ZLBA 3K9LA 4GMGA 4FGKA 1J21A 1EFPB 1HL3A 3OLZA 1HLDA 1J09A 4MQUA 4JI6B 3RSGA 4FU0A 1L5ZA 2A9JA 4HLQB 4C0SA 3SXJA 2C97A 3HXKA 1GGVA 3HLKA 3K1TA 4K9KA 1AKYA 1M83A 3C5VA 5TB5A 4B84A 1Z47A 1TC1A 1S2DA 2GAOA 3EAGA 5U4QA 1T9BA 4EFMA 1MEJA 3A3OA 5JPCA 4I5IA 3R0XA 3LA6A 5A4KA 1YZFA 3I58A 5IP5A 4MS3A 4BLSA 1SUFA 4C76A 1K27A 1Q0LA 3FUXA 2P78A 2A6PA 2IF0A 1IVNA 2PN1A 3W7AA 3CUWA 4N0DA 1XYYA 3H2JA 3HA5A 4LIPD 4YJ2A 4UFOA 2HQBA 3CWCA 4R8MA 3D8SA 3NASA 2R5FA 1PLLA 4R1QA 2DUWA 2EQBA 1LX7A 1MGPA 1RPAA 2RCYA 4Y6LA 2XIQA 1WF6A 4NBUA 1YA6A 1MKYA 4PLPA 2P35A 4KO4S 3CUKA 1I0LA 5C8YA 2Q3JA 1AXGA 1J0CA 1HEUA 2PRJA 2AI1A 2GN9A 3AF1A 3JYNA 3LBNA 4PGAA 4EO9A 1EIWA 3TCNA 1HQYE 1XZPA 2DUJA 4AS3A 3ND9A 4KSYA 1QE0A 2J6CA 1UDWA 1I24A 4ZOLB 5K2MA 3GO4A 1RBZA 2J3HA 4N3AA 5DH9A 5AKZA 3RROA 3SYNA 3QFTA 4FOLA 3UTCA 3VUFA 4DQUA 4JJ8A 4EY3A 2D54A 3V9AA 1IBCA 1XMXA 2B34A 3D6NB 3JWPA 3QOYA 4FHFA 3ONVA 1KAHA 4HSGA 1FRVA 1RCFA 2V5UA 1CIVA 4WY2A 1JFLA 3IAS1 3FFWA 5MN6A 2FMHA 2ZG6A 1IY8A 4ZT4A 4I1OA 2QG4A 3QKRA 3VM6A 1YR2A 1EIZA 3SZOA 5C7LO 2ZRJA 1NT4A 1UZMA 3B2NA 3M3PA 1EXVA 1HQCA 2QMOA 5FA5A 3HNOA 5F7JA 3PFHA 4PC3A 2BM1A 5B2FA 2XT0A 1GTL1 3LZCA 5DRYA 1PCXA 2W2OA 3HSSA 2EW8A 2CUKA 1KZGB 1GAXA 1KI1A 2PQ2A 2IS4A 4IUYA 4OEHA 4KH1A 3GT4A 2AN9A 3SF8A 4UTRA 4K6HA 1UOOA 2BFCB 4W99A 5B58C 8OHMA 2FVYA 4DG9A 4LYJA 3OKPA 4E15A 3U61B 5G0UA 2RKBA 3GLHE 5FHRA 3VRHA 5DNWA 4Z9AA 3G2PA 2XUQA 4FBLA 4OFXA 4JKIA 5F77A 4C05A 2GD0A 1U4OA 4YP9A 2VPZA 3BL8A 4M9CA 3WGQA 3W8DA 3QY9A 3P71T 4NYIR 5KU1A 1NF8A 1T3LA 3OX2A 4CNQA 3ZTYA 2FA9A 3PHJA 1NY6A 4OOFA 5JISA 3MBKA 4C4YA 5CFMA 5JJIA 1K6EA 1E4VA 5FLXA 3HEBA 2Q7XA 4W8OA 1WXIA 1AKMA 3UJNA 4WA8A 3OOWA 2AD5A 2FMIA 1Z6ZA 2HMSA 4E09A 2BGGA 4MV1A 1E2LA 1JPVA 5CX1A 4AJNA 2FF5A 5CIWA 2BGMA 2Z2XA 3ZCSA 2QRVB 1PJQA 3ABSB 1AN9A 3DV2A 9GPBA 3G8CA 1L7OA 3V34A 1X1CA 1OI2A 3HLYA 3TRHA 3DKRA 2IHUA 2ZKIA 1IN8A 4W6QA 3FF1A 2RK6A 3AUAA 4C03A 3CFYA 1NSTA 1NP3A 4IIDA 4QJ3A 1MIHA 5AVZA 2H2FA 3WIBA 1YC2A 1WXWA 3DR3A 1X1DA 3OKCA 1GZ5A 5EC8A 4GWKA 4OLBA 3AKEA 4QOIA 3TG8A 1TM1E 1IEXA 1KIAA 1LJLA 1X80A 3GT0A 4OHRA 4E08A 3O2SB 3R8FA 1JMVA 5K0ZA 1GGHA 4NDAA 1SXGA 1Y9AA 3P19A 5AVKA 5DMXA 4BCBA 1QYXA 4DG8A 1M1XB 5AKJA 2NSYA 4LXUA 1SBNE 5JEDA 1C1XA 4R2WA 4WK0B 4Y2HA 1USWA 4PANA 5L40A 4K8OA 1HT3A 3K15A 1XKTA 1MO6A 4QXOA 1KEEA 1SKYE 3HB7A 2AR9A 3RAJA 3SS7X 3NORA 4YHBA 4WEQA 4RD0A 1CQWA 4N7MA 1IQUA 2GLTA 2HEGA 1PV2A 1KDYA 4EY8A 1UOPA 2W6NA 3L77A 5EI5A 5AJUA 2XJ9A 4RJIA 3ZR4B 4B3GA 4KGVA 2EGUA 2QVXX 4AJJA 4BZWA 2ZYDA 1JH9A 3R5JA 2CYCA 3DZJA 3GJRA 4DVGA 2QLNA 4MYDA 1YZ3A 2CKDA 3DEJA 2HFKA 4JUCA 2OV6A 2VPXA 2ZS7A 5FJJA 4EFDA 5ICFA 3HO1A 4IIJB 2EL7A 3SSAA 3PCRB 4K87A 3TSOA 2R6DA 1YGYA 1Y42X 2O4UX 3WWZA 2X8WA 3ERCA 1ATIA 7MHTA 3STXA 2X0KA 3BDAA 4N48A 2C8VA 2ZB3A 1KGSA 5JSZA 2Q0SA 1R0YA 1DXOA 1R9MA 2I3DA 1Q0TA 4L5AA 3O9VA 4Z9XA 1Q0QA 2ZRIA 2R96A 1VJ5A 2EL9A 2PTGA 3EMDA 4FUTA 2ONYA 1KYIA 4M7RA 5CDHA 5E8JA 1WKCA 5CYGA 3A1TA 3LM8A 4HWRA 5HM6A 3N2GA 2XKAA 1JDPA 3T5GA 3E61A 4CQJA 1BKDR 4EA8A 1E7QA 2ORVA 2HDHA 2PD3A 4MVJF 3D8HA 2PM8A 4IVPA 4O4JB 5J4KA 4D7AA 2DBZA 1W76A 1D1PA 3ICOA 3N58A 3P2MA 3U2QA 4EUSA 2VI5A 2VQ3A 4MQBA 4OHFA 4KYTA 4K7JA 4K9SA 4KQGA 2WVGA 2V5AA 1ZJYA 5NULA 1A8IA 1QHEA 4ABTA 1HL7A 3OLWA 4LYFA 2C2GA 4E21A 4F60A 4JI8B 1F2DA 1YC5A 4GR5A 1X19A 2ID8A 4ZJZA 4RD3A 3IXQA 1UUFA 1E60A 5HIIA 1LBIA 1DBWA 4N8DA 1W2HA 1W88B 1NZJA 2GNAA 4CLRB 1XQVA 5BSRA 3EVCA 4V0NA 1Y1RA 4EF6A 5EHXA 2H1RA 1C3OB 1TO2E 5EA2A 3RQIA 1Z0FA 1Y5IA 2HPHA 4Q9HA 2NVUB 3E4DA 4IP0A 3FW1A 1Z5WA 1ZMOA 5E7IA 2RBGA 3F9IA 4KO3S 2ZXFA 1CS4C 1BXRA 3K1JA 1KIFA 2X1MA 4LZZA 3W5JA 4AY3A 4F1WA 2OAEA 1RWOA 1QONA 2BHSA 2R751 4LDQA 1P5ZB 5ICEA 4S2UA 4NU5A 4YTEA 1Y7IA 1ZN7A 5JH7A 3RU3A 2REBA 3O4JA 3IQWA 1G4AE 4MV5A 1PZHA 3CVUA 2AT1A 3RGGA 2H1VA 3BK2A 4J6FA 3MMZA 3R6WA 3DYVA 3OSUA 4RPLA 4E4RA 2I7VA 2F4VB 1AH2A 1P31A 1QIKA 1Z7YA 2QMHA 1W46A 3FNFA 3IIIA 4KLRA 1AM4D 3JWEA 1FLDA 2C0CA 4O4IF 1JS1X 5J2UF 5B6PA 3ORFA 2VJCA 4EKNB 1XLVA 2G5PA 2H07A 3ETGA 3WLMA 2FHPA 4LJ8A 5AW3A 4LRTB 1PRYA 4J16C 1CPYA 1G5FA 2X5OA 4RVNA 1P3JA 4OL9A 2X2EA 5HOQA 3RIMA 2GCOA 3IOMA 4D56A 5A5FA 3QXSA 3PLRA 4F46A 4K05A 1MC5A 2QMEA 1J1IA 1YR7A 4GPEA 2B3DA 5EIOA 1HDEA 4BMPB 1U0EA 4J3JA 1KQNA 4YRAA 4L6AA 2CK3A 1KF0A 4CF4A 4PXSA 4KLAA 1OY1A 4X20A 1IHOA 4JJ7A 4A8JA 2UXCB 4ZIRB 1H9BA 1A7AA 4WY5A 4CNBA 1XELA 3DTVA 2QAJA 4FMDB 3HVRA 3HDJA 2L82A 3ZU2A 5HKOA 3D2LA 2FPGA 1D2NA 4LWQA 4P1ZA 5MHTA 4PXYA 4F2HA 3EMVA 1W5BA 4GOXA 4IZ6A 3ZBPA 3CTPA 4E03A 3CF6R 3O73A 2J32A 3UJBA 2A7XA 1WS6A 2I67A 3ZWPA 4H7EA 1Z5UA 1XX6A 2FQXA 4C0LA 3AI2A 2FK7A 2OOSA 1Y3HA 3ELBA 5EJ6A 3MOSA 3BORA 4J0FA 1YQGA 1NPYA 1ISJA 2B7BA 3PXUA 4KWIA 1HMPA 1ZG3A 4RFSB 4RHEA 4N3CA 2YY7A 1NYTA 4WINA 1EP9A 3VYRB 2AN5A 5CFRA 3S5JA 4KQHA 2FPXA 4Q93A 4WFQA 1RVDA 1MXHA 4Y6RA 2F3UA 5CFOA 3VVCA 1K3TA 5IFLA 3TJMA 1Z15A 2XVMA 4C22A 3DTTA 3LZ6A 1C7IA 1N7GA 3P0JA 4NY1A 4CJXA 1XRRA 3ZKWA 1R50A 4MARA 1AUPA 4HTFA 2RK3A 2ODAA 4Q7KA 5JCOA 1Z3IX 5JAZA 2ZDQA 4EW3A 4OHCA 1LS1A 5LBTA 2W90A 2OAQ1 1QFZA 2PMKA 5K8IA 1OLUB 2VO1A 1M33A 4MQEA 3GVXA 3LBAA 3D6UA 1CNMA 3U9LA 1T1EA 4IIXA 2PANA 4MLZA 2RH5A 1Z38A 4RSHA 3GLFB 4QGAA 2H0QA 5CHYA 3E2IA 2H7CA 2XMZA 5DBHX 2P9JA 2Z0MA 4CKBA 5CTAA 3DV0B 3CUVA 1U99A 3WGLA 1UKYA 1XYVA 2NSLA 1OKKD 2PRYA 2GRJA 2W4MA 1IOVA 2QAIA 4TL9A 3NM4A 2QBYB 3GA0A 3FTDA 1M73E 1NRIA 2VATA 4KAAA 5CJPA 1O1YA 3B8HA 5KYWA 2OTCA 5HRCA 3C87A 3RJTA 1LZKA 2X1HA 4LF4B 3MWLA 4FFLA 4WLEA 1JU4A 1IBRA 1NRXA 3R8XA 4ALNA 1XEWX 5I3CA 2EJUA 4XUEA 2ZOSA 5AHRA 1F2UB 1T25A 2WWWA 3QITA 4Q05A 4UATA 4XGNA 4DC0A 4XWKA 1ZOSA 3RJ9A 5IDYA 5DNUA 4F4JA 4P58A 4U2CA 3TI9A 4ESHA 2VH5R 4GSKA 4E1VA 1UFRA 2PV0A 3ZHZA 1XZKA 3MERA 3RC7A 2JC3A 1T34A 1L3BA 3BB1A 1KE1A 4O8CA 4FXOA 3IPRA 2SKDA 3TEMA 4DADA 4E5YA 1P0MA 1RKVA 3EIQA 3KZVA 3KZNA 2OWDA 4OLJA 4TV9A 4D9BA 1MIOA 1ONSA 2I1QA 3DONA 3TOVA 5EXTA 1P91A 1YR9A 4N7BA 1XXHA 3L8FA 3AEUA 3IQZA 1E61A 1TAHA 2OC4A 1ADBA 1GCAA 4YJFA 4UAGA 2ZGVA 5DZSA 1DZ3A 1GAWA 5LA6A 3RH0A 5CXXA 1IG0A 1ZIDA 3LKDA 1GL7A 4DQDA 5JS8A 5C52B 1DTWA 2P3SA 1KZHA 1FDVA 3R5FA 3L4JA 1JTVA 2GEFA 1JTEA 3WK7A 3HN2A 3AR2A 1CJBA 3C3BA 3AP2A 2YYSA 4DJTA 3F47A 1T9GR