3QMQA

Crystal structure of e. coli lsrg
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
97
structure length
97
Chain Sequence
SMHVTLVEINVHEDKVDEFIEVFRQNHLGSVQEEGNLRFDVLQDPEVNSRFYIYEAYKDEDAVAFHKTTPHYKTCVAKLESLMTGPRKKRLFNGLMP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Processing the Interspecies Quorum-sensing Signal Autoinducer-2 (AI-2): CHARACTERIZATION OF PHOSPHO-(S)-4,5-DIHYDROXY-2,3-PENTANEDIONE ISOMERIZATION BY LsrG PROTEIN.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase
molecule keywords Autoinducer-2 (AI-2) modifying protein LsrG
total genus 27
structure length 97
sequence length 97
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03992 ABM Antibiotic biosynthesis monooxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3qmqA00
3BN7A 1YRXA 1VQYA 2FIUA 3BR8A 1MWZA 4Y2IA 2BJDA 3CJKB 2GO8A 2OAUA 2XMVA 2ROGA 3IWLA 2Q3PA 2RU9A 5F0WA 2K7KA 1KVJA 2N4DA 2ROPA 2ZDOA 3WDOA 2VV5A 4A47A 4A4JA 1CC7A 2IYIA 5B0AA 1FE4A 4A46A 2CRLA 2GGPB 3HHLD 2AW0A 2FHMA 3KG1A 3HHLA 1WD6A 1XBWA 3DXSX 1TL4A 2GFFA 3KNGA 2N7YA 2GGPA 2W4DA 5B0BA 1X0PA 2K1RB 2RMLA 3HFKA 5B0CA 1TZ0A 2HFOA 3TRGA 2AJ1A 1P6TA 2GA7A 2HLTA 1YG0A 2XMMA 4HH1A 1W2IA 1SI9A 5KAKA 3QMQA 1YJUA 2HLUA 2PGCA 5K9FA 3FMBA 1SQEA 3KKFA 3HHLC 3LGNA 4NL5A 4Y2KA 4Q2LA 5B0FA 5T7LA 3T9NA 2ASYA 1OQ6A 4OJ3A 4ZA1A 2XMKA 3TNVA 1KQKA 5B09A 1Y0HA 1GXUA 2OMOA 2K7JA 2N4CA 3BB5A 1V3ZA 1AW0A 1CC8A 1JK9B 2XMTA 4DL0C 2OFHX 1TR0A 3MCSA 1Q8LA 3LO3A 2W4PA 4ZOSA 4HL9A 5A6WA 2ACYA 2EW9A 1Y3JA 1URRA 1MWYA 1YJVA 2KKHA 2OD4A 2OD6A 2XMUA 3K7RA 4FNIA 3DCAA 2RSQA 1SB6A 4A48A 1APSA 1K0VA 4U9RA 1FVSA 3BF4A 2OFGX 5A6PA 2OP5A 2QLXA 1TL5A 1TUVA 4EFAC 2PD1A 3HF5A 4HH0A 2LXFA 1N5TA 2KYZA 5B0DA 1GXTA 2LQBA 1Y3KA 2AP6A 1LQ9A 2IYGA 2W4CA 3IWXA 4OIXA 1Y9OA 4OJ1A 3CJKA 4DN9A 2FB0A 4DPOA 2HIQA 2LDIA 4Y2MA 3E8OA 2RILA 1OPZA 2OKQA 2AJ0A 2XMJA 2ZDPA 2K1RA 1FESA 3HX9A 4HI2A 1RJJA 1AFIA 3HDSA 3QGPA 4FNHA 1JWWA 5B0GA 1Q8BA 2HQIA 3BDEA 2K2PA 3BGUA 2VH7A 2GV1A 1Q4RA 1YJRA 3TOQA 1QUPA 1R6YA 3GZ7A 2QLWA 2QYCA 4OJHA 5T7LB 1YJTA 2BUNA 2FTRA 2XMWA 4YDXA 5F0UA 3VTIA 1FE0A 2LQ9A 2KT3A 5B0EA 1U7LA 5IXUA 5B08A 1KVIA 3BM7A 1CPZA 1FD8A 4F67A 1S6OA 2BJEA 2L3MA 1FVQA 2BBEA 3FGVA 3FRYA 3HHLB 4NPOA 4QOTA 4HI1A 2G9OA 2KT2A 1AFJA 1Q53A 1OQ3A 1OSDA 4OJGA 2QIFA 4YEAA 1S6UA 1N5VA 4Q2MA 1IUJA 2JDJA 3MZIA 1X8DA 2BYCA 1FEEA 2HFNA 3F44A 3I9ZA 1N5SA 1N5QA 1VQSA 2IFXA 1ULRA 2ROEA 3KG0A 3LGMA 2GCFA 3UDCA 1X7VA 1P8GA
chains in the Genus database with same CATH superfamily
1GEHA 3CVKA 2LVWA 3JTPA 1GMUA 4TQSA 1VBXA 5KFNA 2GO8A 1RWOB 2MJUA 3N6NA 3NKYA 5A8WA 3FBFA 1EQMA 2BW2A 5J1EB 5EWFA 3KHLA 4V1Ak 4JI3F 4M8LA 5F0WA 3FSYA 2V5HG 4TU9A 2FZCB 4ED7A 4DQIA 2DNOA 2W9CB 3FK4A 1S9EB 2EVZA 3G87A 4ZJLA 4PWDA 2LEAA 2CWKA 4E98A 1NK6A 3CDBA 1NM2A 1UKUA 2GGPB 3O3LA 3KG1A 4NEZA 2FLPA 4DFPA 1T03B 2DGSA 1NEEA 3G86A 3EPGA 3CJ4A 4OYWA 3KLFA 2LKZA 2WVEA 3HFKA 3CO0P 3PM9A 2YH0A 3A13A 4YMEA 1P6TA 2HBQB 2DBBA 4IH6A 1LK7A 2D41A 3A8JA 2ZM6F 2R8GA 5CAAA 3EZOA 1TTHB 3CD0A 3K8VA 3CT9A 4RW4B 4E8UA 3ILJA 1I94F 3OSPA 1RHKB 3GIMA 5HAOA 4MKAA 5EWGA 1S79A 3SEOA 4CLKA 3MM7B 3HPOA 3TR5A 4KKOB 4PWDB 1J27A 5RUBA 4IKAA 5DGBA 5B09A 3L3CA 3UWTA 3K57A 3EZ5A 2N82B 2QZ8A 2RS2A 5IT9U 3KLHA 1RSCA 1PAEX 1FNMA 1L5UA 4LFAJ 1FDAA 1HNXF 1NZAA 3Q8UA 1R27B 2OEMA 4LREA 2IIHA 4HLBA 1RYSA 8AT1B 4AYBD 5HVGA 1YLXA 2EG1A 4DHVA 2C2RA 5DM7Q 5KFEA 2ZVSA 2MKJA 4X4UA 5M2RA 2I6WA 1C1CB 1YRTA 5J2MB 2FJVA 3C6UB 3N5FA 2IDEA 1X5SA 1HNXJ 1S97A 4PAAA 2XO7A 5DZ7A 3CCES 3VVTA 3NEKA 2VG6A 5ITHA 3OV7A 4DQRA 1FJ7A 2C22A 2DITA 1JB0C 1RABB 2DHHA 1YJ9S 1SQFA 1K1QA 5HVFA 5GADI 4F4ZA 4ECSA 4F3OA 1OPZA 3H5UA 2ASJA 3NWGA 2DR8A 1KQGB 4BCAA 1HMVB 1JLEB 1MW7A 2G1HA 2HZAA 2RJZA 4B3RF 3LP1B 3S01A 3VWSA 3W5ZA 1X9MA 2XG8A 3C19A 1RQ0A 4A8OA 1S0VA 3LWMA 4XDCA 1BUXA 4TY9A 3GP9A 1N0UA 2NZCA 3K5PA 1Q82T 2B43A 1FX4A 2QLBB 3EDQB 3MPDA 4NLVA 3TA2A 5C2GA 5F8MA 3Q22A 2G4BA 1SH0A 3KDOA 3D0IE 2OJ3A 1VQKS 2MHNA 1LWEB 1MMNA 2BUNA 2H5JB 2OEJA 4IUFA 3HHNB 1JLEA 1QE1A 3QT6A 4JV1A 2BVZA 2VA2A 4FYWB 4LSLA 5F0UA 1EETB 3LALA 1B0TA 1EARA 2NUHA 2ZOMA 3NS6A 3FZ2A 3Q8RB 3CD5A 4R0EA 4ZVGA 7FDRA 2CIMA 4DPUA 2J8SA 3EMTA 1FKAF 2BJEA 1IKXA 3FGVA 2F4VF 5IT0A 2HQCA 2FLOA 1Q0NA 1CJKA 4ZPCA 4NXMJ 2MY7A 2HPUA 4MIBA 5HL7Q 4YY3F 2QLFB 4E2FB 2J7KA 3W9IA 2G0IA 5KG1A 1FWLA 3IS9A 4CLZA 2E44A 2HEKA 2V8GA 4HVZA 2PMWA 3TJAA 1HFEL 2ROEA 3LGMA 1IR0A 3OR2A 1IBLJ 3UCZP 1NHKL 2WAQD 4M63A 4ZVTB 3I32A 4WP9A 3MFHA 3V4IA 2EC2A 5CH7B 4M1KA 4KR0B 1IJFB 2FIUA 1WC3A 2E7XA 2Y0BB 4KSEB 2J7WA 1NKEA 3D4JA 1RT7A 2VFTA 5KFHA 2GVDA 3T5LA 1RHJB 1RWUA 1XMBA 2ZFHA 2IVYA 2ZH4A 1AXQA 3CMAS 2VKRA 5ETLA 4RUHA 3KK3B 2RRAA 5KT4A 4EYIB 1NXIA 4PEOA 3N6MA 3BPSP 4FKXA 3NNAA 3AJ2A 4IR1A 2LQJA 2R2UA 1VRTB 2X51A 2V4RA 2N7YA 2GGPA 2W4DA 4PG8A 3AXMA 3OLBA 2B8QA 2LEBA 4LF8F 1WACA 3D5MA 2R7RA 3QJJA 1UJ4A 3MTKA 4WCEQ 3OL6A 4O0NA 2FJAB 1VBYA 4ZPAA 2OTJS 2EFQA 3PCOB 3QWPA 1FTCA 1FWPA 4HACA 3GV8B 2R9LA 1NK4A 1RKIA 2XB2D 2MQPA 5AXKA 2WSEC 2FJDB 1L3VA 1IWGA 3DLKB 1Q7LB 4L75A 5I3PA 4O23A 4RBUA 4DV7F 3PYDA 1RT4B 4DX8H 1PJ5A 3FMWA 2ZZTA 1M0SA 1TAQA 4EWTA 2XMTA 1FK9A 4CH7A 2AJ2A 2DRAA 4JI8F 2AYMA 3D68A 1S99A 3QYYA 2LXIA 1Q95G 2A6MA 5A6WA 5F3ZA 4K0KJ 3E01B 2E1RA 2OD4A 2XCAA 4FNIA 4CLYA 1BWVA 2Z0GA 1HD0A 2VBYA 3L7OA 4A48A 2J9DE 1FVSA 3Q86A 2MLYA 4QZVB 3L7PA 1TL1B 4HH0A 5C42B 3BKUA 5KT5A 5LJ3Y 3SBMA 5F8IA 4OIXA 2LEPA 2YQ3A 3DOLA 4DPOA 3H59A 5HJYA 1HWLA 4Y2MA 2HVEA 4PR6A 2AEJA 3VGVA 4NCGB 2ZHAA 3MM9A 2D74B 5C5JA 2HHUA 1JLBA 4B3MF 3MCOA 4JI6F 4FYYB 2AYBA 4PCQA 3AB4B 4CO3A 1UVJA 1PKUA 4H4OB 1RHRB 3GCXP 4ZVQB 3ILIA 2FVPA 1Y5LB 2UUAF 5E3CA 1PBUA 1B4SA 1HWUA 3WBZA 4ECYA 4IOCQ 3MMAA 3QGGA 2VPXB 2R7QA 1RT1A 1JX4A 2VOPA 5DDQC 1X9SA 1KRPA 2VFSA 2FTRA 4Q0BA 4C8YA 3H5YA 3B54A 3GMGA 2BEFA 2CJYB 4HYKA 4PPDA 1IKVA 2QJ3A 1BHNA 4OHVA 3KJVB 2HHVA 1QSYA 4DUTA 2Z2YB 3P49B 2XBPA 4QCLA 1HL6A 3KUHA 1WC6A 1EX8A 1TELA 2XI3A 3QO9A 4ZJOA 1S1VA 1F1BB 2OSRA 3SSQA 3VR1A 5HO4A 2MGZB 3EM1A 3JYTA 1DLOA 2AD9A 1BQNB 2WBRA 3GU0A 3MM6B 4NZ7A 5IM0B 5E41A 3V4MA 1YBTA 5LJ5Y 3M4XA 2KHDA 3LGHA 4M5IA 5CABA 3AT1B 2HG4A 5IM0A 4K59A 1CJKB 5I4MA 1JXVA 1DLOB 3HFZB 4NCAA 3GWCA 1F3VA 1T94A 2CPHA 1WDDA 5L46A 4YB5A 1FJEB 3LP1A 2Z2ZA 3M2VA 2B9WA 1H7XA 1FFWB 4ANCA 1ULRA 3W1YC 1FJCA 3N5BA 1FFGB 1G6BA 1YBAA 1YWXA 4RWXA 4USWA 3RGIA 2YKNA 1UVIA 3H7HB 2RHQB 5E0OA 1Q5YA 4X4PA 1YRXA 4FS1A 4BWJA 3CGIA 1HHSA 1XWLA 2IC3A 1VDHA 5E3RA 3S1TA 2Q3PA 5KFZA 4M94A 4O3QA 2NLWA 4A8KA 4TYBA 3W2VB 2BJ9A 3OFHA 1T9TA 4F0HA 2XQCA 1Q86T 2V34A 1BE4A 3ISND 3WDOA 3OD2A 2FGOA 4LIWA 2J5AA 2XSJA 4NLSA 1QY7A 4NA2A 1U0HA 4IDKB 3MUVP 1BQNA 1S9FA 2VF3A 3Q8VA 3HHLD 4DV3J 1WC5A 4I1TA 4I67A 4MMOA 2JLEA 2OIHA 3LAMA 2GFFA 4C8ZA 1I51B 4QWCA 4P6QA 2ZHOA 3DLGB 5HROA 1RI7A 2XULA 1TZ0A 4LF7J 3BGRA 1ZAXA 2G2ZA 1HWIA 2P2CB 3H20A 5ETKA 3B78A 1KD1T 1VQ5S 4OZ1A 2AX0A 4WFBQ 4RLEA 3PKYA 2HHHF 4DSJA 1DTTA 1SQEA 1YJNS 1N36F 2MLZA 3R1HA 4JI7J 3Q89A 3M8QB 4LSNA 5A2QY 5B0FA 2LCWA 4ZLJA 4A8XA 1S76D 1XEZA 2QMXA 1FWKA 3MM5B 4A8QA 3VCDA 1MLAA 4DSFA 3OHBA 2NYIA 2WB4A 2YNFB 4MIWA 2D3OR 3JXOA 3IP0A 4K8RA 3CCRS 4NXMF 1FO1A 3I9V9 2C2OB 3QIPA 3TJ8A 3VGTA 2KDOA 1VQ4S 3ENWA 4EO8A 4M5NA 5ETMA 4HL9A 2IVFB 3ITHA 4ZIVA 3OUYB 4ELTA 3RRKA 2KKHA 1S9GB 1WUUA 4BHQA 3J7ZT 4ZDNA 4USTA 5ETOA 2R8JA 4G1IA 4JI6J 3JSMB 1FNOA 2HFUA 1B0VA 1DRZA 4HACB 1LXNA 5C42A 5LOQA 2KJWA 1TK8A 4A8MP 2NCKL 2ABYA 4B3OA 1RT3B 1VR6A 1PBAA 1X4BA 3IWXA 2H65B 2ZUAA 3BH6B 2QX0A 2FHOB 1FRLA 2AU0A 2UVWA 3QBCA 4PG5A 1PG5B 4DL4A 4FBTA 3A8IA 2R7SA 1C4CA 1LWFB 3M2UB 3R5AA 3MPWA 3UR3C 1XTZA 3HI9A 1V9OA 3KK1B 3UPFA 3CCQS 2F3JA 4EZ6A 2O5DA 2XLKA 2BJ1A 5KFWA 3I31A 2H1YA 3BKTA 8ATCB 5K14B 3BO4A 5K5MA 5K14A 2YKMA 4GMKA 1QUPA 3PRVA 1N34F 2YBVA 4I4BA 2R7TA 1LEOA 3ENQA 3SCKE 2QLJB 5KOWA 3R6GB 3WC0A 1S72S 1EJ7L 2E5LF 3TZZA 1MSWD 4DLGA 1VBKA 3GILA 2YNGA 2H5IB 3PZPA 4F4KA 2YNGB 1GQEA 3EGNA 1S77D 3T6JA 1F5CA 1RT3A 2A18A 1RADB 4P73A 5B08A 1JKHB 2F5GA 2W2PP 3OTOJ 3P45B 5K8PA 4DV1F 1FVQA 2BBEA 3DMJB 2YXLA 4LR9A 1S59A 2OTLS 5HK4A 2BE7D 4DF8A 3NL0A 2QYGA 4DSIA 3BR9A 2W7AA 1R31A 3GB0A 4GVBA 4GC6A 2HWTA 1N5VA 3P3DA 4HHJA 1NDKA 3BSNA 3QNWB 3WIVA 3O1LA 4F4YA 5CZVA 2Y1JA 3HHEA 2CJXB 3MOJB 2EG2A 2V8DA 1Z2LA 2VJUA 2GJ2A 4R8UB 2CPEA 4DV4J 2KL8A 5KFLA 4CRJA 3MWBA 4ZCIA 3GIRA 4KO0B 1CS4A 3Q8QB 3CCWA 2RRNA 1J5OA 1WEXA 2I8EA 4KAIA 2HBZB 2QO3A 2O01C 2QL9B 3C14B 4OYPA 1ZM3A 2E1PA 2L9DA 3FFIB 4K0KF 3EDRB 4FYDA 1EP4B 5KFRA 2MHEA 1U0SA 2PEHA 3W64A 4DL2A 5DDPC 1FKPB 1HNWF 2Q6CA 3QRPA 4WP3A 2EKNA 4GO7X 3WIUA 5LMNF 4J9VA 4ZCKA 2HBYB 1Y10A 1X4DA 1M5HA 2DNYA 3ZFVA 3R7BB 1NK5A 1LW0B 3QIDA 2HNDB 1P27B 1U24A 4QWEA 3BREA 2F8EX 1CC7A 1S6QB 3CPWR 4LF5J 1FE4A 3UN3A 4F0KA 1XNQJ 3KJQB 2X3GA 1R0BG 2FJBB 2LQ5A 2XYGB 2HS3A 2I38A 2YWEA 3OTBA 2Z30B 4PQAA 5E3PA 5IT4A 2GAHC 1Q7YT 1FHTA 1OYDA 2CPIA 3KK3A 2GQQA 2M0GB 3KLIA 1WF2A 2CJBA 2P9EA 2VFUA 4QR0A 4JI0F 1QE1B 2HLUA 3P8BB 3OBIA 2Y8YA 2P9CA 3MGJA 3HHLC 1FXLA 1EB0A 2FVCA 4QWAA 4U7UK 2CNKB 2AZ1A 4AD6A 2VDIA 3SI8A 4U8YA 4PUOB 3NGTA 2BRLA 4FYVB 3CEDA 4IH7A 3TNVA 3W9HA 4JI5F 3UFCX 2HS4A 1QAYA 4I64A 4DPYA 2MKHA 2NR0A 1V3ZA 5A8RA 1CC8A 3DYAA 4KBIA 1VCTA 3J80Y 1SH3A 3SSRA 3DYAB 2MJNA 2FVSA 4ED2A 3A3OB 3QSYB 2CQ0A 2Q43A 2CVEA 4LFCJ 3OW2R 2XSJB 3SV3A 4OV1A 1O8BA 2CJ9A 1H0HB 2BE2A 2RF2A 3LANA 3MEDA 1FTRA 1M1HA 3I5CA 5D6GA 2F7VA 2R8KA 3ZTRA 4ELVA 4LJMA 2OP5A 1WHWA 2QLXA 2ZWOA 3HVAA 1E6YB 3T1HF 5IT9Y 1ZS6A 2KJVA 1EP4A 2MYFA 1N5TA 2CPXA 3AQPA 3PFEA 4CIOA 5K20B 1H73A 1NJWA 4G1QB 5HLFA 2IRXA 3I82A 2DR9A 2LDIA 3KG4A 4L72B 5IC4B 3B6BA 3J7YU 3G8QA 2AEMA 2DH7A 3TEHB 3PJWA 2VOOA 1AYEA 2DXDA 2OUGA 1EKSA 1RTJA 5A8KA 4USVA 5ETNA 4DPTA 3ULHA 3VQSA 1MROB 1YITS 1ZZFA 1RK8A 3CUNA 2NXUA 4FDFA 3D6MB 3IXQA 4GKJF 2RQ4A 4M5LA 3H4DA 3MCNA 3EVMA 1CJVA 2HWIA 3MM7A 4CLSA 7FD1A 1RWXB 1NCLA 3M9NB 2VIHA 4EBCA 4QIFA 4F02A 1JJHA 4OX8A 5KFAA 1AUDA 1LWCA 4C3MA 3VAJA 2HFVA 1RTDA 2RUGA 3D67A 4TNOA 4P52A 1RU2A 1RWMB 4EI2A 4XK8C 3NOGA 4DZDA 1HA1A 1SCJB 2IDLA 1L3SA 4KO0A 3FQKA 4C98A 5EGYA 2Z2LA 1S6OA 4FXDA 2AIRB 1QTMA 3W2WA 3DHWC 3AJ1A 2KXFA 2VZ9A 1NB2A 1H2TZ 5L39A 1FJGF 3MEGB 4LF7F 2JEFA 4CLWA 1S9EA 4DX6A 2JNJA 4Q2MA 5DQHA 4KTQA 2YWWA 2ZBQA 4N5SA 2R7WA 3IBCB 5LT5A 1ZYQA 1BC6A 1WHYA 4UZCA 5CQGA 4DV3F 4FF1A 1N5SA 1PCAA 4PXDA 5J1EA 4M95A 1JMTA 3MXHP 4NI2A 5KT6A 3KLHB 1Q81T 3D3BJ 3ILLA 3RBDA 1YJWS 4B3SJ 1VQ7S 2B6AA 1K1SA 2MEWA 2AMCB 2ZITA 3D54A 3DU6A 5CHCB 4BWMA 4ZHRA 2KG1A 4OX9J 4QYZJ 4KPCA 3GPAA 4HDHA 5FIIA 4CLFA 4RW6A 4RW8A 4FP9A 2ROGA 4JP8A 2HK3A 2DT9A 2EEYA 2MZQA 2VUGA 2CQ4A 2YKOA 1I1GA 2J0XA 3DHXA 3GONA 3ONQA 3BQ0A 2AGPA 3TAMB 1XERA 3M6UA 2RIJA 5CYMA 4F25A 2E9RX 4TLQA 1VYAA 2KVIA 4EMDA 1MROA 2UVRA 2GIFA 2M52A 4Z37A 5L9XA 3HHLA 4LBPA 1TL3B 1XMQF 1S12A 1RZMA 3DXSX 1XBWA 1N52B 1X0PA 1OS5A 3D66A 1PILA 4R5PA 2E29A 1PYTA 1T3OA 4LFBF 2AF6A 2HGMA 3BYPA 2OPSA 4HH1A 4I69A 4HTIA 3RRGA 2OPQB 2PEBA 4KV8A 2DD8S 2B9YA 2XMAA 3W60A 3MMJA 3M9MB 4IO1A 1DQ9A 1LXJA 4KIAA 5D78A 3LGNA 4ZPDA 3U1MA 3KK2B 2ZKTA 4ES3A 5J2QB 3BKFA 2CQPA 4RW8B 2NPIA 1TFYA 3PTWA 3RW7A 2A0FB 2MY8A 3O8WA 4ZS6A 1WTFA 2XMKA 2GX8A 1H3DA 2UU9J 3HVTB 3MMBB 3LP0B 4BC7A 3RBEA 3BSOA 2L41A 4P71A 3UD5A 1RT5B 2H9ZA 4DL0C 3PW0A 4NOHA 3HZGA 1CEZA 4IYQA 5L1JA 2C3YA 4P75A 5CD4A 1MWYA 1H72C 1QSLA 1XC9A 4NEYA 1N33J 1FT8A 2J0SD 3QWUA 5IQ6A 3KFWX 3D1HA 4NLOA 2YX7A 1X0FA 5A6PA 1RTIA 1Q1KA 5KFSA 2HRUA 2RT3A 1D9DA 4ZMMA 1HHQA 1K9MT 2GIRA 4CH1A 2NZ4A 3K17A 2AYEA 5B0DA 2IAJB 4K5RA 2E5HA 1ZTWA 2LQBA 3VAIA 2N7CA 2XWYA 1HBOB 2GHPA 3RTVA 2RILA 1G3OA 1MMDA 3R6LB 4ES1A 5SUHA 2KZZA 2BZ2A 2DNLA 3TEGA 4B17A 2HSEB 3B4MA 3R5BA 4M5DA 3POTB 3B4DA 3SDEB 3CJSA 2YNHB 4F0MA 5DO2A 4Y34A 5K8OA 4PZVA 3S8SA 3KHHA 4IG0A 2YVSA 1Q8BA 5A8RB 2CQ1A 2HQIA 1HR0J 2F8MA 1VIOA 3NCRA 5LSLA 5HQMA 2DIUA 3MM6A 1UZDA 5HI7A 4OYZA 4K4VA 1ZAWA 2F63A 2SXLA 2V2QA 3VGUA 2JX2A 3DRRA 3GJSB 1S1WB 2QGFB 4MK8A 4O4GA 2ATLA 1U1KA 1SC6A 5IC6B 4K4TA 2XLJA 4DUYJ 1NK9A 4DZ6A 2OPRB 1LK5A 2GQCA 1S57A 2ZWPA 4Y3CA 2NXEA 4G1QA 3QSIA 4DG1B 1QAXA 1S7HA 3AA9A 4D3GA 2A6OA 1CPZA 1C0TA 2P9GA 2VPWB 2CDRB 2W9AA 3QAEA 1M5KC 5F8JA 2AX1A 2HNZA 2DVIA 1RT6A 4BC9A 2M9KA 5EDWA 1P1LA 2YPYA 1VK8A 2BX6A 4DS5A 2RNEA 1Q53A 2Z8QA 3FUYA 1DAXA 2UU9F 2VASA 2B5JB 3W66A 4OLPA 3VZIA 3BO3A 2GQ2A 3MZIA 3T1YJ 2JC1A 3S7RA 3F44A 1XNQF 3VAGA 4K4ZA 2XCPA 2XGPA 2CJKA 1HARA 2DGXA 1VQSA 4RW9A 4TYAA 2UUTA 4U6PA 3PVXA 5ETPA 2GCFA 4DN0A 1NK7A 3OXGA 2IVMA 4MFBA 3OFFA 1YVFA 1VQYA 1D9FA 3PW4A 2YNIA 4ZHRB 3DGVA 5DG8A 4RBVA 2MKCA 2ZH5A 2VPYB 2RU3A 5EUHA 2AQ4A 4AT1B 8RUCA 4X4SA 3HZEA 2UP1A 2EWHA 1WG1A 4ECZA 4DWIA 3SIPB 3Q0AA 1JLAB 3C15B 1QD1A 4WPAA 4WXOA 2CWXA 2JC0A 4B9MA 4DR4F 1IKYA 2IJFA 1RLCL 1MU2A 3UO0A 1TL3A 2CQ3A 1VRUA 3SCIE 3KMSA 2FHKA 5EWEA 1C1BB 2M3DA 4GKJJ 5KFPA 2R7UA 3JSRA 3J81U 2QL7B 3QQCD 3HSGA 2HNDA 4CYUB 2AJ1A 2HGLA 2XGQA 2DGQA 1KHWA 2Q1LA 3UDVA 4C6AA 4DL7A 1TK5A 3R7SB 1SI9A 3N79A 2J9CA 3UCGA 1S10A 5FJ4A 5L1IA 3P5BP 2QT7A 5KFFA 2J9EA 3MOZA 4DFJA 1UVLA 1HQEB 1FKOA 1GT8A 3G8TA 4MKYA 1CLFA 1TL1A 3J7A1 4KE5A 4RU9A 1NJYA 4QIVA 1U25A 2D69A 3HFVA 2ZZMA 4R0JA 3VV2B 3FCVA 4LIRA 4C8NA 2XM3A 4DL6A 1VQ9S 2J0QD 3I4PA 1XNRF 3GFYA 1F6TA 2LLZA 3ZZOA 4LQ9A 4PWUA 2I0XA 2XYPB 2YWKA 1HQUB 3E3XA 3W63A 1JQGA 1UETA 1QSSA 4ZIWA 3I4HX 5DZ6A 3AFGA 4KH1B 4WXWA 1RT4A 4KRWA 3FJ2A 4QR1A 3MEGA 4CO1A 4EZ9A 2PI4A 2Y9HA 1SUQB 2DNGA 2DY9A 3FVYA 1TMJA 2JH3A 2RSQA 3I0RA 4NLWA 3RB0A 3MECA 1F2GA 1F5BA 3BF4A 2OFGX 4I2PA 3SFGA 3DRSB 1O6XA 2H5EA 2QV6A 2WOMA 4N77A 3AD9C 4M5JA 4P9SA 5EHHA 2ZBIA 5IV4A 1UW9A 4ATNA 1ZETA 1VQLS 3QGIA 1IR2A 4FN5A 3QFHA 4X65J 5KT7A 3OLAA 2X1AA 3J7AN 2HNYB 1U4BA 5HMYA 5AJ3J 1WHXA 2HIQA 1YKWA 3MEDB 2E1CA 3BGRB 2XEXA 2ZOGA 3OR1A 4P2FA 3F41A 1AB8A 2W01A 4JBCA 3PO5A 1NH7A 2Z58B 2MZJA 1JWWA 1MU2B 1UPPA 1LNQA 1SKUB 4LRAA 4P7VA 5B0GA 1U1PA 1H38A 1KLNA 1S1XB 1BGXT 3R5GA 1VLOA 2RQMA 4DSLA 4WFYA 2E7VA 3MAQA 4IG3A 4ECRA 1HWJA 2E5JA 2XY7A 2WVFA 3I96A 1FERA 1R3NA 2B0GA 4K2XA 3L7UA 4OX6A 3MI7X 4P72A 5T7LB 3SFUA 3MPVA 2W9BA 1M90T 3QT5A 1I6JA 2E5LJ 3W62A 5GADU 1KFDA 1AUSL 2F65A 2DTJA 3R5DA 2W2QP 1RAEB 2YKNB 4ZPTR 4DQSA 3DLJA 4ECUA 3DLGA 2MKSA 2V50A 4OYIA 1H7WA 3IO1A 4J9OA 2E9TA 1Q79A 3DRRB 3JTOA 5F8HA 4Z7CA 1WG5A 2L3MA 3D2WA 3FRYA 3JSMA 1ZA1B 4F50A 5DG7A 1HBMB 2OO4A 3FBEA 1OQ3A 1H74A 3G96A 4F4XA 4JV5F 4GKKF 2DGOA 1EHWA 1UFWA 3CB4A 4IG0B 4RX6A 2MGZA 1NMEB 2B56A 2HQGA 2YNHA 1A0OB 4Y00A 3QIPB 2VBZA 4F3QA 1ZM2A 2MZSA 2W8LA 2L9NA 5F9NA 3D6FB 4B3TF 4KHRA 5DM6Q 3M32A 3R5CA 1ZM9A 2WCXA 4QIEA 4JUZA 2PE8A 3M32B 1VC6A 1HYSA 3LWLA 1TL7B 2XMVA 2ZC3A 1APSA 5AE2A 3WX4A 1S1WA 3V6JA 2WONB 2DY1A 3MMCA 1ZTTA 4DEZA 4NYZA 1JXLA 1Z1ZA 2RQKA 3RB3A 1VOMA 4AE5A 5HANA 5CCLA 1S0OA 3US5A 4OZJA 2C2KB 1S7IA 1VISA 3V5RA 4KGKA 4AQYJ 1XIQA 1HNWJ 3MR6A 4Y2AA 3ZXWA 1KEKA 1UJ5A 5D0EA 2EKYA 4OZ3A 2K1RB 2RMLA 4MJKA 4QW8A 4JI2F 3UN5A 5IWAF 4B9UA 1PIEA 1S4EA 2BR0A 1KP6A 2GA7A 1U47A 2EBGA 1X4FA 4KH0B 4ZP7A 5AE1A 1NSPA 1X5PA 2UVUA 2CPDA 3TWZA 1YJUA 2AGQA 3GTYX 4WFXA 5DRKA 3KKFA 3A8KA 1XR7A 1FRXA 1KBRA 2BKNA 2M88A 3BGFA 4RW4A 2BMBA 5DQGA 4I2PB 1IWAA 3T9NA 1R7IA 2NS1B 4C3KA 2ASYA 5JMNA 3TVYA 2ZBCA 1JLQB 1WOPA 4LRFA 2AT1B 2Z2MA 3CDUA 5KFUA 5BXIA 5DLGA 1F9HA 4ECQA 2N4CA 4ED8A 4WKYA 1M5PC 1DY3A 1JK9B 5JVHQ 1HNZJ 5IZHA 5AXNA 3NGSA 2BDPA 5HSPA 4Q44A 4J9LA 2ZUGA 2HQDA 3R97A 4DI6A 5DG9A 3CCLS 2CXEA 2V69A 3CE8A 1VIXA 3OXFA 4F36A 2BOPA 5E5NA 1NKBA 3GJRB 4P2MA 3CDEA 3HD2A 3CULA 2DCUB 3FEYB 4NYPA 4URQU 5MLCV 2XS7A 1FKOB 3D1QA 3G82B 2XTJP 4ZA1A 1TFWA 2A1BA 4KGZB 4QJVA 2MZ1A 2R8IA 2BANB 2RUSA 2VBWA 5E33A 1RDRA 1CS4B 3BBCA 4YHHJ 4EGLA 4FF2A 5D0GA 2LQ8A 1X9WA 1RJJA 5D4NA 5C7PA 3QJLA 2K06A 3QGPA 4CH0S 2Q79A 4PXEA 4GO5X 3RG6A 1T03A 2GC8A 3KWMA 2IRYA 3V81B 3O6QA 5T41A 1OMSA 4QYRA 3J80U 2GV1A 1JLAA 2EFNA 1GTHA 3C15A 4PABA 4ID8A 2VFRA 1ICEB 2V4JB 3QZ8A 4ILMA 4O3NA 3GZ7A 2QLWA 4B9NA 2CQCA 4DR3F 3K5OA 2R2RA 4IFVA 2G13A 4OYBA 5C2CA 3UI3A 4ILLA 4IRDA 1VC0A 1RAJA 2B9XA 1SBRA 4O3OA 3ICLA 4LBIA 5GAGU 5K8MA 2BANA 2YWGA 4OMFG 4USIA 3NNCA 1U7LA 2WZ1A 3FSXA 4ZITA 3OL9A 5HATA 2XO6A 4K4XA 5AXMA 4UF4A 3EZUA 3J81Y 2LMIA 5KFKA 2VKZG 3K89A 4L6V3 2Q66A 1UA1A 3C66A 4OYMA 1X4HA 2BRKA 1U0HB 3MEEB 4IDKA 4WTOB 5I3UA 4DR6J 1OSDA 2QEXS 1RAOA 1URNA 1C0UA 3P96A 2BM0A 2VQEJ 3FBCA 3LQVA 5GAHI 1SV5A 2BYCA 2W2OP 2HFNA 3W2VA 1YIJS 2LU2A 4IOAQ 1X31C 4DUZJ 3PXGa 4C8OA 2IM1A 4DR7J 1ZZNA 2C2NA 5DS7A 4HT7A 1RHMB 1RCOB 3QLHA 4DV6J 1NSKL 4DOZA 2MMYA 3H98A 1NPKA 2MQOA 1QM9A 2QMUB 4OZ5A 5C24B 4CLTA 3ZNUA 2ZZNA 3UN2A 2FD2A 2A10A 2KO1A 4G65A 5GMEA 3M7VA 3D28A 3G6VA 1CJVB 2WRMA 2KU7A 4XDDA 3TO8A 4PXCA 4DV6F 4X4NA 4RZRA 2E5GA 4DPXA 2I2YA 4QQBA 4ERDA 3KLGA 2VG7B 1HBMA 3ELHA 2O3DA 1IQZA 1NHUA 1R8PA 2AW0A 2R2TA 1OPIA 2RKIA 4UOFA 1WD6A 5GAGI 2HHHJ 3M05A 2DKOB 2Y1IA 1NK8A 1VK3A 2BA9A 1UL3A 1HNIB 2AKWB 1SQGA 2M8HA 4DG1A 1KQSR 1TU0B 3LPYA 1NH8A 4JI0J 4J91A 3MM5A 1FRJA 4QU7A 4LSLB 1KOOA 4LR8A 3Q8PB 7AT1B 4DMZA 5KAKA 1JXEA 1BY9A 2DO0A 2PGCA 4C97A 3FMBA 3THPA 2MSTA 4TN2A 2GS8A 4CTAA 1WKKA 2UV8A 2NXCA 1TL7A 2D3O1 4TU8A 1RTHB 3GIIA 2C2EA 5IV3A 5HQ8A 4N76A 1FRMA 2BE2B 1U1LA 4C8LA 2AV5A 1REGX 5HROB 1Y0HA 1WKJA 3PEJA 1WI8A 1GXLA 4KHPJ 2KM8C 2DJWA 4CO0A 1M5VC 3ENAA 1R8AA 3TUJC 3POTA 2Y1LB 3SCJE 1FRKA 2CQBA 2B5JA 3HXMA 1U45A 2XLIA 2DRDA 4WU2A 2F8HA 4NLGA 1WEYA 3AQOA 4Z7YA 3OTDA 3CW2C 3KUEA 4QU6A 2HS0A 3B8HA 2PDAA 1LW2B 3IG1B 3ETMA 1RAFB 4HR2A 4YR3A 3HF5A 1UVMA 3UVJA 1MN9A 2DNPA 3AOBA 3DRXA 4MK9A 4CM0A 3DI6A 3TUZC 2I5JB 1HBUA 4QBUA 2UXCF 1UWBB 1N0VC 1IBCB 3BN4A 5HVHA 3K58A 3DOMA 1HYSB 3D6HB 2A2CA 1F3FA 3I5BA 1NSQA 1QLNA 4ECWA 3PIOQ 2YX1A 4EBEA 2M2BA 3HSDA 2MQLA 2R4FA 4FKYA 3IFEA 3PYEA 4DS4A 1NJIT 2HHWA 1FK9B 1T05A 5HBMA 4OZNA 3FC9A 3TVZA 5L1KA 2EK1A 4CLUA 3GV5B 2QA4G 3CD6S 4DBQA 2C2DA 4NZ0A 2OLWA 1B70B 2HQ3A 5CYMB 1E6VA 1EKRA 1VHFA 2VL1A 1KDNA 2VPZB 1T0TV 1OSCA 1UEUA 3HSJA 2WW4A 4CZCA 3TAPA 3C14A 4DL5A 4UUWA 5HN0A 2HVHA 2COLA 2KT3A 3VAKA 2RQCA 1OY9A 1T7PA 1FD2A 2ZH8A 2JRSA 3MAHA 1FD8A 5SZTA 2QFJA 1WDTA 2M5YA 1WJ9A 1F60B 1RWVB 2PA8D 2RD5C 1IN0A 2H54B 3LP2B 4NPOA 3RYLA 3W5YA 3ZTOA 3G8SA 4UY85 2KT2A 4YP3A 4Q7AA 5CYJA 6AT1B 5GAEU 3TA1A 2CPZA 1PC4A 1TKZB 3MEEA 2DEJA 3P4UB 4EU0A 3V81A 3Q8SB 3RAQA 1W2BR 4IR9A 1H98A 2QRRA 1YRUA 4UW2A 5G0RA 3K5MA 3PV8A 2DO4A 4DPWA 4XPEA 3FRZA 1KOHA 2DK2A 4J9UE 4XTTA 2CJAA 4ZN1A 1SJ3P 4NCGA 4AL6A 2HAFA 3UNYA 1K0VA 3IAS9 3WX8A 3KMQA 5KFCA 2NYHA 3Q23A 2BQ3A 2HGNA 1DARA 2OAUA 3G82A 4O4GB 4LF8J 4NI2B 3R1LA 1J5EJ 1J5EF 2VC0A 4LF9F 4QYZK 3MD1A 4WJBA 2IPOB 4OI2A 4WWSA 3MECB 1DFDA 5JXSA 1REVB 1X4GA 4N7TA 3VAHA 1DJ0A 2F4FA 5E3AA 3CJ8A 2R3VA 2IYIA 3MR3A 2EI5A 2CQIA 5F41A 2XC9A 3OUYA 2ZH2A 4JYAJ 1S1UB 3CTRA 3V6DB 3CJ0A 3DGPB 3RJMB 2XY6A 2PSZA 3PY8A 4YOEA 4ZVFA 2P6TA 3GG1A 3ZTSA 2LDYA 1U6BA 5D77A 2GJFA 3HLUA 1LFPA 4H4MB 4RR5A 2CUYA 4NX9A 2D9PA 2EXUA 3UQSA 5D0RA 4WZMA 2ZD1A 4B3RJ 3RUBL 2DGWA 3KLEB 4ITSA 5KFGA 4PPZA 3PYFA 2LXUA 4OI6A 1HI1A 3IG1A 4C8KA 1FA0A 3RW6A 1SC1B 2ZJPQ 3CF5Q 1TKXB 2IBOA 4C4WA 2UUWA 4Y0FA 2HMIA 3V6DA 1R0AB 1RISA 1SJ4P 2HK2A 2LU1A 4JI3J 3AODA 2HIYA 4KFBA 4Q8FA 2JOQA 3VHQA 3MAAB 5KG4A 2PFFB 2DH8A 1JLQA 2OD6A 2C28A 1UJ6A 4RNOA 2IM3A 4U9RA 1FRHA 1YSJA 2CQ2A 3W65A 3V6KA 1U26A 2ZNYA 5HMZA 1RHQB 1XR5A 4CTAB 3GG0A 1DTTB 3UVJB 2V68A 3UD3P 1LW2A 1HW8A 4ZLNA 1Q8KA 3IGVA 2FVQA 3W3SA 2Y0SD 1O51A 3GYXB 1HQ2A 4DN9A 5AJ3F 1ZA2B 1MN7A 1T3NA 4NLYA 4O4RA 4LMZA 4DV0J 2CVIA 4LRDA 2IMOA 2ZDPA 4B08A 2MPUA 3CCJS 4KFBB 5HMXA 2KZMA 4DX5A 4HDGA 2HVDA 4ZPWR 1SL2A 2CNNB 1KTVA 1SVDA 3T6BA 1EAYC 1K47A 1NBEB 3EXYA 3K5NA 3NY0A 1RWWB 2BACA 4MT1A 4K4SA 4ID5B 2V4QA 1RUSA 2VG7A 4RWWA 2MDAA 3DNCA 5CYQB 5IWAJ 4JI2J 2WSFC 1PJ7A 4LF6J 2UXDF 3NXZA 3I5AA 1PGZA 3VQTA 3TZYA 1WTBA 1GNKA 1BQMB 2KRRA 4YQWA 4G6VB 2R2SA 3HVRA 1C0TB 2H48B 1IKWA 4U67Q 3T5KA 5G4DA 2XZDB 3MM8A 1TVRA 2W2NP 4NA1A 1SJQA 1AROP 4ZVRB 3AA8A 4C11B 1CVJA 4OZLA 2VHGA 2DNRA 1FE0A 2G2YA 3NAHA 1GAOA 3F73A 4NCBA 4UTGA 3W61A 4I2QB 1TVRB 3PRBA 4N47A 4FS2A 3DI6B 2DNHA 4OZ0A 4LUBA 3ZZZA 2QA4S 1RYRA 2NSCA 1OYEA 3D0GE 1HNZF 1JIHA 2X1GA 3HCXA 1N6QA 2FJWA 3PJ9A 4FXWA 1RAHB 3DXBA 4AL5A 4MIAA 4H4OA 3MAAA 3G6ES 3G71S 4J9NA 3CC7S 4ID5A 4J9RA 1K8AT 1NSAA 3HKWA 1IBMF 4W4MA 1FDDA 2XSFA 4PG7A 4ZVSB 4J9MA 3S6EA 4OI1A 3GJQB 3HVWA 2ALYB 1SJFA 4O3SA 4KY3A 3VAFA 4RW6B 3EUNA 5FLXU 1P8GA 3BS9A 3N4WA 4JB8B 4RJVA 2CADA 3KJVA 1SH2A 1VBZA 2BABA 3M6VA 3CMES 3GSDA 3DOLB 1HBNB 2C3PA 4OYOA 3H5SA 4P74A 1KKHA 2MZTA 4ZKAA 5L9NA 3M1VA 2MXYA 4V19X 2KFNA 1HIYA 2H3EB 2RU9A 3IC1A 3NGUA 4C0OC 4CLPA 5D8HB 2BM1A 4HT5A 5HQLA 2C3OA 3PX4A 4DQPA 5HJXA 2BJ8A 1KTQA 4DU8A 4DSKA 1KVJA 1B99A 1SC4B 2R42A 4DCJB 1HD1A 5B0AA 1OY8A 2GIQA 3ZZYA 2CRLA 4D3HA 4W90B 4OI0A 4PG4A 4DR5J 3MD3A 1SIWB 3W8GA 3UDLA 2GJIA 3ZTQA 4NRTA 4WZQA 4KHPF 4L3KA 3ZZPA 1U09A 3MMBA 1SXLA 3DRPA 3U27A 5LMUJ 1JJ4A 2UUCF 3Q2SC 5BYRA 3FCWA 1AZSB 3RAXA 5HP1B 2JVRA 3TAMA 5LSOA 4P7TA 2FLLA 1P1TA 1T95A 5KOXA 1IVZA 5CA5A 2WOMB 2CNLB 1HHTP 1S0NA 3ZZ0A 5FDLA 2F9DA 3G6XA 3IBFB 1KR4A 2YKMB 5EX3A 2KRBA 2HFZA 3DOKB 2EK6A 2B6AB 1HPZA 2M4MA 2E66A 3QT8A 1QDUB 4DUYF 3PW2A 2NSBA 3RBXA 3U7JA 2XHWA 3KJNB 3G4SS 1B3TA 3HSZA 1JLCA 1RTZA 1TV6B 3GSIA 3BH7B 1S1UA 2CNOB 1YQHA 3CWJA 1UA0A 2W4PA 4JYAF 2AJFE 3OPKA 3K0JA 5KFOA 2V0NA 2FJEB 1C0UB 4MH8A 4K4YA 1TKZA 1N56A 3RB6A 3JB9k 3CDAA 1FXDA 2EFVA 1D3WA 1DTQA 3DCAA 2FZGB 5I3UB 4YUDA 4BDPA 4J9PA 4E0DA 1RWNB 3EVOA 2F1FA 4EFAC 3NNHA 2PD1A 4TY8A 2WHOA 3M6XA 4OZ2A 1BD6A 2KG0A 2HHTA 2LXFA 3DDKA 1E6YA 2GNKA 2MQMA 4DV0F 1Q8IA 1QTNB 2GMHA 4NZ6A 4DV7J 1NKCA 3WC2A 1RT2A 3H8YA 3E8OA 1UP1A 2YWHA 5J2PA 3V2UC 2RHSB 3HX9A 3W5XA 2K1RA 1U6FA 2J8AA 5M2PA 3D7SB 4X66J 4JV2A 2JLFA 3GR0A 4LF1A 2ASDA 2PN6A 3LF0A 2DISA 2LA6A 3AY0A 2V9WA 4A8SA 4J37A 4V19J 3BDEA 3QAUA 4B9SA 1YX2A 4O44A 3PHEA 4U7CA 4MYTA 1F9FA 5BR8J 3UD4P 3TOQA 2HNZB 3RB4A 4DR5F 3TJ9A 3L9ZA 1C4AA 1V5VA 3FEXB 4AXIA 4U7UD 1Y00A 4YR2A 3JTNA 2G1DA 3HK2A 1N88A 1NUEA 2XMWA 4UT4A 3F56A 5KFVA 2Z57B 5KFMA 2DR7A 1VMBA 4FVCA 2IJNA 4C11A 4RNNA 4Q45A 1HBUB 1HNIA 3JSYA 2HZVA 2Q6BA 2KFZA 3OVBA 1HR0F 2EC0A 2KXHA 2D3UA 2E1AA 3T5HA 4ZN3A 3KJFB 4JI1J 3CJ5A 1VRQC 2G9OA 3SZ2A 4FPRA 1AFJA 3D9BA 1TUGB 1CBKA 4RW7A 3EGZA 5LXRA 4YEAA 3KDNA 4ZVEA 1RP5A 4RW7B 1B7FA 1GMWD 3OT9A 3ITHB 4NMLA 4USKA 4ZVHA 4ED0A 4F8RA 3TQEA 4IRKA 1RT6B 3K5LA 1HNVA 2WW8A 4F3MA 4RNMA 1VQ8S 2NUUG 6FD1A 4CO2A 3OL8A 3T1YF 1PYSB 1BWEA 5F9LA 5CZXA 3MUTP 4RUAA 2ILYA 4DR6F 1Q5VA 4TKTA 4PRFA 3GFZA 1EQ0A 3BN7A 3F0NA 3CJKB 4Y2IA 3MUMP 4XAKA 2YY3A 5ETQA 1Z4UA 5K8NA 3MR2A 4X64J 2ADCA 2VG6B 1CULA 1ZOTA 3DC2A 4DU7A 5D15A 2OELA 3R7NB 1VI7A 5JVGQ 3R9LA 4H54A 3MEKA 2RF2B 1HWKA 1K73T 1GK8A 4B3TJ 2JHEA 4ENOA 2PT0A 3QJPA 1M5OC 3KNAA 3BV8A 3WZ0A 4GKKJ 3RR7A 5M2UA 1JLBB 1DZ5A 5B0BA 2VBXA 2JLGA 2HAIA 5B0CA 4KQZA 3A3PB 4USJC 3HM9A 2DHXA 3PEHA 4KGMA 4DV2J 4DLEA 4WF9Q 1TKTB 3QGHA 4AL7A 1TKDA 3PR4A 2DNQA 2HRTA 1WEZA 4Y2KA 1JLFB 3NS7B 1JJCB 4YHHF 1V3RA 1VFJA 3EPIA 3BQ1A 2VU5A 3OJUA 2UV8G 3PHTA 1J5OB 2JWNA 3I87A 1F2HA 1CJUB 4Y65A 2BJ7A 2DNMA 2WBMA 3ZZTA 4XIUA 1GXUA 3BB5A 1FNXH 2AYGA 5A76A 3UW1A 4G3IA 4R8UA 3J7YI 3ILOA 3TI0A 5GAEI 3TYTA 2OH2A 5L1LA 1TV6A 4CCHA 3CNQP 3G2XA 4NA3A 1H2VZ 1URRA 1YJVA 2BE9B 2KM8B 3I0SB 3EGVA 5I42A 2YKQA 3DOKA 3SSSA 3G9CA 1WC4A 3BYRA 2DRBA 2HNYA 3M6WA 2ASLA 3OXLA 1NU4A 4OX9F 5JUMA 3D6TB 1TUVA 3JQMA 3TVKA 4ECTA 2CYYA 5A0YA 3D0HE 1B0PA 2PMHA 2CZ9A 1RBOB 2POKA 2XI2A 2YKPA 1JKHA 2YTCA 3FFIA 1U2RA 2AP6A 4C0HA 2HHXA 2ZEJA 5HMWA 4ZVPB 3EVWA 1AZSA 1A9NB 4I6AA 4F2SA 4LF6F 3HP6A 2KHCA 3H4BA 1VQNS 1FJGJ 2O1PA 2H4YB 4B02A 2RB7A 3N0VA 5DLFA 2W9BB 3J7Z5 4M5HA 1OO0B 4JI1F 1VQPS 1VC5A 5H9FJ 4LFBJ 1EZZB 1U48A 1WKLA 2OSQA 2YNFA 3TANA 1ELOA 4LT6A 2VD3A 4QW9A 4O44B 4DR1F 3K59A 1D0EA 1M5SA 3NCPA 4WK3A 4JI8J 2RH3A 2CJQA 2YH1A 1M1GA 2WTFA 2W1BA 3CC2S 2R7XA 2B4UA 2GHWA 2BXJA 3A8EA 3H0PA 5HP1A 3UNGC 5KG3A 1BLUA 1RT2B 2LQ9A 3OVSA 2P6SA 3R8YA 2A2DA 3OTCA 2JFKA 1TUWA 4P10A 2JFDA 2KXNB 2NREA 3SQGA 5T14A 4LF9J 3HKZD 4IQXA 1VS3A 4JI4J 2PI5A 1WSVA 1UW4A 5F8LA 1U1MA 1SJ1A 1Y4ZB 4WFAQ 2EFOA 1UFLA 2DPJA 2CQDA 2KVQE 1IKYB 4HI1A 5KTQA 2IA6A 1GFWB 2B7CB 2H51B 4KHMA 4OJGA 3UCUP 4U95A 3IM9A 1PC5A 1R8BA 1T11A 2HBRB 2MQ8A 3Q83A 4LRBA 2KH9A 4UOHA 3VVUA 3LTOA 1L3UA 3NMRA 3RRHA 2JVOA 1CQNA 1W25A 4WK1A 4LF4F 2B9EA 3UDCA 1X7VA 3GFHA 2PO4A 2KYXA 2MTLA 2IM0A 3AHPA 2BJDA 3U02A 4B3OB 2MKKA 2VQFJ 1LWCB 2J6TA 2ZH3A 1IKWB 1ITPA 1NPPA 4B9TA 1G7CB 3A3NB 4AQYF 5H9FK 4WFNQ 1QVGR 6FDRA 2N4DA 2ZDOA 3OTEA 5DETA 4OYXA 4A47A 3NGDA 1C1BA 1QJHA 3CCTA 1U2FA 5KFIA 5CD4H 4C3LA 3SYZA 3PW5A 4OI3A 4CNZA 3MFIA 1G2EA 4OHXA 3O2IA 4GRSA 4PG6A 1WC1A 3N9UC 3MURP 3M8SA 1G4CA 3GE9A 3DKDA 1KONA 2Y1RI 1W7WA 3ADAC 3Q8YA 2HLTA 4O3RA 2XMMA 3VF0B 4ETZA 2XS5A 5HLFB 3MM8B 5LMUF 2J6SA 2VG5A 4RPFA 4NLRA 4X66F 1CULB 5D4PA 4DR2F 1UVKA 2VG5B 1TKTA 1U1QA 1KN6A 3P5TL 3C6UA 3KYLA 4OJ3A 1SJRA 2MQQA 2C2ZB 1KWMA 3EGWB 5U47A 4RNFA 5CCMA 5GAHU 4LF5F 1TAUA 1GX6A 4DX7A 2K7JA 2OPPA 4JV0A 4ES2A 3ZZRA 4ZCMA 2MQNA 3DLEA 3L09A 3MCSA 1Q8LA 3CXCR 1VHIA 4ZOSA 3NOCA 1RBLA 3OJSA 2ZKUA 2VODA 3R2DJ 1TMMA 2ACYA 4DR1J 4IFVB 4ECXA 1X5TA 1S6PB 4DFMA 4LFCF 1G1XA 4ER8A 1QAIA 2IHR1 5ETSA 1SB6A 1NJXA 4KKOA 4WE1B 5IQQA 3PR5B 1N6QB 3TX8A 1IKXB 3HULA 4N8NA 1TL5A 2VFVA 4FVMA 2KB2A 3CO9A 3H2VE 3FQLA 1T9WA 2EBEA 2IRUA 3PFOA 3CJKA 2OPSB 2FB0A 4ZP8A 4CQ1A 4Q5VA 1IKVB 1V5IB 4FXVA 3DU5A 2OKQA 3BSAA 1KS2A 5ADZA 2C3UA 1CQMA 3TP2A 4ZK7M 1WC0A 2IMWP 3GYNA 2ZJQQ 3NWRA 1AT1B 4FNHA 2ZH9A 2XY5A 4UQGA 1P9QC 5F8NA 2K2PA 2DCLA 4RNHA 3AH6A 2IJRA 2VH7A 3BGUA 2B3TB 3H2UB 3LP0A 4F4AA 5LSRA 2R7OA 2UUCJ 2I9SA 2PA3A 1YJRA 2AGOA 1SL0A 5ETRA 5ETVA 1R6YA 4Y2CA 3RZAA 3H40A 5EN1A 3HO1A 2WK4A 1S1VB 2DEIA 4NRUA 1HQEA 2V8HA 2DNKA 4Z2XA 1GH8A 5D0HA 2D9OA 1N32J 1SL1A 3X3UA 2U2FA 2J9DA 2W2MP 3VTIA 4K5SA 5KFBA 3CCZA 3N6LA 2AEFA 3IMQJ 3RAMA 2IAJA 4ZP6A 4Q0BB 4TXSA 4RUCA 3BJYA 3BGOP 1RCXB 3NRBA 4PYAA 5G0RB 2DHAA 2ZHBA 2J6UA 2DR6A 4NE9C 3W9JA 2KTQA 4QOTA 1FRIA 2D3ZA 1N54B 1CJTA 1SUQA 2ZH6A 4IG3B 4RO0A 4GVBB 4MKVA 2QIFA 1FDNA 9RUBA 1I3OB 2NXJA 1IUJA 3Q2TC 3PO4A 1HW9A 4C48A 4YS2A 3EE3A 3SV4A 4OHYA 2AJQA 3LP2A 1IBMJ 1UAWA 1ROFA 4FYXB 4YB6A 3R27A 4UUXA 4EO6A 1VQOS 2HMIB 4YY3J 2V67A 4LVNP 3GIKA 2FGCA 3CJQA 3JAMY 1SKWA 3BR8A 3DDIA 1UEVA 2V6AA 3O5TB 3PIPQ 1F5AA 4O3PA 3V4IB 4CNYA 1RTDB 1BXNA 2MLXA 1KLMA 5LM7E 2V2KA 5A0YB 2FZKB 1F0XA 5F3TA 1N4LA 3HHKA 4JI4F 1DQAA 3OVAA 2C3MA 1IR1A 1JLGB 4HEA9 1D1UA 1JNZB 1TP7A 3B82A 4NLTA 1MNEA 4H4MA 3U1LA 4F04B 3D1OA 5E3QA 1S0MA 2JEJA 3K8WA 4A4JA 4CLLA 5FLXY 3C6TA 3JS9A 4IFYB 3ISZA 2CQGA 1ZPVA 3EJMA 1OIAA 3LW5C 3W2WB 3GR1A 4A8YA 1LWXA 1BQXA 3NBPB 2FLNA 2DGUA 2QFIA 3CJTA 1PO6A 1ZAVA 1HLWA 5A2QU 1XMQJ 2VC1A 1I94J 1SC3B 3LA0A 3CCMS 1S49A 1UFKA 2W9CA 1YG0A 3CMQA 3PACA 1W2IA 4N56A 3CJ3A 2ZH7A 2OPRA 4ALZA 3TQ1A 1J2VA 1WG4A 3M8QA 5KG6A 4X4OA 3LOUA 3QZ7A 1IBLF 1LWEA 4G1PA 2L48A 1YDLA 4NL5A 2IBKA 4K4UA 2W8KA 4ED6A 4B9LA 3HD1A 4IO9Q 3ZZUA 1OQ6A 4HHHA 4K7QA 2JZ5A 1RLDA 2DH9A 2N3LA 3T41A 1S4FA 2OMOA 2J7UA 1M1KT 1D8YA 4H4KC 1DQ8A 4RW9B 1AW0A 1VRUB 2G2OA 4I68A 4KGXB 5J1PA 2WSCC 4HHUA 3ZC4A 3LAKA 5ETTA 1NK0A 4LSZB 2BW7A 1YK9A 1D09B 2OPPB 4C0BA 2E7WA 1UPMB 5BR8F 4DSEA 2WVBA 3BSCA 2J0WA 1U6ZA 1CJUA 4NWBA 2ATCB 3QATA 1OWXA 1U1OA 3RBZA 2EFGA 5KT3A 4DFKA 1N8RT 2V2ZA 4FBUA 1IXKA 2WONA 3M8PB 1PAUB 1GXTA 2HHPA 4Y6IA 4ECVA 2GW8A 1Q78A 1S48A 4OJ1A 2BQUA 3MTJA 1KFSA 2ZM6J 5J1NA 4USMA 2RDJA 2V2VA 2FVRA 4CM2A 2QSFA 3J81j 1AFIA 4IOBA 2HVIA 2HYIB 2YQ0A 1T9XA 3DLEB 4ILRA 4U8VA 5H1SV 4YR0A 3C2PA 1N5YB 4HKQA 2PFDA 1XR6A 4ZVOB 1ZH5A 4ZPVR 2OHDA 2XZWA 4QWBA 4TLRA 1JJ2R 3KUGA 5D3GA 4A8FA 4JOUA 4ICLB 2DNZA 2QYCA 3AD7C 4OJHA 3UE2A 2CPFA 3A12A 3MMCB 1RWPB 3M8WA 4PQUB 1ZM4A 3H90A 3T19A 3PYGA 2KI2A 4I7FA 1YTYA 4NLUA 4JI5J 3OSNA 2BV3A 3EYZA 1OJ4A 1XN9A 3KLIB 2UUAJ 1N33F 3CDWA 1RAGB 1FF2A 3EICA 4I7FB 3KTQA 1DHMA 3TA0A 1IBKJ 3IR6B 2XS2A 4K2JA 1D8ZA 4DJBA 5DGAA 4CO5A 1RHUB 1YBUA 3Q24A 3HHLB 3FNNA 4EK2A 4I6YA 2ZOFA 4URSA 3IRXA 3JSBA 2NPFA 1KQFB 4H4KA 1WORA 3CJRA 3VGSA 1S6UA 1LW0A 2DXFA 4L76A 5KFDA 5LL6d 4IQMA 4BS2A 3M8YA 1RA7A 1WOSA 1X8DA 3E51A 3BQ2A 2FUG9 1MWQA 3I9ZA 4DL3A 1LV5A 2R7VA 1IJEB 2APOA 2VICA 1HMVA 3T1HJ 3FZBA 4DDFA 3BEGB 1TKXA 4DV2F 3UR0A 9ATCB 2HHQA 3HJVA 4YDDB 2EFPA 2CAJA 3QLHB 4LQ3A 1GTEA 1MWZA 4ZLPA 2CFXA 1RTHA 2FJXA 1WF0A 2B7BB 3ISNC 4J9QA 4L3NA 4OI4A 2X7IA 2P5VA 1UMJA 4J5OA 3MMAB 2YKAA 5KT2A 2ALZA 4USHA 2K7KA 4KPYA 4BLGA 3IA0A 1QVFR 1GMVA 1C1CA 5J2MA 4OFZA 2O66A 3MPYA 4QIWD 1R6VA 4P2XA 1RA6A 3T1AA 5EX0A 1WELA 2EPIA 4NLDA 3THTA 2CG4A 2P8IA 3ZNJ1 5C25B 4NXNJ 2HHSA 3TUIC 1JLCB 1TL4A 4ZPBA 3FKBA 4WBFA 4DR2J 3BDPA 4IRCA 2V94A 2IM2A 3L4BC 3G6YA 2HFOA 4C8MA 3TRGA 4X4TA 2OI2A 2MKIA 2HW3A 1R89A 2QMWA 4FZVA 1REVA 4GVLA 2ZJRQ 3C16A 4N8OA 2ZE2B 3M2RA 4DXLA 3OFEA 3QMQA 3MF5A 4CWBA 4JI7F 2LYVA 5K9FA 4C9DA 4J9KA 5J2QA 2JL9A 1IQTA 1KLMB 2H4WB 4I56A 4EUVA 4TY8B 4YB1P 4CT9A 3OL7A 5DDRC 4NMXA 1KSPA 3MR5A 2V4JA 5I3QA 3LH2S 1KQKA 4CO4A 3AJDA 2GAGC 2QG9B 3H42A 3GV7B 3E01A 1FFSB 4DR4J 4WYWA 1LFWA 2RE1A 5E2QA 3KLFB 1U1RA 4X4VA 3NBPA 1H2UX 4RBTA 3K2YA 3HT0A 3ET6A 4ANEA 2HRYA 4OHWA 3C6TB 4IFYA 1HPZB 4WIIA 2B51A 3FEZA 2XMUA 3K7RA 3NGKA 5AT1B 2ERRA 2ADBA 1NPRA 3DLKA 4MKBA 3DFEA 5BYSA 3DMJA 1X5OA 2DIVA 2GO9A 2J76E 1RU1A 4ETXA 2X1FA 2DHSA 2VDHA 3T5JA 1YZ6A 4DV4F 2IY5B 2IYGA 2W4CA 2YNIB 3NLCA 1V3SA 1R43A 4XO0A 1T9YA 1XJWB 3NG8A 2KFYA 2Y8WA 3SQOP 3PX6A 2YQ1A 1S9GA 4MTPA 5KG7A 2AHOB 3OR2B 2VJVA 3X1LB 2CDQA 3TZXA 1NLKL 1VRTA 3EX7B 5C25A 1E6VB 2Z56B 4U96A 1R0CB 2D7SA 4DV1J 3THVA 1S1TA 4B3MJ 2ZC4A 3AB2B 1PYOB 3IGNA 2G0CA 3R5JB 4PXBA 3V6HA 2UUBF 2BKOA 1CG2A 3AXKA 1RACB 4MAKA 4KC5A 4Y28C 2LA4A 1KC8T 3TUPA 2UVVA 1YJ7A 1RTJB 2QN6B 5A8KB 2UXCJ 3L95X 1YJTA 4OQJA 2RS8A 1LWFA 3M2UA 2KT5A 4N41A 2JEGA 5D4OA 3PKMA 4YDXA 4DR3J 3M30B 4Q8EA 4X84A 5KFQA 2ACMA 4OL8A 3C46A 3DOMB 3WHIA 3H25A 4DQQA 4X4RA 4ED1A 1KVIA 4KT0C 1NJZA 4LRCA 1R8HA 3TX0A 1T9UA 4FF4A 2QSWA 4F67A 1OY6A 3AAWB 2ZH1A 4KB7A 2V9KA 5L8RC 5KFXA 1S5ZA 2B4PA 4FPIA 4WE1A 1K0TA 4WIQA 3FCHA 1SIZA 1UTAA 5D3GB 5GMKa 1GMWA 3BPDA 3N01A 1WWHA 3IRXB 2RRBA 3OFGA 1HI8A 3BZQA 4I0WA 4UY8T 4ZP9A 2L08A 3PDNA 3NS5A 1X4CA 3QO9B 4OV6A 3MCMA 4RUBA 4M5DB 4LVOP 2UXBF 3KG0A 3VAMA 1SKSA 3IBWA 4I2QA 1X4AA 2ZVIA 1FDBA 4AXJA 3GQCA 2YWFA 2ZBRA 2MB0B 3W8PA 3M30A 2K3IA 1NAQA 1WSRA 3GYGA 3QT7A 1F9EB 3DM2B 4WYLA 5BYQA 5J2NB 3T9ZA 3FBBA 3OTOF 3KHGA 4K50A 2GMJA 3IWLA 3M8PA 1IM6A 4PQUA 1U8WA 1BQMA 3ZTPA 2HVZA 5THWA 2FPHX 2F9JA 4Q43A 1CSJA 1RXOB 2KN4A 2O67A 2ROPA 4NXNF 5H9EK 3M8RA 3M9OB 3AOCA 2M70A 2GVZA 2U1AA 2FHMA 1N5YA 4YFUA 4UQTA 2RKIB 3DRYA 3H2LA 2FYXA 2CPJA 3KNGA 4NLXA 3WQPA 1X60A 4J90A 3SQGB 2NQPA 1S6QA 2W24A 2ZBPA 3LUYA 4QIGA 1RKJA 2D1CA 1Z2ZA 2G0JA 3MM9B 1P9YA 2OEKA 1I5OB 1VLYA 3I55S 3MHYA 2QA2A 4GC7A 2JEIA 3KLVA 1XQIA 1XMOF 4W98A 2L9WA 4ZVUB 3KK2A 4LF4J 3CIMA 3KLEA 4Q2LA 4EEYA 3DM2A 5J2NA 2OPQA 4KV8B 3UDEA 1VQ6S 5FD1A 5CXTA 1N32F 1YHQS 2N3OA 2DNNA 3ZO7A 2C1EB 3M2VB 4L74A 2Z4PA 3NCQA 1HQUA 4M5MA 1TR0A 4WFZA 4QR2A 3LO3A 5KG0A 1B7YB 3AOAA 5JJBA 1R0AA 2F4VJ 1PJ6A 3D3CJ 4KYZA 1KNZA 1H6KX 1Y3JA 1QUVA 1IM4A 3KLGB 2C2MB 3HVTA 3MR7A 1GX5A 1IBKF 3E2EA 5J2PB 3BGLA 3PNIA 4X2BA 1R8CA 5FDLB 3JYTB 1JLGA 1Y5IB 4W92B 1U49A 4ZLLA 1YGYA 1X4EA 4J9SA 3RU0A 2KYZA 4S0MA 2AZ3A 2OMLA 1RAIB 5A8WB 1RBAA 1T9VA 3I6PA 3N28A 3KOAA 1Y9OA 2VONA 5MAOA 1N48A 4EBDA 4JV5J 3PX0A 5DJBA 1BMQB 3ETOA 3SXLA 4X62F 4X65F 1VQMS 3DRPB 5GMDA 2AJ0A 1JNRB 1LKZA 2QC3A 2XMJA 4ZCLA 3AD8C 5AXLA 4RU2A 2F40A 3CD7A 2DGTA 3ENVA 2V8VA 3DGPA 3BBBA 2V8PA 1Y11A 3HDSA 1NB7A 2CZVC 3O44A 3CCSS 1NNDA 2BOAA 4ZJQA 4A8WA 1MMLA 3A4TA 4X62J 1CJTB 2WVCA 1NO8A 1S1TB 1NDCA 1UCNA 2CKWA 4F4WA 4CP5A 4URGA 4RL1A 2ILZA 3KK1A 1RB0A 4LSNB 3DLLQ 1HKAA 2I1RA 1ZPWX 2MSSA 4DCOB 2LECA 1MG7A 4DF4A 1FI4A 4USUA 3FDSA 3DN9A 4R25A 1XNRJ 1HBNA 2GZOA 1UWAA 2X1BA 3C16B 4AFFA 2V63A 5F8GA 2VQEF 4KJIA 4NASA 2QL5B 4UOGA 3QRRA 4MFBB 5B0EA 5KFTA 2FHJA 4CYUA 2IA0A 1Y7PA 3CIZA 2FDNA 3CSKA 1C2PA 3GCWP 3PJXA 4MYUA 4NLPA 2VA3A 4X64F 3TZWA 4K4WA 3DLBA 3HJFA 3DRSA 2FY8A 4TQRA 3GLJA 3OHAA 4DCPB 1O5JA 3JQJA 2XYHB 5KG2A 2FC8A 3KHRA 4EYHB 3C3LA 4LFAF 1RGVA 2LP4A 3I0SA 3OQ2A 1T02A 2UXBJ 2C42A 1KHVA 2DGVA 1WHVA 2VB6A 3NP5A 2DB1A 5AE3A 1NZ8A 5KFJA 1T05B 5KG5A 2YX4A 3VZHA 4ED5A 1RT7B 2CG8A 2PC6A 5DDOC 4XPCA 4O0IA 3HHDA 1A6LA 3GIJA 2GMLA 1XMOJ 3CJ2A 3GFXA 4B9VA 4WU3A 2XNRA 4LR7A 2HFSA 1V6HA 5LMNJ 3CC4S 1UWBA 1NDPA 3MPUB 1JLFA 2I5JA 3W7BA 3TARA 3SCLE 4DV5F 5L38A 4FF3A 1NRKA 1HNVB 2NXNA 4ICLA 5BJRA 3DLHA 4LBHA 4YB7A 2WB1D 3A1YG 5I42B 1S6PA 2VV5A 4MK7A 5CYQA 1A7GE 3JQKA 4WKRA 4QPXA 1DURA 2XNQA 4WP8A 4A46A 4DUZF 5HBMB 3IR7B 4PWWA 3MDFA 4ED4A 5H9EJ 1ACMB 3IR5B 1WI6A 1RAAB 4C7QA 2FQQB 1U02A 3EXCX 2AWZA 2E1MC 3GJTB 1VJWA 4M5GA 3NMAA 4RKUC 4TU7A 3CCVS 2XWXA 4LF2A 2QTWA 4M5KA 3PW7A 2HKEA 1U1NA 3M1VB 5E7OB 3JAMU 5T7LA 4PKDB 1SKRA 4B3SF 5D4LA 1ZBTA 1HI0P 2DPIA 3DDNA 2DR5A 2UZAA 1KVKA 4OLOA 3M8ZA 4BBYA 3NAIA 2W7PA 1FX2A 4AUKA 3QFWA 4X4QA 4QPTA 1FCAA 3U1NA 1VGYA 2M7SA 1WNEA 1DBDA 1T8EA 1L3KA 2OFHX 3IS9B 4CDIA 3IWNC 3R2CJ 2RVJA 1N34J 2DHGA 5IFMA 2HQFA 2EW9A 2GVZB 3OR1B 2BKPA 2W7OA 2M8DB 4PUOA 5IOLA 3TAQA 2Y3YA 1HBOA 2X3DA 3P6YC 4QWDA 5DQIA 1TQLA 2R8HA 1FKPA 3QRQA 2GHVC 5IS2A 3TW0A 4IH5A 2OGUA 5C24A 1B64A 2IC3B 1RTIB 1Y3KA 1LQ9A 2K3KA 2AJ4A 3BBFA 3I0RB 1EETA 2CZ4A 2B4OA 1O0PA 1NDLA 1YZ7A 2LFVA 1UEKA 1WF1A 3C8YA 4KGVB 4L73A 4R5PB 2UUBJ 1D9AA 4HI2A 1FESA 3R3TA 2HZCA 4TVAB 2XZTB 2E9ZA 4YN3B 1RT1B 2RDIA 4F26A 4OX7A 4ED3A 2MKYA 1SV5B 3SMZA 3QPIA 2B4VA 3I56S 4OHZA 1FXRA 2QA1A 3EWGA 5GVQA 3FSIA 3H5XA 4F7VA 2PIIA 3IN5A 4I6WA 1Q4RA 2BJ3A 2FY1A 1L3TA 3T3FA 2JSXA 2RDDA 1TK0A 2RAQA 4P2SA 1WOOA 4C2MA 1U8SA 3CCUS 2FC9A 3SDEA 5KFYA 2A3JA 1AA1B 1XK8A 1RE1B 1K44A 2QE5A 1U2CA 2ZD1B 2HURA 2ZE2A 3M2RB 3PRDA 3HT3A 1YI2S 4OYAA 2CQHA 2CA9A 1PSDA 2YPZA 2FHJD 1LOUA 4PYDA 4CI0B 3RR8A 5LXYA 5IXUA 2UXDJ 3BM7A 3LPEA 4DV5J 1N36J 1EIYB 1FEHA 1SPBP 4NYOA 2VQFF 3IAM9 3KXDA 4WTYA 1UVNA 3NGRA 3PG9A 4UOCA 4NLQA 2MZRA 2BQRA 2W25A 4ELUA 4HTJA 3IM8A 2CPYA 4F2RA 1DTQB 5B7WA 3VALA 4UZBA 1Q16B 4DR7F 2DXEA 1W26A 2E5IA 2WVDA 1S1XA 2DYAA 2ZNZA 2JDJA 3ET6B 3IRWP 3BO2A 1FEEA 1QAJA 2HWHA 1RT5A 2GVDB 1N5QA 2XHCA 1VJQA 2K8GA 2JJ4D 2IFXA 2PMZD 4CT8A 1UZHA 3HMJG 1Y5NB 1NHVA 2B8PA 4J7CA 1RWKB 4ANDA
chains in the Genus database with same CATH topology
3CVKA 2LVWA 3JTPA 4TQSA 1VBXA 5KFNA 2GO8A 2MJUA 3N6NA 3NKYA 5A8WA 2BW2A 5EWFA 5J1EB 3KHLA 4JI3F 4M8LA 5F0WA 3FSYA 2V5HG 4TU9A 4ED7A 4DQIA 2DNOA 2W9CB 1S9EB 2EVZA 2LEAA 4E98A 1NK6A 3CDBA 2GGPB 1UKUA 3O3LA 3KG1A 2FLPA 4DFPA 1T03B 2DGSA 1NEEA 3G86A 3EPGA 3CJ4A 3KLFA 2LKZA 3HFKA 3PM9A 2YH0A 4YMEA 1P6TA 2DBBA 4IH6A 1LK7A 2D41A 2R8GA 3CD0A 3K8VA 3CT9A 4RW4B 4E8UA 1I94F 3OSPA 3GIMA 4MKAA 5EWGA 1S79A 3SEOA 3HPOA 3MM7B 4PWDB 3TR5A 4KKOB 4IKAA 5DGBA 5B09A 3L3CA 3UWTA 3K57A 3EZ5A 2N82B 2QZ8A 2RS2A 3KLHA 1FNMA 1FDAA 1HNXF 1NZAA 1R27B 4HLBA 1RYSA 4AYBD 2EG1A 4DHVA 2C2RA 5DM7Q 5KFEA 2ZVSA 2MKJA 4X4UA 5M2RA 1C1CB 1YRTA 5J2MB 2FJVA 3C6UB 3N5FA 1X5SA 1S97A 2XO7A 3CCES 2VG6A 5ITHA 3OV7A 4DQRA 1FJ7A 2C22A 2DITA 1JB0C 1YJ9S 4F4ZA 1K1QA 5GADI 4ECSA 4F3OA 1OPZA 3H5UA 2ASJA 3NWGA 2DR8A 1KQGB 4BCAA 1HMVB 1JLEB 1MW7A 2RJZA 4B3RF 3LP1B 3S01A 3VWSA 1X9MA 2XG8A 4A8OA 1RQ0A 1S0VA 3LWMA 4XDCA 4TY9A 1N0UA 3K5PA 2B43A 3TA2A 5F8MA 3Q22A 4NLVA 2G4BA 1SH0A 2OJ3A 3D0IE 1VQKS 2MHNA 1LWEB 1MMNA 2BUNA 4IUFA 3HHNB 1JLEA 1QE1A 4JV1A 2BVZA 2VA2A 4LSLA 5F0UA 1EETB 3LALA 1B0TA 2ZOMA 2NUHA 3NS6A 3FZ2A 3Q8RB 3CD5A 4R0EA 4ZVGA 7FDRA 2CIMA 1FKAF 2BJEA 1IKXA 3FGVA 2F4VF 5IT0A 2FLOA 4ZPCA 2MY7A 2HPUA 4MIBA 5HL7Q 4YY3F 2J7KA 5KG1A 3IS9A 2E44A 2V8GA 4HVZA 1HFEL 2ROEA 3LGMA 1IR0A 3OR2A 3UCZP 2WAQD 4M63A 3V4IA 3MFHA 3I32A 5CH7B 4M1KA 4KR0B 1IJFB 2FIUA 2E7XA 4KSEB 2J7WA 1NKEA 1RT7A 2VFTA 5KFHA 3T5LA 1RWUA 1XMBA 2ZFHA 2IVYA 2ZH4A 1AXQA 3CMAS 2VKRA 4RUHA 3KK3B 2RRAA 5KT4A 4EYIB 3N6MA 3NNAA 3AJ2A 4IR1A 2LQJA 2R2UA 1VRTB 2X51A 2V4RA 2N7YA 2GGPA 2W4DA 4PG8A 3OLBA 2LEBA 1G1XA 4LF8F 1WACA 3D5MA 2R7RA 3QJJA 1UJ4A 3MTKA 4WCEQ 3OL6A 2FJAB 1VBYA 4ZPAA 2OTJS 2EFQA 3QWPA 1FTCA 3GV8B 2R9LA 1NK4A 1RKIA 2XB2D 2MQPA 5AXKA 2WSEC 2FJDB 1L3VA 3DLKB 1Q7LB 5I3PA 4DV7F 4O23A 4RBUA 1RT4B 4DX8H 3FMWA 1M0SA 1TAQA 4EWTA 2XMTA 1FK9A 4CH7A 2DRAA 4JI8F 2AYMA 3QYYA 1S99A 2LXIA 5A6WA 5F3ZA 3E01B 2E1RA 2OD4A 2XCAA 4FNIA 2Z0GA 1HD0A 2VBYA 3L7OA 4A48A 2J9DE 1FVSA 4QZVB 3L7PA 1TL1B 4HH0A 5C42B 5KT5A 5LJ3Y 5F8IA 4OIXA 2LEPA 2YQ3A 3DOLA 4DPOA 3H59A 1HWLA 4Y2MA 2ZHAA 4PR6A 4NCGB 3MM9A 2D74B 5C5JA 2HHUA 1JLBA 4B3MF 4JI6F 2AYBA 4PCQA 3AB4B 4CO3A 1UVJA 4H4OB 2FVPA 1Y5LB 2UUAF 5E3CA 1HWUA 3WBZA 4ECYA 4IOCQ 3MMAA 3QGGA 2VPXB 2R7QA 1RT1A 1JX4A 2VOPA 5DDQC 1X9SA 1KRPA 2VFSA 2FTRA 4Q0BA 4C8YA 3H5YA 3GMGA 4HYKA 4PPDA 1IKVA 3KJVB 4OHVA 2HHVA 1QSYA 3P49B 2XBPA 4QCLA 1HL6A 2XI3A 3QO9A 3SSQA 1S1VA 2OSRA 2MGZB 3VR1A 5HO4A 3JYTA 1DLOA 2AD9A 1BQNB 2WBRA 5E41A 3MM6B 4NZ7A 5IM0B 3V4MA 5LJ5Y 3M4XA 2KHDA 5IM0A 2HG4A 4K59A 5I4MA 1DLOB 4NCAA 3GWCA 1T94A 2CPHA 1FJEB 4YB5A 3LP1A 3M2VA 2B9WA 1H7XA 1ULRA 1FJCA 3N5BA 1G6BA 1YBAA 1YWXA 4RWXA 1UVIA 2YKNA 5E0OA 4X4PA 1YRXA 4FS1A 4BWJA 3CGIA 1HHSA 1XWLA 2IC3A 5E3RA 3S1TA 2Q3PA 5KFZA 4M94A 4O3QA 2NLWA 4A8KA 4TYBA 3W2VB 3OFHA 1Q86T 3ISND 3WDOA 4LIWA 2FGOA 2J5AA 2XSJA 4NLSA 1QY7A 4NA2A 4IDKB 3MUVP 1BQNA 1S9FA 4I67A 3HHLD 4I1TA 4MMOA 2JLEA 2OIHA 3LAMA 2GFFA 4C8ZA 4QWCA 4P6QA 2ZHOA 3DLGB 5HROA 1RI7A 2XULA 1TZ0A 3BGRA 1ZAXA 1HWIA 3H20A 3B78A 1KD1T 1VQ5S 4OZ1A 2AX0A 4WFBQ 4RLEA 3PKYA 2HHHF 4DSJA 1DTTA 1SQEA 1YJNS 1N36F 3R1HA 3M8QB 4LSNA 5A2QY 5B0FA 2LCWA 4A8XA 1S76D 1XEZA 2QMXA 3MM5B 4A8QA 3VCDA 4DSFA 3OHBA 2NYIA 2WB4A 2YNFB 4MIWA 2D3OR 4NXMF 3CCRS 1FO1A 3I9V9 3QIPA 1VQ4S 2KDOA 3ENWA 4EO8A 2IVFB 4HL9A 3OUYB 3ITHA 4ELTA 3RRKA 2KKHA 1S9GB 4BHQA 3J7ZT 4ZDNA 4G1IA 3JSMB 1FNOA 1B0VA 1DRZA 1LXNA 5C42A 1TK8A 2KJWA 4A8MP 2ABYA 4B3OA 1RT3B 3IWXA 1X4BA 5GADU 2AU0A 2FHOB 1FRLA 2UVWA 4PG5A 4DL4A 4FBTA 2R7SA 1C4CA 1LWFB 3M2UB 3R5AA 3MPWA 3UR3C 1XTZA 3HI9A 1V9OA 3KK1B 3UPFA 3CCQS 2F3JA 4EZ6A 2O5DA 2XLKA 5KFWA 3I31A 5K14B 3BO4A 5K5MA 5K14A 2YKMA 4GMKA 1QUPA 1N34F 4I4BA 2R7TA 3ENQA 3SCKE 5KOWA 3WC0A 1S72S 2E5LF 1MSWD 4DLGA 3GILA 2YNGA 3PZPA 4F4KA 2YNGB 1GQEA 3EGNA 1S77D 3T6JA 1F5CA 1RT3A 2A18A 5B08A 1JKHB 5K8PA 4DV1F 1FVQA 2BBEA 3DMJB 2OTLS 4DF8A 3NL0A 4DSIA 3BR9A 2W7AA 1R31A 3GB0A 4GC6A 2HWTA 1N5VA 3P3DA 4HHJA 3BSNA 4F4YA 3O1LA 2Y1JA 5CZVA 3HHEA 3MOJB 2EG2A 2V8DA 1Z2LA 2GJ2A 4R8UB 2CPEA 5KFLA 4ZCIA 3MWBA 4KO0B 3Q8QB 3CCWA 2RRNA 1J5OA 1WEXA 2I8EA 4KAIA 2QO3A 2O01C 4FYDA 1ZM3A 2L9DA 3FFIB 4K0KF 1EP4B 5KFRA 2MHEA 4DL2A 2PEHA 5DDPC 1FKPB 1HNWF 2Q6CA 4GO7X 5LMNF 4ZCKA 1X4DA 1M5HA 2DNYA 3ZFVA 1NK5A 1LW0B 3QIDA 2HNDB 1P27B 1U24A 4QWEA 3BREA 2F8EX 1CC7A 1S6QB 3CPWR 1FE4A 2X3GA 2FJBB 2LQ5A 2YWEA 2HS3A 2I38A 3OTBA 5E3PA 5IT4A 4PQAA 1Q7YT 1FHTA 2CPIA 3KK3A 2GQQA 2M0GB 3KLIA 1WF2A 2CJBA 2P9EA 2VFUA 4QR0A 4JI0F 1QE1B 2HLUA 3OBIA 2P9CA 3MGJA 3HHLC 2FVCA 4QWAA 4U7UK 3SI8A 4PUOB 2BRLA 3CEDA 4IH7A 3TNVA 4JI5F 3UFCX 2HS4A 1QAYA 4I64A 2MKHA 2NR0A 1V3ZA 5A8RA 1CC8A 3DYAA 4KBIA 3J80Y 1SH3A 3SSRA 3DYAB 2MJNA 2FVSA 4ED2A 2CQ0A 2Q43A 2CVEA 3OW2R 2XSJB 3SV3A 4OV1A 1O8BA 2CJ9A 1H0HB 2BE2A 2RF2A 3LANA 3MEDA 1FTRA 5D6GA 3I5CA 4ELVA 2F7VA 4LJMA 2OP5A 1WHWA 2QLXA 3HVAA 5IT9Y 1E6YB 3T1HF 2KJVA 1EP4A 2MYFA 1N5TA 2CPXA 3AQPA 3PFEA 4CIOA 1NJWA 4G1QB 5HLFA 2IRXA 3I82A 2DR9A 2LDIA 3KG4A 4L72B 3J7YU 3G8QA 2DH7A 3PJWA 2VOOA 1RTJA 5A8KA 3ULHA 3VQSA 1MROB 1YITS 1ZZFA 1RK8A 3CUNA 2NXUA 3IXQA 4GKJF 2RQ4A 3H4DA 3MM7A 2HWIA 4PWDA 3M9NB 7FD1A 4EBCA 4QIFA 4F02A 1JJHA 4OX8A 5KFAA 1AUDA 1LWCA 4C3MA 3VAJA 1RTDA 2RUGA 4TNOA 4XK8C 1HA1A 1L3SA 4KO0A 3FQKA 4C98A 5EGYA 2Z2LA 1S6OA 4FXDA 1QTMA 3W2WA 3DHWC 3AJ1A 2KXFA 2VZ9A 1H2TZ 5L39A 1FJGF 3MEGB 4LF7F 2JEFA 1S9EA 5DQHA 4Q2MA 4KTQA 4N5SA 2R7WA 1BC6A 5LT5A 1ZYQA 1WHYA 5CQGA 4DV3F 1N5SA 4M95A 4PXDA 5J1EA 3MXHP 1JMTA 4K4ZA 5KT6A 3KLHB 1Q81T 3RBDA 1YJWS 1VQ7S 2B6AA 3D54A 1K1SA 2ZITA 5CHCB 3DU6A 4BWMA 4ZHRA 2KG1A 4QYZJ 4HDHA 5FIIA 4RW6A 4RW8A 4FP9A 2ROGA 4DJBA 2VUGA 2DT9A 2MZQA 4WKYA 2YKOA 2CQ4A 3DHXA 1I1GA 2J0XA 3ONQA 1L5UA 3BQ0A 2AGPA 3TAMB 1XERA 3M6UA 2RIJA 5CYMA 4F25A 2E9RX 4TLQA 2KVIA 1MROA 2UVRA 4Z37A 2M52A 5L9XA 3HHLA 1TL3B 1XMQF 3DXSX 1XBWA 1N52B 1X0PA 1OS5A 1PILA 4R5PA 2E29A 1T3OA 4LFBF 2AF6A 2HGMA 4HH1A 2OPSA 4I69A 4HTIA 3RRGA 2OPQB 4KV8A 2DD8S 2B9YA 3MMJA 3M9MB 4IO1A 1DQ9A 1LXJA 4KIAA 5D78A 3LGNA 4ZPDA 3U1MA 3KK2B 2ZKTA 4ES3A 5J2QB 2CQPA 4RW8B 2NPIA 1TFYA 3RW7A 4ZS6A 2MY8A 3O8WA 1WTFA 2XMKA 2GX8A 1H3DA 3HVTB 3MMBB 3LP0B 4BC7A 3RBEA 3BSOA 2L41A 4DL0C 1RT5B 2H9ZA 3PW0A 4NOHA 3HZGA 1CEZA 4IYQA 5L1JA 2C3YA 1MWYA 1XC9A 1FT8A 2J0SD 3QWUA 5IQ6A 3KFWX 3D1HA 4NLOA 2YX7A 1X0FA 5A6PA 1RTIA 1Q1KA 5KFSA 2HRUA 2RT3A 1D9DA 4ZMMA 1K9MT 2GIRA 4CH1A 2NZ4A 2AYEA 5B0DA 2IAJB 4K5RA 2E5HA 1ZTWA 2LQBA 3VAIA 2N7CA 2XWYA 1HBOB 2GHPA 3RTVA 2RILA 1G3OA 1MMDA 4ES1A 5SUHA 2KZZA 2BZ2A 2DNLA 4B17A 3B4MA 3R5BA 4M5DA 3POTB 3B4DA 3SDEB 5K8OA 2YNHB 3S8SA 5DO2A 4Y34A 3KHHA 3UD4P 4IG0A 2YVSA 1Q8BA 5A8RB 2CQ1A 2HQIA 2F8MA 1VIOA 3NCRA 5LSLA 2DIUA 3MM6A 5HI7A 4K4VA 1ZAWA 2SXLA 2ATLA 2JX2A 3DRRA 4MK8A 1S1WB 1U1KA 1SC6A 4K4TA 2XLJA 1NK9A 2OPRB 1LK5A 2GQCA 4Y3CA 4G1QA 4DG1B 1QAXA 1S7HA 3AA9A 4D3GA 1CPZA 1C0TA 2P9GA 2VPWB 5F8JA 2W9AA 3QAEA 1M5KC 2AX1A 2HNZA 2DVIA 1RT6A 4BC9A 2M9KA 5EDWA 1P1LA 1VK8A 4DS5A 2RNEA 1Q53A 2Z8QA 2UU9F 1DAXA 2VASA 2B5JB 4OLPA 3VZIA 3BO3A 2GQ2A 3MZIA </