3QMRA

Crystal structure of the mutant r160a,v182a of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with the inhibitor bmp
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
219
structure length
219
Chain Sequence
VMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTAPERLSRLREIIGQDSFLISPGAGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGIIESIKDLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational changes in orotidine 5'-monophosphate decarboxylase: a structure-based explanation for how the 5'-phosphate group activates the enzyme.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus str. delta h
molecule tags Lyase/lyase inhibitor
molecule keywords Orotidine 5'-phosphate decarboxylase
total genus 81
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2011-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3qmrA00
4ZQMA 1W31A 1CW2A 2WNQA 3B04A 3W1UA 1QPRA 2P10A 1SFJA 1I2QA 3M47A 4FIRA 4JNMA 5EKYA 3W1AA 1TPH1 2BSLA 1AG1O 2NUWA 4OBTA 3OVPA 1ZY9A 3W85A 5CG7A 2DJLA 3P82A 2NWSA 2HTMA 3LXCA 5AHLA 3W1RA 4QIUA 1LZOA 4AHPA 5K4XA 3PS7A 2QCFA 3DXIA 3LM7A 1XKYA 2FFCA 1QDSA 2X1TA 3C2RA 4H3DA 3O05A 3A23A 4DQWA 2X1UA 5D37A 1QR7A 3W1MA 3L0GA 2E6FA 1KM6A 3ABRA 5DLCA 3HOJA 1A5SA 2TRSA 4A21A 1W3NA 2HS8A 3VE7A 4ICNA 2QJHA 3A5FA 5K7JA 2ZBTA 4WXYA 3WJYA 2Z6IA 4UTJA 1EP3A 1J2WA 4PTNA 2J6XA 3NZRA 4NXSA 3F4WA 3UPWA 1LTDA 1FWSA 3A9IA 5F1VA 4GWEA 5AB3A 1DQXA 3N9SA 3P8JA 3PG9A 4GNJA 3VCRA 1QOQA 1W0MA 3WK3A 3NQGA 5D2WA 4QJ1A 1UUOA 3SR7A 3Q37A 1KBIA 1TMHA 4JTLA 1WOAA 4JTFA 2FPVA 2YW4A 3ABQA 3NR0A 2O7SA 5AHMA 4AF0B 3MI2A 4YXGA 3JR2A 1G4SA 2RHGA 4MY9A 5L9FA 1YDVA 2A7PA 5HR6A 3DFOA 2V2CA 1KFJA 3B06A 2WSQA 3BW3A 2TSYA 2ATSA 5IBXA 2DZXA 4JN6A 1PVNA 3UY8A 5BNKA 2J9ZA 2CW6A 4AXKA 4LNYA 1I2PA 4UNLA 4DBDA 2Y63A 3TJLA 4NJKA 3G1VA 2NLIA 1TSIA 1B9BA 2YYTA 1XFBA 1TPEA 3S9YA 1RVGA 3CHVA 1K7FA 4JTUA 2W6RA 3QW3A 1FWNA 1XBXA 3TC6A 4KWWA 1P4CA 1WXJA 2ZRUA 1NAL1 4X22A 1I2OA 1V5XA 1W54A 3K30A 3NPWA 5TIMA 1ZNNA 3GZ3A 2YX0A 2G95A 1JR1A 3R8RA 1YTEA 2C15A 2IQTA 5D03A 2Z6JA 4N9DA 1BWLA 1TTPA 1GWJA 5FI8A 2QCCA 4MJZA 2QF7A 4OV4A 1YYAA 3L0KA 4R34A 5D30A 3P60A 2HS6A 5FEPA 1OYAA 1D3GA 4ADUA 3CPRA 5G2IA 1EA0A 3EWXA 5F4WA 5HJLA 4DO5A 3H54A 1MXSA 2Z0IA 1DVJA 1ZENA 4HNVA 4LS2A 3ZWTA 4DPPA 2YZRA 4XBKA 1QWGA 1Q6RA 3LCWA 4K38A 3RK8A 1JCMP 4GXMA 3H55A 3IEBA 2FPYA 2V82A 2V2HA 3BG5A 4N6EA 5HWNA 1FDZA 2GUUA 1D9EA 3LRLA 3B0UX 4O1CA 3BLEA 5HINA 5MHBA 4TMBA 1ADOA 5EPDA 2YW3A 1LRTA 3HMJG 1LROA 1ICPA 1LORA 2QR6A 1ZHAA 1LOQA 4ZQPA 1AMKA 2R8WA 3FKRA 4CCEA 1L9WA 1R30A 2H90A 4IUOA 1ME9A 3S5ZA 3PSVA 1GTEA 4FNSA 1F7BA 3DI1A 3OVQA 5C5YA 4JTHA 3T55A 1TTQA 1TYGA 4N4QA 3W86A 4CQ8A 1FQ0A 2ZZ3A 1G7VA 4AB4A 1KM5A 3EKZA 1PIIA 3WJXA 1RR2A 1M7PA 4QITA 4S1FA 3GAKA 5ABTA 2CLKA 4O4WA 3GDMA 5CZTA 3W2LA 2RH9A 1TV7A 3LHUA 5C2XA 1TRIA 1FXQA 3OEXA 3O16A 3P7YA 3S8HA 4NX5A 1QPOA 1HO1A 3EX2A 4Y6GA 3CWOX 4TO8A 3C61A 3Q94A 4FEZA 4MZ8A 1YTKA 5HQEA 3LBCA 1T99A 2H6RA 4UFHA 2OX1A 2A5HA 4LTSA 1KV5A 2JKEA 5KINA 3PBYA 3G1SA 3W76A 1WV2A 3LOTA 1N55A 3THQA 1ZALA 4DELA 4POCA 3LTYA 5CPMA 4FHAA 1P1XA 1LBFA 4R53A 3G0UA 3MBFA 5I3KA 2B7NA 3GR7A 3MHFA 3W7QA 3HGJA 3PAJA 5D38A 5F1UA 3G3DA 4HPXA 3QQ1A 2NZLA 3W1PA 3E9AA 4PH6A 3IIOA 4FNUA 4Z1BA 3LTSA 3IVSA 3W75A 3TU9A 3T40A 5E93A 3W88A 3KHJA 4LW7A 1FX6A 3TSBA 2EPHA 4IPJA 5CPNA 5LKYA 3GXTA 3LERA 4MY1A 2WPBA 4QAIA 4Z1CA 3ZR4A 4Y8FA 1VR6A 1M5WA 1JRCA 5BRBA 2ZFAA 2QDHA 3T7VA 3NQMA 3STEA 1K7EA 5AYZA 1H5YA 2QUTA 2ZRYA 3NL5A 2A0NA 2VEPA 1OFRA 1BEUA 3PBWA 1GVOA 3CM4A 3PWAA 4LRTA 4ORIA 3HBLA 5F2IA 4UMCA 2Q8ZA 4ZMGA 1ZJIA 1KFCA 5SWUA 5D33A 2R94A 3MP3A 1LM1A 4YWIA 1XL9A 3I7RA 1G4TA 1KFKA 3NPXA 4JX6A 1H50A 1P0NA 2DZVA 4EIVA 1QOPA 4IX2A 3LHVA 2CLIA 4FXSA 5G5IA 5KITA 4O57A 3PR2A 1Z48A 1IXNA 3W72A 2VEKA 5FF4A 3O6CA 1SW3A 1XUUA 1Q3NA 5TBOA 5K3VA 3P5YA 2NXIA 2W79A 3PUEA 4KFPA 1SFLA 1YLVA 4DO4A 1SO6A 1XBVA 3GLCA 2E77A 1KV8A 3TQ0A 3BW2A 4Z1AA 3RLUA 5HWJA 3IIPA 1C8VA 1O94A 3VKJA 4AWTA 2WNZA 1DJQA 3C52A 1LBLA 1W3TA 3E02A 1DKWA 1GVQA 4HN4A 2CLLA 3NPUA 2E68A 1D3HA 3UWVA 1PCWA 1AW1A 3KX6A 3W7DA 1BTMA 1W5MA 3R89A 4MY8A 2DJXA 2YGYA 1FXPA 4BR1A 3UWUA 1IGSA 3M9YA 1Q6LA 4K6AA 1IXPA 1SO3A 3NA8A 1DBTA 5KZEA 1S5TA 2RDWA 5HNRA 1EX5A 3NGJA 4RR4A 1C29A 2GVGA 1G4EA 3DI0A 2FJKA 2JGQA 1SUXA 4JY9A 1HTIA 3KRZA 3NO5A 3SFKA 2BXVA 1ZFJA 2QUVA 2ZDRA 1TTJA 4JTEA 3BVJA 3NG3A 2I14A 4O50A 4XBSA 1LOSA 2CU0A 1F6PA 4NQ1A 4NZJA 3STFA 1F73A 3KRSA 1X1ZA 3W87A 3TUUA 3SSJA 4XTDA 5EMUA 1H62A 2NX9A 3VFLA 3SY5A 5LHEA 2WOQA 3LLDA 3FJ6A 1M7OA 3RU6A 1QFEA 3P67A 3BGJA 1OABA 3MHUA 4Q33A 3ATZA 4UTIA 4NUWA 1OFDA 4QNWA 2G96A 4CNNA 2PE4A 1ME8A 2A21A 2NV2A 4AWSA 3S1WA 2V30A 3GB6A 4I9AA 3FFSA 4M7SA 3SIZA 5F4XA 2OZ0A 1XBYA 1EPXA 1NVMA 3MBDA 4PODA 2GVJA 2DZUA 4NZFA 3D0CA 5I3HA 4OHQA 2O7QA 3BW4A 2P1FA 1F05A 1KA9F 1KFLA 1QAPA 5D2XA 3PSWA 3MYPA 1VJIA 1JVNA 2C18A 3QYQA 3UXDA 4O52A 1LDCA 4E0CA 5J5RA 4MPQA 1TPDA 1GTHA 2ZZ2A 3G22A 1VPXA 2C19A 1ZAHA 2Y7GA 3L65A 1H7NA 4O11A 1UB3A 3EXSA 3BLFA 5I3FA 4P61A 1WBHA 3QQ0A 1B4EA 2X1SA 3MHGA 3LDVA 3QSTA 1EB3A 4A3UA 1GYLA 3DENA 3E49A 4O13A 5GVJA 3TC7A 1XC4A 2ZRWA 2YXGA 3CLMA 1Y0EA 4N9CA 5D05A 1W5QA 3MUXA 4WX2A 1DHPA 3FIGA 3P62A 3NDOA 3N3MA 4YLWA 2YYUA 2Y6ZA 4O8RA 3A24A 4AH7A 3TJXA 1QPNA 2CLHA 3IVTA 5AC7A 2NXGA 2OT0A 3ZWSA 3TAOA 1NFBA 4NXKA 1TIMA 1GG1A 2E1DA 2WJZA 5TQLA 4P2VA 3N73A 3FEMA 3IV3A 1VQTA 1PHQA 1FCBA 3PY2A 4M6QA 5EYWA 3LXBA 3TDFA 4MYAA 3STGA 2QCNA 4HKPA 3QW4B 4YL2A 3U2OA 1NF0A 2VEMA 2Q3OA 4MZYA 5AFDA 1MO0A 4LWWA 1DOSA 5HMSA 1T8XA 3LRMA 5CPLA 1RD5A 1QNVA 4FB7A 3HGSA 3KXQA 3S5OA 1F76A 3TSMA 2A1YA 1W5OA 3UWYA 3W7KA 4ZQRA 4DPQA 5FF7A 1SW0A 1PE1A 5H2ZA 4JTGA 1CI1A 3L68A 2YPIA 4CQ9A 2BTMA 1TQJA 1OFAA 1B57A 2V0TA 5AHNA 4EF8A 3LX9A 5AYXA 4E2BA 3TH6A 1QO2A 2ZZ4A 4MLJA 3LBMA 3T78A 3O6YX 4UTTA 3FYPA 3DFNA 4WY0F 4UTWC 4J9JA 4LU0A 1KM2A 2RFGA 4UFJA 1RQEA 1LRNA 3P61A 4LC6A 4ZQOA 1MEWA 3QFEA 4Y90A 5LZLA 5C55A 1PV8A 1W5PA 1ME7A 3W7PA 4R33A 3BV4A 4FIQA 5DY2A 4RZ6A 2TPSA 4AF0A 3SW6A 4MUZA 1I4NA 2V8ZA 3HGOA 2GQAA 1YXYA 4O15A 3SECA 3BO9A 1VS1A 4RV8A 2GQ8A 5LNWA 4Z0SA 1JULA 3LCLA 1GVRA 2VFIA 5DCEA 5DY3A 1HG3A 3S6DA 1TV8A 2BLEA 5K9DA 3B03A 5CPOA 4O17A 2C16A 3QMTA 5FF0A 1KM4A 5K9CA 1GQNA 2ZCGA 1MEHA 2ZZ6A 3C2EA 4JTSA 5C6MA 1BKSA 3LCHA 4XQ6A 1JUKA 2QKFA 2E6YA 2RDUA 3LGEA 3GAYA 4RJEA 3ABOA 2TMDA 1LOLA 4JGDA 4JXCA 4NJIA 2X1RA 1V7YA 3Q58A 2QDGA 3AJXA 2JK2A 1FBAA 4DBEA 2J27A 3QPZA 1I2NA 1YXCA 2ZA2A 3B05A 1R2SA 4TR9A 2CZEA 2GOUA 1JUBA 2X30A 4XWUA 1JCYA 1H60A 2H3BA 5D09A 3DFPA 3GXPA 2PRMA 4JX5A 4UR7A 4DEFA 4BFAA 1YTDA 4TMCA 1H7PA 4OWGA 4MVAA 4O19A 1J5TA 1SPQA 4TX9A 2NX3A 1AK5A 1OYBA 3V75A 4OU1A 4NU7A 3M5YA 3PF3A 3UYCA 1BWKA 5LGZA 2BZNA 1OFPA 2ZRZA 1FCUA 1JUEA 1X7FA 1OK6A 3DKLA 3IIXA 4O10A 5K2ZA 4C1KA 4MZ1A 3W1XA 4ADTA 2I1OA 2ISVA 3KAOA 4O4VA 1JCJA 4GUGA 3VI2A 3W83A 3UNDA 3TW7A 3IGSA 1VYRA 3TXVA 2Y61A 3L2IA 3TCEA 1OX4B 3KVKA 1F5ZA 4LVAA 1OF6A 1R2TA 3RF9A 1VZWA 2HMCA 3NAVA 3GDLA 2LLEA 3EWWA 3GNDA 3E96A 2V9DA 4QNEA 3YPIA 4UTUA 4WXZA 4LV4A 1H7WA 4GBUA 2NWRA 3IIVA 5EY5A 3W7GA 2JKPA 3WJSA 3WK1A 5CZSA 5F4SA 3RFAA 3NL2A 1R46A 3GX9A 4N9BA 3WK2A 1KBJA 3QJAA 4I7UA 4NJJA 1VC4A 5FEWA 3W74A 1JCXA 3W1NA 3ATYA 3W1LA 1SW7A 3GNNA 3HPZA 2YSWA 2NXHA 3W7CA 1A50A 1O4UA 3M0ZA 2BWGA 1FY6A 2RKXA 3M5VA 5H91A 1L6YA 4JR5A 3UQNA 4LVBA 4O54A 3NL6A 1L6WA 4HSOA 4RX0A 3W73A 4PA8A 5F2GA 2WNNA 4ONVA 3UWZA 1VLIA 3WFAA 2JKAA 3G3MA 1X8FA 1NEYA 1ICSA 4UTTC 3PUOA 2C0AA 2KZHA 3LV6A 4G1KA 3NM3A 1LYXA 2QJIA 4MYXA 1EWEA 4UMAA 3F03K 4M19A 1QO5A 3I6RA 4GUJA 1A5CA 3M43A 1S5VA 1SSDA 4H6KA 1TO3A 5HR7A 1JCLA 1KTBA 1U83A 4BK9A 5BOOA 4UCGA 2XN1A 1OK4A 2GJLA 3DFTA 1W8SA 1MSSA 3NPVA 1J4EA 3W2KA 4YMZA 1VRDA 5EBUA 1W1ZA 3OA3A 4FO4A 2YCEA 4KFNA 4UXDA 4BI5A 4AMAA 4O0ZA 1WAUA 4CNOA 1H1ZA 1XXXA 4Q4KA 3EX4A 4WZHA 2A6NA 1ONRA 3CEPA 1K8ZA 1XBZA 3B0VC 3UWWA 3N2XA 5LNVA 1KM1A 5K4ZA 3W7IA 4Y9AA 3QMRA 1ZAIA 1X6UA 2WV8A 3RNDA 3PC0A 2E6DA 2E5CA 3UWQA 4K8HA 3RMJA 4N6FA 4E2DA 3UZ5A 4WY0A 2Y85A 3ANYA 2VFDA 3JS3A 3BGGA 4M6VA 1R47A 3BK0A 3KVMA 1SZFA 4QM1A 1F74A 4RXFA 3W84A 1EP1A 3EWUA 2DZSA 5L6UA 4Z0JA 1X1OA 3BPWA 3FLUA 5D32A 1GYNA 3L0NA 3O06A 2GVLA 4JTTA 2V2DA 1PL9A 4M5PA 1OYCA 3CC1A 2PCQA 4D2JA 1UBSA 2FB3A 4U4MA 3OBKA 3EXRA 3C8FA 1JJKA 3TK7A 2ISWA 3NQCA 4QSHA 4Z1DA 3B8DA 3RLVA 4JDBA 1S3HA 3FS2A 4LVFA 4UTWA 3STCA 3NQAA 3W7OA 1L6SA 1SZNA 3NQ7A 4KWVA 3W07A 5D02A 3QRHA 3L66A 4KFOA 3VNDA 4IWWA 3O8AA 1S5WA 4XUGA 5EL1A 6TIMA 4AVFA 3DZ1A 3W23A 5DCBA 5DXYA 3QC3A 1WBJA 2AAMA 3DU0A 4AHOA 1EIXA 5C54A 2WSRA 5U7SA 4FX8A 3W6YA 5BMXA 2GQ9A 3IGUA 5A8GA 1KFEA 3EXTA 4UUIA 4X9SA 3NQFA 1I2RA 3TV8A 1N8FA 3F1QA 1KTNA 4FNRA 3BG3A 4S2BA 1O5XA 2DP3A 4BWLA 3C3NA 1GVSA 3MWAA 1OFQA 4K7YA 1H7XA 1M6JA 3SZ8A 3TW6A 2PC4A 3MYOA 3CIWA 1JQXA 2EHHA 4YCOA 1VHCA 3USBA 2FLIA 1MZHA 3T4CA 1NF7A 3P8IA 1WA3A 3GYEA 3NZ1A 5LNSA 1RQHA 3R5EA 4YCPA 4HNTA 3L67A 1VH7A 3NXFA 4AWUA 1P0KA 3NVTA 3LCGA 3W7MA 4FF7A 3PB0A 4HT3A 4N9EA 3SI9A 3LHTA 1K7XA 1GG0A 2A6LA 2NUYA 1C9DA 1ML1A 1SR9A 2QJGA 3GDRA 5G1TA 3O1NA 4DF2A 1QCWA 3FOKA 1WQ5A 2R91A 1VCGA 4FNTA 1OVDA 1VCVA 2A4AA 4O0KA 4UTKA 3GDTA 3R2GA 3V1PA 4IMCA 5E1QA 3L9CA 2FPTA 4O14A 1JRBA 7TIMA 5DN1A 3B4UA 3G1AA 4NT0A 5AOUA 5CSSA 3EEGA 3P5ZA 3HIJA 4JIQA 3S1VA 2Y70A 4RZ4A 2Y62A 1H1YA 3DH7A 2EGZA 2CLEA 1F2JA 3HPSA 2FQIA 3WJWA 4MFEA 4MKNA 1UASA 2VFHA 2DORA 4NNAA 5FF3A 3NQ2A 4MLRA 3QPYA 3NOEA 3QEZA 1P5BA 1TTIA 4IGHA 5I3IA 5LNUA 1H7RA 4MIMA 5DBTA 3DHDA 1T0OA 3C56A 1F6KA 1O95A 1DJNA 3LRKA 3VE9A 3UY7A 3C0JA 5G4WA 2Y88A 3QMSA 1Z44A 3B0PA 4LOCA 2CFFA 2QCHA 4UNKA 3MJYA 5KTLA 4RZ5A 5AC6A 3N14A 2E5DA 3CEUA 4AEOA 1YDNA 1OX4A 2ZZ5A 3NEVA 5D2VA 1K3UA 4I7VA 1RZMA 2V81A 1SSGA 3TKFA 4PC8A 3QF0A 4O16A 3PBUA 1W56A 4FX6M 3NQEA 3G8EA 4KKXA 3PBVA 3OHIA 4HNNA 4Q32A 1G67A 2I9EA 4GJ1A 4GUFA 4HSNA 3NYZA 4LRSA 1OFOA 5DXXA 5CSRA 1LCOA 3C2FA 4O1DA 5HULA 1HFBA 1UCWA 3MI3A 3CT7A 4EOUA 4OGZA 4JEQA 1YXDA 2RDTA 2BX7A 2Q8LA 3TA6A 1G69A 1RPXA 1B3OA 3G1HA 3S1UA 3W7EA 2B7QA 4DO6A 4JTJA 4EF9A 3HPXA 4IX0A 3U8GA 2VELA 3LXAA 4EVZA 4CQAA 3W9ZA 2XN0A 1ZCOA 2B7OA 4UTHA 1B4KA 2A85A 1QPQA 2OMAA 2H8XA 4LUJA 4ZVJA 1KLYA 1CX9A 3UZJA 5F2MA 2EAWA 5DBUA 4DF1A 2VXNA 2ZYFA 2QCDA 1N7KA 4QQ3A 5LNRA 4XZ9A 4IXHA 5KZDA 5IM51 4RXGA 1TCDA 2PRHA 3LCIA 3M7WA 2F7FA 3KVLA 5KMYA 2QCLA 5D2TA 4XTIA 3ZS4A 4RLIA 3W22A 1GOXA 3BARA 4UIOA 4JDYA 2NUXA 5FEZA 1TPC1 4OQVA 2CLOA 2VC6A 1LLWA 1FWWA 1XDMA 1A53A 3KRUA 4IPIA 4BF9A 4JTKA 3GDKA 2DZPA 2ZTJA 3G0SA 5I3GA 3W2NA 3QZEA 2WQPA 4LVDA 2QCMA 3TMQA 3C6CA 3HG2A 1VGAA 4BWLC 2C6QA 1TPB1 4UFKA 2A2IA 3Q2DA 4FNQA 2CWNA 2EF9A 3DAQA 4K39A 1K8YA 2G5WA 3DFSA 1YADA 2YFOA 1EP2A 3KOFA 1TJPA 5EA9A 2ATMA 3W7LA 3G1YA 4S2CA 1XUZA 1TB3A 3G1FA 3HGRA 4O1BA 4WY0B 5AHEA 1TREA 4IXXA 4JY8A 1XI3A 3TXZA 1UUMA 1YPFA 3IIZA 4XKYB 2CLMA 3O15A 5LGXA 1EUNA 4UR8A 1RV8A 3DFQA 2PRLA 4HHPA 5E0KA 1FDYA 4HIBA 3T44A 8TIMA 4WJEA 3TSDA 3LI1A 3GR8A 1VCFA 3LB0A 1EUAA 1ICQA 2FB2A 3A22A 3NL3A 4LS1A 5AYYA 3CU2A 4PFMA 3S5NA 3S0CA 3GKFA 3A21A 3N9RA 2CZ5A 3AO0A 2YR1A 3DGRA 2DZTA 3M5ZA 2H8ZA 4O53A 5A5WA 3LTPA 3EWZA 4JS3A 1LLZA 4W9TA 4AAJA 1W3IA 2QCGA 4PCFA 3HG3A 3ZFHA 4NX0A 3MI6A 1XCFA 4LUIA 2VEIA 2V5BA 4JIPA 4R7JA 4LVGA 3TMLA 2QCDB 5CKSA 1IF2A 5BW6A 4UFLA 3R12A 4CCDA 5I3JA 2UV8G 3W7RA 2QUUA 4K7VA 3TROA 4JD4A 4H4IA 2E5BA 3G0XA 3SGZA 1Z41A 5DELA 1TQXA 4FX7A 3G1XA 2ZRXA 2CZDA 3W70A 3S5YA 3O63A 1SZGA 4N4PA 5F2LA 3H53A 2QAPA 4B5NA 1VYPX 3G1DA 3MMTA 3L5MA 4ORMA 5IBXC 1GEQA 1OF8A 4LV9A 1DL3A 4QISA 4LS0A 3G24A 3TR2A 3LCXA 3I65A 3WK0A 1DORA 1IIGA 1RQBA 1KW1A 1LP6A 4M7TA 1I8JA 3DHFA 1DQWA 1TPVA 3PUDA 2VFEA 1Q45A 1EEPA 3E12A 2QAFA 3NQ8A 2C13A 2CLFA 1A5BA 3QM3A 2DU2A 4DF0A 2B4GA 5HWMA 3I7QA 2NX1A 1HUVA 2YFNA 1JQVA 5D2YA 2AGKA 4K8EA 3BG9A 1G7UA 1KTCA 3C2VA 4UMBA 1SQ7A 5FESA 4IQLA 3EX1A 3M5XA 1AL8A 2ZA1A 4PEKA 3L5LA 5HUPA 2Z2UA 2Y89A 5LHFA 2ZQ0A 4ZZ9A 4IMGA 4CCCA 1H61A 1ZAJA 3THAA 4N02A 1OG0A 2OCZA 2Y7FA 2ALDA 2FDSA 4PL1A 4O28A 1FCVA 5K9XA 1GZGA 1E51A 3SGUA 3NQ6A 4JTIA 5CZ0A 3JRKA 3FKKA 4A22A 3W3OA 4BI6A 4NVTA 3PG8A 3DKJA 3O6DA 4Z08A 5G1YA 2P0OA 1OHLA 3HQ1A 1OX6A 5CGQA 3INPA 4IJBA 4L4LA 1T96A 1Q6QA 4JYFA 4WOQA 1TV5A 1WDWA 4X2RA 3M44A 3MP4A 3C4UA 4MOZA 3ELFA 2J9XA 1OJXA 3F4NA 3BLIA 2H3DA 3HB9A 2X2GA 1KM0A 4E38A 2B7PA 4PL2A 3I7SA 2QEZA 1FWRA 4RKAA 1FWTA 2Q3RA 2XN2A 3W2JA 4RK8A 3IRDA 5AC8A 2JGYA 3P84A 1O5KA 1MEIA 1YPIA 3TQVA 1U5JA 1TPUA 1HL2A 3EX3A 3C2OA 3DBPA 4FXRA 4O1AA 3N2MA 4L4MA 4Y96A 2ZZ7A 3E0IA 5U4NA 3HJZA 4CNPA 3MO7A 3LV5A 4LC8A 1XDLA 4AHQA 5CZJA 4ZL1A 1SU5A 1Z42A 2XFWA 2ZTKA 4IMFA 2OT1A 2WKJA 4A2RA 1A5AA 3UPBA 4EWND 3CQ0A 4ZQNA 4HPJA 4MFDA 3EX6A 2E6AA 1EWDA 4N2YA 2F84A 3OVRA 3LI0A 2ABBA 3ABSA 4IMEA 1LRQA 3L5AA 4JYDA 1K02A 1VYSX 3TNOA 2J24A 3KFTA 1AL7A 3P80A 4XKYA 1NSJA 4ADSA 4O12A 4OT7A 2ABAA 1KFBA 4WUIA 1G4PA 3A5VA 3LLFA 1FDJA 1SO4A 3NQVA 2OJPA 2TYSA 1G6CA 1WYIA 1TJRA 3S42A 4K36A 3GKAA 4I7WA 5T26A 3M16A 1WX0A 4NJGA 2WSYA 3GXNA 2Y7EA 5FF2A 1W37A 1UJPA 1GPWA 5HUOA 1O60A 1AW5A 3HF3A 4C1LA 4DXVA 2J88A 2Z1BA 3W71A 4FNPA 1XM3A 4GUIA 1ALDA 3KVJA 3N34A 3UXAA 3EWBX 3GIYA 4IMDA 3IVUA 3TFXA 4M6PA 5D04C 1K03A 1FUYA 1W5NA 4TU1A 3W1TA 2VOMA 3LHYA 2V5LA 4HNUA 2A7RA 4NNBA 1KM3A 1SO5A 1JCNA 1H7OA 3QH2A 1PS9A 4JX4A 5DCDA 2ZA3A 3M41A 3HG5A 3PVFA 5KSWA 4JYEA 5FEXA 3NNTA 4WOZA 3LHZA 3GVGA 3EKLA 5KZMA 1H63A 3FA5A 1LBMA 3R13A 4ZQCA 1I45A 2D73A 4LY8A 3TAKA 3M6YA 4GE8A 1IXQA 2R14A 4A2SA 4NNCA 1OFEA 2ZZ1A 3G18A 2C14A 1IXOA 1FCQA 4UTLA 4BI7A 1OX5A 2B0MA 3HG4A 1Q6OA 3W2UA 2ZRVA 3S1XA 3P74A 1TRDA 1GT8A 2C3ZA 1VHNA 2JBMA 2X16A 5AHFA 3G8RA 2CZFA 3LCFA 3OG3A 4U28A 4IOTA 4UFIA 3PULA 2VENA 1PHWA 3FYOA 4UTMA 2PURA 4UC5A 3QSRA 4WQ6A 1THFD 2GJNA 2Y7DA 1L2UA 5BMWA 4X3ZA 2HSAA 4LT9A 2WO5A 3MW7A 4ALDA 1TPFA 3L21A 3M1ZA 1HO4A 1SZEA 1QMLA 3FJLA 3O07A 2W0UA 3CIXA 3CWNA 4GRSA 2A7NA 5G2WA 1KLZA 6ALDA 1VLWA 3HO8A 4RCXA 3NM1A 4ML9A 4UFMA 4K37A 2J9YA 2QCEA 3WJZA 3TFCA 3CTLA 3EWYA 4O18A 4OE7A 3W1QA 3N19B 3TE9A 3TX9A 2GPTA 1PCKA 3U6WA 4GC4A 1DV7A 3I68A 3CB8A 1R2RA 3W2MA 5J5DA 3W7HA 3IGXA 2FIQA 2FTPA 3OIXA 4GFSA 3UD6A 3TIMA 2AQWA 5AHIA 3W7NA 1K8XA 2NV1A 2G97A 1H51A 1GVFA 5G4EA 1WOBA 4A29A 1GJPA 3MP5A 3P81A 1AW2A 5AN7A 1OFBA 2VFGA 2YDAA 4GUHA 2ISSA 2VFFA 3TQKA 4WD0A 4OV9A 4JICA 1YDOA 1IIHA 1TPWA 3SJ3A 4MJMA 2DZWA 3NQDA 2VKZG 3GK0A 4TIMA 3EB2A 4NJHA 2C1HA 5LSMA 3PM6A 3PB2A 2EKCA 2E09A 4CLMA 3W7JA 3LHWA 5G2HA
chains in the Genus database with same CATH superfamily
4Z2IA 1X7IA 3W1UA 2P10A 1SFJA 1I2QA 4L6OA 3W38A 1A5OC 2BSLA 3OOQA 2NUWA 3W85A 5CG7A 3G2GA 5A2BA 3P82A 1MDRA 1UD8A 4MM1A 2HNHA 5AHLA 3N13A 3AYRA 3W1RA 2VR2A 2VYOA 4MB4A 6XIAA 2A3EA 4Q4PA 1Z6KA 4DX3A 3DXIA 3V35A 1XKYA 4GI4A 3APTA 1B3VA 2ZVRA 2AMXA 4KT2A 3A23A 4P7NA 4DQWA 2UY5A 1U1HA 1ZQ5A 5I24A 3W1MA 3FCPA 2E6FA 3ABRA 3WZ0E 3LD5A 2TRSA 1ODZA 4PUEA 4OOZA 1ISZA 2ZBTA 4WXYA 3ZJKA 2YLAA 3RAOA 5E9XA 1WKDA 3PZOA 2J75A 1FWSA 3WH8A 3KBJA 3G5EA 2E9MA 4GYPA 3ECQA 3B8UA 3R4IA 3SCRA 3A3WA 4C6OA 1QOQA 4EXAA 5D2WA 2XVLA 1ITUA 1CLXA 2NQZA 3SR7A 5C9RA 1KBIA 2YW4A 4WDUA 2O4QA 2O7SA 1AJZA 3MI2A 1Q6FA 3UCQA 2XFFA 2RHGA 2Y0FA 3B06A 3P0XA 3BW3A 2J7EA 4AVOA 5IBXA 2DZXA 1PVNA 2BY1A 2WQDA 1I2PA 3ZLHA 2QDDA 3TJLA 4RPPA 2BASA 2NLIA 1GJWA 3LPOA 3BURA 5FD0A 1LQ0A 3VM7A 4H7ZA 2CKSA 1TPEA 3S9YA 1RVGA 1CTNA 3QW3A 4JN7A 3POCA 4DWSB 3KW3A 1UP3A 4KWWA 4ACZB 1WXJA 1EGMA 1VD6A 1LL7A 4X22A 3ARXA 1I2OA 2I5GA 1AA1B 1W54A 2FMOA 1KBKA 3CZKA 3K30A 3RIKA 8CGTA 2YX0A 4M24A 3SJNA 3L4YA 2DSZA 1UPMB 2XJ7A 2Z6JA 4JFWA 5JUVA 2AAAA 3LLXA 4QS5A 4MJZA 3CMJA 2QF7A 3GBEA 4HJFA 3P60A 3PJXA 1PX3A 1GVEA 2GDVA 1NWTA 4HJWA 2CXGA 4DO5A 1MXSA 3JW7A 4LS2A 5DX7A 4DPPA 4XBKA 1R3RA 1PAMA 3LCWA 2OG9A 3QN3A 4C60A 4FZIA 4RDVA 3BLDA 3LQGA 4N6EA 1FDZA 2GUUA 3LRLA 1CDGA 3B0UX 5HINA 3S2CA 3B0YA 4K1GA 1ECEA 4J4KA 3BE7A 2QR6A 4PTVA 2R8WA 4CCEA 4HA3A 2H90A 4ZCWA 3PZMA 3PSVA 1F7BA 3SB0A 5C5YA 1TTQA 4CQ8A 2ZZ3A 4WGHA 4FAMA 1VPQA 3MSDA 4HMDA 1KM5A 2G4JA 3M0VA 2AKZA 1E5NA 4GYKA 3QV6A 1RR2A 4QITA 3UJ2A 2CLKA 3B8VA 4O4WA 2W92A 3W2LA 2OQHA 1DXIA 1TV7A 3GTIA 2V5DA 3FAXA 1Q5MA 2PLMA 2Z2AA 3IUHA 4W7UA 4F0LA 5C2XA 4ASTA 5BU6A 3O16A 3P7YA 2VMFA 2NQLA 3ZR5A 1HO1A 4RPQA 3SGGA 1B3ZA 4TO8A 4FEZA 4IIFA 1YTKA 3LBCA 3E5BA 4UFHA 3TJIA 4LTSA 1U5HA 1DWFM 2BGQA 4MWAA 1PPIA 4IGMA 5H8UA 1ZALA 1IHIA 3AAMA 4POCA 1LBFA 2VX5A 3I3EA 3MBFA 7PTDA 3U3HA 4HPXA 1ELSA 5AYIA 3E9AA 3WMLA 4FNUA 2ESCA 1DJGA 1DIKA 2DSVA 3LTSA 4M3PA 2FHFA 3IVSA 3IJDA 3TU9A 4P8XA 2EKGA 4LW7A 3TYCA 1FX6A 4TTUA 1UOKA 4IPJA 3TSBA 1XQKA 3ZR4A 2PA6A 4Y8FA 1MQRA 2ZFAA 3ZMRA 2QDHA 1XLBA 3STEA 4PUDA 1K7EA 3USZA 1RCQA 1XLDA 3RPDA 2PWFA 4MTVA 1BEUA 3GC5A 1GVOA 1YNQA 5FJJA 1LT7A 4LRTA 2VZUA 1YHTA 1NWUA 3HBLA 3UG5A 1ZJIA 1KFCA 4QG8A 2R94A 4YWIA 2Y2WA 3N04A 3L2LA 2DZVA 4EIVA 1MNSA 5C0QA 3M0XA 2WKGA 1R0MA 4L9XA 2JIEA 1XLEA 1Z48A 3T05A 2VC9A 5FF4A 1EDTA 1RY8A 1XUUA 5TBOA 2P0IA 2PGRA 2YKKA 4KFPA 4LAKA 5DANA 4Q7BA 1Q6GA 3TQ0A 1AJ2A 3E0FA 4Z1AA 2NQ5A 5HWJA 3QLLA 5DT5A 3EB4A 3HMCA 1MYRA 1W3TA 1P43A 3E02A 1DKWA 1E0UA 2CLLA 4XAFA 3VZYA 3NPUA 4QBXA 2ZC8A 4AZ5A 4GQ0A 3N29A 1AW1A 1Q65A 1KRCC 5MF5A 2DJXA 5HANA 2YGYA 5FSEC 1IGSA 1XS2A 3ZJ7A 2IW0A 4WDXA 4GHRA 4JNYA 4Z2JA 2RDWA 3MV01 3CPUA 1U22A 3KRZA 3F4VA 3H2CA 3BLLA 2FMNA 2VL4A 4JTEA 4KEVA 3IARA 4PCPA 2XVNA 4XBSA 3QKZA 1UZHA 4AIUA 1KRBC 1A47A 1UA7A 1NP0A 1TFVA 2VDIA 3ITTA 1F73A 4D72A 2VRQA 4C6BA 2X0HA 3SSJA 3VABA 1W6TA 3TLLA 1OADA 1E70M 4Y9PA 5EMUA 1KGUA 3VFLA 2QVHA 2PGWA 2D2HA 3SY5A 2VCCA 3FX4A 3GC4A 1HN1A 3A4JA 3F2DA 3TP4A 5I78A 1OABA 4Q33A 4S3EA 4D8ZA 4GABA 3CQHA 4UTIA 2EBNA 1SYTA 3BJFA 4IPPA 4QNWA 4NI8A 2G96A 3VFCA 2ALRA 2ZWZA 2PE4A 5HMEA 2NV2A 4B2DD 2EPNA 2FH8A 3SIZA 1D7FA 1WDSA 3BLOA 3MBDA 5I6SA 3D0CA 2P1FA 1F05A 1KA9F 1KFLA 3QV8A 5D2XA 4G7FA 1RP8A 1ZBKA 4X2PA 3A12A 4IQDA 2DY3A 1E72M 1ZAHA 4A3QA 2Q09A 1RHCA 3L7RA 4HZ8A 3WLQA 3SM0A 3M7SA 2WBKA 3E6EA 3L65A 1H7NA 1UB3A 4MDPA 4CD4A 3EXSA 3OGRA 3BLFA 3MUIA 3UR8A 4P61A 2PDCA 1WBHA 5ENLA 3V5CA 2MUCA 3CASA 3QSTA 3E49A 3TR9A 5GVJA 4HNLA 2ZRWA 2DUXA 1UBPC 4XSMA 3LSCA 4DJFC 3A64A 1W5QA 1BRLA 1XIMA 3FIGA 3VNIA 2JEQA 1XRFA 7A3HA 3IVTA 3T0DA 3WBYA 2OT0A 1XYAA 3H2FA 3TAOA 4NXKA 3DN5A 1E1CB 4FMVA 3QHOA 3M6DA 4K1WA 4KIEA 1PHQA 5CG0A 1SR0A 2PDNA 1POKA 5T9BG 3U2OA 3F2BA 1NDWA 5AFDA 3NVDA 3CGTA 2Q02A 3KCLA 4HU3A 4LWWA 3B4YA 2WANA 4OUIA 3WD1A 5D8ZA 3CHCA 4L1XA 1QBAA 1F76A 3GG8A 3QHNA 4Z2LA 4MDOA 1JZ6A 1CI1A 3OQEA 2OWCA 5FJOA 4PBEA 4IPLA 4S3DA 2BTMA 1TQJA 1ZRQA 1OFAA 4F66A 1JD9A 5AHNA 4EF8A 1BYBA 2FZ8A 3LX9A 1J11A 5HNUA 4DZHA 4XAPA 4MLJA 1JI2A 2PLKA 3LBMA 4RNJA 4NZ4A 4GZ7A 2R1MA 3O6AA 3AUOA 2AKMA 4J9JA 3NIYA 1A5LC 2ZADA 2VQTA 3CZGA 1CGWA 1RQEA 3ITXA 1LRNA 1HQTA 1DEDA 4LC6A 4Y90A 4S3FA 1ME7A 1OD0A 4GA8A 3E2RA 4RZ6A 1K9EA 4B4FA 4QJ4B 2PDQA 5DO8A 3CT2A 4MUZA 1I4NA 1R3WA 2V8ZA 2GQAA 1YXYA 4O15A 2QYGA 4TXEA 1O12A 2VUNA 2IPJA 3LEPA 1JULA 4Z0SA 3AMCA 2ODOA 4E4FA 1TV8A 4QLLA 2BLEA 1TE6A 5K9DA 3DG7A 1GOKA 3C8NA 3QMTA 4QGCA 1OZMA 2ZZ6A 2ZCGA 1FHLA 3LCHA 1GKPA 3W28A 3AISA 2PWGA 2RDUA 3LGEA 3WH7A 4CN1A 2O9PA 4PRWA 4XZLX 3M0IA 3M0HA 4CEXC 3AS2A 4DBEA 3QPZA 1AUSL 1J0KA 1R2SA 5FJTA 2CZEA 3K2GA 1W1VA 1JUBA 1HJVA 4UQBA 1I1WA 1H60A 2H3BA 1S2WA 3GXPA 2PRMA 1YTDA 4C5YA 1H7PA 2NT0A 2PGFA 2QW5A 4MVAA 1SPQA 2NX3A 1OYBA 3PTQA 3T0BA 1VBGA 3A4AA 3PF3A 3ZLFA 3TYUA 1DE6A 4W87A 2W5FA 1OFPA 1X7FA 4KETA 1R8LA 4HOXA 5CLWA 1E1CA 1F8IA 1BYCA 3IIXA 2E4TA 4H6QA 2VEFA 2IUZA 3WF4A 2VJXA 3KAOA 1W1TA 2WVVA 3UNDA 4AZBA 3N4EA 3P93A 4RDZA 1YEYA 3TCEA 5DF0A 4LVAA 3RF9A 1VZWA 5I03A 4LJ3A 3ANVA 4L9YA 1E1EA 3W02A 4UTUA 1X8CA 3IJ9A 4LV4A 1H7WA 2VDHA 2ZX6A 4J3WA 3WL1A 3REQA 4LB3A 3WK2A 3ZYZA 4XZWA 4I7UA 1VC4A 3SO7A 3XIMA 2ZVIA 3W1NA 1N82A 3WF3A 2WW5A 2V5JA 4EK7A 2YSWA 3KDNA 3W7CA 1O4UA 2ZICA 4FLOA 3GVQA 3SUTA 2BWGA 4JCMA 2QIIA 1TA3A 1ZTVA 1KCXA 4M82A 4JR5A 4P7OA 1FFRA 3ZT6A 5M3WA 1L6WA 4HSOA 4PA8A 4JTAA 2GK1A 4ONVA 3UWZA 3KS6A 4YTUA 3IJ6A 1WKEA 2C0AA 3LV6A 4G1KA 1J5SA 5IFPA 4E6MA 2PD5A 3F03K 3UT0A 2YB1A 4GUJA 4QROA 3NFUA 4H83A 1RUSA 1HL9A 3ZVHA 2W66A 3EB3A 2G4FA 3VMOA 2XPKA 5HPOA 1ITXA 3BV7A 1CLVA 5EBUA 4DYKA 4S39A 1V77A 4KFNA 1R3QA 1EO7A 1WAUA 3DHPA 4Q4KA 4WZHA 1IR1A 1ONRA 1K8ZA 3B0VC 3N2XA 1JF5A 4RW3A 3BGAA 1E6SM 1QI2A 2YA0A 2CEQA 4Y9AA 3QMRA 4I5UA 3GSMA 2WV8A 1JDFA 4B5VA 3PC0A 3SCVA 1DXFA 3RMJA 2ACRA 4E8CA 2CWXA 4MHBA 2VFDA 3JS3A 3BK0A 3BAJA 3KVMA 1BVNP 1FWFC 3W84A 1GOOA 2DZSA 2DW6A 3DBNA 3FLUA 3L0NA 3MZNA 1UMLA 4KGLA 4JTTA 2V2DA 1PL9A 3ID7A 3CC1A 1HKVA 3GTNA 4QSHA 1JPDX 4LVFA 3MSYA 1EHNA 1TV2A 4MPKA 1CGYA 1L6SA 4GIAA 3QR3A 5C7HA 3L66A 4KFOA 3D46A 4YHEA 1A0CA 5I3DA 4W8BA 4TVUA 4XUGA 4AVFA 5JIPA 1PDZA 1WBJA 4AUBA 1WDPA 4W89A 1RD6A 5U7SA 3OTRA 5LIXX 4X9SA 3NQFA 4QEHA 3TV8A 3AHYA 1Q2RA 1O5XA 4M8UA 1XCWA 2P76A 4BWLA 3OBAA 3S2LA 4ZA0A 3RM8A 2C0HA 2IPWA 2Q01A 4TUFA 4S3BA 4TOQA 2DW7A 1WA3A 5D9MA 1HP4A 4GINA 1VPYA 2YIHA 1ZGDA 1X96A 3NVTA 2XUCA 3LCGA 4KBXA 1IGWA 3VDAA 3LENA 6REQB 3SI9A 4IICA 1MFVA 4HPGA 3AIEA 1VAHA 4G8TA 1S3TC 2NW0A 3AXMA 1ML1A 3GDRA 2DH2A 4X63A 3OP2A 1ZP4A 1VCGA 1F3XA 4YHGA 4FPSA 3V1PA 4IMCA 2FPTA 7TIMA 4F2BA 1OC5A 2XH7A 1A4LA 3VGGA 3HIJA 2GGIA 1X6LA 2Y62A 1H1YA 3DH7A 3D5HA 2NQHA 5J04A 2EGZA 1FKXA 2FQIA 3B40A 3WJWA 1W32A 4WKFA 2DIJA 4PSRA 2VFHA 2BS9A 4ZOCA 5FF3A 4MLRA 1L2QA 5M03A 3NOEA 3QEZA 4JQAA 4C6CA 3KTSA 1H7RA 1UH3A 3C56A 1F6KA 1O95A 1DJNA 3UGVA 3VE9A 3UY7A 1Z44A 4R7OA 4L6HA 4AD1A 4RZ5A 1HVXA 3TONA 4MMWA 5FJUA 3RCMA 4AY8A 3CEUA 4AEOA 4NRSA 3IAQA 5IRPA 1ITCA 1F3EA 3NEVA 4D71A 3WLTA 1B3YA 1T8QA 1SSGA 1EJUC 4PC8A 1W9DM 3PBUA 4PBFA 4B3ZA 1T7LA 1I60A 5ABEA 2PDKA 4Q32A 1V93A 1P6CA 1ZU8A 3MPGA 1UZ1A 1QJWA 4LRSA 5CSRA 4B2DA 2GYIA 2PDJA 2ZX5A 3TN4A 3CT7A 2ZUWA 4OGZA 4JZ5A 2RDTA 4OFCA 2Q8LA 1FHUA 1G69A 1OZQA 3G1HA 4EE9A 3W7EA 4DO6A 3RYSA 1A5KC 4EF9A 3UW6A 5DMLA 3BCJA 3OB8A 4IX0A 3U8GA 4FLQA 3PP7A 2J77A 5CH9A 2A85A 5A8MA 4ZVJA 1KLYA 4BA0A 5A6BD 2WHLA 4UR9A 3BAXA 1H1NA 2VP8A 4QQ3A 1MFUA 1QI0A 1TELA 5EBAA 4LAZA 4IXHA 5MKGA 2Z1VA 5KZDA 5IM51 1IV8A 4Q8NA 3M7WA 4MAZA 5KMYA 1QNSA 2QCLA 1IEQA 2CHOA 2A79A 4E8GA 3AU6A 1UZ4A 3L2MA 1POJA 4RLIA 3VIFA 4JDYA 1TPC1 1JPMA 4OQVA 1CCWB 3KRUA 1NFPA 2OKOA 4JTKA 5A6LA 2ZTJA 3G0SA 3EMQA 3W2NA 3QZEA 1GOWA 1S5MA 4HYRA 4RV3A 3TMQA 1BGAA 4GNVA 3PHAA 2C6QA 3R7MA 3A47A 3WQVA 1H09A 4FNQA 2G5WA 3DFSA 2YFOA 4KERA 3VMNA 3W7LA 1E1FA 1OWQA 3A13A 1TREA 4IXXA 4QCFA 5JBEA 1YPFA 2GWNA 1W1PA 3ZLGA 2ZE3A 5I00A 1Z89A 3IV8A 3DFQA 2XGBA 4V1XA 5A3HA 1FDYA 3C3UA 4HIBA 8TIMA 4WJEA 5C2CA 3LI1A 4N7QA 3QKEA 1NDYA 3WLIA 3RJXA 3MCNA 1UD5A 5E5CA 2OGYA 3CU2A 3EAUA 4M51A 3S5NA 3S0CA 4IIBA 1UYQA 4Y9OA 1W1B1 1ZL1A 3URQA 1UIOA 2DZTA 2H8ZA 3VO0A 3EWZA 3AALA 3U7VA 1LLZA 3CYVA 4XO6A 1E0TA 3O7UA 2PZ0A 1W3IA 1LWJA 1NFGA 2QCGA 3QBUA 4GXPA 4EACA 2XG9A 4PCFA 3MC5A 1XCFA 3N18A 4R7JA 3AIVA 3U0HA 1HF6A 4KCTA 2VVSA 4CCDA 2QHAA 3JU2A 3WD2A 1YDYA 5I3JA 5HNNA 3KCJA 1QBBA 4HA4A 2PPGA 3G0XA 2QGHA 1TQXA 1HT6A 2PEVA 3LYEA 4FOUA 2VNCA 4CQCA 2DH3A 3KL5A 1MZRA 3PZVA 4N4PA 3H53A 2Z26A 2W3ZA 4B5NA 1WE5A 3MMTA 1R3YA 3KDOA 5IXEA 4L4OA 1OCBA 4ORMA 1B31A 1F3WA 2WYSA 4GX9A 3REQB 1KKOA 4LS0A 3G24A 5M5DA 4OIFA 3ITOA 1OBAA 3I65A 3LCXA 1DORA 1DIDA 2PWDA 4M7TA 1RJQA 2V69A 2VR4A 2VFEA 5B80A 1Q45A 1RA0A 1I0BA 1YQ2A 3EA1A 1EYWA 2CPUA 1D8WA 3H2AA 2B4GA 5HWMA 4GYPC 5JMUA 3KTCA 5D2YA 4EPDC 3UR7A 1TMLA 3BG9A 3GFYA 1G7UA 2KAUC 4D1IA 4UMBA 4K8GA 1UC5A 3FVDA 4IFOA 4C7DA 2Y89A 4DBSA 3FJ4A 2CCRA 2BY0A 3LS9A 4KCVA 3NZPA 2OELA 5CC6A 1TV3A 3R0KA 2Y7FA 4TVDA 4J35A 2FDSA 2OYMA 4JIRA 4LFYA 4PL1A 2FHBA 4LYRA 5A6SA 4ML4A 4M80A 4CU7A 1BVZA 4D6EA 4NZ5A 2OPJA 4JAWA 3HV9A 1T41A 1VENA 1GKRA 4A22A 3W3OA 4NVTA 3OPSA 4NAEB 3WUEA 3LNPA 2VD9A 3INPA 3UG8A 3VKDA 2BVDA 2WLYA 2PZNA 1TWSA 3E0VA 4WOQA 3ARTA 1WDWA 2FJUB 3EPNA 4X2RA 3M44A 4CU6A 4PR4A 3BLIA 1KM0A 4Q22A 1FRBA 3WQFA 1GW1A 3OHMB 1FWTA 1UH2A 1C3FA 3M0YA 3IRDA 3MUY1 5AC8A 3T09A 3PBMA 1MEIA 4X60A 1ITQA 1HL2A 1W9VA 3C2OA 3DBPA 3H7VA 5GNYA 2A3HA 1OC6A 4CNPA 1UKOA 2YBUA 4LC8A 1XDLA 3BZGA 5CZJA 4ZL1A 5DMYA 4XG1A 4A2RA 3S5SA 3AOFA 1I0DA 1P6WA 2WMIB 4MFDA 4WDWA 3EX6A 3ABXA 1EIBA 2R1KA 2BY2A 4HVXA 1B9ZA 3LI0A 4IMEA 1MXGA 1Z8AA 2F2HA 4F9DA 1K02A 4NYUA 1AL7A 2DVUA 3DCPA 3GG0A 4CQDA 2ABAA 3D6NA 3BAKA 1G4PA 3A5VA 2CC0A 4LY4A 4CNUA 2HRWA 4H8VA 1EXBA 1DIEA 1SM9A 5CAHA 4CEUC 1F07A 4NJGA 1QRQA 4ZB0A 2W9MA 5TAOA 3GFXA 1XIJA 1K70A 3HF3A 1QK2A 4C1LA 3A6OA 4DXVA 2J88A 4MG4A 3W71A 4GUIA 2GUBA 3OU8A 1G1YA 1E4NA 4JNZA 4KGJA 3ZJ8A 1FUYA 4H9TA 1OSEA 4HBKA 4ICCX 3W1TA 3CHDA 4NNBA 1KM3A 4IG2A 1JCNA 1H7OA 2GK1B 1PS9A 4JX4A 1W3JA 3HG5A 3PVFA 5KSWA 1J10A 1CGUA 3IK2A 3TLQA 3E2SA 1JDDA 2OLHA 5KZMA 3FA5A 3K4DA 1W9UA 2YCIX 4LY8A 3TAKA 3AWOA 4TV6A 1H41A 4NNCA 1OFEA 3R8GA 5TF0A 2JALA 3NZGA 1NIUA 1OX5A 2B0MA 3T8LA 2Y8VA 3TYDA 3S1XA 1KXHA 3AIBA 5AHFA 1TRDA 4FSAA 1VHNA 2JBMA 1OT2A 2Y5EA 3SY8A 4YVXA 3EPOA 4IOTA 4O1FA 2VENA 2WJEA 2WCSA 3FYOA 4UTMA 3GW0A 4B3KA 4DUWA 1CECA 4X3ZA 5JH1A 1TPFA 2PDLA 1DWJM 3O07A 3N2OA 2VQUA 4H8NA 1QU4A 1YKWA 4PMXA 2YOCA 3PZNA 1OCNA 1K77A 4UFMA 3NM1A 3AYTA 1FH9A 5A6AA 2J9YA 2QCEA 3WJZA 3TFCA 2C71A 5A8QA 4O18A 4TQTA 3Q45A 5BXTA 4MNMA 1E73M 3TE9A 4WIWA 3TX9A 2GPTA 3U6WA 3CB8A 3AMDA 3DC0A 3W7HA 2FIQA 3NCOA 3UD6A 4BF7A 4HU8A 5AHIA 2G97A 1KB3A 1GJPA 2XYLA 3MP5A 3P81A 3TVAA 1AW2A 4PZVA 2VFGA 1CGTA 3TQKA 3VKKA 4JICA 4MJMA 2JIWA 2WVUA 2DZWA 3V1HA 2VKZG 1DJWA 3OW1A 2PP0A 4TIMA 1O5QA 3PB2A 2EKCA 3R6IA 4B16A 1BYDA 1XCXA 3PK7A 2HWGA 2D23A 1E9LA 4EXQA 2E3ZA 1PKYA 3OODA 4UB9A 4FIRA 3W1AA 3OVPA 4EXBA 2Q8XA 4ZTXA 3CZLA 2I16A 3ZR6A 2NWSA 1A3WA 2HTMA 1VBJA 3PAOA 4DUXA 4QIUA 4P7QA 3VVGA 5K4XA 3VIHA 3PS7A 4H41A 3RJYA 3T4WA 4UQEA 4MNLA 3L4WA 2WB5A 5I23A 3O05A 1M04A 2FKPA 2W4XA 3MWCA 4OJYA 1VKFA 4E4PA 2WZHA 4WLCA 1LUCB 2GSJA 1DP0A 3A5FA 1OM0A 4DJDC 3WJYA 3KE0A 1QI5A 3F4WA 3UPWA 1RK6A 4GWEA 1DQXA 3VCNA 3N9SA 3P8JA 3PG9A 1KCLA 2E40A 2WXDM 3VC6A 1W0MA 1BGGA 1CB7B 3QR1A 4QJ1A 4XSLA 1ADSA 3Q37A 4ATWA 1TMHA 2WWDA 1Z7AA 2IKJA 2DVXA 1TJ0A 2HCVA 2FTYA 2HROA 4QSFA 5I7GA 1G4SA 3QV7A 1P7TB 5HR6A 3DFOA 1K9TA 2FGBA 3S9IA 1KFJA 1DJYA 2CETA 3XINA 3AIUA 2TSYA 2ATSA 2R82A 5BNKA 4LNYA 1QASA 2XM1A 4UNLA 1JZ8A 5AKQA 5CJ5A 5GJMA 3G1VA 2HVMA 3EWDA 1P0DA 1J0ZA 5LA2A 3ZSTA 1XYBA 1E9ZB 3CHVA 4DLFA 3P6LA 1CNVA 1XBXA 2X05A 1OGSA 4UBPC 5REQB 1JPIA 2YL5A 1V5XA 3WQGA 3NPWA 4WSHA 2HK1A 2VGFA 4GY0A 1ZNNA 3ZJ6A 5HQLA 3W24A 5C9UA 3PWGA 4A8IA 2G95A 1YTEA 3ERPA 5D03A 1BWLA 1TTPA 4G9PA 1GWJA 3H7RA 5AVHA 1J0JA 4XB3A 2VZTA 1YYAA 2HS6A 1S38A 1KCZA 3DDMA 1UROA 4L9ZA 3RO8A 1RLDA 1EA0A 2E8ZA 3GH5A 4YYFA 5F4WA 4S23A 2QQ6A 2Z0IA 1DVJA 3MDUA 3ZWTA 1Q6RA 4K38A 1B3WA 1JCMP 2YBTA 3IEBA 1BAGA 4GYFA 2FPYA 2V82A 1Q4WA 1CENA 3SCTA 1MMFA 5HWNA 2ZX9A 1NELA 3QV9A 2PC8A 3PJUA 2DPEA 4C6LA 5MHBA 4TMBA 4I5RA 3U2EA 4HNCA 3WLOA 3BDKA 3ONBA 1LRTA 4PTWA 4ZOBA 1ICPA 1AMKA 2I56A 2POTA 1R30A 4IUOA 4FNSA 1GK8A 3DI1A 3LNMA 4HPHA 4JTHA 1EOKA 3W86A 4L80A 5A6JA 1FQ0A 3ZSSA 1G7VA 4GVIA 3UNTA 3QQWA 5CPTA 2OZTA 5FIPA 2Z27A 1H4PA 4CCZA 3ONCA 5ABTA 4XKMA 4MB1A 1QVBA 4I6VA 3V7PA 1WB0A 3GDMA 4TV5A 3FNDA 4NRRA 4XD3A 1G9HA 2P3EA 3LGDA 3U2CA 2R1PA 4NX5A 4A4AA 2WWCA 2IQDA 2DQWA 1JAKA 3Q94A 3WBWA 3O0KA 5CJMA 5HQEA 4OZOA 3VZXA 2EEXA 4KF1A 2A5HA 3WQOA 1IQ8A 5IDIA 4M1RA 3H4WA 4K68A 2YCLA 3W76A 1PIFA 3LOTA 1N55A 4E2VA 2G3NA 1BD0A 1VB9A 4DELA 3LPPA 4PMZA 3NURA 4FHAA 1XLAA 2J7CA 1TR9A 2B7NA 1MNZA 3MHFA 3H26A 2OLSA 3PAJA 1XSIA 5F1UA 1I75A 3G3DA 1QHZA 3QQ1A 3S83A 3WNOA 3W1PA 4HCHA 4IJCA 4GY1A 4LYKA 4EPBC 1XPYA 3W75A 4XK2A 4EAYA 3T40A 1E6PA 3W88A 4QXIA 2BHZA 2EPHA 4QFUA 5LKYA 3LERA 2WPBA 4Z1CA 4DNHA 4GG9A 1ECQA 1VR6A 3CQKA 4JL2A 4P8VA 4AC7C 1OEPA 3NQMA 2V68A 2PODA 1BG4A 2ZRYA 1CYGA 3ICJA 3KOZA 4J3VA 2HISA 2ZX7A 3CM4A 1PKLA 5CSYA 1CGXA 3VA8A 4UMCA 2Q8ZA 3UVIA 4ZXLA 1V0NA 4PB4A 2WM0A 4HMEA 3D3FA 1XL9A 4Q4MA 3ZQ9A 4W4QA 3F4DA 1KFKA 2O92A 1QOPA 2DUZA 2VM8A 4Y2WA 4DUOA 3ITYA 2PDXA 3LQLA 4DWSC 2DFAA 4WJ8A 3VMPA 2CLIA 3AU2A 4FXSA 3UBPC 4FR6A 1J79A 1J8VA 1HXJA 2VEKA 3Q65A 1SW3A 1Q3NA 3N1AA 3P5YA 2OKTA 2IKGA 1E5JA 2W79A 1YLVA 1SO6A 1XH1A 4WSKA 3GLCA 2E77A 1KV8A 2X1IA 3BW2A 4YN5A 1TR1A 3F5LA 3IUDA 3IIPA 1C8VA 4NF7A 5C2GA 1DJQA 2UY4A 1LBLA 5BWFA 4JKKA 3HJEA 1GVQA 1NARA 4HN4A 3BMVA 1YBQB 1A0EA 5FJRA 3KX6A 3B8WA 1W5MA 2DEPA 3RO6A 3NZQA 4J28A 3T2OA 1B5TA 1BFNA 3M9YA 1Q6LA 4K6AA 2WJDA 2WZIA 3NA8A 3ZM8A 1W1YA 1UKPA 3TWBA 1V6XA 2D2OA 1M68A 4RR4A 4DWSA 1C29A 1G4EA 2OTDA 1MQQA 2JGQA 4JY9A 3VKAA 2WSKA 3V0UA 4C6QA 3H12A 5CC7A 2WVSA 3BVJA 2I14A 4OBSA 3MSGA 1LOSA 2E8YA 1F6PA 3WF2A 4NQ1A 1K4HA 3W87A 2DQXA 3TUUA 4E8DA 4XTDA 3ITGA 2PP1A 1IEVA 3B9DA 1M7OA 4Q8VA 2HQAA 3BGJA 2CHRA 4P8WA 2HZGA 3ZIZA 4G1NA 1XR2A 3CL6A 5EU9A 1X38A 1VEPA 1DE5A 1BYAA 3BCDA 4ZE5A 4LF1A 3MVIA 4DIAA 2V30A 4M7SA 5F4XA 5IHRA 4IMAA 5EMLA 3EEZA 7ENLA 2DZUA 3FSUA 2G41A 1XYCA 2EQDA 1QAPA 4D8LA 3WLRA 3PSWA 3MYPA 2RJGA 1JVNA 4EX4A 4BF5A 4E0CA 4JTCA 5J5RA 1EQCA 1GTHA 4DLMA 1VPXA 2I57A 1GQJA 4LEFA 3M0MA 3N17A 3VGHA 2INFA 2ZUTA 3MS8A 6REQA 4O11A 3TCSA 1DQUA 1WKFA 2FH6A 2BGNE 3G77A 3UZYA 4XVDA 3LDVA 3LY0A 4O13A 1ZJBA 1XC4A 2YXGA 4IIHA 3N6JA 1RPKA 3MUXA 4GH1A 1R3TA 1DHPA 3VILA 1E0WA 3P3BA 3WUBA 3WH9A 3P62A 3NDOA 3N3MA 4YLWA 4R27A 3Q4DA 3TJXA 4BZYA 2CLHA 1K6AA 5AC7A 2NXGA 2YXOA 3VIMA 3GNPA 2INEA 4Y9NA 1JZ7A 1TIMA 5CSUA 4GX8A 4H9ZA 1PTDA 3MZ2A 3UA3A 4EPKA 3HPFA 3N73A 1FWBC 4G6CA 1VQTA 4M6QA 1OGGA 5EYWA 1R7OA 3TDFA 4MYAA 4HKPA 3QFWA 3EA3A 4LNCA 3SCSA 1J0YA 1GQKA 2VEMA 1VFOA 3B9NA 1B30A 8RUCA 5HMSA 3BAYA 3THDA 3LRMA 5CPLA 1RD5A 4B9YA 1QNVA 4FB7A 4ZEPA 3S5OA 3TSMA 2A1YA 4ZQRA 3WLPA 5FF7A 4GIYA 3S2NA 4AZGA 5H2ZA 4JTGA 3L68A 2P50A 5MKGB 5A1AA 2YPIA 3VIJA 1PXGA 1AZ2A 3WMCA 1R3VA 3KP0A 5AYXA 3GC2A 4E2BA 3TH6A 3KWXA 3RCNA 1LUCA 1UR8A 3CBWA 1OCQA 1KM2A 2RFGA 3P61A 5LZLA 3ME3A 1EC8A 1W5PA 1IZKA 3V0TA 2PP3A 3SW6A 2ZXDA 3CZJA 3BO9A 1MDLA 2GQ8A 4XZBA 3EOLA 3LG3A 3LCLA 1GVRA 5DY3A 1HG3A 1E6RA 1O68A 3VD9A 3WQ6A 5CPOA 4O17A 5A2AA 5FF0A 1GUVA 3C2EA 4JTSA 1JNDA 4XZNX 1NOFA 1JUKA 2QKFA 2E6YA 3GAYA 1F8MA 3ABOA 3GHTA 2X1RA 3Q58A 2QDGA 4AY7A 1UHVA 2ONEA 4JFSA 3QY6A 1IEXA 1YXCA 2ZA2A 4AD5A 3K5XA 3VCCA 4Q8QA 2GOUA 1VIZA 4H00A 5D09A 3DFPA 3VUSA 4JX5A 4UR7A 4F4RA 1JZ5A 4OWGA 1NM9A 4TX9A 3V75A 1AK5A 5DFAA 1PZ3A 4NU7A 3UYCA 2BZNA 3MY9A 2ZRZA 4QS6A 2FVKA 3BSGA 3W1XA 2WMKA 4ADTA 2ISVA 4O4VA 1JCJA 4GUGA 1VRXA 3H2NA 1EBHA 2P8CA 3TXVA 3AMLA 4GQRA 2RJHA 2Y61A 3L2IA 1OX4B 3GTHA 1UW9A 4M56A 3GDLA 1TZZA 1D2KA 2DIKA 1UR3M 3E96A 2V9DA 3QPEA 1C8XA 1DWHM 1Q8AA 4MGGA 2J74A 5GNZA 3WJSA 4J27A 3AXKA 3OGSA 2WVVB 4GLEA 4Q4RA 3RFAA 2XIOA 2YL8A 3NL2A 3CH0A 1KBJA 3QJAA 4FLSA 4NJJA 4C6IA 3BANA 2XH0A 3GNNA 2G50A 5CCZA 1A50A 4M0XA 4JFUA 1UWRA 1IWBA 2C91A 3AMGA 3M0ZA 3UA4A 3IAPA 4FXFA 1JPHA 3ZVHB 2UBPC 4O54A 4H2CA 3AXHA 3SIMA 4KCUA 1EZWA 2JKAA 4ROPA 1X8FA 3RPMA 1NEYA 3MO4A 1NWRA 3QOMA 3ARVA 2KZHA 3NM3A 1XYZA 4MYXA 2XGIA 4UMAA 4GIEA 2XIJA 1QO5A 3I6RA 1SSDA 3KTXA 1JCLA 1KTBA 5BOOA 2OZ3A 4UCGA 1OK4A 3W6MA 2NQJA 1GEHA 4F40A 1W9BM 3VXGA 2XIIA 3M0KA 1GGOA 1MSSA 3DX5A 3VGDA 3ABZA 4YMZA 1VRDA 1W1ZA 5DRIA 2PFHA 4FO4A 1TWDA 4QG9A 4UXDA 4AMAA 3HM7A 2A6NA 4LEQA 4DNMA 1KM1A 5K4ZA 1IYXA 4I9MA 1VEMA 3RX2A 4Y7EA 1E43A 2WPGA 2E5CA 7TAAA 3GU1A 6PTDA 1UP0A 4E2DA 2UY2A 1UG6A 2Y85A 3NWRA 1SZFA 2P5NA 1F74A 2EPOA 1BRLB 3SRDA 4Z0JA 1X1OA 3BPWA 1GYNA 3O06A 3B9EA 4XBJA 1WZKA 5EFDA 2JQXA 2PCQA 3AXIA 1IWPA 2FB3A 4U4MA 4S3KA 3BOFA 5A94A 4AZCA 4C6EA 1PDYA 3TK7A 1KGXA 1S3HA 3FS2A 3STCA 1JNEA 1SJCA 4C90A 1AVAA 4O8AA 3VNDA 3AFBA 1KBBA 4IWWA 3D47A 1CXEA 3O8AA 2XSBA 1W1A1 5EL1A 6TIMA 4WEVX 3WELA 5DXYA 4E3TA 4IP4A 1PZ0A 3DU0A 1TJ2A 3HQPA 3MA8A 4YVVA 3M0LA 2OFJA 2VC5A 1K9DA 1M01A 3W25A 2O0TA 3W6YA 1V6WA 3KBMA 5EMJA 5BMXA 5I07A 2GQ9A 5I09A 4PEEA 1KFEA 3TW9A 3LZ5A 3K4WA 9RUBA 1DWAM 4GPNA 4BQ4A 4WSJA 3K8MA 2O9RA 2XHYA 4FNRA 3DECA 4S2BA 1WZLA 2DP3A 1JDEA 3VM5A 3R0UA 1OFQA 4K7YA 1M6JA 3PNUA 1JQXA 2EHHA 1VHCA 3USBA 2HJPA 2GOKA 3GYEA 4DVOA 2J78A 5LNSA 1RQHA 3R5EA 4YCPA 4HNTA 3C5QA 3U4AA 1VH7A 4AWUA 2XWDA 3GZAA 4PMNA 1O5RA 2Z24A 2A3AA 4N9EA 1IR2A 1GG0A 4IIDA 2F61A 2NUYA 2D69A 1EO5A 1E9YB 1QCWA 3FOKA 1GONA 5CC3A 3CV6A 4HSHA 2A4AA 4O0KA 5A6KA 4GJIA 3GDTA 3AROA 5E1QA 3H7UA 4G5DA 1AMYA 1TUXA 3PTDA 3B4UA 2I5IA 3TWAA 4HU4A 4NT0A 3R0DA 2PDHA 3EEGA 3VUPA 3DESA 3S1VA 1QPKA 3PNZA 2Y70A 4RZ4A 2AL2B 4JTDA 4PE8A 2CLEA 2BVYA 4UQCA 1QNPA 5DMMA 4MKNA 1UASA 1OT1A 4NNAA 4GMEA 3NQ2A 4ZENA 1XG4A 4IGHA 2G37A 1R5YA 2XVPA 5I3IA 5LNUA 4GVGA 4C6DA 3IUIA 5DBTA 1UWSA 3DHDA 4FP1A 1T0OA 1DTUA 3UJSA 4FS9A 1EH9A 3VIIA 4LOCA 1DJHA 2QCHA 5CEWA 2P88A 1OD8A 1WDDA 5AC6A 1ZCCA 4GZJA 2IQ0A 1OX4A 7ODCA 1M3UA 4D6GA 3TKFA 2QMKA 1ZB5A 2YL6A 3G8EA 2E9BA 3PBVA 3NSXA 4IFKA 4HNNA 1AH3A 2AMGA 5HQMA 2O55A 2I9EA 4I9TA 4GJ1A 1JDCA 4GUFA 2FTWA 4FLRA 1W2VA 5FCZA 4RZBA 3NO3A 1FOBA 4UNIA 1LCOA 2PTDA 4DI8A 5HULA 3L4TA 1NP2A 4MF4A 3SADA 4JEQA 2BX7A 3IJIA 3TA6A 3W4RA 4KEMA 2B7QA 4JTJA 3COTA 4L4PA 3HPXA 5C9ZA 1FWHC 4EVZA 4GI8A 3W9ZA 4K3ZA 1ZCOA 2B7OA 4KWUA 4F0RA 2D0HA 3WQPA 3UYIA 2QXWA 1V3JA 1GNXA 1CX9A 4LH8A 3UZJA 2XVGA 1NQ6A 2VXNA 4FK9A 4NZ1A 1N7KA 3I3DA 4GY7A 4IIGA 4US5D 1V4YA 1TCDA 3HQOA 4GZIA 1EQPA 3GG7A 1GZJA 1W9PA 3TOPA 4HHLA 3HFYA 1VIWA 3W22A 4UIOA 4AMCA 5FEZA 2OZ8A 5M17A 3MMDA 4DJEA 3GDKA 5I3GA 2ZUMA 2DV0A 2WQPA 4LVDA 3HG2A 4BWLC 4PMQA 1TPB1 3WLMA 4UFKA 4AISA 2A2IA 2EF9A 3OYXA 4K39A 1TJPA 5EA9A 4S3GA 4S2CA 4WY0B 5AHEA 2ASHA 4JY8A 3TXZA 1UUMA 3WDRA 5HMFA 5LGXA 1XLLA 1C7SA 4UR8A 3WQEA 1X97A 2PRLA 4JFVA 4L56A 4QJ5B 1JL8A 5E0KA 3UG3A 4LAMA 3VNYA 3TSDA 1WXZA 1SFSA 5JQ9A 3LB0A 2WZTA 4YTQA 1ICQA 2FB2A 3THUA 4LBUA 3NL3A 1JFHA 1LWIA 1B0IA 1PSCA 3RDKA 1TJ1A 2VX4A 3A21A 1IE7C 2CZ5A 3AO0A 3E5PA 1VBRA 3S47A 3RLHA 4FOKA 5BXRA 3M5ZA 2G3MA 4O53A 5A5WA 4JS3A 4W9TA 4AWEA 2D3NA 3SN4A 1KR1A 1P48A 5LIUX 3VD5A 3ZFHA 2I5QA 2GFTA 1MVYA 2VZVA 4JIPA 2PTZA 4LVGA 3IK4A 1K8CA 4F9JA 4B5XA 3CV2A 4ZFMA 5BW6A 4UFLA 4OKDA 5PTDA 3W7RA 4K7VA 3SGZA 5CBJA 1Z41A 2CZDA 4IL2A 5IOBA 5FJIA 2PTYA 5F2LA 3TN6A 2QAPA 3N2BA 5LIWX 4DJDD 4BCEA 1EX1A 3WNKA 2Z7KA 5H8PA 1WDRA 1OF8A 1DL3A 1QTWA 4QISA 1FH8A 1QT1A 3GR4A 1QI4A 2F8QA 1CEOA 1PUDA 1IIGA 3EMZA 1RQBA 5EMYA 1KW1A 1MW0A 1MUWA 3WD0A 1DQWA 1TPVA 4QG6A 1VEOA 4PUKA 4WHBA 2QAFA 3PPHA 4WRHA 1CXIA 4ACZA 1A5BA 1R6WA 3QM3A 3QR0A 4AVNA 1CZ1A 1PTGA 1JQVA 2AGKA 1E56A 3P14A 3BC9A 1E40A 4GFIA 1KTCA 3C2VA 1KC7A 2Z25A 3M5XA 5HUPA 1BF6A 4P8UA 5LHFA 3FVMA 4IMGA 4R5EA 1HX0A 3RUBL 1OIFA 4RNHA 3WLKX 1H61A 3WNNA 3THAA 4N02A 1OG0A 3S6TA 2OCZA 3CAWA 3CNYA 1SFTA 1FWIC 5K9XA 3XISA 1W2PA 3VGEA 1DJIA 3SGUA 5GJNA 3N2TA 2FYMA 3THCA 3GH4A 4Z08A 1L8NA 5HXMA 3HQ1A 1OX6A 3AHZA 2CBUA 2FZ9A 4JOMA 2EG7A 4GVFA 4JYFA 1LWHA 1SJDA 1TV5A 4GKLA 3I10A 4H9UA 2UY3A 2J9XA 4GACA 3F4NA 3DFYA 5A6BA 4PMYA 3PWIA 1FWRA 4YTRA 2OGJA 3AYSA 4UQAA 2HPMA 1YNYA 3FA3A 1TPUA 3EX3A 4FXRA 2R9RA 4R9OA 4L4MA 4RE3A 3E0IA 1QWKA 2BODX 3MUCA 3LV5A 4LGXA 4Z1YA 3VNMA 1SU5A 1Z42A 2ZTKA 4IMFA 4LCRA 2YCJA 4XIAA 2OT1A 3UVAA 1V3MA 1PJ9A 4HPJA 1UJQA 2VWTA 3SAZA 4YNGA 4H8HA 2VX7A 3KOXA 4MNJA 3U57A 2ABBA 3VIOA 3L5AA 1M9HA 4B92A 1VYSX 3VX0A 4I9JA 1M41A 3KFTA 4HPNA 4IT1A 2XH4A 4O12A 5A2CA 4PRTA 4PTDA 3LLFA 3DG6A 1C7TA 1SO4A 3EOOA 1Z3NA 1O7AA 2OYLA 3T81A 2OJPA 4PUWA 1C90A 1EKOA 3D3AA 1G6CA 2JFEX 1TJRA 5AC5A 5TNVA 1V3KA 3VD3A 3C86A 4YIWA 3B8SA 2FHCA 4QCEA 3FSTA 3AYVA 1WX0A 3W01A 3GXNA 4CVUA 3IS4A 1UJPA 1FHDA 4B3LA 3GFZA 2J62A 3T07A 3QY7A 2J8FA 4KIRA 2I17A 4JHZA 5I5RA 3VOGA 3KVJA 4QDPA 1EOMA 3E3HA 1RLCL 1CXHA 1QOXA 1LG1A 3IVUA 3TFXA 4M6PA 4TU1A 2VDGA 3LN3A 1HJQA 4Q4SA 2VOMA 2A3LA 2OEKA 1VFSA 4IF2A 2A7RA 1EGZA 3QH2A 1GOIA 2J4GA 3M41A 1LF1A 2GJRA 3NNTA 3RITA 3LHZA 2NV9A 3EKLA 3LBOA 3BMXA 3VDBA 4ZQCA 1GZ1A 4BJHA 2QNEA 2R14A 3TEVA 5IDZA 2FVMA 1W91A 1FCQA 4BI7A 3PTMA 3NJ3A 5A6MA 2QUNA 4ZOAA 2X16A 3E0LA 2E1WA 3OG3A 4U28A 2J6VA 4W8LA 3PULA 4HCLA 1PHWA 2QVNA 4UC5A 3DC8A 2XTKA 1EGVA 3SQLA 4RNIA 1XGDA 2WO5A 4LT9A 1XIHA 3M1ZA 1HO4A 3UCCA 5G2WA 5HOSA 4XX6A 2W67A 4ERGA 6ALDA 4U31A 1CXLA 2X7VA 2O56A 2IPFA 3VD4A 4R7WA 2REQB 5A8OA 1RH9A 1ODUA 2FVLA 3CTLA 4P7RA 2MANA 3W1QA 3I3BA 5GNXA 2ZIDA 3ES7A 3TTYA 1I9CB 2YDRA 3H2OA 4REQA 5CBBA 5HA7A 1DV7A 1CXFA 2FTPA 4Q4OA 2AQWA 4W88A 4H6RA 2NV1A 3KZPA 4A29A 2RUSA 3OIHA 3SDOA 4W84A 3BTNA 1VFFA 4GUHA 1ENUA 2E9LA 4WD0A 4OV9A 4WR3A 1IIHA 1TPWA 3SJ3A 2PWHA 2PDGA 2EPMX 1A0DA 3NQDA 4U2ZA 2HDJA 2IXVA 4GZEA 3KCOA 3ALGA 4HB7A 1V6UA 3BUVA 4H9MA 2E09A 4PCTA 1SJBA 1VJSA 5G2HA 3WNMA 4L1WA 1W31A 2WNQA 4ZSTA 1DIOA 3B04A 4HP5A 2XSAA 3M47A 5EKYA 4JNMA 4AX6A 1TPH1 1AG1O 4F79A 4AIBA 1D3CA 2DJLA 3VKBA 3HFTA 3R10A 3LXCA 4XZHA 4ZOEA 5A69A 3HU7A 2F6UA 4AD4A 1RALA 2QCFA 2QV5A 3ARWA 2WNWA 3WKZA 2D0FA 2VC7A 1AQ0A 3LM7A 3H24A 1E71M 4ZE4A 3C2RA 5G1MA 3WMSA 1H11A 1EDQA 3E2QA 5B7YA 3WNPA 4RNFA 3CPGA 2PDBA 3A9BA 3WD3A 1A80A 1QUMA 5DLCA 1EL3A 1A5SA 4AC1X 4A21A 3VE7A 2HS8A 2QJHA 2YDSA 1QK0A 4GH3A 4GQBA 5K7JA 1HJUA 1NY1A 4PTNA 4WKAA 4MAVA 4AXNA 4NXSA 4MADA 3VGFA 3AS0A 4GNJA 4M6UA 1US0A 3NQGA 1FFQA 4WJXA 2CZVA 1C8YA 2OSWA 2Y8KA 1WOAA 4JTFA 2FPVA 1RK5A 4LAUA 1MUCA 5AHMA 3VNKA 4AF0B 5D8WA 2R1NA 3C0SA 3PZ9A 3W81A 4MY9A 5L9FA 1YDVA 3UESA 3I4EA 3LA4A 1RCXB 4R3UA 2J13A 1RAKA 3S2MA 7XIMA 4JN6A 3UY8A 3DIPA 2CW6A 1UPPA 2Y63A 3BMWA 4D1JA 2VWSA 1TZ7A 3PZGA 5JBDA 1XC6A 1XFBA 2GUYA 1K7FA 4GO9A 2W6RA 3TC6A 3GH7A 2DGAA 1NAL1 3QGVA 3MV11 4AU0A 1UWUA 1MW3A 2VT0A 3VNZA 1FWEC 2J8TA 1QW9A 5TIMA 5GPRA 3E2VA 3CUGA 3GZ3A 5EMMA 3KUMA 3VGBA 1XRVA 1JR1A 3R8RA 5TD4A 2BP1A 3AWNA 3MT1A 1TWIA 5FI8A 2QCCA 3CMGA 2WHMA 3WUGA 3FXYA 4OV4A 3L0KA 5FEPA 2OOFA 3A3XA 1OYAA 1D3GA 2XU2A 3ORWA 3LPFA 5E09A 2AGTA 5HJLA 2GVEA 1ZENA 2A3BA 1SGJA 2C1IA 3UFYA 4HYWA 4GXMA 1XWYA 3H55A 1PBGA 2DT2A 3T0TA 2V2HA 4Q8PA 4ZB2A 4CUCA 4U33A 3RRAA 3BLEA 1ADOA 2WAGA 4R85A 4RE4A 1BPLB 1F3TA 4J3SA 3RRXA 4LX4A 4Z2KA 1LROA 1LORA 4ZQPA 3BSHA 4G56A 4M81A 3KLKA 3S5ZA 4MUPA 1REQA 5AZ0A 3OVQA 3T55A 1JEZA 3FGCA 3EOSA 3GDBA 2PWVA 1L0PA 1EDGA 1BHGA 3RMEA 3EKZA 3KRBA 4IUGA 2VRKA 1PIIA 4H6EA 1M7PA 3GAKA 5ABGA 3WCZA 3W37A 4H9XA 5CZTA 2RH9A 1UR0A 2ZOXA 1M1BA 1TCMA 4H7VA 1TRIA 3OEXA 1JXKA 1QPOA 3HURA 3CWOX 2DZAA 3OQ8A 2ZXQA 2P3ZA 4MZ8A 4U3CA 1MI3A 1S2AA 2CESA 2H6RA 4C7FA 4IISA 4J3ZA 2ZDSA 5KINA 4M1BA 2GZXA 3DGBA 1WV2A 4YS1A 3THQA 3LTYA 5CPMA 2I7GA 4DM1A 3F4CA 3ZOAA 3W7QA 1NWSA 3HGJA 3WQWA 5D38A 1QNOA 2PS2A 3IIOA 1J2BA 1VFMA 3FXGA 4IG2B 3VU2A 3AIRA 1PX4A 3R79A 3PFMA 5AY7A 4OTKA 4IJRA 4V27A 4ERIA 1Q7ZA 5E93A 3KHJA 1RP9A 5CPNA 4QAIA 4KEZA 1XFCA 2IMRA 5BRBA 4W5ZA 3RM9A 1LT8A 3O2LA 3T7VA 4ZO9A 3FJNA 2A0NA 2QIWA 3CV1A 4B5SA 2VEPA 2GSHA 1YW1A 4PMOA 1OFRA 2F9RA 4MNKA 3PBWA 5LYRA 3PWAA 2H9AB 5F2IA 2VZOA 4L6DA 4ZMGA 2YBVA 3N6QA 3CV7A 5SWUA 5D33A 1J6OA 2QPXA 1LM1A 2B31A 1JYWA 1JYXA 3I7RA 1XRTA 1XH2A 1UKSA 2WCAA 3BSMA 8XIAA 4IX2A 5D9PA 5KITA 3PR2A 3IRSA 1E3ZA 3ES8A 3RPTA 2C79A 5FA5A 3RU8X 3SBFA 1UWIA 3NO1A 5K3VA 3GIQA 5J8LA 2NXIA 2OX4A 2VI0A 3PUEA 4DO4A 1E4MM 3SEPA 3DFHA 4AWTA 3C52A 4JBRA 3A3HA 1C92A 2FGZA 5CPQA 2E68A 1D3HA 1EJSC 2BVTA 3UWVA 4B5WA 2WZMA 3W7DA 1OCJA 1BTMA 4MY8A 1FXPA 4BR1A 3UWUA 4ZXOA 2V67A 3SRFA 3EDDA 2WMFA 2E28A 1IXPA 1ESWA 5CBIA 2YB4A 5KZEA 4PFHA 3W27A 2IPGA 1DJXA 1KXQA 1EX5A 2WC3A 3DI0A 1LG2A 1SUXA 1HTIA 3NO5A 3KOWA 1EXPA 1XLMA 3KL3A 1TTJA 3SSZA 4L64A 3HZ3A 2CU0A 3L4ZA 3QTPA 2VOTA 1AQFA 1Q4NX 4NZJA 3KRSA 1X1ZA 1JFXA 1BKHA 5DEZA 4GGBA 3AI0A 1RJRA 2WOQA 3LLDA 3RU6A 3RX3A 2BVWA 2EG8A 3U4FA 3ATZA 5BXPA 1V08A 4IL0A 4NUWA 4CKQA 1UWQA 3EKGA 4L1GA 9XIAA 1JXJA 4C6NA 1ZUAX 3LM3A 3GXFA 4TX8A 4R88A 1AJ0A 1CIUA 3FDKA 1ME8A 2A21A 2Y4SA 3AS3A 1V0LA 4IP7A 3S1WA 3FFSA 3GRIA 3VZZA 1EPXA 1NVMA 4IPNB 4PODA 2GVJA 4PSPA 4OHQA 1PWMA 1UR4A 3UXLA 3UU0A 3PFRA 4A8NA 1VJIA 4QR6A 4Z2GA 2ACSA 3AICA 3QYQA 4F0HA 5BCAA 1LDCA 2Q6ZA 3VPLA 4MPQA 1DHKA 3G22A 4UCFA 1YBQA 1Y8BA 1GKQA 1V6VA 4URIA 1D8CA 4HMNA 1XIDA 3QQ0A 1B4EA 3VDHA 3MHGA 4N0RA 3GXMA 3TOYA 1Y0EA 4N9CA 4GC3A 4PMVA 3GBDA 4S3AA 1RSCA 1XQLA 2Y6ZA 4O8RA 4AH7A 2XFYA 4HQVA 4PMUA 4MB3A 1NFBA 3CUFA 3GNRA 2NVDA 2E1DA 3U2ZA 3PPFA 1WUFA 4QHRA 4Q7IA 3PY2A 3WEMA 2R1LA 3KBNA 1O1ZA 3LXBA 3R58A 2DVTA 3STGA 2GSEA 2QCNA 2WMJA 1XIBA 3B9OA 1NF0A 4MZYA 5E0FA 1G94A 1MO0A 1DOSA 1T8XA 3GTFA 3HGSA 3KXQA 1R9YA 1XLJA 1W5OA 3W7KA 4A3RA 1PE1A 4I90A 4XO7A 5CGMA 5XIMA 4MWAC 1B57A 5HJYA 3EZ4A 1Q6CA 4PMRA 4E3VA 1JCTA 1QO2A 2ZZ4A 3T78A 2OQLA 4GNKB 2UZ9A 4I6KA 4UTTA 4YTTA 3UZXA 4IP5A 3NUKA 3DFNA 2P8BA 4LU0A 4J5NA 4D8AA 1DYSA 3GHRA 4UFJA 1BSLA 4UOQA 1OY0A 2FZMA 4U2YA 2Z00A 2ZUUA 5CXPA 1KBLA 3W7PA 4R33A 3MKCA 4FIQA 4NAFA 1VF8A 2NVCA 5CC5A 2C1GA 1RCOB 3SECA 4FF5A 1VS1A 3OZMA 4RV8A 5D9OA 2VFIA 5DCEA 3NDYA 2HXTA 3S6DA 3LGGA 2BXZA 3B03A 2JF6A 4KESA 2C16A 1KM4A 4DAIA 1R7AA 2Y5SA 2ZKMX 5C6MA 2F6KA 4XQ6A 5T9CE 3ZZ1A 4PTXA 3T0AA 4JGDA 5HAOA 1PO9A 3KBSA 2WLZA 4NJIA 4C91A 1V7YA 3AJXA 3GTXA 1UUQA 5JVLA 1UD3A 4TR9A 1IT7A 4AQLA 2X30A 4OECA 1IZCA 1YNPA 2ON3A 4XWUA 4BS0A 3VOJA 3VOCA 4DEFA 4BFAA 4TMCA 1OGBA 4O19A 4G7EB 5A95A 4OU1A 1BWKA 5LGZA 5HATA 1FCUA 3C0QA 1GHSA 4ECLA 3POHA 3DKLA 3KBWA 3WBAA 4W85A 5K2ZA 4C1KA 4B91A 4MZ1A 4C6PA 4UQDA 3GVWA 2I1OA 3K1GA 3K8LA 3VI2A 1FWCC 4YU1A 4CGTA 2VGBA 3TW7A 5ABFB 1VYRA 4IM4A 4CNSA 1J9YA 4AD0A 1F5ZA 4HZMA 1OF6A 1R2TA 1IWAA 2AQVA 2HMCA 1FHVA 3GE7A 4Z42C 1NQKA 3HA1A 3SN0A 2OO6A 3GHUA 3YPIA 2P53A 3WLLA 4WXZA 4GBUA 4E5TA 2JKPA 3VDCA 4AFYA 1HKMA 3LU2A 5CZSA 4DRSA 1BQGA 1R46A 1PKNA 3IJ7A 4N9BA 1SMAA 3W74A 4V15A 1JCXA 3ATYA 4US5A 1SW7A 3ITVA 3HPZA 2NXHA 5LXEA 2WSPA 2QV4A 1S1RA