3QMRA

Crystal structure of the mutant r160a,v182a of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with the inhibitor bmp
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
219
structure length
219
Chain Sequence
VMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTAPERLSRLREIIGQDSFLISPGAGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGIIESIKDLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational changes in orotidine 5'-monophosphate decarboxylase: a structure-based explanation for how the 5'-phosphate group activates the enzyme.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus str. delta h
molecule tags Lyase/lyase inhibitor
molecule keywords Orotidine 5'-phosphate decarboxylase
total genus 81
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2011-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3qmrA00
1MEHA 2E5BA 3W1PA 3MUXA 1W5OA 1XFBA 3CC1A 3GX9A 4Z0SA 3S5YA 4M6QA 4A29A 1DOSA 4O14A 2VEKA 3G1DA 4IMCA 2GVGA 1LRNA 3NGJA 4O19A 1WBJA 3B03A 1LROA 5CG7A 3M44A 1DORA 1LZOA 3T78A 2FQIA 3OBKA 4JEQA 2YFNA 1O60A 5LZLA 2ISVA 3W72A 3S9YA 2OT0A 3N19B 3DI1A 4NT0A 5F2LA 2JKEA 2P10A 4NJGA 5EY5A 3OA3A 1LRQA 2ALDA 4JGDA 4EVZA 5AHLA 1SUXA 3PAJA 1TRIA 1GPWA 4QAIA 4CQ8A 3E9AA 4FIRA 3HF3A 2W6RA 2E5CA 4CCEA 2QCCA 4UFJA 4OV9A 3DZ1A 3QW3A 1ZCOA 2Q8ZA 1R2TA 3ZS4A 3F1QA 3NZRA 2C13A 3PSVA 4I7WA 3JS3A 3TSBA 4LV9A 3IGXA 1I2QA 5G2IA 1SSGA 2DZUA 1Z42A 2VEIA 2FPYA 2J6XA 4R33A 4M6VA 3H55A 3LCLA 3QMTA 1TPB1 4UUIA 4IPJA 1ML1A 1GYNA 5A5WA 2J9XA 1YLVA 4JTSA 3GDMA 2V8ZA 4NVTA 3INPA 1OFBA 3TE9A 3EWXA 3PBVA 3W7DA 3NYZA 3IIVA 1O95A 1TPC1 2DZXA 4GWEA 3W76A 3W7MA 1P1XA 1XM3A 1ZAIA 3U6WA 3GB6A 3TROA 2X1SA 4X22A 4GE8A 4FEZA 3P8JA 3IIOA 1EWEA 3C3NA 5FF3A 1KW1A 4EF8A 1XBXA 1H7OA 2V2HA 5F2IA 2E6AA 3NXFA 1IIGA 3L67A 2ZFAA 4Z1CA 3KHJA 4RCXA 2QAPA 2H6RA 4S2BA 1FX6A 2OJPA 5LGZA 3UY7A 3PUDA 3M6YA 3MYOA 5DCBA 4IX0A 2YFOA 3DGRA 3LLFA 1J5TA 1TPVA 2QCMA 3DKJA 4OHQA 1U5JA 3DH7A 1W0MA 4CCCA 2QR6A 3LRKA 2NX9A 3QF0A 3FS2A 4NUWA 4QNWA 5F2MA 1R47A 3UWYA 3O15A 1W3TA 5F1UA 1LBMA 2NXIA 1VYRA 5J5DA 3W2UA 2ATSA 2QAFA 3NQ8A 4BI7A 4KFPA 2BX7A 4DQWA 5D2YA 3LTYA 3GLCA 3TH6A 1VLWA 3Q58A 3UXAA 1KM1A 5I3JA 1IF2A 1FUYA 3W87A 1FWTA 1GQNA 2XN2A 5D38A 2Y6ZA 1B4EA 5HWMA 3TAOA 3TCEA 2Y7DA 4FNUA 1SFJA 4WOQA 4LVGA 3HG2A 3MBDA 4LRTA 5CSRA 5CPOA 3G8RA 4TU1A 4U4MA 3M5XA 3W2MA 2YDAA 5AHNA 1ME7A 1JQVA 1F74A 1QO2A 1NF7A 5D09A 4LY8A 3CLMA 3QSTA 1G67A 1EEPA 2NXHA 3L65A 4JTUA 3C6CA 5DCDA 3W23A 1QDSA 3PM6A 1DJNA 4O50A 1LORA 1RQEA 2RKXA 3O06A 1TSIA 3PVFA 4WUIA 1AW5A 2Z2UA 4K7YA 1VLIA 4DO5A 3CHVA 5TQLA 4U28A 3G1XA 4MIMA 2V2DA 2NWRA 3TFXA 3PUOA 1H1YA 1VC4A 1VJIA 5LNWA 2PE4A 3THAA 5HR6A 4E2DA 1TCDA 1KTBA 2ZA2A 5FESA 2WNQA 1T99A 3DHDA 3SY5A 4QQ3A 1A5AA 1VYPX 2WSRA 1QWGA 1FY6A 5KZDA 4JICA 3HG4A 1ZAJA 4O16A 2VFDA 3BK0A 3DXIA 3NM3A 1JJKA 1JCJA 4Y90A 2WQPA 4XBSA 1LM1A 3S1VA 3QYQA 2P1FA 5KTLA 3EWZA 3G1FA 5AHEA 4AAJA 2WSQA 3S8HA 1GVSA 4L4LA 1TB3A 4KFOA 4IPIA 1YXYA 7TIMA 3TQVA 1H60A 2ATMA 3B0VC 1EWDA 1RQHA 4J9JA 2EF9A 3RF9A 3I7RA 1S5WA 1QPOA 3FKKA 4W9TA 2ZCGA 5AHMA 3NQ7A 5SWUA 4N9BA 5I3HA 4X9SA 4MY1A 2VFIA 4O17A 3PY2A 2G97A 2TMDA 1SZNA 1ZY9A 1OFDA 5C54A 3NEVA 4EF9A 4NZJA 1SW7A 5CKSA 5G1YA 1I2OA 4GUFA 1LOSA 3UNDA 4O54A 1UASA 4RZ4A 1H62A 3LCGA 3HMJG 1FXPA 3MHFA 3GXNA 2HSAA 5DN1A 4AWUA 1S5TA 1L6YA 3ABRA 3NQDA 3EWYA 2RDWA 2KZHA 4X3ZA 2RH9A 3E12A 5D2TA 1KFKA 1TPFA 3G1HA 1SW3A 1XCFA 3PWAA 3MYPA 3KVJA 3SZ8A 4JTFA 3PB0A 3UWUA 4ZQPA 3N34A 4JDBA 3S5OA 3UYCA 3L66A 3W7LA 4Q32A 5HINA 1HTIA 5LNRA 3VFLA 3B8DA 4TO8A 2E68A 2DJXA 3HGJA 3PF3A 2WJZA 3VE7A 3BW4A 3MP3A 2ZA3A 4HT3A 2ZRYA 3LXAA 3S1UA 3SJ3A 1PS9A 3QSRA 3EXRA 3TUUA 1MEWA 1G6CA 4GFSA 3SSJA 1TYGA 3S5NA 3VI2A 4H3DA 3NQGA 3W2KA 3W6YA 2V5BA 2QCDA 4O1DA 4N9EA 3S6DA 3M16A 2E1DA 4UIOA 2NLIA 4FB7A 3L5MA 3MW7A 3LB0A 1OYBA 1TMHA 5E0KA 4MFDA 5E93A 1OX6A 4KWWA 2CLFA 3PBYA 4ALDA 3GIYA 1K7XA 3BO9A 4RKAA 4PH6A 4MFEA 4M19A 2V5LA 4H4IA 3WFAA 3BARA 4O13A 3NNTA 3OHIA 1QCWA 1G4SA 2A21A 3E96A 4GC4A 2J88A 4UTTA 2RFGA 4S2CA 1QPNA 1UB3A 5TIMA 1FXQA 4LOCA 4O12A 1S3HA 2D73A 1DKWA 5H91A 2V9DA 5EPDA 3O1NA 3LHZA 4UMBA 1Q6LA 3STGA 3EWBX 1E51A 1WV2A 2TSYA 5CPNA 3R8RA 1FCQA 2V2CA 2XN0A 1AG1O 5K9CA 4WOZA 1H63A 2PURA 5CGQA 3JR2A 4ADSA 4CQ9A 4OGZA 5D05A 4GUJA 4A22A 5HR7A 1QOQA 2QCHA 1NEYA 4K37A 4LRSA 4LC6A 3QPZA 1RZMA 1FDZA 3STCA 3DFSA 4BI5A 3DFTA 2X16A 1WX0A 3GAKA 2IQTA 3FFSA 3LCFA 4FX6M 4UTJA 4LVFA 1EB3A 1QR7A 3KXQA 1Q6RA 2ZTKA 1TTIA 3K30A 1JCNA 5F4SA 2WOQA 1NSJA 1OFPA 2VEPA 2Y85A 3G0UA 2X1UA 1I2PA 4ICNA 4BFAA 1MXSA 1XBVA 1KM5A 3C0JA 4RXFA 1KTNA 4AXKA 2ZZ5A 5L9FA 3M0ZA 2G96A 5LSMA 5F2GA 1VS1A 3R2GA 1NAL1 1FCVA 3OVQA 3SFKA 1W3NA 2OT1A 1YDOA 3NQMA 2ZZ6A 1TPH1 1ZENA 1DV7A 2VC6A 3C2OA 4O28A 3KRSA 5KMYA 2YGYA 3QQ0A 2Y70A 2WNNA 2E6DA 1O5KA 3W3OA 1A50A 3KFTA 3EXTA 4Z0JA 4O52A 1CX9A 4CCDA 3TMLA 4E2BA 2R91A 1YTKA 4XTIA 4BI6A 3QH2A 1KTCA 1TPUA 1KFJA 4JXCA 4EIVA 3DHFA 3WJYA 4NZFA 3EX1A 3T4CA 1XKYA 3PB2A 4DF0A 4NJJA 4D2JA 2WO5A 5HMSA 3N73A 3P60A 4Z1AA 4Y9AA 2QJIA 2DORA 2J9ZA 2A1YA 1W37A 1H61A 1FWSA 5BW6A 2CZEA 2CLIA 1LOLA 3E49A 3HG5A 5HULA 1UCWA 4K36A 3NL6A 2PCQA 3MHGA 4OT7A 2FPVA 3W1RA 4UFKA 5FEPA 1K7EA 5D03A 2LLEA 2R14A 4WD0A 1TV7A 3NQCA 1VH7A 3F03K 1I45A 3UPWA 3BG9A 1OX4A 2JKAA 3CQ0A 3G1AA 5CPLA 2VENA 1LTDA 1M5WA 3TFCA 1Q6OA 1SZEA 3EKZA 4CNPA 2BZNA 2CLKA 3NQFA 3W7PA 5AB3A 4YMZA 3CTLA 2FB2A 1ZALA 1BWLA 3DI0A 3O05A 1F7BA 4YL2A 5D2WA 1H5YA 3S1WA 3D0CA 3LCIA 4RX0A 4ZQRA 3DFNA 4GUGA 2YR1A 2C18A 5DXXA 2I1OA 1H51A 4AHOA 2H90A 5AC8A 1GTEA 1QPQA 1MZHA 4LVDA 2I9EA 4O1CA 2B4GA 1JQXA 3LOTA 1UBSA 1MO0A 1OYAA 3IIPA 1ICQA 3NDOA 3EXSA 2CW6A 5G5IA 1XUZA 3GDKA 5CZ0A 4ZL1A 1FCBA 5D2XA 2NUWA 3V1PA 5KSWA 2PRHA 3W07A 4K6AA 5DBTA 4I9AA 4Y96A 2NV1A 1JUKA 1EPXA 5K9XA 4XKYB 1SSDA 5FF2A 4IMFA 4A2SA 4K38A 3W7IA 4Z1DA 1TV5A 2ZRVA 1C29A 1BEUA 4LS1A 3THQA 3HPZA 1LDCA 1K8XA 4IMDA 1UUMA 1Z41A 3P84A 3N2MA 3ZFHA 4MZ1A 4DF1A 4C1LA 1AW1A 3S5ZA 2CU0A 5DCEA 4I7UA 3LDVA 3TC7A 3R13A 3P67A 1W31A 1XBZA 3CB8A 3UWWA 1OFEA 4ORIA 5A8GA 4MLJA 1HUVA 1NF0A 3LHYA 3G1SA 5KZMA 2FLIA 4FNPA 3SGZA 1JR1A 3GZ3A 1X1OA 3LLDA 3W1MA 4O53A 3EWUA 4JYDA 2CLOA 1DJQA 2DZSA 4GXMA 3W86A 1PVNA 4LT9A 4GJ1A 3AJXA 4BK9A 1OFRA 4JIQA 2CFFA 4AHPA 5EL1A 1Q45A 1GEQA 2DU2A 3M47A 4JYFA 3TA6A 5I3GA 3H53A 1OX4B 1PHQA 3QZEA 2VEMA 1G69A 3WJXA 1Q6QA 1AK5A 4NNBA 3HGSA 5L6UA 4DF2A 1XDMA 4L4MA 3UXDA 3QQ1A 1QPRA 1XXXA 5LGXA 5C6MA 5K2ZA 3HJZA 3W1UA 1G7VA 1JRCA 4R34A 5BMXA 2DJLA 3U8GA 3G3DA 2EHHA 1TREA 1OF6A 3QEZA 4ZQNA 3NPXA 2AAMA 4NNAA 1VHNA 1YTEA 3ZWSA 1BKSA 1VR6A 3CEPA 3TV8A 3U2OA 3PS7A 5I3FA 1H7PA 1GG1A 1OJXA 2O7SA 5EKYA 1NVMA 4AWTA 1KLYA 3T55A 3W73A 4HNNA 4UR7A 5AYZA 5AHFA 3G8EA 4TMCA 5U4NA 3WK1A 3LV5A 2RDUA 3FEMA 1OHLA 3BW2A 5EMUA 1F76A 3P5YA 3NM1A 4LC8A 1ZNNA 5FEZA 1J4EA 1SW0A 3AO0A 2CLHA 2QUUA 1K02A 3FYPA 2CZ5A 2W79A 3NL2A 1J2WA 4QM1A 2ABBA 4NJHA 2GQAA 4XKYA 3FOKA 2Y62A 4RLIA 4MZ8A 1L9WA 1OYCA 3QRHA 4IXHA 3C4UA 2B7OA 1LRTA 1Z48A 1IXQA 3N2XA 1FWWA 2GJNA 1RR2A 4M7TA 1OF8A 3M5VA 1FWNA 5K7JA 4G1KA 1SZGA 3LERA 2A7RA 4UC5A 5U7SA 1N55A 3IRDA 3O6DA 5DLCA 4DBDA 4LTSA 1AL8A 3GXPA 4I7VA 1XC4A 4MJMA 3W7OA 2QUTA 1C8VA 3W70A 2CLEA 4LV4A 2B7QA 2B0MA 3TK7A 3TQ0A 1YPIA 5LNVA 4H6KA 2QDHA 4NX5A 1JVNA 5IBXC 3NOEA 2ZRWA 3G0SA 2DZPA 5CZJA 2X30A 4UTIA 1X6UA 3CWNA 4M5PA 2X2GA 1WDWA 3VE9A 3CU2A 1P5BA 3RLVA 6TIMA 4UTWC 3QFEA 2Y7GA 4KFNA 1WBHA 4C1KA 2NXGA 1PCWA 3LHUA 3WK2A 4DXVA 2V0TA 4UNKA 1ZHAA 4JYEA 1THFD 1NFBA 1ZJIA 3W88A 4ONVA 2A0NA 3HGRA 3NR0A 1L6WA 5D30A 3NAVA 1F73A 3I6RA 5AC7A 1YTDA 3MI6A 3CIXA 1OABA 4AH7A 5AYYA 4O57A 1TO3A 4UCGA 4UTMA 2Y61A 3C2FA 1C9DA 1FQ0A 3NQ2A 4JX4A 2Q3RA 2JKPA 2JBMA 3NPUA 3RNDA 5F1VA 2A6NA 4LVBA 3W1NA 1GYLA 3T40A 3B04A 5ABTA 2RDTA 4HSNA 1DQWA 4JX5A 1R2RA 4EOUA 3WK3A 3HB9A 1OX5A 5DELA 5H2ZA 3GKAA 2ABAA 1LCOA 4KKXA 1P0NA 3SW6A 3G22A 1D3GA 5K4ZA 2XFWA 3SR7A 3N14A 4P2VA 2ZTJA 3C8FA 2NZLA 4CNOA 2WNZA 2FTPA 2X1RA 3MI3A 1S5VA 3BLIA 5AFDA 4K8EA 3IVTA 3VKJA 1I4NA 1YADA 3NQ6A 3JRKA 2YYUA 3UZJA 4BR1A 4LNYA 2E09A 2X1TA 5FF7A 3DAQA 4N6FA 1EA0A 4M6PA 3P74A 1F6PA 3BV4A 3EX3A 2FJKA 4FIQA 4Y6GA 4NQ1A 5AC6A 3C56A 1X8FA 4PL1A 2EGZA 2Z1BA 3EX2A 2QCDB 3NL3A 4RV8A 2EPHA 3O07A 1SPQA 4AF0B 4MYAA 3MI2A 3TU9A 5I3KA 2FDSA 3LV6A 4UTWA 5HQEA 3B06A 1SZFA 2YPIA 5I3IA 1H7XA 3LI1A 4TMBA 3C61A 1FBAA 3BG5A 1ME8A 5K3VA 3NPVA 4WY0B 1DVJA 1Q3NA 1SU5A 2VELA 1OG0A 3TQKA 3B0UX 1O4UA 1WXJA 1XBYA 1W5NA 1YYAA 4N2YA 1W5QA 1T0OA 2R8WA 3PBUA 2ZBTA 1QAPA 4M7SA 4IOTA 1GOXA 2Y7EA 3L21A 1TRDA 4Q4KA 4P61A 4NXSA 3NQAA 4CLMA 2G95A 1TJRA 1R2SA 1VYSX 1PHWA 1W5MA 2ZYFA 3LXCA 2VOMA 4NJIA 5DBUA 3P82A 5G4WA 1KM0A 3TXZA 5G2HA 2HS8A 3CWOX 2HTMA 2DZWA 4XQ6A 4JY9A 3W7GA 5DY3A 5C2XA 4PODA 1Y0EA 1WOBA 1TQXA 3TSDA 1RD5A 3S1XA 4JD4A 3GK0A 2RHGA 1B4KA 2Z0IA 1KM2A 2H3BA 3L0NA 2CLLA 2ZA1A 3WJWA 3PSWA 3EX6A 1HL2A 4O0KA 3RLUA 4IJBA 4DEFA 4ZZ9A 4ZQOA 4JTHA 5KZEA 2HMCA 1TPWA 5T26A 4XWUA 1FDYA 5LKYA 2TYSA 2AGKA 4JY8A 4RXGA 3QMRA 4RZ5A 1MEIA 3BPWA 3N9RA 3SECA 3W1TA 5IBXA 4UTLA 3B4UA 2BWGA 2GPTA 2ZZ4A 4HHPA 3W7CA 4WXZA 2QCEA 3SI9A 1IGSA 4FO4A 1RQBA 1WA3A 2QCFA 1JUEA 3LBMA 2QJGA 4UTHA 2DZTA 2Y89A 3OVPA 1W1ZA 4Z08A 2OMAA 3CIWA 2WSYA 4FHAA 3W7JA 1ONRA 4X2RA 2PRMA 1HO4A 4N9CA 1GVFA 1G4TA 3C2EA 3LCXA 3NZ1A 2E77A 3A9IA 1L2UA 4N9DA 3O8AA 1XDLA 2ISSA 3LI0A 5AHIA 2NX3A 3QPYA 3VCRA 3C2RA 1SR9A 3I65A 3OEXA 1V7YA 4NXKA 2B7NA 2YW3A 1KFLA 2WV8A 5LNUA 4MY8A 3V75A 3CPRA 3RU6A 2F7FA 5FEWA 4AVFA 1MSSA 2GJLA 1OFQA 4LWWA 3SIZA 1WQ5A 4JIPA 5HWNA 3HPSA 5GVJA 3FKRA 4PTNA 1SO6A 4RZ6A 4QIUA 1PV8A 1W5PA 4FF7A 2WPBA 3P80A 3E02A 3PC0A 1UJPA 4CQAA 3P61A 1W3IA 4NNCA 3TSMA 2VFGA 1XI3A 3R89A 4FXRA 2JGYA 3FA5A 4UFMA 4JS3A 2R94A 3FLUA 1V5XA 1N8FA 1PIIA 3N3MA 5EBUA 3MMTA 4RR4A 4MOZA 1GG0A 3UD6A 3L9CA 3ATYA 4XTDA 1VPXA 4AB4A 1YDVA 1U83A 5D2VA 3LCHA 4UTTC 1X7FA 1IXPA 2ISWA 1OFOA 4HNVA 1N7KA 4QSHA 1RPXA 4AF0A 4O4WA 1H7WA 5K9DA 1KFCA 4WY0A 1KFEA 1TPDA 2QJHA 4IUOA 1H7NA 3MHUA 4LUIA 4UFLA 3DENA 1JCXA 2NX1A 4PL2A 4E38A 1D3HA 3GR8A 4IX2A 4GNJA 1TPEA 1H1ZA 4UNLA 4FNRA 1XUUA 1K3UA 3ABSA 2A7PA 3DFQA 3M7WA 1DHPA 1GVOA 3G1YA 3YPIA 2A4AA 4MVAA 3EWWA 1WOAA 4OWGA 1QFEA 4WJEA 3ZWTA 1B9BA 1IXNA 3IV3A 3M41A 4KWVA 4NJKA 3NPWA 1VZWA 2ZDRA 3STFA 4O11A 3RFAA 3A23A 2H3DA 3G18A 3DKLA 2QCNA 4DELA 3UY8A 1X1ZA 1R30A 3BLEA 3P5ZA 4N4PA 4LS2A 2C19A 2XN1A 3MBFA 1T8XA 3PR2A 4O1AA 4PFMA 3RK8A 4A3UA 1KFBA 2PRLA 3OIXA 1B3OA 2A85A 3TW7A 3BGGA 2HS6A 3W1XA 4FNQA 3TJLA 2ZZ1A 2ZRZA 4POCA 2A2IA 2GVJA 4XUGA 3ELFA 4UMAA 2V81A 2C6QA 2TRSA 4IWWA 3OG3A 3M5ZA 2QCLA 3EB2A 3TAKA 3L5LA 4GRSA 1JULA 4OU1A 4RJEA 3W7EA 1R46A 3L68A 4QJ1A 1XL9A 3LX9A 3BW3A 2ZZ3A 3ANYA 3A5VA 1ICPA 1KM6A 3BVJA 4AEOA 3GDRA 4UFHA 4Y8FA 4DPQA 2FFCA 1P0KA 2C1HA 1KBIA 3UZ5A 4UFIA 3W22A 1L6SA 3PUEA 3HBLA 4O18A 4UTUA 2GOUA 4FX7A 3TJXA 3TMQA 5BNKA 2E6YA 3CEUA 4K8HA 1KLZA 1K03A 1M7OA 3USBA 3G0XA 3TX9A 2C16A 3IVSA 2EAWA 1H50A 4YCOA 4HPXA 1UUOA 2BXVA 3EEGA 3W2LA 3UWVA 1LLZA 4EWND 3LCWA 2VFFA 5D37A 4MZYA 1SO5A 1CW2A 3I68A 3WK0A 3TNOA 1D9EA 5FF0A 4HNTA 4OV4A 5HUOA 4DO4A 4O15A 3GDLA 5HWJA 3L5AA 2UV8G 1EUAA 4IXXA 1SQ7A 3R12A 3HQ1A 4MUZA 4OE7A 4HN4A 2YW4A 3W9ZA 2Q3OA 3MO7A 4JTTA 5IM51 4IMGA 5FI8A 2VFHA 3HIJA 1ZAHA 3L2IA 1KV5A 4JTEA 3W1AA 3F4WA 3TDFA 3GNDA 1A53A 3B0PA 2JGQA 3IIZA 2YZRA 4N02A 1LLWA 4HSOA 1LYXA 3W71A 3G1VA 1JCLA 5F4WA 3QW4B 4JNMA 4S1FA 4A2RA 2PC4A 4IGHA 1VGAA 3W7KA 2A5HA 3W74A 4WY0F 2OX1A 2YYTA 3HOJA 1WYIA 3Q2DA 4ML9A 3LTPA 3FIGA 2W0UA 3W83A 1FWRA 4MKNA 5D04C 1TTJA 3F4NA 1QO5A 2QEZA 2Q8LA 1DQXA 1PL9A 4DPPA 2GUUA 4WXYA 1H7RA 4A21A 2QUVA 3NL5A 2YX0A 3E0IA 4LVAA 3B05A 3IGUA 1M7PA 1VCVA 2ZZ2A 3LRMA 1QOPA 5J5RA 1BWKA 3GDTA 2V30A 3TR2A 3W75A 1FDJA 1LBLA 2NUYA 2YXGA 4FNTA 3GNNA 5BRBA 3MP5A 2VKZG 1G7UA 3T7VA 5C5YA 2AQWA 4N4QA 5DY2A 2ZZ7A 1HG3A 2J24A 3PBWA 3LHWA 4ADUA 4MLRA 3O6YX 2WKJA 3GAYA 5EYWA 4UTKA 3W2NA 4JTLA 4O10A 3W84A 3Q94A 1VCGA 4QNEA 3EX4A 1CI1A 5AOUA 3FJLA 2I14A 1LBFA 2VXNA 5BMWA 4AHQA 1I2RA 1ALDA 3KOFA 3EKLA 3LXBA 4BF9A 3P7YA 1B57A 3MWAA 1F6KA 3I7SA 3GKFA 4JX6A 3CM4A 3WJZA 4O8RA 1GVQA 5K4XA 3P62A 3KRUA 4XBKA 1KBJA 1OK6A 5D02A 3MP4A 6ALDA 4TX9A 3LHTA 3WJSA 1K8ZA 1W56A 3BLFA 1DL3A 1VHCA 1GWJA 3A24A 3W85A 4K39A 5C55A 3LGEA 4LUJA 2BSLA 1RV8A 2Y88A 2CZFA 4JTGA 3DU0A 1ADOA 4K7VA 1EUNA 5HNRA 3CT7A 4GUHA 3TC6A 3W7QA 3TW6A 1I8JA 3W7NA 2DZVA 2CLMA 2Z6JA 5D32A 4MPQA 3A21A 4XZ9A 3S0CA 3KVLA 5KINA 2JK2A 1JUBA 1EX5A 3NG3A 4DO6A 5HJLA 3C2VA 1GT8A 4PC8A 3UPBA 3KVMA 2C14A 3N9SA 3I7QA 4JR5A 3BGJA 2GQ9A 3W7HA 5BOOA 2OCZA 2CWNA 3ABOA 4ZQCA 4YLWA 1TTPA 4FNSA 3LBCA 3HPXA 2QCGA 4WZHA 1G4EA 2H8ZA 5AYXA 1YXDA 2QKFA 3LTSA 2C15A 1F2JA 4BWLC 2Y63A 3GR7A 1F05A 4MY9A 2NUXA 4WX2A 1TTQA 3C52A 3KRZA 4OBTA 1OK4A 1QMLA 1LP6A 3O16A 3FJ6A 1EIXA 4AWSA 4HNUA 2F84A 3NQVA 5KITA 4MYXA 3PG9A 2Z6IA 3QJAA 4QITA 2BLEA 4O0ZA 3W1LA 4B5NA 1F5ZA 1T96A 2NV2A 1WAUA 5CZTA 5G4EA 3NA8A 2QDGA 3G24A 1I2NA 2ZRUA 1A5SA 3DFPA 1SO3A 1RVGA 1QNVA 3A5FA 4ZVJA 1PCKA 1DBTA 3M1ZA 5G2WA 1KM4A 1LOQA 5MHBA 1IIHA 3IGSA 3L0GA 4HKPA 3PG8A 3QM3A 3W7RA 1TIMA 4PA8A 4R53A 1HO1A 1O94A 2E5DA 4ADTA 3SGUA 5HUPA 2GQ8A 5LHEA 1P4CA 3NO5A 4LU0A 2YCEA 3KVKA 4TR9A 5CPMA 3UQNA 5EA9A 1YXCA 1K7FA 1JCYA 1FCUA 3OVRA 1GVRA 4YWIA 2NWSA 4FXSA 4GBUA 1W8SA 1JRBA 2ZRXA 4DBEA 3ABQA 1W54A 3HO8A 5DXYA 3KX6A 3T44A 4MJZA 1M6JA 3ZR4A 3ATZA 3QMSA 5F4XA 2P0OA 3IVUA 2J9YA 2OZ0A 3LRLA 4IMEA 1EP1A 4O1BA 2H8XA 4JTJA 3FYOA 4N6EA 4CNNA 1GTHA 4NX0A 4E0CA 4FX8A 3LM7A 2FB3A 1SFLA 3UWQA 2J27A 4GUIA 1VQTA 3GYEA 5LNSA 2CZDA 4HPJA 2A7NA 3MJYA 4Z1BA 3TIMA 3NQEA 3LHVA 5AN7A 4PCFA 3RMJA 3QC3A 4AMAA 3DBPA 3O6CA 1GZGA 4HIBA 1EP2A 4OQVA 3TXVA 1A5CA 2VFEA 1ZFJA 3L0KA 2GVLA 4NU7A 1GJPA 4UXDA 2BTMA 3IEBA 3A22A 3HG3A 4O4VA 1JCMP 1BTMA 1PE1A 1YPFA 1OVDA 2DP3A 2B7PA 4IQLA 4LS0A 2ZQ0A 3TKFA 4YXGA 1K8YA 2TPSA 3M43A 3Q37A 5CSSA 2C0AA 4TIMA 1TQJA 3NVTA 3STEA 4UR8A 2QF7A 3P81A 1EP3A 3KAOA 4YCPA 1KA9F 3HGOA 4RK8A 5CZSA 3GXTA 3H54A 2FIQA 4PEKA 4Q33A 4JN6A 2O7QA 1G4PA 1Z44A 4ZQMA 3VNDA 2EKCA 1ICSA 3GVGA 4UMCA 3P8IA 2FPTA 4BWLA 1AMKA 4R7JA 5FF4A 1VCFA 1AW2A 2Y7FA 1AL7A 3PULA 2E6FA 8TIMA 5TBOA 1ME9A 2A6LA 3BG3A 3W1QA 5D33A 1OFAA 3UWZA 1TJPA 1HFBA 3W2JA 4QISA 1YDNA 4JTKA 2G5WA 2YSWA 4ZMGA 3R5EA 5LHFA 1SO4A 3IIXA 3M5YA 4ORMA 1IXOA 5FEXA 3O63A 5E1QA 4JTIA 1A5BA 4JDYA 1TV8A 5G1TA 4WQ6A 3S42A 2V82A 1KV8A 1KM3A 3DFOA 3G3MA 1VRDA 1O5XA 3M9YA 4LW7A 2C3ZA
chains in the Genus database with same CATH superfamily
2UY2A 3W1PA 4Z0SA 3S5YA 4NF7A 3ARPA 2VEKA 4IMCA 2GVGA 1LRNA 2XVKA 4O19A 1LROA 1XH0A 4L4OA 1AUSL 6REQA 3M46A 5BXRA 5LZLA 1ITQA 4H41A 3W72A 1E9ZB 3S9YA 5F2LA 4V2XA 4NJGA 1FWEC 4JGDA 3OG2A 4S3GA 4FK9A 3WLIA 1TRIA 2GSJA 2X0HA 4QAIA 2OG9A 1VPQA 1XLDA 3L2LA 5ECUA 4XD3A 3B8WA 3DZ1A 3R11A 1OSEA 1ZCOA 3WLQA 2HDJA 3NZQA 5C7VA 4L65A 3PPGA 1CT5A 1JZ8A 4HGXA 4IL0A 1DJWA 2A3BA 3NZRA 4YTTA 4QE4A 1TVNA 4I7WA 3TSBA 4LV9A 1SSGA 3V3WA 1Z42A 1GKQA 1HKKA 2FPYA 3WBWA 4XBJA 2GK1A 2J6XA 4U5KA 2Z7KA 3H55A 1XYFA 2PLMA 2XFFA 3L12A 3BAIA 1ML1A 3TCSA 2V8ZA 1EC9A 4AFYA 1OFBA 4YTUA 2IQ0A 3VIIA 4C6PA 4Z17A 2NSOA 1LG1A 4OVXA 1GCYA 3WBXA 3IIVA 1O95A 2DZXA 3W76A 1P1XA 1XM3A 1ZAIA 3DG3A 3RDKA 3SFWA 3TTSA 4PFHA 2EG8A 2YL8A 3C3NA 4QGCA 3EWCA 4EF8A 3QKEA 5KETA 2BP1A 2D2GA 2E6AA 1AD1A 1EJWC 2ZFAA 3NIYA 4Z1CA 4KCWA 1S3TC 1AVAA 2OYMA 3PUDA 2PBGA 1TPVA 2QCMA 2YCLB 3DKJA 1R3RA 1D3CA 1A80A 1V3LA 1XISA 4NP7A 1FKXA 5HK4A 1NWTA 1EPVA 4PUWA 2OXNA 4LAUA 3H23A 2QAFA 3NQ8A 1L0PA 1GW9A 1UKQA 1I1WA 4KFPA 2BX7A 3PPHA 2VM8A 2BOGX 1XHGA 3Q58A 1KM1A 5I3JA 1C90A 5I78A 3OB8A 1TA3B 2IMRA 2XN2A 5HWMA 1WKYA 4MJ2A 4WOQA 1J10A 3MBDA 4NAEB 4JZ5A 5CPOA 3QYSA 3G8RA 3M5XA 3A6OA 1DTUA 1ME7A 3GC2A 4L56A 1QO2A 1VIWA 3SN0A 3IJ6A 3QSTA 3WQ5A 3KLLA 3W23A 1Z69A 1EDGA 1DJNA 4O50A 2V6AA 1XFCA 1LORA 3ZVHB 1TSIA 3PVFA 3CLWA 4S3EA 5TD4A 4K7YA 2D0FA 5TQLA 2O9TA 4HOWA 1PX4A 1XLLA 4M29A 4CEUC 5CBJA 1R3YA 3G2GA 1VJIA 2W92A 3THAA 1KRCC 1KTBA 1H0GA 5FESA 4AY8A 3SY5A 4AX7A 1FWJC 1VYPX 3UCQA 1LT7A 3OJGA 3N15A 5HJXA 1ZAJA 3OPSA 3ZT7A 4O16A 3NM3A 4Y90A 4C6KA 1LM1A 3HV9A 2VO5A 3VU2A 3AXHA 3G1FA 2G37A 4AAJA 2WSQA 3VILA 1GVSA 5PTDA 1PKMA 4L4LA 1E9IA 1QI2A 4KFOA 1GZ1A 1YXYA 4JCLA 1PWLA 3TQVA 4MB1A 3VINA 4XVEA 2CC0A 4MWAE 2ATMA 3B0VC 2EXOA 4B90A 1QPOA 3FKKA 3TN4A 3ZSTA 3VIJA 1V79A 2VUYA 5AHMA 3NQ7A 5SWUA 5A6JA 5IFPA 4TQTA 4MY1A 5HANA 4L5ZA 4R88A 3ZJ6A 1ZPTA 2VFIA 5IXEA 3PY2A 2TMDA 5C54A 5CKSA 2J8GA 1I2OA 1REQB 1VP5A 1DWAM 1F8MA 3FAXA 3VFCA 1KGWA 2QW5A 3SY8A 1MNSA 1A47A 1IT0A 4AWUA 3GG0A 4QLKA 4QBXA 4NKCA 3SCTA 2HXUA 4LSBA 3HPAA 4NSBA 2KZHA 4Y9PA 8RUCA 3BCJA 3EOUA 3AISA 1SW3A 1XCFA 5FJTA 3PWAA 2ZUNA 3KVJA 3SZ8A 4H00A 3S5OA 3UYCA 5LNRA 3E2QA 1H3GA 1UC5A 4ZB2A 1UZ1A 2WJZA 3BW4A 4Q7NA 1J12A 4LGXA 3S1UA 3QSRA 3GM8A 3TUUA 2RDXA 4D6HA 3GXDA 3K4AA 2YOCA 1HP4A 2OO0A 1HN1A 3TZFA 4O1DA 2GVYA 3S6DA 4M81A 2VCAA 4UIOA 4MNLA 3UVAA 3L5MA 1F3TA 2YLLA 4WEVX 1RK5A 4PUMA 3Q45A 1J79A 3WLTA 4ALDA 3GIYA 4RKAA 1PDZA 4GH1A 1UD6A 3WD4A 4M19A 4IG2B 3WFAA 2A21A 1YNPA 3E96A 4RL3A 5DFAA 4BF7A 2KX9A 3AAMA 1DKWA 3EMQA 3FDKA 1CGTA 5EPDA 3O1NA 4UMBA 1Q6LA 2PDWA 2VZVA 3EWBX 1WV2A 1FCQA 3QGAC 3SCWA 4WOZA 1TUXA 3R8HA 1XC6A 1V02E 5HR7A 1NEYA 4K37A 2PWEA 4HNLA 2W91A 3QPZA 4DWSD 3UF9A 4LALA 1CLXA 3DFSA 2F6UA 5G1MA 3CZLA 4FX6M 3KXQA 1Q6RA 4F0RA 2JEPA 3CMGA 1GJUA 2WJFA 1SM9A 3TTQA 4C6DA 2X1UA 1BVNP 4BFAA 1D2KA 4RXFA 3UG8A 1I9CB 2ZZ5A 1T8QA 4H9VA 5L9FA 2G96A 4FOUA 1EZ2A 3OP2A 1MW0A 1US2A 1AZ1A 4L9YA 2VMFA 1YDOA 1TPH1 5CPQA 4HU4A 3TN6A 4GIRA 4ATDA 3B9NA 4O28A 1V3MA 3CNYA 5AC4A 4KEUA 4C1NB 2XYLA 4NIRA 1RA5A 2WNWA 2IKGA 1A50A 4PTWA 2DSKA 1HKVA 2F2HA 2WMJA 4Z0JA 3TMLA 4E2BA 1QI4A 4XTIA 1KTCA 1XGEA 4DJFD 4HMCA 2X2YA 4Q6XA 2WC4A 3EX1A 2YCKX 4EAMA 4DF0A 5D8ZA 2E9LA 2ZWZA 1BRLA 4NZ3A 5HMSA 3N73A 3GG1A 2J9ZA 4IQEA 3WEOA 4RUBA 2CZEA 5EB8A 1LOLA 4Q4MA 5AVHA 4DBUA 3W6MA 2QGYA 3GC4A 3NL6A 4YVXA 5M03A 4OT7A 4WHBA 2PTWA 3WUBA 3W1RA 1CXEA 4OOUA 5FKYA 2PC8A 3NQCA 3USZA 3E74A 4K1WA 2F38A 2CESA 3BG9A 3D6NA 3QZAA 1RJRA 3CQ0A 3G1AA 2G3MA 5A6BD 4IGSA 4LAMA 1Q6OA 1SZEA 3EKZA 4X9YA 2BZNA 2CLKA 1Q7ZA 4S3FA 4YMZA 2FB2A 1ZALA 2JE8A 4ERIA 1XYBA 4YL2A 1P1MA 2WMIA 1C8XA 2ZICA 3WO8A 1LL6A 1REQA 2I1OA 4F0LA 1GTEA 1B3YA 1GQLA 1R3SA 3VAVA 1MZHA 4P7OA 3VGEA 4O1CA 1JQXA 1UBSA 2QYGA 1OYAA 3NDOA 1GKRA 3M7SA 3GDKA 2O55A 5REQB 2OSWA 5CSUA 5BRPA 3REQA 4WLCA 4CD6A 3GIPA 4YVPA 1ZRQA 1KD0A 1JD7A 4HCHA 1JYXA 4I9AA 4Y96A 2NV1A 2HNHA 2OLSA 1JUKA 2V68A 1EPXA 3VUPA 3BJTA 5FF2A 3SAZA 2X41A 2DSZA 4A2SA 3GH4A 4K38A 3W7IA 4IIHA 4Z1DA 1TV5A 1TUFA 1PWMA 3HPZA 5DO8A 1JF5A 1LDCA 1K8XA 1UUMA 1Z41A 3ES7A 3LS9A 3ARQA 3N2MA 4Q8NA 1MZRA 2PDLA 3LYEA 5C9ZA 3AWOA 1AW1A 1VEPA 2CU0A 2NV9A 3EOLA 1GQKA 4IP4A 3LDVA 3AHVA 5JQ9A 3AWNA 3NUKA 1W31A 3ID7A 1HUVA 1NF0A 3NZPA 4DUOA 3G1SA 5DMNA 5KZMA 1OZQA 3II1A 7ODCA 3LLDA 3LQGA 5BU9A 3ES8A 3O9NA 4MDPA 5AZ1A 2PDCA 1PVNA 3K8MA 4LT9A 3QR1A 1TX2A 3KOXA 1CDGA 3S4TA 5EL1A 3AHTA 3QY8A 1Q45A 3UXLA 4BQ3A 3CHCA 3M47A 3M0IA 1OX4B 1UP0A 3U5YA 1PHQA 3QZEA 2VEMA 3U4AA 4P7QA 4DF2A 2YA0A 4C5ZA 2WHMA 1L8PA 2OZTA 1G5AA 1OF6A 3VDCA 1KC7A 3BLDA 1ZB5A 4NNAA 3HA1A 3SQLA 4JOMA 1JZ5A 1BKSA 1J2BA 3CEPA 5E0FA 3C0LA 3M0MA 3PS7A 4WSKA 2O7SA 5EKYA 1F07A 2WKLA 4AWTA 4HNNA 4UR7A 4XX6A 3G8EA 5U4NA 3WK1A 3WLPA 1TJ0A 2POTA 3LV5A 1JPIA 1OHLA 3NM1A 1J4EA 1SW0A 2OVLA 2CLHA 1K02A 4IFKB 4DRSA 4KH2A 5A3HA 1KKOA 5E5CA 2Y62A 4D6CA 3VKBA 3O0FA 1QU4A 5GPRA 5CPTA 3L4YA 3QN3A 3M0LA 1JZ7A 2V3FA 5JUVA 4M1BA 5K7JA 3ME3A 1N55A 3ZLHA 5DLCA 4LTSA 1AL8A 4MJMA 2WJDA 3W7OA 1M01A 1ECEA 3IV8A 3QV8A 4Q8QA 4N42A 4H6KA 2QDHA 4NX5A 3CS2A 1AD4A 3E0FA 2ZRWA 3UXIA 3IJ8A 2PTDA 4AUBA 3WZ0E 4I5UA 2X30A 1HJWA 1LQ2A 3BOLA 1AJ2A 3CWNA 4M5PA 2POZA 3CASA 3VE9A 4DJDD 1P5BA 1V0NA 2J7BA 1Q6CA 3DGBA 4L1GA 1XSKA 3RRAA 4JYEA 1NFBA 4ONVA 1NOUA 3HGRA 4EK7A 3MSYA 3EPNA 4NYUA 1XYMA 3G5EA 4E8CA 1UKTA 4AH7A 2W61A 3E5BA 4O57A 4UCGA 2DFAA 4MM1A 2C91A 3NPUA 5F1VA 1IZKA 4LVBA 4GBDA 1A5LC 3EOEA 4WGXA 4A6GA 4EPDC 1R0MA 4F0HA 1AZ2A 4MB5A 3HB9A 5DELA 1YEYA 2AKMA 1E0XA 3APGA 1VIZA 2HK0A 3SW6A 1XLAA 2DUXA 2XFWA 4D1IA 4GYJA 3QVQA 1KQZA 3C8FA 2XH2A 5I0DA 1U30A 5BXSA 3BLIA 2WJEA 1YADA 3NQ6A 4M1RA 4HU3A 4LNYA 2E09A 1EHNA 1MQRA 2X1TA 1C7SA 3VD3A 2BVDA 2XVLA 7REQB 2OZ3A 2Q09A 4FP1A 4LAZA 5IHSA 3BV4A 3RJXA 3EX3A 2DW7A 3T2OA 4NQ1A 2DSWA 4ZXLA 1V93A 3TU9A 4MYAA 3LV6A 4WGHA 5I3IA 3WFLA 3L4ZA 4R9XA 2DVUA 3NPVA 4RE2A 3Q65A 1DWJM 1OG0A 3TQKA 3B0UX 1WXJA 1JPDX 1W5QA 3CV7A 2R8WA 4ECLA 2NVDA 2GVEA 1MYRA 4M7SA 3KOYA 3H2EA 4XV0A 1UWQA 5HBFA 1UR1A 3IUIA 4TV5A 6A3HA 3UZYA 3G77A 3WCZA 2ZYFA 3NSXA 5CC5A 1GUVA 5A69A 1FA2A 2CKRA 1EQPA 1I1XA 2R24A 3TYUA 3VNMA 1RPKA 5T8GA 4XQ6A 3WKZA 3E0WA 3T05A 1WOBA 4H7VA 1JYWA 4GI4A 3GK0A 2RHGA 5E70A 1KM2A 3UNTA 4ICMA 3WENA 3PSWA 1HL2A 3H7RA 5D9MA 4ZZ9A 1U33A 4FF5A 5KZEA 2HMCA 4P7NA 1QXLA 1K70A 3AZTA 1W3HA 3APTA 3GD6A 7TAAA 3QGVA 4DM2A 1W1YA 2XFRA 3HTWA 4BEUA 1OGBA 2ZZ4A 4HHPA 3AYSA 4KIEA 4FO4A 1B30A 3UVIA 4C7FA 2XIOA 2QJGA 1E4MM 1UWSA 2Y89A 4Z08A 5DT5A 2OMAA 3KL5A 5XINA 3ZR6A 3AIEA 2O92A 3RUBL 3W7JA 4W7UA 2J62A 4GY0A 4S23A 4N9CA 1XIGA 1G4TA 4NZ1A 5HDRA 3ZMRA 3B9DA 4DZHA 1XDLA 3LI0A 2NX3A 4ACZB 1SR9A 3OEXA 4NXKA 1MRAA 1TVLA 1KFLA 3WLHA 2WV8A 2YKKA 4MY8A 4PTMA 3V75A 2XJ7A 4Q8OA 1PXGA 2VGIA 4AVFA 2GJLA 4U31A 4LWWA 1MVYA 3SIZA 4D6GA 5KEZA 2TAAA 4PUDA 1TX0A 4OUIA 3RN6A 3GNOA 4CNSA 3GVWA 3LMZA 4QIUA 5CBIA 2VWTA 2F6KA 1PV8A 2ODOA 4FF7A 3E02A 3EA3A 2I9UA 2XZ7A 4CQAA 4PB3A 2ZC1A 4IHCA 3CK5A 3P61A 4AU0A 1W3IA 4NNCA 3VTRA 4B2DD 2JGYA 2DQXA 3ITTA 3WN6A 1DJYA 4V28A 3FLUA 3WQ4A 4B91A 1J11A 3N3MA 1I75A 4RE3A 2XIBA 4RR4A 1EC8A 3HQPA 2HZGA 3UD6A 3L9CA 1UR3M 4AB4A 1PBGA 1YDVA 5LIUX 3CXOA 1P6BA 4QE1A 3TYZA 2ISWA 5BWFA 2QIWA 1RCQA 3VZZA 4AF0A 1N8WA 4CD7A 4O4WA 1UW9A 2C71A 4V27A 2A79A 2OWWA 4WY0A 5FCZA 3QHNA 2FZBA 2OLHA 3VOCA 4PTDA 4PL2A 4AZCA 3ABSA 3W28A 1TELA 1DHPA 1MXDA 1GVOA 3G1YA 3T81A 1QI5A 4OWGA 3ZWTA 4W87A 4IMAA 3BLLA 5GNZA 2PDKA 1DWFM 3STFA 3OYZA 2W67A 3POCA 8A3HA 4NG3A 3IJQA 4ZBCA 1NOWA 2V38A 1UJQA 2INFA 4GINA 3OIXA 4IP7A 1B3OA 2A85A 1O5QA 4QEHA 3W1XA 4POCA 1X6NA 2VDHA 3BAWA 3ELFA 5A95A 5REQA 2C6QA 1FHLA 3GXMA 2DIKA 2D22A 4LCQA 3WL1A 3W26A 3M5ZA 3AC0A 4I5XA 3VDHA 3TAKA 4US6A 3COTA 3L68A 1U1JA 3GG7A 4Y9NA 3ANYA 5FL0A 1ICPA 1DYSA 3F5JA 3RM4A 4R5EA 2WANA 2FFCA 1P0KA 1J01A 2C1HA 2VCBA 5IFTA 3VM7A 3JZEA 2ZC8A 4UFIA 3W22A 4H2CA 3DFYA 4YJ5A 3PUEA 4UTUA 1P0EA 4AQLA 1V6XA 3TMQA 1M7OA 1FWAC 3RIKA 4AZHA 1U1HA 3TX9A 2GUYA 1RCOB 3IVSA 2EAWA 1H50A 4M80A 4BS0A 1Q7MA 4I9TA 3CUZA 3AS1A 3RJYA 3W2LA 3WLNA 3LNPA 2VDGA 4PCPA 2AQVA 3VNIA 7PTDA 2FKPA 4PUJA 5FSEC 1NM9A 2D2HA 5D37A 3EGJA 4LBRA 1QNOA 9CGTA 2BY1A 2FH8A 4GMEA 1D9EA 4V1YA 4HNTA 5HUOA 2UV8G 3WDJA 3W29A 1DP0A 1J0YA 4HHHA 1K77A 3B9AA 4ZTXA 3HIJA 1ZAHA 3WF3A 4Z1YA 3GNDA 2WXDM 3GY1A 2YZRA 4N02A 1J93A 1LLWA 2CYGA 4HSOA 3IJLA 3WH5A 1RALA 1JCLA 4PR4A 3SUUA 3QW4B 4JNMA 2OX1A 1PPIA 4HNOA 4GZEA 3D3AA 1WXZA 3KCJA 1IWPA 4WDUA 3LTPA 2REQA 3FK4A 3BSMA 5ABGA 1TTJA 4F2BA 1ZBWA 4TTUA 1QO5A 2QEZA 2WM0A 1DQXA 1M7XA 1PL9A 4DPPA 3SY1A 1W6TA 5EFDA 1F3WA 2QUVA 4ZCWA 3A3WA 3E0IA 3B05A 1M7PA 1CYGA 1VCVA 4JTDA 1WDRA 3LRMA 4JIHA 1US3A 2NUYA 3W53A 1OEPA 1RSCA 3PTMA 1Q63A 3ORWA 3T7VA 4DAFA 5C5YA 5AYBA 1A0EA 2J24A 1Q6EA 3Q4DA 3SUVA 3T8QA 1V77A 3XINA 4ATLA 3VC5A 1YRRA 3ZOAA 3EX4A 1W3JA 1QI0A 2OOGA 5AOUA 3FJLA 2I14A 3TC3A 2VXNA 1K6AA 1I2RA 4J2PA 1ALDA 3EKLA 1H0IA 3QV6A 4GISA 3L4VA 3GKFA 4JX6A 4O8RA 1GVQA 3CV6A 1KBJA 2V67A 4TX9A 2RJHA 3BLFA 1PZ3A 5C55A 4AD0A 2XGBA 1ONWA 5CZKA 2CZFA 3OQ8A 2BY3A 5LIXX 3GRIA 3TVAA 4V15A 3G6LA 4PBFA 2D0HA 3T1GA 3TC6A 3T4WA 1I8JA 2DZVA 4GY1A 2CLMA 1GOKA 2D69A 2Z6JA 3GG8A 4GYPC 1ONEA 4XB3A 4K68A 3F5LA 4IIGA 2JK2A 5FJPA 3C2VA 1GT8A 1FH8A 1XRFA 5IHRA 3LU2A 2GQ9A 4KEMA 2OCZA 3VYLA 2BVTA 3WNKA 1TTPA 4XZNX 1IZJA 5I03A 3HPXA 2H8ZA 1RVKA 5AYXA 2QKFA 3LTSA 2Q6ZA 3MUIA 1W2PA 1VJZA 2Y63A 2VX6A 1R6WA 2NUXA 2HQAA 1PYMA 3C52A 3KRZA 4AG0A 1QMLA 3T0AA 3EDEA 1O7AA 3O16A 3FJ6A 1EIXA 4AWSA 1V3IA 4QP0A 4MYXA 2WMFA 1FTXA 1M41A 2ZUSA 1QK0A 3AXXA 3HURA 4IISA 5FJOA 4FXFA 3DFPA 2QF8A 2F8QA 1RVGA 1QNVA 3VKCA 5G2WA 4C6QA 1KXQA 1IIHA 1KO0A 3QM3A 1S2VA 2IXUA 2IPWA 3W7RA 1KKRA 4PA8A 5HMFA 3ARSA 1O94A 1RUSA 3B3DA 2E5DA 4IM4A 5HUPA 2XU2A 1P4CA 3NO5A 5CPMA 3ZR5A 3C0QA 3S1GA 1XLHA 3PHAA 3OVRA 3E1F1 1JFXA 2NWSA 1W8SA 1BXNA 5IOBA 2ZRXA 2GGGA 3HO8A 3WQDA 1M6JA 2NQHA 3ATZA 4GNKB 4GZ7A 1C93A 4XZHA 3I3EA 1XD0A 3E3HA 2IKHA 4MG4A 4S3CA 1Z9AA 4CU7A 5FL1A 3VCNA 5BYWA 4NX0A 4E0CA 1SFLA 3UWQA 4LY4A 3UCDA 1KWKA 1XRVA 3GYEA 3V4BA 4FALA 1W9VA 4Z1BA 1A5NC 2A7NA 3MJYA 1XYZA 3GH7A 3RX3A 2E3ZA 1KXHA 1EP2A 4OQVA 4UQDA 1X97A 3BGAA 1F3EA 2BTMA 3NZGA 1D7KA 1UH4A 3A22A 3HG3A 1JCMP 1BTMA 4HJFA 4WKAA 1CLVA 1D8CA 3MA8A 4U3AA 1EZWA 1K8YA 2EJ1A 1X7IA 3QTPA 2C0AA 3STEA 4UR8A 2QF7A 3WD0A 1CXIA 4GVGA 4X0VA 4RK8A 3GXTA 2FIQA 4MF4A 1HKMA 1XX1A 2YCJA 1XIDA 4BHYA 1TZ9A 4GQGA 2EKCA 1ICSA 1UPMB 4UMCA 2YDRA 2J8TA 3AIUA 1VCFA 3B0YA 3CO4A 3PZVA 3CO8A 2MANA 5TBOA 3OGVA 2A6LA 1F6YA 3BG3A 3R8GA 4NZ5A 1TJPA 3W2JA 4XSLA 4QISA 5A6KA 1JEZA 4AZIA 1YDNA 5CH9A 4JTKA 1UD4A 2J4GA 3CHFA 4ORMA 1IXOA 1WE5A 5FEXA 1BPLB 4NAEA 4GO9A 1J8VA 3W37A 1KRBC 4IT1A 3PFMA 2J8FA 3DFOA 5C71A 1VRDA 1EGVA 2E8YA 4LW7A 2PS2A 1ZP3A 3MUXA 1W5OA 3GX9A 2BMBA 3HU7A 3H26A 4M6QA 4A29A 3BZJA 1X1NA 4DJDA 1L6FA 2PDXA 2YZ5A 4HK5A 2DZAA 2A3EA 2YCLA 2BGNE 4QCFA 2YFNA 1EXPA 2VT0A 3OBAA 2YB4A 1ZP4A 2ISVA 4GFIA 2RGLA 4B5SA 3L4WA 3DI1A 2P10A 4KEZA 3UG4A 2Y5EA 3B8VA 3VIPA 5AHLA 1U22A 5BOFA 1SUXA 2EJAA 2DIJA 4ZOEA 3RPTA 4CQ8A 1Z3NA 1B1YA 4FIRA 3HF3A 1OCQA 4I3GA 1XR2A 4CCEA 4Q4QA 4UFJA 2DUZA 5ABFA 3QW3A 2PCEA 3CUHA 1XINA 4CVWA 1JCTA 2P3ZA 3ZS4A 4UBPC 2QS8A 3F1QA 1IWAA 3O2LA 1CGWA 3IGXA 2E8ZA 3CV2A 3N6QA 3LZ3A 3WX7A 1O6IA 4ZR8A 1BRLB 2ACUA 4XUYA 4PRRA 4UUIA 4IPJA 5A5WA 4FMVA 2REQB 2J9XA 3RMEA 4NVTA 3RRXA 2H9AA 3W7DA 1NIUA 3NYZA 1TPC1 2VR5A 4Z2LA 4GWEA 3N9KA 3U6WA 4H9ZA 3GB6A 1YBQA 2X1SA 4KPLA 4AD5A 3VOGA 3L4XA 4D71A 1ZUAX 2GSEA 5JBEA 3L4TA 4DJFA 4W86A 2E28A 1H7OA 4B5VA 2Z24A 3KHJA 1SMDA 2FZ9A 4CVUA 1FX6A 2OJPA 1OY0A 2ALRA 3UY7A 3FEQA 5HJYA 3M6YA 2XIQA 3DGRA 4O1EA 1U5JA 4J3UA 4J3SA 3SCSA 2NX9A 2Z25A 4QNWA 4JEJA 5F2MA 5FJUA 4HA3A 1LBMA 2NXIA 4W8LA 3W2UA 4XZMX 4BI7A 3H12A 3H24A 5ENLA 2WYSA 2FHFA 4KGLA 4DQWA 3TLLA 3AICA 3LTYA 5KZ6A 1FUYA 3W87A 1E1CB 2Y6ZA 5FJRA 3TAOA 4ZE4A 1TR1A 4HPNA 4LVGA 3PZTA 2GZXA 4GXWA 1NDZA 3HQNA 4LPCA 4J7RA 2AGTA 1B2YA 3OZPA 5AHNA 1JXKA 1JD9A 1BXBA 2BDQA 3B8TA 4TVCA 1NF7A 5D09A 2GJPA 3KTSA 3CLMA 3QKZA 4CQCA 1EEPA 3M6DA 2ONEA 2Z1VA 3C6CA 3ITOA 1QW9A 4JTAA 3GU2A 4A4AA 3R4IA 5I24A 2QULA 4YS1A 2PTZA 2IKIA 4NYYA 1RQEA 4YTSA 3AZRA 3VM5A 2Z2UA 1VLIA 4DO5A 2W5FA 1EHAA 3G1XA 1FWCC 4MIMA 2OQLA 2V2DA 2CHOA 5AECA 1UD5A 5LNWA 4GOAA 2PE4A 2GWGA 2XTKA 1HQTA 2PDGA 2DY3A 4D8ZA 4E2DA 2OSYA 4L64A 4ZO6A 2WNQA 4NZ4A 4F0KA 1E15A 1UQZA 3CYJA 2WSRA 1QBAA 4PTXA 1ADSA 2DUAA 5DF0A 5C9XA 3BK0A 1JCJA 1E43A 2WQPA 4XBSA 1ISZA 1SYTA 1PX8A 5AHEA 3FY1A 3TN5A 2R82A 1TB3A 1EYWA 7TIMA 2WQDA 1H60A 3M0XA 1PZ2A 4LUYA 1UP2A 4J9JA 3I7RA 4LYRA 4ERAA 4W9TA 3RG6A 4HZ6A 2ZCGA 4LYPA 4JIRA 2BXZA 2VRKA 5I3HA 4N9BA 3IJ7A 4MAZA 3P14A 4DXXA 1PKNA 4HNCA 1CLKA 2G97A 1SZNA 3B8UA 1OFDA 3NEVA 4A3QA 3N2BA 1YPXA 3PZMA 5G1YA 1XYAA 4DLFA 3UNDA 4O54A 3IWPA 1PB0A 1UASA 4D8AA 4RZ4A 4QDPA 4KGJA 1YW1A 3MHFA 1VFUA 5DN1A 5AVNA 3MUY1 3ABRA 3UR2A 3F5KA 2R6OA 3DYPA 4X3ZA 2RH9A 1IGWA 3E12A 2SFPA 4ZOAA 3ZM8A 4IJCA 5CLTA 3QC0A 1IHIA 4KWSA 2WKGA 3N34A 3L66A 3M0YA 3E6EA 5HINA 1HTIA 1LWJA 3PNZA 2E1WA 4TO8A 2DJXA 3HGJA 3VD7A 3EZ4A 3ABZA 1GW1A 2HPMA 4UZUA 2GDVA 3WQFA 3SCVA 3SSJA 5I2UA 1EJSC 3GBDA 3NQGA 3W2KA 1IT8A 2V5BA 3BC9A 5FSDC 3EDJA 3GO2A 4PMQA 3LB0A 3I10A 1HKWA 3LPPA 5E0KA 4D8LA 2TODA 5E93A 1NJJA 4KWWA 2CLFA 1K7XA 2MUCA 2BY0A 4PH6A 1GQIA 4PMJA 4HMDA 3BWWA 1EA9C 4GA8A 3IUDA 3OHIA 3E38A 1ZLPA 4S2CA 1QPNA 4Z2HA 6XIMA 3UXKA 2F61A 4O12A 4CUCA 2IUZA 1S2AA 1RHCA 2V9DA 2P53A 4FI4A 1P6WA 4KETA 1VPYA 5CPNA 3R8RA 2HBXA 4RW5A 2AL1A 3W01A 2V3EA 5CGQA 1R85A 1L8NA 3JR2A 5XIMA 5D05A 4GUJA 4A22A 4LRSA 3CH0A 4LC6A 3UJFA 3GU1A 1RZMA 1FDZA 4AIEA 3STCA 3FXYA 3D5HA 2BODX 3VK5A 1BF2A 2X16A 3GAKA 4UTJA 3FFSA 3LCFA 1QR7A 1V3KA 1AFSA 2ZTKA 5TNVA 4EPBC 5F4SA 2WOQA 1HNYA 2Y85A 1I2PA 5BXTA 1JG9A 4LFYA 2NT0A 5HQLA 3WEZA 4AXKA 3M4HA 2HPIA 1TMLA 3W25A 1PSCA 1PTAA 3DOPA 4YPJA 4L1WA 3WQVA 4DBWA 3SFKA 3CZ8A 3WDQA 2AL2A 1BKHA 4LH8A 1ZENA 2VC6A 3A3XA 3CWHA 5HAOA 2EPNA 1DIDA 1Y7VA 4PMRA 2E6DA 3W3OA 2E67A 4HYWA 2F6XA 2A3HA 2WZEA 3CJPA 1P7TA 2QUMA 3H6OA 1NH6A 4BI6A 5BZAA 1T7LA 3PPCA 3T4CA 2GLKA 3PB2A 4NJJA 2WO5A 1O66A 2J7HA 4I6VA 1K9FA 2DORA 4AX6A 4S3DA 5I23A 2RAGA 3NTYA 1ZBCA 1BSLA 2J7FA 2OOFA 1WNOA 1H61A 3MQTA 2CLIA 2JIEA 1S1PA 3GH5A 3OVGA 3WDRA 3UESA 3EB4A 3MHGA 2JFEX 5I00A 2FPVA 3C3UA 4UFKA 4S38A 2LLEA 3LPOA 2ACSA 3PZOA 2WHKA 1O5RA 1QNSA 1IEXA 1W17A 1DXFA 4F3HA 4HBKA 3SN1A 1RAKA 4GQQA 1OX4A 2JKAA 1PTGA 2VENA 2UY4A 2AQOA 2VDIA 4ZXOA 1BVWA 3CTLA 3CBWA 1X39A 3O05A 1F7BA 2RGMA 3CZEA 2YBVA 1SR0A 1EKOA 2FGZA 3DFNA 4QS6A 2C18A 4G1NA 1KWGA 3VD5A 5AC8A 1W9PA 2C1IA 1QPQA 4RPPA 2B4GA 3GTIA 4RNHA 1ICQA 3EXSA 3SADA 5G5IA 1WKEA 1XUZA 4QFUA 1A5OC 4CQDA 3BOXA 3EDFA 2INZA 4ZL1A 1FCBA 3ALGA 3V1PA 4DI8A 4NASA 5DBTA 4ENLA 1GKPA 5K9XA 3UERA 1SSDA 4JQ1A 1W3KA 3CUFA 1US0A 1RJQA 2ZRVA 1BEUA 1Y5WA 2I56A 4LF1A 3WQWA 3NYDA 2D24A 1BG4A 2OEMA 4MZ1A 3SBFA 5MF5A 4C1LA 4MJ4A 2CBUA 4I5RA 1HJUA 3CAQA 3R43A 4JQ4A 2E4TA 4GJJA 4F4RA 4PMUA 1XPGA 4HZMA 3CB8A 1OFEA 4FR6A 4ZFMA 3LHYA 3SGZA 1JR1A 3W1MA 1J18A 4CD5A 3MDWA 4GXMA 3W86A 2VNCA 5A8NA 4ROQA 4CCZA 4KS0A 1G69A 1Q6QA 1AK5A 1R8LA 3F4VA 4NNBA 3HGSA 4LXFA 1E0VA 3UXDA 2D0GA 2VQUA 5C6MA 5K2ZA 2J7GA 3HJZA 4QG6A 1G7VA 1LWHA 5BMXA 3U8GA 4YYFA 4BEQA 1TREA 2PWDA 2AAMA 2G3NA 3RX2A 1YTEA 3TV8A 1SGJA 1OJXA 2P50A 2FDMA 2WVSA 4EXAA 2HJPA 2ON3A 1DJIA 3MV11 3RLHA 1M03A 3DYOA 5A6AA 2PBOA 3QR3A 3AO0A 2HBVA 2PZNA 1J2WA 2GDQA 3MSGA 5HPOA 4XKYA 2IPJA 4DY1A 1L9WA 3QRHA 1XIBA 4G5DA 4Z2KA 2YCIX 2BY2A 1LRTA 1Z48A 4LF2A 1IXQA 3N2XA 2GJNA 3CHEA 1BYBA 1OF8A 1FWNA 3LGGA 4G1KA 3LERA 4EPKA 2VC5A 3QPEA 5U7SA 4DJDC 1T6MA 1W2VA 1MFUA 2ZUWA 1XC4A 2VOTA 3K5XA 1C8VA 1OD0A 1VJSA 3MWCA 2B0MA 5T91A 1AH4A 5LNVA 1MNZA 3NOEA 4A35A 4D72A 3MPGA 3KW3A 3G0SA 2BOEX 2QPUA 1CNVA 3BMXA 1FHUA 1X6UA 3MMUA 1WDWA 1UMLA 3CU2A 1AQMA 2Y7GA 4J3ZA 3E5PA 4C1KA 2NXGA 2UY5A 2DT2A 1PCWA 3LHUA 2VYOA 4DXVA 2V0TA 4I6KA 2PMQA 2I5QA 1KRMA 1S1RA 1VFHA 3PBGA 1T41A 1I0DA 2A0NA 2NQLA 4AYGA 1YNQA 3NR0A 4I8DA 1L6WA 5D30A 1XS2A 3NAVA 2ZDSA 3M0VA 3VGBA 1OABA 2HE8A 4QJ3B 5AYYA 4W93A 1TO3A 3C2FA 3BSHA 4KT2A 5EU9A 3LQLA 2JKPA 3FN9A 3UJSA 3RNDA 2A6NA 2GDUA 1GYLA 1S2TA 1PX3A 2RDTA 2I16A 4DUXA 2YJQA 1DQWA 4JX5A 3T2PA 4EOUA 1RY0A 1OX5A 2GFTA 2XIIA 2DDXA 4Y9OA 2ACRA 1LG2A 3B4YA 5HMDA 3MV01 1P0NA 3MB9A 3G22A 4QTGA 4URIA 1TWZA 4FLRA 1MDLA 3MT1A 3H8AA 3SEPA 2NZLA 3JVAA 2V5CA 3TTOA 1S5VA 3TNBA 3AMGA 1I4NA 3JRKA 2YYUA 3UZJA 4BR1A 2ZOXA 1EJUC 1EA0A 2PDPA 3R94A 5FJIA 3WBEA 1F6PA 2PDBA 1E0WA 2J6VA 4I90A 3DESA 3MC5A 3H2OA 1FFQA 4LEFA 2G3JA 4Y6GA 5CJ5A 1Z32X 1X8FA 2Z1BA 2QCDB 3NL3A 2EPHA 1SPQA 4AF0B 3MI2A 3S6TA 2FDSA 4UTWA 4IIEA 4OBSA 4ZO9A 3VDGA 3BG5A 5K3VA 4WY0B 2PGRA 1IT7A 1DVJA 1SU5A 4PE8A 1W5NA 4MWAB 1Q8JA 3MKVA 4MHBA 3PBUA 1CGUA 4WR3A 1QAPA 3QXBA 1L6GA 9XIAA 3P3BA 1S2UA 2Y7EA 3LGDA 2AOSA 4P61A 2CBJA 3NQAA 4CLMA 1ITUA 1HKIA 1V6VA 2YDSA 2G95A 1TR9A 2BFGA 1W5MA 2FMOA 2GJXA 4H6QA 4B4FA 3KBWA 2VOMA 5DBUA 2Q71A 1ESWA 3P82A 4AXNA 1KM0A 4US5D 2E0PA 2OX4A 1EFZA 3VABA 1FP8A 2PUZA 1JXJA 5BOEA 4QDWA 5DY3A 5C2XA 1TZZA 3V5CA 4HZ8A 4J3XA 4M56A 1U2YA 4KESA 4A3RA 4AIBA 4P8WA 3WJWA 1J0JA 4O0KA 3FX4A 4ZQOA 5EMMA 4JTHA 1K1DA 1J0ZA 3IUHA 4XZLX 2B31A 3SSZA 1K4GA 1MQPA 2VTFA 2V5JA 6ENLA 2MNRA 1KNWA 3S9ZA 3A4AA 4RXGA 3WY1A 4RZ5A 1MEIA 4MB4A 3N9RA 3W1TA 5IBXA 7REQA 3C8NA 3TYEA 4WXZA 1UWIA 1FWIC 2QCEA 3T0BA 1OC6A 1ZCCA 1HF6A 1J0HA 4AMCA 1WA3A 3VGFA 2QCFA 3T09A 3BTNA 3HMCA 3LG3A 4W7VA 4UTHA 2PODA 3KP0A 3UR8A 2FHCA 4S3JA 2WSYA 1L2QA 4FHAA 5M2FX 1ONRA 1OGGA 1HO4A 1GVFA 2E77A 1E6SM 3WEMA 4IPNB 4N9DA 1I0BA 3ARWA 5M17A 2J7CA 2Y1HA 4OUEA 4IZGA 1XIMA 3R0UA 3CQJA 3TQPA 1ITCA 5D9PA 2G3FA 1WQ5A 3FSTA 2WC3A 1XLEA 3HPSA 1BGAA 2WPBA 2YL6A 1KCXA 3KBNA 1XW8A 3HFTA 3IK4A 2ZX5A 3GVVA 2Z1SA 1A5UA 2R1KA 1R9XA 4FXRA 4JS3A 2PD5A 3V7PA 4Z42C 3DFHA 3VC6A 3ALFA 4GIEA 3ATYA 1EJRC 8XIAA 1NP2A 1WUEA 3FGCA 5D2VA 1BHGA 2OZ8A 4UTTC 4MB3A 4JIEA 3URQA 3SCUA 5GNXA 1RXOB 4UOZA 4HHLA 2HXTA 4HU8A 2BHYA 1TPDA 1VFOA 2QJHA 2QT3A 3MHUA 4LUIA 1A4LA 5HA7A 3V0SA 2NX1A 2OEJA 4YU1A 1D3HA 3GR8A 3B8SA 4GNJA 3U7BA 4XZBA 2G4JA 4UQEA 4FNRA 1XUUA 3WQEA 1IZCA 1I6NA 2BBFA 1XIFA 1XLKA 2A7PA 1XQLA 1QHZA 2A4AA 2VI0A 2CWXA 3EWWA 1WOAA 1B9BA 1N8IA 3NO3A 4KWVA 4F0MA 4PSRA 3R6IA 6REQB 3A4JA 3RFAA 3A23A 2PI6A 3B9EA 3WF1A 5FD0A 3DKLA 1R87A 2QCNA 4D6EA 1J5SA 3UA3A 3GBEA 3UY8A 3VIFA 1X1ZA 7ENLA 1VFMA 5HXMA 1CB2A 4N4PA 2C19A 3NDYA 4PUKA 3RK8A 1T8XA 4PFMA 4A3UA 3RCYA 1B9ZA 2O4MA 3RAOA 1GEHA 4C7GA 3CL7A 4NI3A 2X0SA 2W4XA 2HS6A 4OTKA 3TJLA 4XIMA 2GVJA 3IGHX 4P7RA 4UMAA 4LCSA 4ZB5A 3LY0A 3LBOA 1DJGA 3VXGA 1R3VA 3FAWA 4BQ2A 1JULA 3G6MA 5DRIA 3BW3A 4JTRA 2ZZ3A 3A5VA 4AEOA 4Q8WA 4Y8FA 3GW0A 4B3ZA 4DPQA 4GK8A 2ZX8A 2W9MA 2JQXA 1EDTA 4AEFA 3AUJA 3SO7A 4ATWA 1XDJA 3HBLA 2G4FA 3UT0A 2EG6A 4M6UA 2ZADA 1KLZA 2G41A 3ISIX 4B16A 3USBA 1JL8A 1WCGA 4DJEA 3VNZA 4NAFA 4YCOA 2C8NA 1MXGA 3WMCA 2ZUVA 1F8IA 2DH3A 1XIHA 2VFFA 4I9MA 4GQBA 3MKCA 3S46A 1J0KA 4AY1A 2VEGA 4YTQA 3LSBA 4MZYA 2WVVA 1SO5A 1FWDC 1I60A 1XGZA 3TNOA 4CU6A 4OV4A 4MNMA 5FAGA 2BVYA 1XG3A 2OQHA 4JL1A 3HQ1A 3KLKA 4OE7A 1NFPA 1YQ2A 3CPGA 4D6FA 2Q3OA 1E0TA 3MCMA 5HNUA 2WAGA 3ITXA 4IMGA 3PANA 1EDQA 5FI8A 4DJFC 1UUQA 1LYXA 3G1VA 4Q8MA 5F4WA 2VR2A 1VGAA 3W7KA 2A5HA 3LEPA 1CIUA 3W74A 3U48A 3TWBA 3CMFA 1YE6A 1EO7A 2WZTA 3ONCA 2OR2A 3HOJA 4ZE5A 4ML9A 3DIPA 3W83A 1FWRA 2EO7A 2ZUUA 2OYKA 3F4NA 1V3HA 1Z7AA 2Q8LA 1M53A 3EWDA 4W84A 2I57A 1C8YA 2PTXA 4A21A 3GHSA 2YX0A 3RM9A 4LVAA 2WMKA 1VBRA 3U2ZA 2YA2A 3W75A 4GGHA 2FHBA 5FJJA 3SQMA 4WF7A 5BRBA 3MP5A 2VKZG 1OQFA 1E4LA 4B3KA 4C91A 4N4QA 5CPSA 2ZZ7A 1HG3A 4A3HA 3PBWA 3BAXA 1X8CA 4S3AA 1V6WA 3W2NA 1EO5A 4O10A 3J7HA 4UQAA 3W84A 1VCGA 4QNEA 2OODA 1CI1A 5FA5A 4HCLA 1LBFA 1MW3A 3KOFA 3KZSA 1ZJBA 3AZSA 3MWAA 4K1GA 3I7SA 3WJZA 3CM4A 3WELA 1IWBA 3P62A 1EGZA 3KRUA 1FWBC 1KRAC 5I77A 2DV0A 6ALDA 3PTDA 3WJSA 1TIWA 4IIFA 3XIMA 1J96A 4K39A 4LNCA 5I09A 1C9WA 4E2VA 1FH7A 4JTGA 2J7DA 5HNRA 3WD3A 4HMEA 2QPXA 1NWSA 2Y5SA 1XKJA 3SUTA 3T6CA 3B9OA 1V0KA 7A3HA 5D32A 4NRSA 4MPQA 5JXQA 3A21A 3N4FA 3KVLA 5KINA 1JUBA 2J78A 3FJNA 3KVMA 3T0DA 3H2MA 3N9SA 3KL0A 3T08A 5BOOA 2R1NA 5C8BB 3ABOA 4YLWA 2AMXA 3LBCA 3TN3A 4WZHA 3TYAA 1F2JA 3RU8X 4BWLC 4QG9A 4MWAA 1F05A 4MY9A 4TOQA 1K8CA 2WHLA 3LUTA 3OLEA 3ZYZA 4CKQA 1TTQA 4OBTA 4PMDA 1OK4A 3CZGA 1LP6A 4J3WA 3DDMA 3N4AA 4HNUA 3MS8A 3BQ5A 5KITA 1UKOA 1C8QA 4O0ZA 1T96A 3LZ5A 2NV2A 1WAUA 1OCJA 5CZTA 4RZBA 3WQCA 2QDGA 1I2NA 1A5SA 3TW9A 3MSRA 4C5YA 3MZNA 5MHBA 1CGVA 2VEFA 5HATA 2C0HA 3H4GA 2GYIA 1BF6A 3XISA 3VMOA 3SGUA 1W3LA 4MNKA 5CJMA 3CH9A 4TR9A 2D23A 4EE9A 3UQNA 3SCNA 4E3TA 1XP3A 3WH6A 1JCYA 3CZJA 4QLJA 5C7HA 2ZE3A 3ABQA 1VAHA 1NU5A 3ZR4A 4MJZA 3O7UA 1E40A 3QMSA 1IEIA 1UA7A 2P0OA 1E1EA 2OZ0A 3FGCB 2QV4A 4IMEA 4EX4A 2QPSA 3WH9A 1PYFA 4GZJA 3RO8A 5FIPA 1H11A 2XHYA 4HU0A 3SCOA 2BHZA 1GTHA 4H2HA 4B4HA 2R1MA 1F9CA 2ZXQA 2CNCA 3F2BA 4GUIA 3BMVA 3CTTA 2CZDA 3TIMA 1XIIA 1Q2SA 3AJ7A 4PCFA 1U5VA 3CAKA 3RMJA 3K4WA 4P8UA 5I6SA 4M24A 3DN5A 3BCFA 4HIBA 4LUSB 3TXVA 3ZT6A 1MUWA 1UYQA 2ACQA 3L0KA 4NU7A 5HQMA 2UWFA 1G0CA 1WUFA 3IEBA 2QXWA 1OVDA 3RGTA 2B7PA 5B80A 2J7EA 4YXGA 4REQA 2PGFA 3UGRA 2VGGA 1W9DM 3M43A 3Q37A 2D3NA 5CSSA 2VP8A 1TQJA 3NVTA 3S2NA 4YWSA 2XIMA 5ABFB 1EP3A 3WMLA 1KBLA 3TJ4A 4YCPA 1KA9F 3GW3A 3HGOA 3RILA 3K1GA 3WLKX 1SJDA 2EPMX 3H54A 1HT6A 1GOOA 3FHQA 3QLLA 1DHKA 2PFHA 2O7QA 2WK2A 1G4PA 2Y0FA 2EPLX 2XGZA 3VGDA 1BQCA 3GVGA 3M07A 1GJWA 2HVMA 2FPTA 3WQPA 3PPFA 4N0RA 4R7JA 4PSPA 4ZTYA 1IYXA 3OZOA 4ZO7A 8TIMA 4KRZA 3A4WA 2Z00A 3EB3A 4S3KA 3W1QA 3W6LA 4JPGA 4QLLA 3UR7A 5A94A 5EFFA 4P5UA 5CXPA 2YSWA 1MQQA 3CUJA 1KCZA 3TP4A 3O63A 5E1QA 4JTIA 3ITGA 1TV8A 5G1TA 5BROA 3BXWA 3S42A 5MKGA 1EC7A 1KM3A 1B5TA 1O5XA 3M9YA 4PMNA 4DYKA 4Z2JA 1WPCA 1XFBA 3CC1A 1EX1A 2O9RA 2GQ3A 2VUNA 3CGTA 3VNKA 3G1DA 3UPMA 5CC7A 3OGSA 3CUGA 4LB3A 1WBJA 2HISA 3PZ9A 4G9PA 3M44A 4WKFA 1JGMA 4GCAA 2UZ9A 4LX4A 3PJTA 4JEQA 1UOZA 2R9RA 3SCRA 3MVIA 4B9ZA 4CD4A 1E0UA 2OT0A 3N19B 2PU1A 4NT0A 5EY5A 1NWUA 2VX5A 4EVZA 1EBGA 3N29A 3KDNA 1V3JA 4Q7BA 2O4QA 3A47A 4XAZA 1XYCA 1R5YA 3E9AA 3AS2A 2W6RA 2E5CA 1WZLA 3U2EA 4OV9A 2PWUA 3I3DA 4QR6A 3WF2A 2O9PA 3URBA 3R7MA 2CCRA 1CCWB 1OD8A 4GXPA 3IANA 3VO0A 2C13A 2JF6A 2VEIA 1JPHA 4M6VA 4XISA 3LCLA 3QMTA 5M1TA 2EPKX 1P43A 3N25A 2ZXDA 4PULA 5A2AA 4JTSA 1QI3A 1NQKA 3I3BA 3H2FA 3INPA 4WDWA 5C2CA 2E7FA 1CBGA 3PWIA 2QMJA 3WLRA 1HXJA 1BG9A 4FEZA 3P8JA 3W02A 3IIOA 1EWEA 5J8LA 1BVZA 1KW1A 4DHGA 4H6RA 1H09A 1XBXA 3WD2A 1TVPA 2CKSA 2V2HA 3AMLA 5F2IA 3TEVA 4QSFA 4YIWA 1ZBKA 4PRTA 1IIGA 3AHXA 1GK8A 4RCXA 2QAPA 4I9JA 2H6RA 5LGZA 3PJWA 3MYOA 5DCBA 3S5SA 3LLFA 1HJVA 1J5TA 1OG6A 3H21A 4OHQA 3DH7A 3VZYA 4KERA 4W88A 2BB0A 4CCCA 2QR6A 4H6EA 1SJBA 1OCBA 1QJWA 1E3ZA 4NUWA 3FS2A 3O15A 4DWDA 1JAKA 1ENUA 4GX8A 4G6CA 4R9OA 3ZQ9A 2PF0A 3WNOA 6XIAA 1W3TA 5F1UA 3LPGA 1VYRA 1HKJA 1MDRA 4DBSA 2D1ZA 2FZNA 3QTGA 4PGLA 4M0XA 2A3LA 4GVIA 3N6JA 3TR9A 1A3WA 3OODA 4Q4PA 1VB9A 1R7OA 1LJYA 3UXAA 3NJ3A 8XIMA 4LBSA 1FWTA 1GQNA 4NZCA 2P8BA 3EA2A 2XG9A 1E4IA 4JFTA 1ODZA 1UZHA 1J6OA 4FNUA 2Z26A 4LRTA 5CSRA 2NQ9A 2HV5A 3ARXA 2PD9A 2W3ZA 1K6WA 4TU1A 4KRUA 3CT2A 3W2MA 2YDAA 4PEEA 3BH4A 3SQSA 1JQVA 4EKJA 1G67A 3KBVA 3PM6A 3WDPP 1H49A 1ZTVA 4G2DA 1S2CA 1CEOA 1JNDA 4RDVA 1HZYA 3VD4A 1XLFA 2GGIA 4NY2A 3O06A 4J3TA 4WUIA 1AW5A 1W9XA 6PTDA 2FZ8A 1E5NA 5A8MA 4ICCX 1UZ4A 4U28A 2QIIA 4DWSB 2NWRA 3TFXA 3OOQA 1HGWA 3VIHA 4G7EA 5BXPA 4IICA 1V6YA 1WO2A 3PP7A 2QJJA 3ZLGA 3BURA 1TCDA 5HR6A 1OC5A 2YIHA 1FWHC 4WDTA 1XSJA 3SRKA 3DHDA 4QQ3A 1A5AA 4GG9A 4C6MA 1W1A1 1GHSA 4Q7IA 2G50A 3HG4A 2ZVRA 2XH0A 4PCTA 2VFDA 1JJKA 1OWQA 1TJ1A 3TTYA 1PKYA 3P6LA 3EWZA 1LUCA 4AZCB 1XPYA 1JFHA 1B0IA 3T0CA 4IPIA 3N13A 2HVOA 2OO6A 3BAKA 2P88A 1EWDA 4MADA 2EF9A 4ZB0A 1QWKA 1RLCL 1S5WA 3ITVA 1P7TB 4H7ZA 3DERA 4RDZA 2C7FA 4X9SA 5LIWX 3BANA 4O17A 3HN3A 1ZU8A 2C79A 4AEEA 3NGFA 4LQ1A 1H62A 3LCGA 3GXNA 1F3XA 3DEQA 1S5TA 3L23A 2FVKA 1HP5A 3CPUA 1UG6A 3NQDA 3EWYA 1QPKA 1KFKA 1RJPA 1S46A 2CHNA 3G1HA 3MYPA 3PB0A 4HA4A 4ZQPA 2NT1A 3CL6A 4JDBA 5GJPA 1R3WA 4Q32A 3RHGA 3PF3A 1UMYA 5E09A 1XJBA 3MP3A 4HT3A 2ZRYA 1PS9A 1TG7A 6CGTA 2IS7A 1MEWA 4GFSA 2VVNA 4WVXA 3VI2A 2AL2B 3QFWA 4GH3A 4JCMA 3W6YA 3JW7A 3GXIA 4DUWA 2NLIA 1DTNA 2QHAA 3MMDA 1JPKA 1DEDA 2Y8UA 3OW1A 2OKTA 1XCWA 4MFEA 3V36A 3MSDA 2V5LA 4H4IA 5JBFA 5T9BG 1QCWA 1G4SA 1BGGA 2RFGA 1UB3A 5TIMA 1AQ0A 4TXEA 3S2LA 4FS9A 3QZ6A 3JUGA 4FOJA 3LENA 4IGMA 2D73A 5JMUA 4K3ZA 2WWDA 5H91A 4HA0A 3STGA 1PJ9A 1E51A 2TSYA 3MMWA 2V2CA 1RCXB 2X42A 5K9CA 3AUOA 1H63A 2WM1A 4ZOBA 4ADSA 4DJEC 4CQ9A 4OGZA 3VKKA 3QHMA 3V0TA 4E6MA 4DNMA 1QOQA 1TFVA 4KWOA 4BI5A 4LVFA 1TTIA 4DWSA 4H9MA 2XDFA 4DNHA 3WYZA 1BQGA 1NSJA 2VEPA 4HA1A 3G0UA 2F2KA 1MXSA 1KM5A 3C0JA 3BMWA 1W9UA 1JZ6A 1W1IE 3M0ZA 2QLYA 1OZMA 3W81A 3ARUA 5F2GA 2VGBA 4IF2A 4V33A 3TYDA 1FVPA 3R2GA 1NAL1 1FCVA 3WNLA 5CG0A 2OT1A 4BF5A 2ZZ6A 1HJQA 2P76A 1HW6A 1YDYA 1DV7A 3VNLA 3RM8A 5A8OA 3KRSA 5KMYA 3EOOA 1KXTA 1O5KA 5LA2A 3OTRA 4PMVA 1RH9A 4O52A 1CX9A 3GVQA 4CCDA 1CXLA 3QH2A 1XQKA 1OC7A 1TPUA 3ARYA 3BQ6A 4JXCA 3TOPA 4FOKA 4EIVA 3WJYA 4NZFA 3N6HA 4DI9A 4GIAA 1XKYA 1XLCA 2WHJA 3EDDA 4D2JA 1DWHM 5FAJA 5M5DA 3C2YA 1PIFA 4Y9AA 1KBBA 2QJIA 3OZMA 3KRBA 3VNYA 4FAMA 1EGMA 4PTVA 1Q6DA 1W37A 1FWSA 5DMLA 2GGJA 3E49A 2PCQA 2X09A 1BYCA 5FEPA 3NDZA 3I4KA 3DC0A 2R14A 4WD0A 2NQ5A 4PBGA 3DHPA 4FPSA 3UPWA 1E5JA 2CETA 1A3XA 4PB5A 4QJ4B 4F79A 1M5WA 3TFCA 3DI0A 3L4UA 3KBMA 5D2WA 3NSMA 1H5YA 5MKGB 1ISXA 4H9XA 1A5MC 4TVDA 3LCIA 4KRTA 4RX0A 4ZQRA 4D6JA 2YR1A 4WSHA 1V0MA 2ZE0A 5DXXA 4OJYA 2EEXA 4DYEA 4L1XA 5A1AA 4LCRA 4LVDA 2PDYA 1EJTC 3LOTA 1EOMA 5DRCA 2VD9A 3AHZA 3KCLA 3IIPA 2ZUTA 2CW6A 1S5MA 1WAWA 1B90A 1WDQA 2J79A 5CZ0A 4E2OA 3ONBA 5D2XA 1X38A 4FLOA 2NUWA 2E40A 1RP8A 3W07A 4K6AA 3AU2A 2PEVA 4XKYB 1UKPA 3SCQA 3CUIA 3OYXA 3TYCA 1E1CA 4IIBA 3VD9A 1LLOA 1C29A 1H1NA 4LS1A 1Q2RA 3L2MA 1S2WA 1KR1A 3P2VA 3AALA 4GPNA 1MW1A 4E4UA 1KCKA 2PA6A 1BFNA 3VDBA 3S5ZA 1SMAA 1POKA 5DCEA 5GNYA 4I7UA 4D6DA 3R13A 4DZAA 5EGRA 3BCDA 3AROA 2P8CA 4MWAC 1VBHA 1UWRA 3SJNA 3PUGA 5A8GA 3OLDA 3MTWA 3N04A 3L7RA 3UU0A 3EWUA 1M1BA 1PTDA 4JYDA 1DJQA 2XSAA 3KWXA 2V5DA 5DX7A 5EMJA 2DZSA 2XSXA 3AJXA 4Q3MA 2VVSA 4JIQA 3K13A 2CFFA 1PEZA 2ZXAA 1UD3A 3M0HA 2DU2A 4Q22A 3NCOA 5HOSA 3S83A 5BCAA 4G8TA 5L6UA 2WC7A 1QPRA 1IEQA 4GHRA 2A3AA 5LGXA 1UWTA 3W1UA 1UHVA 1JRCA 4R34A 4HOZA 1KXVA 2OYLA 1OT2A 2EHHA 3NPXA 4C6IA 3W82A 1VHNA 3ZWSA 1R3TA 1H7PA 1F4AA 1GG1A 3PNUA 4GLEA 2OGYA 1NVMA 3UEQA 3W73A 1RA0A 5AHFA 2OB3A 4TMCA 3EDKA 3AMKA 1VD6A 3AIRA 2RDUA 3FEMA 1W1TA 3BW2A 3MU7A 1GZJA 2Y8VA 3P5YA 4GO8A 4LC8A 1ZNNA 4AD3A 3FYPA 2G8ZA 4OBRA 3WBAA 4QM1A 4QROA 2ABBA 4NJHA 3U57A 4LUTB 1JNEA 1OYCA 4MPKA 4B3LA 1FWWA 5ABHA 1RR2A 2PP1A 4LAOA 2FMNA 3K8KA 5DEZA 1SZGA 4JHOA 4UC5A 2PAJA 3BJSA 5FACA 4DBDA 1JYVA 2Q02A 2PDHA 3GXPA 4I7VA 2XM2A 3M0KA 1AJZA 2QUTA 4LV4A 3UZWA 5EMYA 3TQ0A 1YPIA