3QMRA

Crystal structure of the mutant r160a,v182a of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with the inhibitor bmp
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
219
structure length
219
Chain Sequence
b'VMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTAPERLSRLREIIGQDSFLISPGAGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGIIESIKDLL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title Conformational changes in orotidine 5'-monophosphate decarboxylase: a structure-based explanation for how the 5'-phosphate group activates the enzyme.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus str. delta h
molecule tags Lyase/lyase inhibitor
total genus 81
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2011-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3qmrA00
4WX2A 3Q58A 2YPIA 3EWWA 3GAYA 3BG5A 4HPXA 3EWUA 3B05A 3FJ6A 3MW7A 1PIIA 3W70A 1RD5A 5K4ZA 4QNWA 3G1VA 4S2BA 2NLIA 1FCUA 3T78A 3DHDA 3GDTA 3O05A 5FF4A 3LTYA 2JKEA 3TJXA 3CQ0A 1W37A 1IIHA 2QCDA 4A29A 3L65A 3CHVA 4ZQPA 1TTQA 3C2RA 1A5SA 2QDHA 1I4NA 1JVNA 2YXGA 1KFCA 4Z1BA 2Y85A 3KRSA 3MJYA 1KLZA 3PAJA 5J5RA 1N8FA 4ALDA 5CZJA 4AVFA 2A7RA 2QCGA 3GLCA 4IMCA 4BK9A 5C2XA 2A4AA 3HGSA 2CLEA 1O94A 1H1YA 1WOBA 3I6RA 3PBVA 1FUYA 4GUIA 5U7SA 5E1QA 2W6RA 3KVMA 4LWWA 1ME7A 1WAUA 3UWQA 4FNTA 2UV8G 4O54A 1VRDA 4GE8A 4X22A 3HJZA 3BG3A 3H53A 3LERA 4MLRA 3S1WA 2Y62A 2QCLA 2HS8A 4UTWC 4MFEA 3DFPA 3WJWA 3C4UA 4O15A 1C8VA 2I9EA 1DQXA 4RCXA 3T55A 4MLJA 1KFEA 3RMJA 3LRLA 1TQXA 5CPMA 3NQDA 8TIMA 3G0XA 4ZQMA 3A21A 3NA8A 2G97A 3DU0A 4M7TA 4MVAA 4ONVA 5KMYA 5KZMA 1WA3A 4NJJA 2YFOA 3G0UA 3O1NA 4OHQA 3W22A 4EF8A 3TAKA 4ZQOA 4RXFA 4N02A 1Q6RA 1W5MA 3IVUA 1QAPA 3L0KA 4QQ3A 3N34A 4CCEA 3W76A 4WOQA 2R8WA 3T4CA 3DHFA 1S5WA 3HGRA 3VE7A 2OX1A 2EHHA 2YW4A 3GIYA 4QNEA 4O1CA 5E0KA 3PBWA 1KW1A 2RDTA 2F84A 5BMXA 2A21A 3TJLA 1Z48A 1B9BA 1IXOA 4RJEA 3IIVA 1OF8A 3HG2A 4UC5A 3W7MA 4JTEA 3W2LA 1KFLA 2CLKA 3QH2A 4AAJA 1JR1A 1QPQA 4GBUA 3KAOA 3GK0A 2VFEA 1TYGA 2QCNA 3A9IA 1AL7A 2EKCA 3WK3A 3TK7A 4FEZA 1F2JA 1Q6OA 5I3IA 3W1MA 4MZYA 5L6UA 3W71A 3WK0A 4PH6A 2E1DA 4JTJA 2E6DA 3QW4B 3SZ8A 4FXRA 1LBFA 3W2NA 1HFBA 3UWWA 4ADTA 3A5VA 2E5BA 1FY6A 1OYCA 2FPVA 3N9SA 1KBIA 1XDMA 1K02A 3NQVA 5TIMA 4XUGA 2XN1A 4DF0A 4FIRA 4L4LA 4LC6A 4O13A 3TE9A 5LGZA 1K7FA 3R5EA 2CZDA 1XDLA 4N4PA 5DBTA 3KVLA 1PCWA 1TPH1 3ATZA 5AYYA 3W1XA 1XXXA 4NX5A 3L0NA 1O5KA 5AYXA 2AGKA 4O4VA 1V5XA 1SO5A 3W1AA 1OVDA 2Y6ZA 1XUZA 4LY8A 3DFSA 4N4QA 2VFIA 3G1SA 1TB3A 3NXFA 4ZQRA 5F2IA 3BW4A 1ALDA 2P10A 5D2TA 1EP1A 2FQIA 4O50A 2BTMA 5IM51 3P61A 4UR7A 4IWWA 3W73A 3GR7A 3W07A 5EY5A 3S0CA 3STFA 3HF3A 4L4MA 3NL3A 4Z0SA 4O1DA 4NJIA 4AF0A 1TREA 1Q45A 5DN1A 2BSLA 4IXHA 4AWTA 1YDOA 4I7WA 3DFTA 4UFMA 4UTLA 3W1UA 2ISSA 4O1AA 1W5NA 2NX3A 4X2RA 3NL2A 3UXDA 4WY0A 4EWND 5LZLA 1OABA 3EB2A 4UXDA 3LHVA 4WOZA 4JTTA 4WXYA 1TRIA 3Q2DA 2NUXA 4UUIA 3UQNA 2GQAA 4CQ8A 5DXYA 1JCNA 4M5PA 4ZMGA 4E2DA 3ZFHA 1LM1A 1TJPA 3QSRA 1EIXA 3NG3A 1LOLA 3LB0A 4QISA 3QEZA 1B4EA 4ZVJA 1XBZA 3UYCA 2H90A 4M6VA 4H4IA 4FX8A 4CNPA 4JEQA 1OJXA 5I3HA 6TIMA 4MZ1A 4AMAA 5EMUA 3O15A 3NQ6A 2YGYA 1EEPA 3S5NA 3E9AA 3G22A 4AF0B 4H3DA 2H3DA 3S6DA 3G8RA 2VFGA 3W1LA 2V5LA 3DGRA 5D02A 1Y0EA 3QW3A 1L2UA 5AB3A 1H7RA 3N2MA 2CU0A 1TJRA 5AHIA 3N14A 2Z6IA 4O8RA 1OFAA 2OCZA 3RNDA 1C9DA 1OX5A 2B7NA 3LHUA 2YYTA 1RQHA 1DVJA 4LC8A 2Y70A 2ZQ0A 3MP4A 1G4TA 5MHBA 3KVKA 2WSRA 3TA6A 1VR6A 4MJZA 5A8GA 3K30A 2ZZ2A 2J6XA 1F74A 3L67A 1VLIA 3TSBA 3WFAA 3GKAA 1VHNA 3L5LA 1GOXA 1XI3A 1QPOA 2GJNA 3LHZA 3M5YA 5K4XA 3BGGA 3L5AA 2V2DA 1LLZA 3GDLA 4EF9A 4AH7A 2V82A 4A2SA 1A5CA 3T7VA 3TMQA 2Z0IA 3OVQA 1FWRA 1LOSA 1OG0A 1HO4A 3Q37A 1TQJA 3P7YA 1LTDA 2A6NA 1LLWA 3DFNA 1JQVA 1OF6A 3H54A 1KFKA 5FEXA 5L9FA 3C61A 3RLUA 3TR2A 3S1XA 1U5JA 5HMSA 3GXNA 2NUWA 4DF2A 1QMLA 3LCLA 5J5DA 2J88A 1KFBA 4O1BA 5F4XA 4U4MA 4FNUA 4JY9A 4C1KA 4FB7A 1VS1A 3WJSA 1N7KA 3G1HA 1JCXA 4M6QA 4WQ6A 3OIXA 3EXTA 2NWRA 1ZAJA 2PCQA 2C3ZA 4DO4A 2R94A 3ABRA 1RR2A 3RFAA 3OEXA 3FA5A 1LBMA 5BOOA 4MYXA 3UWUA 1VC4A 1KTBA 4N2YA 2GPTA 3CLMA 1PVNA 3ZR4A 2FIQA 3LBCA 1YADA 3FS2A 4XWUA 1LP6A 3TROA 4YXGA 3S1VA 1A53A 3L68A 3T40A 4A22A 3ZWSA 1PCKA 5HNRA 1H61A 2QUTA 2X2GA 4YMZA 3MO7A 1HO1A 1R46A 2DZSA 5AC7A 1OHLA 1VYRA 1XC4A 2Y7GA 3WJZA 3ZS4A 3BGJA 3DI0A 3SGUA 3W1TA 2G95A 3C56A 3MI3A 3W23A 5G5IA 5DBUA 4ICNA 4UMBA 3B03A 4O10A 1E51A 3LLFA 1FCQA 2V81A 3P8IA 1A5AA 4JX5A 4TIMA 4PODA 3VNDA 2OJPA 3ZWTA 4DQWA 3NYZA 1PS9A 5FF7A 4J9JA 2WV8A 3W7GA 3FLUA 3NL5A 1YLVA 4FHAA 1D3HA 3P5YA 1RV8A 3MBDA 2F7FA 2X1SA 3M5ZA 1EX5A 2Q8LA 2WKJA 1CI1A 5K7JA 3LV5A 1ZHAA 4WY0F 3UWYA 2H8XA 3P80A 1G4PA 1EB3A 4O57A 4RZ6A 3ABOA 3TC6A 5C55A 1UUOA 3PM6A 1Z42A 2J27A 3R2GA 3GXTA 2TMDA 5EL1A 2WNQA 1A5BA 4KFPA 1JCJA 3LI0A 2X16A 4Z1CA 5LNSA 2NZLA 2X1RA 1FXQA 2BX7A 2CWNA 2DP3A 3HOJA 4N9BA 2A1YA 1DJNA 4N9CA 1M5WA 2G5WA 1J2WA 4O28A 5DCBA 3HBLA 3PUDA 4QIUA 1ADOA 1JRBA 2QDGA 3USBA 4Z1DA 4H6KA 2PC4A 3QJAA 1VGAA 1WBJA 3QPYA 4EIVA 4R7JA 1F5ZA 2NXGA 2JKAA 5LKYA 4PTNA 1QNVA 1LDCA 3IVTA 2ZZ4A 1SFLA 3W7JA 4FNSA 2YW3A 2WQPA 4UTMA 2ZCGA 4LU0A 2BWGA 1F6KA 1TTPA 3SR7A 5G4WA 4A3UA 1ZNNA 3KXQA 4UTJA 1O4UA 4IMEA 5AFDA 1VZWA 4JN6A 3EX6A 3LHTA 2V5BA 1GVRA 1T8XA 3IVSA 3IIZA 2E6FA 3IV3A 2V30A 1WOAA 2JK2A 1I2QA 4Q33A 1YTDA 4JDYA 5F1UA 1VCFA 4K36A 3A24A 5DELA 2W79A 4N9DA 4K39A 3M1ZA 4AB4A 2A85A 5T26A 3HPZA 1FCVA 3N73A 4HN4A 3TX9A 1ZAHA 3P84A 3M41A 2QUUA 1MEIA 4QJ1A 3W7HA 3ABQA 1I8JA 1GPWA 5A5WA 3B06A 3NQMA 5D2WA 1W3IA 4FNPA 1GYNA 2ZZ6A 3B04A 3QRHA 4FNQA 2ZRXA 4LV4A 4HPJA 3W7NA 7TIMA 3LI1A 3CT7A 1OFBA 1R2RA 1WQ5A 3DBPA 1LYXA 1YTEA 4JD4A 3QC3A 3O6CA 4FX6M 5FESA 5FF2A 3W7LA 2RHGA 2GUUA 3UPWA 1H7PA 1TTJA 1YXYA 2Y88A 4FO4A 3M5VA 4O18A 3W7DA 3LV6A 2JGQA 4GC4A 4ORMA 2FLIA 3PY2A 4K38A 1IXNA 1KM1A 1JCMP 1OFPA 1NSJA 3SY5A 1AW1A 2ISVA 3ABSA 2YDAA 3SGZA 2VC6A 2B7PA 4LNYA 3OG3A 5SWUA 3L21A 4PL1A 1ICSA 2QCDB 3PULA 4GWEA 3CEUA 3PVFA 2QJHA 3C6CA 1K7EA 4KFNA 1D9EA 3RU6A 2XFWA 4O52A 1ZY9A 3S8HA 2CLMA 2FFCA 4NJKA 5C5YA 2J9YA 3F4WA 1NFBA 1Q6QA 3SJ3A 3PSVA 4N6FA 1DJQA 1JQXA 1M7PA 1AW2A 2KZHA 4HHPA 1HTIA 2ISWA 4UTIA 3W7OA 3FYOA 3LM7A 3PUEA 1QOQA 5HULA 3BW2A 2PRMA 1GVFA 1AK5A 3QYQA 1GG0A 1B57A 2AQWA 4YL2A 2TPSA 4XBKA 1R30A 1VPXA 4HSOA 3W7EA 5D2VA 1XUUA 3BO9A 1GVSA 4YLWA 3V75A 2Q3OA 2ALDA 4K8EA 4LVFA 2DU2A 1PL9A 2C16A 2LLEA 2E6YA 1EWEA 2WNZA 3UY7A 4K8HA 1X6UA 4GRSA 2X1TA 3W83A 4GUJA 5D37A 2ZFAA 1BTMA 1FXPA 1WX0A 1GTHA 2ZRZA 2QAFA 1LOQA 3HGOA 5FF3A 2YYUA 2ZRVA 1GT8A 4OGZA 2VENA 1H60A 1FDJA 3QQ0A 1LRQA 2DZVA 4RZ5A 4UTTA 2VFFA 3HO8A 2Y7DA 3DKLA 5I3FA 1B3OA 1FCBA 1DORA 4UTHA 1FWWA 3OA3A 4K7YA 5G1YA 5AN7A 3I7QA 1QCWA 2VEKA 2ZZ7A 3TSMA 2FTPA 3IIXA 2ZTKA 3OBKA 3R13A 4CQ9A 1K8XA 1TPFA 1P0NA 2PRLA 4IXXA 4RXGA 4GNJA 3SIZA 5D30A 4Y96A 3UWVA 5AHFA 3A5FA 1HL2A 1K7XA 2DORA 3NVTA 1KM6A 2A0NA 3M47A 1T99A 4Y90A 5EPDA 1SW3A 4PA8A 1QR7A 4IUOA 3DI1A 1AL8A 4O4WA 2QR6A 5LNRA 4N9EA 4UFLA 2VEIA 3KVJA 4FX7A 3NQFA 2ZZ5A 5IBXA 3N19B 4QAIA 3PBYA 3C52A 4B5NA 2ATSA 3G1YA 1TPEA 2RH9A 5G2IA 2QF7A 2R91A 3G0SA 3CWNA 5CKSA 2J9ZA 3W1QA 1KM5A 3HB9A 4WJEA 3GDRA 3IEBA 1VYPX 2RKXA 3PB2A 3LGEA 3NM1A 3UNDA 1YYAA 1DV7A 4NU7A 3R89A 1UCWA 3W2UA 2B7OA 1NEYA 1Z41A 1I2PA 5FEWA 1SFJA 1UASA 3N9RA 2ZA3A 3BPWA 4HNNA 3WK1A 4O14A 2JBMA 2YR1A 3I68A 2NXHA 4JYDA 1KTNA 1OFEA 1SO4A 3VE9A 1W5PA 2Z1BA 4IMDA 3HMJG 3THAA 3BK0A 5D38A 5EYWA 4HNTA 4O0KA 5F4WA 4BWLA 1ZCOA 3FKRA 2YSWA 3HG3A 5KITA 1GYLA 4NUWA 1JUBA 2P0OA 2X1UA 3PWAA 4N6EA 4RR4A 4PCFA 1TO3A 3E12A 2RFGA 1PHWA 1QOPA 1M7OA 3W87A 3P62A 3LHYA 1SSDA 2HSAA 3NQ7A 4K37A 2QKFA 4G1KA 1LRNA 5C54A 4WY0B 3BW3A 2ZBTA 3DXIA 4R53A 5CPOA 2QEZA 2WJZA 1A50A 5C6MA 4YWIA 3W74A 3CEPA 1JULA 3LHWA 2VELA 2BZNA 3MYOA 1DOSA 4Y9AA 3IGUA 3B8DA 2XN0A 1H51A 1MSSA 2Z2UA 4NNCA 5LGXA 2PURA 3W85A 1H5YA 3JR2A 3G18A 3M43A 1TTIA 3GDKA 2CLHA 1UBSA 4FNRA 3LCGA 4NNAA 5E93A 2RDUA 4LRTA 3AJXA 3INPA 1JUEA 1JCYA 4ADSA 3I65A 4GJ1A 3OVPA 1KA9F 4FXSA 2CLLA 2ZZ3A 5U4NA 5AC6A 4NJHA 4UFJA 2GOUA 3W6YA 1BWLA 3TQVA 3CU2A 3C2OA 3KOFA 4Z1AA 5CPLA 2E09A 4AXKA 3I7SA 1TPWA 2Y61A 2QAPA 5HJLA 2QCFA 1SW7A 3O07A 1X8FA 2GVGA 4Y6GA 2E68A 2GJLA 1GTEA 1IXPA 3LXBA 2EF9A 4PC8A 3LDVA 3TDFA 5LNUA 3RF9A 1ZFJA 3QMRA 1X1OA 5TQLA 4HIBA 3GNNA 3EWZA 1KV5A 3NQEA 1TRDA 3QMTA 3W3OA 1R2TA 4IX0A 1W5OA 3RLVA 3MP3A 4MZ8A 3TU9A 1W3NA 3C0JA 1W3TA 3EXRA 3PF3A 3DZ1A 1IGSA 3G3DA 2YFNA 3VCRA 3HG4A 4MKNA 2ZYFA 4JX6A 1ONRA 2OZ0A 4NQ1A 2NX9A 5AHLA 2YX0A 4A21A 3EWYA 3E02A 4O17A 4IOTA 1R2SA 3W86A 5H2ZA 4BR1A 4YCPA 1QDSA 1WV2A 4JTFA 1T0OA 4RV8A 2NX1A 1DHPA 2Y63A 4NXKA 4JTHA 3EX4A 1K8YA 1O95A 1TV8A 2C15A 4JIQA 2ATMA 3EX2A 1SZNA 5AHEA 1LCOA 2ZA1A 1KLYA 4TO8A 4MIMA 4JXCA 3AO0A 4C1LA 3UXAA 5K3VA 1W54A 5TBOA 4JYFA 4S1FA 2J24A 3W9ZA 3P5ZA 1RZMA 3M9YA 4OU1A 2ZRYA 1F6PA 5AHNA 4CCDA 1SR9A 2OT1A 2GQ8A 4JIPA 4LV9A 1TPB1 4LS2A 2B7QA 2TRSA 2EPHA 5H91A 1FWTA 1UUMA 2DZPA 2HS6A 1RQBA 3CIXA 3R12A 1W31A 3W75A 3MUXA 5HWMA 3GNDA 1AG1O 1IF2A 1TV5A 3CWOX 1TSIA 4BI6A 1N55A 4CNOA 2AAMA 1SZGA 2C1HA 4U28A 3LRMA 1L6WA 2WSYA 4IX2A 3IRDA 3M16A 4RK8A 4MYAA 4CNNA 1TPC1 5D09A 4GUGA 2WSQA 1G7UA 1LRTA 5I3JA 3G1AA 1GJPA 1I2OA 1OX4A 1SZEA 4R33A 1I45A 2C13A 3GR8A 2GQ9A 5LSMA 3TQ0A 4LUJA 3QF0A 5KZEA 4TX9A 2B0MA 3W7PA 5FEPA 4E38A 3B0PA 1FBAA 5BW6A 2W0UA 1W56A 1XM3A 4NNBA 3TW6A 2I14A 1W5QA 5HWNA 3P81A 2A5HA 4UMAA 4ZQCA 3M5XA 4MOZA 3TXVA 5F1VA 2ZRUA 1VCVA 2QCHA 3NDOA 2JKPA 2TSYA 4PEKA 1G69A 3CB8A 3BLEA 1FDYA 3GDMA 3LOTA 2E5DA 4UTKA 3HIJA 3SSJA 1NF0A 1OFDA 4JR5A 3G1XA 2NXIA 3DFQA 1SUXA 2NV2A 1ZAIA 3P67A 4OV4A 5K2ZA 2OT0A 3U2OA 4JNMA 3NPUA 3C2EA 3QFEA 4UCGA 3KHJA 4ZQNA 4NT0A 1LZOA 2CZ5A 1CX9A 5CSRA 1ICPA 1JUKA 3GAKA 2YZRA 4PL2A 1WXJA 3W7RA 1ME9A 4M7SA 1U83A 3E0IA 1J4EA 4GXMA 3DKJA 4ZZ9A 1SPQA 4JTSA 3IGXA 1QO2A 2FPYA 2NUYA 3LX9A 1DBTA 3W1RA 1FWSA 2QJGA 1X1ZA 2CLFA 3FOKA 1EUAA 2VEMA 3PBUA 4NZFA 4Z08A 1RQEA 4BF9A 3NO5A 3NR0A 3WK2A 4MY1A 1F76A 3PR2A 3EX1A 2GVJA 3TV8A 4ADUA 1MEWA 3S5OA 3STCA 3VKJA 3QM3A 5G1TA 2EGZA 2XN2A 2TYSA 4DPPA 1AW5A 1JCLA 1O5XA 5FEZA 3IGSA 1H7WA 1KFJA 5D33A 4HSNA 5D03A 1LORA 1SW0A 1BEUA 5G4EA 3SFKA 4UTUA 5F2MA 2C6QA 4X9SA 1ZJIA 4JY8A 1FQ0A 1OFRA 4IQLA 4CCCA 4TMBA 4MPQA 3MHUA 1SO3A 3D0CA 2WNNA 3UD6A 1EP3A 2C18A 1QPNA 1LBLA 3HPSA 4X3ZA 4IMGA 5FF0A 3NL6A 6ALDA 1C29A 3PG8A 4UFKA 4LT9A 4HT3A 4LTSA 4K7VA 3O63A 4DO5A 4AHQA 4EVZA 1HG3A 5KTLA 4UNKA 1Q3NA 3QSTA 3F1QA 4HNVA 2IQTA 3C2FA 5CZTA 1GVQA 1OX6A 2G96A 3NGJA 5HWJA 1WYIA 2Y7FA 1MZHA 3BLIA 1GQNA 5DLCA 4S2CA 4O19A 2BXVA 2V2CA 4MUZA 3HPXA 5LNVA 1EPXA 1P4CA 5K9CA 4UTWA 2Z6JA 4UNLA 4TU1A 2ABBA 1T96A 4QSHA 3MWAA 4DBDA 5EKYA 5BMWA 3E96A 5BNKA 1O60A 1BKSA 5CSSA 3PC0A 4UTTC 1G6CA 3LXCA 2Q3RA 3NZ1A 3EEGA 3L2IA 3M44A 3VI2A 3TQKA 2VKZG 2HMCA 4NJGA 1ICQA 3W1NA 1F7BA 3SI9A 4MJMA 4DF1A 4NXSA 3GZ3A 4Q4KA 4XKYB 2CW6A 3BLFA 4I7VA 4XQ6A 3ELFA 4XTIA 5F4SA 3FYPA 3KFTA 4IPIA 3P60A 3DH7A 1G4SA 4MY9A 5FI8A 1KM3A 3QMSA 2VFDA 4KFOA 3V1PA 1R47A 1GZGA 1F73A 1VYSX 1OYAA 5ABTA 1B4KA 1P0KA 4DEFA 5CGQA 3NZRA 1W8SA 4O11A 5AYZA 3NQ2A 4LW7A 1QFEA 1TIMA 1P5BA 3W7IA 3NQ8A 4CQAA 1EWDA 1OFQA 4JTUA 4I9AA 5KZDA 3W84A 2DJXA 3MI6A 1DL3A 4IGHA 2EAWA 1XL9A 5D32A 1JRCA 5CZSA 5IBXC 3B0VC 1H7OA 4OQVA 2QCMA 3G1DA 3LCFA 1W0MA 4RLIA 5I3KA 1GWJA 4O12A 1YTKA 3WJXA 4DO6A 3O8AA 2FPTA 2I1OA 1XBVA 2C14A 3STEA 4WZHA 1X7FA 5DXXA 5DY2A 5D2XA 1H50A 1GG1A 1G67A 2A7NA 4WUIA 3IIOA 4UFIA 3S9YA 4M6PA 5KSWA 3S5ZA 5LHFA 1SU5A 3FKKA 4NVTA 1YPFA 1S5TA 1TCDA 3NEVA 4LOCA 1YPIA 1EUNA 1VQTA 4IMFA 3MHFA 1KM2A 1JJKA 4MY8A 3H55A 3YPIA 3E49A 1VCGA 3O16A 4GUFA 3T44A 1NF7A 1L6SA 4BWLC 5EA9A 2O7QA 3FJLA 4ZL1A 4OE7A 2CZFA 3STGA 3CM4A 1M6JA 2GVLA 2H6RA 5F2LA 3EKZA 5AOUA 2VFHA 1KM0A 4BI7A 3B4UA 4YCOA 3UY8A 4NX0A 4BI5A 2R14A 2FB3A 3G8EA 3O6YX 3PB0A 1MO0A 3FEMA 1XBYA 4UFHA 2HTMA 1ME8A 2V2HA 3L5MA 3PUOA 1FDZA 3SW6A 3EWBX 3GXPA 3U6WA 1EA0A 3NOEA 3NQAA 2O7SA 4JICA 4W9TA 3TH6A 4P61A 1TPVA 3ANYA 2JGYA 1OK4A 1SSGA 2DJLA 4AWSA 4JDBA 1F05A 1KBJA 1K8ZA 1WBHA 3FFSA 3QZEA 4JGDA 4LVGA 2V0TA 3ATYA 1IXQA 5HINA 3W88A 2C19A 3KRUA 4AHPA 3QQ1A 4LVBA 3EWXA 5K9XA 3THQA 4DELA 1QWGA 3TW7A 1VHCA 1AMKA 3N3MA 3UZJA 3RK8A 2VXNA 4JYEA 3W2JA 3QPZA 3TNOA 2E77A 3W7QA 4GUHA 1NAL1 3BVJA 2FJKA 4K6AA 4JTGA 2Y7EA 3PG9A 3P74A 1KTCA 3TIMA 3R8RA 2NV1A 2J9XA 2V8ZA 4I7UA 3GYEA 4O53A 1THFD 5DCEA 4KWWA 3BARA 2QCEA 1J5TA 1XKYA 3M7WA 1FWNA 4RZ4A 1YDNA 3OVRA 1KM4A 4OBTA 1OK6A 4JTLA 2CLOA 3LCWA 4GFSA 1TV7A 4OWGA 4TR9A 2WPBA 3G24A 2PRHA 3DENA 4JTKA 3WJYA 4P2VA 3TCEA 2ZZ1A 3LCXA 4BFAA 1OFOA 3DAQA 4WD0A 1D3GA 1MEHA 4Y8FA 2YCEA 1BWKA 3HQ1A 3W2KA 3TSDA 3IIPA 4QITA 3MYPA 3NPXA 3LCHA 3EXSA 1GEQA 4AWUA 3OHIA 4O16A 1XCFA 2CLIA 3TAOA 5HR7A 5D05A 3W1PA 1DKWA 3CIWA 3KX6A 1K3UA 3U8GA 5D2YA 1P1XA 3LRKA 4Q32A 4RX0A 3TFXA 1ZALA 3LLDA 4Z0JA 5HR6A 3TXZA 4JTIA 1H7NA 1MXSA 3Q94A 3L9CA 3C3NA 4UMCA 4TMCA 3G3MA 4POCA 3L0GA 5AHMA 2Q8ZA 2QJIA 2A2IA 2E6AA 1K03A 1UB3A 4LVDA 2RDWA 5HUPA 1DQWA 3S5YA 2VEPA 5HUOA 2E5CA 4D2JA 3BG9A 1XBXA 3EKLA 3NQGA 1SQ7A 4LS1A 4OV9A 3SECA 4XTDA 1H63A 3MBFA 2D73A 2QUVA 3CTLA 3C8FA 4ML9A 3PSWA 1G4EA 1TMHA 2QCCA 1HUVA 3W2MA 4EOUA 3HG5A 4IJBA 3O6DA 4PFMA 2X30A 4LS0A 1VLWA 4NZJA 1CW2A 1YXCA 3C2VA 3P8JA 4IPJA 5CZ0A 1G7VA 3MI2A 1S3HA 2CFFA 4XBSA 2DZXA 2OMAA 3O06A 2ZRWA 3TUUA 4M19A 4LUIA 4DBEA 3F4NA 3UPBA 3L66A 1VH7A 4FIQA 1XFBA 3M0ZA 2WO5A 3B0UX 1L9WA 2V9DA 4OT7A 4MFDA 4RKAA 3W7KA 2BLEA 2A7PA 5D04C 3W72A 2DZTA 1PV8A 1H62A 5CG7A 3GX9A 4WXZA 4AEOA 4AHOA 1NVMA 2H8ZA 2WOQA 4DPQA 3LXAA 1RVGA 4KKXA 3CPRA 1PE1A 2DZWA 1YDVA 2FDSA 3DFOA 3MHGA 4E2BA 3VFLA 1ZENA 3NPVA 3N2XA 3P82A 5KINA 3TFCA 4LRSA 3W7CA 4ORIA 1IIGA 5BRBA 3GB6A 3LTSA 4HKPA 1WDWA 3A22A 1I2NA 1TPUA 2H3BA 1H1ZA 1QO5A 4O0ZA 3GVGA 4QM1A 1SO6A 1TPDA 2ZA2A 1UJPA 2CZEA 4LVAA 5CPNA 2VOMA 3LTPA 3NPWA 1QPRA 5LHEA 3GKFA 3EX3A 3TC7A 5EBUA 5GVJA 4XKYA 1OYBA 3NM3A 1I2RA 5LNWA 4R34A 4XZ9A 1PHQA 3LCIA 5I3GA 3NNTA 4DXVA 1FX6A 5HQEA 1ML1A 1EP2A 3PS7A 3A23A 3TMLA 1S5VA 1GVOA 3TKFA 1H7XA 3CC1A 2ZDRA 4UIOA 5K9DA 3JRKA 1L6YA 5G2WA 1Z44A 2ZTJA 1KV8A 2A6LA 2DZUA 4UR8A 3HGJA 1V7YA 3MMTA 2PE4A 3LBMA 4FF7A 1Q6LA 1LROA 2Y89A 3S42A 5DY3A 1SZFA 4HNUA 3M6YA 3S1UA 1W1ZA 2P1FA 1YXDA 3UWZA 4JX4A 3KRZA 3NQCA 3JS3A 4JS3A 3F03K 4A2RA 3I7RA 1OX4B 2NWSA 4KWVA 3G1FA 3NAVA 3BV4A 1VJIA 2ABAA 3FIGA 4E0CA 4CLMA 2B4GA 5F2GA 2FB2A 5G2HA 3UZ5A 2C0AA 1RPXA 5DCDA 3MP5A 5AC8A
chains in the Genus database with same CATH superfamily
4L9XA 4ZFCA 2I9UA 3B05A 3FJ6A 3H2EA 1C8XA 1E15A 4QNWA 1XINA 2OQYA 3BLLA 3T78A 4K3ZA 5ABEA 5FF4A 4PSRA 1KRBC 3LTYA 1W37A 3L65A 3UT0A 4ZQPA 1BSLA 3A3HA 1ODZA 4XAYA 4NAEA 3KRSA 3PTMA 1NDVA 3UPMA 3U57A 1N8FA 2ISFA 2QCGA 1UR2A 4IJCA 2QJMA 4DB7A 1US2A 2XFFA 3B9DA 3VIIA 2A4AA 3CJPA 3LBOA 3HGSA 2CLEA 3KBJA 1UR0A 3UJSA 3KTXA 5IHRA 8CGTA 2Z1XA 4GUIA 3MQTA 2W6RA 3UWQA 3VVGA 4D72A 2PU0A 2UV8G 4RW3A 4H1ZA 2J7GA 2PDIA 1EC9A 2QCLA 3PBGA 4DLFA 3LENA 3GG7A 2I9EA 1DQXA 2OYMA 4MLJA 1KFEA 3RMJA 2CPUA 4IMAA 3A12A 1TQXA 1A5UA 4Y9NA 1BRLA 1O7AA 2OEKA 3WEOA 4MVAA 4NL1A 3IJDA 1JD7A 1N8WA 4RXFA 2MANA 3LNPA 3L0KA 4QQ3A 1DJXA 3N34A 4CCEA 2R8WA 1MW2A 3T4CA 3DHFA 3WBAA 1SZRA 1S5WA 3HGRA 3VE7A 1TWSA 2OX1A 2PDFA 4QNEA 3WLHA 2PTXA 1YX1A 5E0KA 1UZ1A 2RDTA 3UG3A 4NYYA 4RJEA 4B5UA 3HG2A 1DWIM 4JTEA 1KFLA 3PZTA 4NHVA 3QH2A 1JR1A 4GBUA 3TYZA 2QCNA 1AL7A 1DHKA 4MZYA 5L6UA 2E1DA 5TNVA 3SDOA 4UOQA 1HFBA 1QBAA 4DN1A 1BAGA 1FY6A 4B3KA 1ISYA 3H4GA 3L7RA 3WH6A 3CHDA 1CGUA 3DC8A 4M81A 5T8GA 4OECA 3R5EA 4F66A 3CIVA 5H8UA 1C92A 2AGKA 4IQEA 4O4VA 3LLXA 3B97A 1XUZA 3CL6A 2XIBA 5CC6A 1KGUA 4ZTXA 4MF4A 3R10A 4PR4A 2HBVA 3GR7A 3W73A 2VUNA 3HF3A 4L4MA 2IMRA 3ZJKA 3NL3A 4B5WA 4O1DA 4AVOA 4B4FA 3CHCA 1BD0A 1DJWA 4NJIA 3VIGA 2WSPA 1Q45A 1I1XA 2BSLA 1J0IA 1NTHA 3VILA 1R86A 3WQPA 4UFMA 3EOOA 3ZVIA 2OKOA 4X2RA 4AYGA 4D6CA 1UWRA 3BL3A 3MU7A 4BF5A 4UXDA 1XRTA 3L4WA 3N6HA 1AQFA 4ZXOA 2WVTA 4UUIA 7TAAA 5A8QA 3T6CA 4M5PA 4E2DA 4KCUA 1DWJM 4M1BA 4G7FA 4HTBA 1B4EA 4ZVJA 4KCVA 4HP5A 3ANVA 4GVGA 3PZIA 2H90A 2GOKA 3GC4A 4MTVA 5G1MA 1OJXA 3M0HA 1LF1A 4A8NA 3G22A 3OGVA 4H3DA 3G8RA 3VD4A 3W1LA 3RAOA 2GGIA 1UWQA 3DGRA 4R7WA 3AYVA 5I7GA 1IQ8A 2CU0A 3GXDA 3XISA 1UKTA 3MO4A 2X09A 3OZYA 4O8RA 4UBPC 1AH4A 2VC9A 4F0SA 4AFYA 1E9IA 3CZJA 1RQHA 1W1TA 1X1NA 1H49A 2RGLA 4GZ7A 4YPJA 1KGXA 2ZQ0A 4G7EA 4S3EA 3T42A 1D7KA 3PANA 2J6XA 1F74A 3VOJA 1UWAA 3T4WA 3GKAA 4DZHA 3LHZA 4I90A 3M5YA 4B5TA 5HNTA 3HN3A 4DWDA 1VJSA 1PKLA 1TE6A 3EOUA 1A5CA 1V6VA 2R9RA 4GA8A 5ABFA 1OG0A 1YE6A 4HGXA 3WCZA 5T9CE 4GY7A 1XLFA 2XGBA 1PX8A 3URBA 1I1WA 1N82A 4GX9A 3UJ2A 3WH9A 3GE7A 5L9FA 4REQB 1JXJA 2CKSA 1KR1A 1U5JA 1BHGA 3ZJ6A 2WANA 1E56A 2NUWA 5A6LA 4U4MA 1VEOA 1FKWA 4QFUA 1YPXA 4FB7A 3H12A 4ILSA 4KRZA 4XD4A 3EXTA 1MW0A 2OFJA 2R94A 3RFAA 3RMEA 3RJXA 4NZ4A 3OEXA 3FA5A 1RD6A 1VC4A 2FTYA 4N2YA 4NSBA 2DEPA 1TWIA 1S2UA 4XWUA 5A6KA 4RNHA 4YXGA 3L68A 4A22A 2AL2A 1PCKA 3TC3A 1C91A 1H61A 2QUTA 3BZGA 2WMGA 2X2GA 3MO7A 4GKLA 1HO1A 1R46A 4WGHA 1HNYA 1J0JA 3BMXA 4IP4A 3DI0A 1V0MA 1V08A 2G95A 3KDNA 3MI3A 2NSXA 1Q6EA 3FN9A 4ICNA 1T5AA 2V81A 3AHZA 1XLGA 4PODA 4TOQA 3VNDA 2OJPA 1XYAA 2VI0A 1PS9A 3GQYA 5BRQA 2WW5A 1JZ2A 1UIOA 1OY0A 3W7GA 3FLUA 2BS9A 4HA3A 4QLKA 4ES4A 1YLVA 3P5YA 1RV8A 1LWIA 3SCUA 1TA3A 2F7FA 2X1SA 3JUGA 1EX5A 4WSKA 1TE1A 3LV5A 1ZHAA 4WY0F 3M64A 3P80A 3EKGA 1G4PA 4K68A 5D8ZA 3TC6A 4XZLX 6REQA 2X7VA 4KMQA 4J27A 4PCNA 1Z42A 3R2GA 5A8PA 2TMDA 4R5EA 1VP5A 1JCJA 1XQLA 2ZXDA 2X1RA 1KCZA 1J12A 2BX7A 2XIQA 3HTWA 2PEVA 3KP0A 2CWNA 2DP3A 3HOJA 3JVAA 4J7RA 4N9BA 3VYLA 5A69A 1DJNA 1E3XA 1T7LA 2G5WA 2C79A 4PTWA 3PUDA 3KTSA 1VFTA 4NZ5A 3QJAA 1UWIA 4R7JA 1F5ZA 2ZUSA 1CWYA 5AZ1A 1NH6A 3IVTA 5DMNA 3D47A 2O0TA 3W7JA 2YW3A 4UTMA 4LU0A 1QUMA 4PEEA 1A0DA 4RZBA 4E4PA 4ZO6A 1O4UA 3AZSA 1VZWA 3EX6A 4E5TA 1LG2A 4F2TA 1FWGC 2F6UA 1BVNP 5JQ9A 4U5KA 1UH2A 1VFOA 3QC0A 2X40A 2V30A 2JK2A 4PULA 3AC0A 4Q33A 2VP8A 4AW7A 3QZAA 3N1AA 4K36A 1OM0A 4KBXA 1Q8JA 3UR2A 4LY4A 2W79A 1KQYA 4L4PA 3M1ZA 4ATWA 1OZMA 3S9ZA 3HPZA 4LXFA 4HN4A 3IRSA 4P8VA 5I07A 3VAVA 1O12A 3W7HA 1IEWA 3ABQA 1UKPA 4CUCA 1FHUA 3CWHA 1GYNA 4FNPA 3B04A 3CUXA 3QRHA 4D8AA 2ZRXA 4LV4A 4ZSUA 3BSMA 5JVLA 3W7NA 7TIMA 3CT7A 5BWFA 1LYXA 3TN3A 2OG9A 4JD4A 3LUTA 4JKKA 4QSFA 5FF2A 2RHGA 3RO8A 3RPTA 5A6TC 1JAKA 3W7DA 3LV6A 3WKZA 1CLKA 3PY2A 2NV9A 1GQIA 1IXNA 5FA5A 1KM1A 1JCMP 1OFPA 1AW1A 2WMKA 3ABSA 1HZYA 4LNYA 3AXMA 2O56A 3U48A 2GLKA 3FA4A 3LG3A 4PL1A 2QCDB 2YJQA 5HQMA 3TYCA 1G0CA 3USZA 3PHAA 4QRNA 4MWAC 3KBNA 3BCDA 4PUMA 4S3KA 3C6CA 3AHXA 3SGGA 4KFNA 1GVEA 1H11A 1US0A 4O52A 2ZXBA 4NJKA 4WSJA 2WWDA 3F4WA 1PJ9A 1DJQA 4E6MA 4HHPA 2Z4GA 5HMEA 4HOWA 3V35A 3KHDA 5HULA 1EJ7L 2XH7A 3AROA 4H6RA 2TPSA 2C8NA 1C90A 1VPXA 4E4FA 4HSOA 2EPLX 3BO9A 4YLWA 2Q3OA 2ALDA 4K8EA 2DU2A 1PL9A 2C16A 2QULA 2E6YA 3K4DA 4P7NA 8XIAA 2J25A 1G94A 1ZBVA 1X6UA 2X1TA 3W83A 4PN2A 1V6UA 4QEEA 3AIBA 1BTMA 4KS0A 4XIMA 1JZ4A 3PWGA 1GTHA 2ZRZA 3OPSA 1LOQA 2WLZA 2ZRVA 4OGZA 2O9PA 1M03A 1XPYA 3B8WA 3ZVHB 3HO8A 1MXDA 2HE8A 4IGMA 4IIBA 5GNYA 1EDTA 3OA3A 4GY1A 2J8TA 5G1YA 5AN7A 1QCWA 1DPMA 3OBKA 1K8XA 1CGYA 2PRLA 3IUDA 2ZIDA 4HN8A 4GNJA 2D20A 1H0IA 4LEQA 2ZKMX 2A3LA 4JQ2A 1P0BA 1DP0A 2CITA 3NVTA 3W81A 4LAMA 1T99A 4Y90A 5FAGA 4KRTA 5C9ZA 3BSHA 4IUOA 1AL8A 3R0DA 1Z8AA 3RR4A 1FRBA 1L8PA 5LNRA 3VINA 3V0SA 2VEIA 3KVJA 3CUGA 2ZZ5A 5IBXA 1J6PA 1VPQA 2QV5A 1E9LA 4QGCA 3K4AA 3WF3A 5G2IA 1JDFA 1ONWA 2QF7A 1OGBA 3CWNA 1EA9C 2KX9A 2J9ZA 1O68A 2WBGA 2XH4A 2R1PA 5I0DA 3NM1A 4HA1A 1IZJA 3W2UA 5CC7A 1X7IA 3HQPA 4PMDA 4X2PA 8XIMA 3N9RA 2JBMA 4XZHA 4H9XA 3T2PA 1QW7A 4JYDA 1OFEA 1EJXC 2HVMA 4QDMA 1MFVA 7PTDA 1W5PA 1WZLA 4GJJA 4O0KA 3CZEA 1XYLA 3FDGA 2YSWA 3HG3A 1AODA 5KITA 4NUWA 1JUBA 2GGHA 1V02A 3BLPX 5HNNA 1PHWA 1JF5A 3F2DA 3P2VA 1FWIC 3AS3A 3P62A 4ACZA 2HSAA 2X0YA 3BW3A 2ZBTA 4RE0A 2QEZA 3F2CA 3DGBA 3FA3A 5J8LA 3AMKA 1R85A 5GQBA 2O9RA 3DHPA 3BTNA 3UA3A 3W74A 3CEPA 3MA8A 3MZ2A 3CQJA 3VDAA 5CZKA 3KRBA 3B8DA 2Z2UA 5IXEA 4Q8MA 4NNCA 5LGXA 1ADDA 1U1HA 3WH5A 4NNAA 4PB3A 4QLLA 4LRTA 1F3TA 3AU2A 1K1DA 2J7HA 2ZZ3A 1K70A 3T8QA 2YLAA 4NJHA 4UFJA 4HHHA 1ZTVA 2NQZA 3TQVA 4NZCA 2PP0A 3I7SA 4L80A 4C65A 2Y61A 4CVWA 5HPCA 5HJLA 1HIZA 1Z89A 3WF2A 4QDWA 1XGEA 3KOXA 2IKGA 4KCWA 4PFHA 1OGSA 2HBXA 3ITXA 4GXPA 1GTEA 3N4EA 2V5KA 1XRSA 3WLOA 2YBUA 1H5VA 4XBJA 3GVVA 3C2YA 5AC4A 3GNNA 4RDWA 4Q4OA 1ESWA 4FOJA 4PRTA 3POCA 2V3EA 3Q45A 3EDEA 1W3TA 1IEIA 3DZ1A 1IGSA 3G3DA 3DG6A 4H8HA 1HL8A 1VKFA 2NX9A 2DT1A 2Z29A 4GBDA 2A3BA 3PJWA 4A21A 4IOTA 1R2SA 3W86A 4JQAA 4M8UA 2IKJA 1CXFA 1WV2A 4UCFA 1Q13A 1T0OA 4RV8A 2WKLA 1A4LA 2Y63A 4NXKA 4JTHA 1K8YA 2P50A 1F61A 1F3XA 3ZT6A 5FCZA 5AHEA 1QW8A 1GCYA 2HNHA 3UXAA 1W54A 3S2CA 3NEHA 2X8RA 1XW8A 1H3GA 1PZ2A 1U5HA 2J24A 3W9ZA 3P3BA 3B0YA 4DNMA 2MNRA 1RZMA 1P0EA 4H7CA 4OU1A 2VC5A 1F6PA 1EQCA 2VTFA 4LV9A 2ADAA 3C0LA 3DESA 2EPHA 5H91A 1FWTA 1IT8A 2HROA 2AMXA 3CMJA 1TX0A 3GNDA 3M0VA 1TV5A 2GL5A 1XJBA 2PLCA 1RP9A 3GXMA 4G6CA 1VBJA 2C1HA 4CNUA 3FGCA 1L6WA 1BFNA 5D09A 5AKQA 4YHGA 3CASA 1CEOA 3QV8A 1MMFA 5I3JA 1QWKA 1XSIA 2VX4A 3SUSA 3QKEA 2C13A 2GQ9A 4YTUA 3L4UA 4ZEPA 4L64A 3WD0A 3QF0A 4BHYA 4TX9A 5REQB 2B0MA 1HL9A 4EKJA 3B0PA 4H04A 2OWCA 2DQWA 2W0UA 1S5NA 1W1PA 1W56A 1XM3A 4MNMA 4NNBA 4C91A 1WCGA 2I14A 5HWNA 4QCFA 4GISA 4UMAA 1HJVA 3M5XA 1R7OA 4J3TA 3PZOA 3WIJA 5H6HA 4E2VA 5C8BB 2PDCA 4GYPA 2DW6A 5EMJA 4LUTB 2WCAA 4J3XA 3LOTA 2YCIX 2P8BA 3SFWA 3T09A 4UTKA 3IS4A 3M0JA 2F9RA 4Q7IA 1NF0A 1OFDA 3GXFA 2V3DA 1JZ3A 1SUXA 2NV2A 3P67A 5K2ZA 2OT0A 3U2OA 4YIWA 1ZZMA 3NO3A 2Q8XA 2E8YA 3TOPA 3IUIA 3QFEA 1W91A 4NT0A 2CZ5A 1ISZA 1CLVA 1CX9A 3VZZA 3QV9A 2DSKA 1Q7MA 4Y9OA 1WXJA 4HA0A 4MMWA 3AMLA 3TN4A 1US3A 3IGXA 5B7ZA 4GLEA 4DJEA 4LEFA 3W1RA 3M0MA 1FWSA 3ZT7A 2DZBA 1X1ZA 3QHNA 3R4IA 4LQ1A 3L4VA 3NR0A 4MY1A 1F76A 3RCNA 2J74A 3EX1A 4ADUA 3S5OA 5BWAA 3S2LA 2XN2A 2TYSA 2WVUA 2XGZA 4DPPA 3U0HA 3LGGA 3D6NA 4GKTA 1LORA 4IM4A 4UTUA 2R6OA 4AYSA 1ZJIA 2BDQA 4JY8A 3B9NA 2IW0A 4US5D 3WDQA 1FQ0A 5XIMA 4OZOA 2YB1A 3C8NA 4MPQA 3LSCA 4V33A 3RO6A 3FV9A 2WNNA 5D9MA 2XPKA 2XSAA 4H8NA 3KEHA 2ZDSA 4L6OA 4S3AA 5CSYA 3OTRA 1A47A 3VGFA 3KBVA 3AALA 2BOEX 2WM1A 1JPMA 5KTLA 2GJXA 4UNKA 3QSTA 1WDSA 2IQTA 1FH8A 3C2FA 5BU6A 3CYVA 3NGJA 5HWJA 4WJ8A 1E0WA 1WYIA 2Y7FA 1MZHA 3BLIA 4S2CA 2WC7A 4O19A 3HPXA 5FIPA 5K9CA 3GW3A 3E0WA 4QSHA 3ZZ1A 3NZPA 4MNKA 4DBDA 5BNKA 3TOYA 4MKSA 1V3MA 5CSSA 4UTTC 3LXCA 3NZ1A 3SCOA 3SCPA 1TR9A 2VKZG 2HMCA 3SRFA 1F7BA 4KW2A 3IAQA 1V3JA 4A35A 1ONXA 1G4SA 4MY9A 3WEMA 4DNHA 2QYGA 1R47A 5ABTA 3DERA 4WIWA 3UXIA 1B4KA 1VIZA 4DEFA 2QDEA 5ABHA 4IJRA 1QFEA 1WNOA 4GYKA 4HOZA 1BF6A 2HVNA 3NQ8A 3LQLA 1OFQA 5KZDA 4H01A 2DJXA 3MI6A 4JBRA 2EAWA 1XL9A 5D32A 3CBWA 5CZSA 3COTA 3KCOA 1H7OA 1K4HA 4PTXA 5GJMA 1BVZA 1MNZA 3G1DA 1BWVA 2DDXA 3LCFA 4GQRA 3GSMA 2DGAA 1GWJA 4O12A 1YTKA 3KDOA 4JQ4A 3MCNA 1XBVA 2C14A 3SQLA 4WZHA 1X7FA 1FP8A 2XIMA 4PMVA 3WL0A 5D2XA 4FLQA 4CVUA 2VR2A 4OOZA 1U22A 3S9YA 2DT3A 4KEMA 1MXGA 4JEJA 4A3YA 1YPFA 4C6DA 1TCDA 2WWCA 4IFKA 3BCJA 4LOCA 3UGVA 4B3LA 4IMFA 4G1NA 1Z6KA 1XCXA 2ACQA 4AY1A 1EYWA 2O7QA 5A8MA 4ZL1A 1JPDX 2CHRA 3STGA 2C71A 1J11A 5E0FA 4GQGA 4TUFA 4BI7A 1ZJHA 1XH2A 1SYTA 1MFUA 2EBNA 5XIAA 3ITGA 2R14A 2FB3A 3KE0A 4P8WA 4YTQA 3PPFA 1UP2A 3E2RA 1XBYA 2XU2A 3PUOA 3U6WA 3NOEA 3TH6A 4CU8A 3ANYA 4GYFA 1DXIA 4AWSA 4JDBA 2E4TA 1IXQA 5HINA 4IQDA 3KRUA 1KRMA 4AHPA 3VIMA 4L65A 3WEZA 4LVBA 3BGAA 3EWXA 5K9XA 4DELA 1VHCA 1AMKA 2WMJA 3NZGA 2VXNA 2E77A 1LQ2A 1VFLA 3HFYA 5I00A 3II1A 4K6AA 4IIFA 4JTGA 3PZ9A 1XRFA 1KTCA 3TIMA 3R8RA 2NV1A 2V8ZA 4UQEA 4QCEA 4JFVA 4KWWA 1O1HA 3V16A 4ZBCA 1J5TA 5KZ6A 1FWNA 1YDNA 1KM4A 4GFSA 3G24A 3DENA 4JTKA 4P2VA 3ZLGA 2XSXA 5BXTA 2ZZ1A 3LCXA 4GIRA 4BFAA 2GK1B 3AS1A 3P14A 3NZQA 3UCQA 2VZTA 2YCEA 1GJWA 4HZ8A 3W2KA 3TSDA 3SCRA 4JOMA 3N11A 3EXSA 1GEQA 1X6LA 1EBHA 1XCFA 1R3SA 2OWXA 1DIDA 3W1PA 5MF5A 2OVLA 3DG7A 2PD9A 4NRSA 1MWOA 3U8GA 3VCCA 1UR4A 4RW5A 3WLQA 3QR1A 3TXZA 1H7NA 3L9CA 4UMCA 4POCA 3R58A 3LZ5A 3VFCA 3KW3A 5M1TA 1Z9AA 4IG2A 1JZ8A 3ES8A 2ZUNA 2VEPA 5HUOA 2E5CA 3LM3A 4LS1A 3VNJA 1BYBA 4M6UA 1H63A 1UD3A 3C8FA 1TMHA 2QCCA 3CS2A 3W2MA 1UMLA 1A4MA 4IJBA 3O6DA 2X30A 4HMCA 4LFYA 1CW2A 1ZBWA 1YXCA 4QEHA 5A3HA 1B90A 2R1NA 3QN3A 1RAKA 2CFFA 1ZP4A 1UD5A 3F4NA 1A3HA 1XFBA 4FIQA 1G9HA 4S38A 5M17A 3B0UX 1L9WA 4RKAA 4ICMA 2A7PA 3PAOA 1KQZA 2GYIA 4HMDA 2DUZA 4B5VA 4B2DD 4AEOA 3C0SA 8A3HA 3LXAA 4OFCA 2VX6A 3CPRA 1PE1A 3B40A 3PPHA 4WR3A 2FDSA 3DFOA 4H7VA 3CXOA 4HCDA 1DQUA 1TV4A 1XR2A 1NWSA 1MRAA 5EU9A 4LBUA 4ORIA 1IIGA 2FKPA 2E67A 1WDWA 2H3BA 3HQOA 1M01A 4AWEA 4LYPA 2NSOA 3GVGA 2ZUUA 4PUKA 3FEQA 4OJYA 3MANA 2ZA2A 5DRIA 2ZX8A 5IDZA 2ANUA 4LVAA 3LTPA 1YNQA 3VABA 2VR4A 1CXIA 4XKYA 3PZMA 2OTDA 1B3YA 1K9EA 5LNWA 1UG6A 2QDDA 3VGGA 4XZ9A 3BXWA 3QHMA 1ML1A 3A23A 3TKFA 4UIOA 2ZDRA 1M41A 1L2QA 4KCTA 5K9DA 3AYRA 1Z44A 3ZYZA 1Y65A 2A6LA 5EBAA 2W67A 3RN6A 1X8CA 3MMTA 2PE4A 3LBMA 1SMDA 1XH0A 2YBVA 1LROA 3VNZA 3S42A 5DY3A 1SZFA 4DZAA 4W5ZA 1FWDC 5ENLA 4OTKA 5HAOA 3F03K 2WBKA 1HKIA 2DSVA 2J6VA 1WO2A 1VJIA 2ABAA 4XAPA 3FIGA 5F2GA 1TX2A 3UZ5A 5DCDA 5DFAA 2VZVA 3MP5A 2VEFA 2VL4A 3Q58A 3UFYA 3UJFA 2PDBA 1GKQA 2HXTA 2R1KA 3EWWA 3GAYA 2YKKA 4AD0A 1QI3A 3SQSA 3MW7A 2PDWA 3BQ5A 1J93A 1VFSA 2NLIA 1FCUA 3DHDA 2WMFA 3WLPA 3CH0A 3H2OA 3I6TA 2OSXA 2JKEA 4R85A 2CBIA 3EPNA 1J0KA 4MJ4A 3CHVA 4DYEA 3QV6A 1A5SA 3MSDA 1JVNA 1KFCA 1R9YA 2Y85A 3MJYA 1UD6A 5J5RA 3W24A 4BK9A 1UKSA 3GVQA 3NOYA 3RR1A 4U33A 2FHBA 1NFPA 4BZYA 1WOBA 5GJNA 1FUYA 3NQBA 5FJOA 5E1QA 4LWWA 1ME7A 1WAUA 5CJMA 3OVGA 3RPDA 5GPRA 5CJNA 1UR3M 4C6JA 3HJZA 1Q6GA 3S1WA 4OVXA 2HS8A 4UTWC 1UWSA 3V4BA 3C4UA 4O15A 3T55A 1IEVA 3LRLA 1XIIA 5CPMA 3NQDA 1RK6A 4XK2A 1VFFA 3LPOA 4M7TA 2G97A 4DI8A 4ONVA 1WA3A 1B9ZA 1IT7A 3WQ5A 3G0UA 4OHQA 3TAKA 4XSMA 3N17A 1JNDA 1V03A 4KEVA 4LAUA 1Q6RA 3IVUA 1QAPA 3B8VA 3VIOA 4WOQA 4E2OA 3CUZA 3G5EA 3LN3A 2EHHA 3GIYA 1VFMA 1O66A 2PODA 4O1CA 3PBWA 1KW1A 1JZ5A 2F84A 2A21A 4NI8A 1Z48A 1BKHA 4AZ5A 9RUBA 1E1EA 3W2LA 1VB9A 3R25A 3MC5A 2Y1HA 3JZUA 3DECA 1C8YA 3KAOA 5CCZA 1TYGA 2V5DA 4KWOA 4FEZA 3QQWA 1Q6OA 2E1WA 3W1MA 1EZ2A 4S3JA 3W71A 1Q63A 1GZJA 4JTJA 4MPKA 1LBFA 4Q6XA 1K8CA 3UWWA 4EX4A 1OC6A 4GVIA 4BQ5A 2XN1A 1QHZA 4FIRA 4L4LA 1P0DA 2BY1A 5M03A 1Q6FA 3TE9A 1K7FA 2CLPA 1XP3A 3U7BA 2V68A 1RH9A 3QHOA 1XXXA 2V3GA 5DT5A 4NX5A 3VD3A 1V5XA 3NDZA 2Y6ZA 1YIXA 4JTRA 3DFSA 3CMFA 2VFIA 2VGFA 2VRQA 5F2IA 1ALDA 4HZMA 2B81A 1VRXA 2DT0A 3V7PA 3CZ8A 4L1WA 5IM51 1UHVA 3P61A 4UR7A 1TMLA 4H2CA 4C6KA 4GI6A 4J1OA 1XLCA 4Z0SA 3G2GA 9XIAA 7REQA 1HJSA 3IPWA 1OT1A 2CXEA 4PTDA 4IXHA 4GABA 5CAKA 5AYIA 2R24A 1BVWA 1YDOA 1EXPA 1CENA 3URAA 4UTLA 2TODA 3QY6A 4BQ3A 3IGHX 3NL2A 4GXWA 1JL8A 4WY0A 5HA7A 4ERAA 1IWPA 3QY8A 3LHVA 1YBQB 6CGTA 1H41A 2JF7A 4CQ8A 4LANA 2G3FA 5DXYA 1JCNA 5A6JA 2INZA 4PUNA 1LM1A 4CD8A 1FWJC 1TJPA 2SFPA 3MJMA 2J7CA 3LB0A 4DUXA 4L4OA 4IIDA 4KERA 4QISA 1E1FA 3QV7A 4G5DA 1KXTA 4NG3A 1XBZA 4QLJA 3L4ZA 4B16A 1UA3A 1OCNA 1WDRA 4FX8A 4H4IA 1H09A 4MZ1A 4FXJA 2BVDA 3T0BA 2YGYA 5FJTA 1EPVA 5D8WA 3LPFA 2BOGX 3E9AA 1HT6A 4AF0B 3S6DA 1EJVC 4C6NA 3J7HA 3QY7A 3PN8A 5AB3A 4XZNX 1TJRA 2XIJA 1FH7A 4GPNA 4REQA 1Z32X 3WQ6A 4WSHA 2OCZA 3RNDA 3OP2A 4W8AA 4YHEA 3EPOA 1DVJA 1ISXA 2QIWA 1B3VA 1RY8A 2ACUA 3ES7A 2Y70A 4I9MA 5MHBA 2VD9A 2WSRA 2GDVA 1RBAA 4MJZA 2FZBA 3AHVA 2YB4A 3SRHA 2QF8A 1WKEA 3WQ8A 1VLIA 4RDYA 2W92A 1VHNA 1XI3A 5K4XA 2V2DA 1LLZA 4AZCA 4EF9A 1JYWA 1ZBCA 4AH7A 3CL8A 1JFXA 3CUHA 4A2SA 4B9ZA 3ARRA 3TMQA 2Z0IA 3OVQA 1FWRA 1C7TA 2VWSA 1HO4A 4I5UA 3OJGA 1WB0A 2JFEX 4IPLA 1TQJA 1LQAA 2PLJA 3DFNA 2HRWA 3V5FA 2FHFA 1PWLA 1JCTA 1JQVA 3QR3A 3HZ3A 4FOUA 3H54A 4XD6A 1WPCA 1I75A 3GHRA 5FEXA 3AIUA 3C61A 3RLUA 3IJ7A 1TWDA 1KFWA 1W3HA 2ZICA 1SJDA 1MUMA 4L1GA 2ZVRA 2J88A 3S6OA 1L6GA 1ZGDA 5JH2A 2P5NA 3BAWA 1CGTA 1WP6A 3MSRA 3UG5A 1VS1A 3WJSA 2XINA 3U2CA 1JCXA 3LMYA 2NWRA 1ZAJA 2C3ZA 4DO4A 3UYIA 3OZOA 3ABRA 1PSCA 4L56A 1LBMA 4P8UA 1QJWA 1KTBA 4RE2A 5MKGB 5A94A 3CLMA 4JCMA 4PRWA 2FIQA 3FS2A 1LP6A 3AAMA 4JZ5A 4ZB2A 3T40A 2DUAA 2PU1A 4TTGA 5HNRA 4HU0A 2C7FA 4RPPA 5FJJA 4XG1A 2DZSA 3OIHA 2UZ9A 1VYRA 1B3WA 3WJZA 5I03A 3W1TA 1O1ZA 1CIUA 3AYTA 3C56A 2RAGA 3W23A 1AMYA 1YHTA 4FXFA 3T07A 3M6DA 5DBUA 5KEZA 4O10A 4XVDA 3ZLFA 1FCQA 3IJIA 3H2AA 3P8IA 4LUSA 3UVIA 2BXZA 5LIUX 4ICCX 5DEZA 3ZWTA 3EWDA 4HZ7A 4W86A 4BKNA 2FVKA 1XSKA 5CBBA 2WV8A 1JAEA 4GG9A 3NL5A 3S5SA 4FHAA 3VU2A 4D6HA 3VNIA 3M5ZA 1FFQA 2Q8LA 4FMVA 2XWDA 1QVBA 1YNYA 2CZVA 3AIWA 3GHUA 1JEZA 3GXTA 2NW0A 1SMAA 5EL1A 1A5BA 3OLEA 4KFPA 1D3CA 4D6GA 2WVVB 4PRRA 3OB8A 4Z1CA 2NZLA 2VDGA 1NQKA 4DUVA 1WUEA 2A1YA 4GQQA 5CSUA 1BLIA 1S2WA 4Q7BA 4H6KA 2FVLA 4EIVA 2JKAA 1QNVA 2XIIA 1LDCA 2P0IA 1SFLA 3GD6A 4C7GA 2ZCGA 5EMMA 2WK2A 4UTJA 1P48A 4IMEA 4L9YA 1E73M 4ZR8A 4GO8A 3GG8A 2E6FA 1JI1A 4J5NA 3H22A 1GOWA 4KQNA 3CK5A 4AIBA 3VX1A 4F0MA 4AD2A 5DELA 4IGSA 2HK1A 2TAAA 4AB4A 1ZAHA 3RCMA 1E9YB 3FDKA 4JCLA 3REQB 3HV8A 1I8JA 3MKCA 1GPWA 3NQMA 3EWCA 4F9DA 3N2CA 2F6XA 2ZZ6A 3AHTA 2CIPA 3R94A 4HPJA 1FFRA 4LF2A 1FHDA 1OFBA 4J4KA 1XISA 4KIEA 2V38A 3TEVA 2PDMA 1E0XA 2ZOXA 3UCCA 3O6CA 4XIAA 2VOTA 4J35A 3UPWA 1H7PA 2I7GA 1XX1A 3WUGA 1JGMA 3M5VA 4AY8A 1TV3A 1PKMA 4LNCA 3QR0A 2FLIA 1S2AA 3SY5A 3MKKA 2YL8A 1E9ZB 2BGSA 2ISVA 4DBUA 3A64A 2FH8A 2VR5A 5CXPA 2B7PA 3IJ6A 4I9JA 4ATDA 1ICSA 4AEEA 3MUCA 3B8IA 4GWEA 2QJHA 1K7EA 2YA1A 1UKOA 2WPGA 3RU6A 5D9PA 2CLMA 2YDRA 3EEZA 1XHGA 1NIUA 3GIQA 1ODUA 1M7PA 1AW2A 3U5YA 1K4GA 2DZAA 1X98A 2KZHA 3AISA 4CD7A 3WF1A 4UTIA 1QOQA 4D6DA 3VC5A 3RRXA 3N12A 1GVFA 1JIBA 5CLWA 3MZNA 2JF6A 4YL2A 1R30A 5HK4A 1NM9A 1DE6A 3T2OA 3CZGA 4DJED 4HSHA 1GVSA 3AOFA 3RDKA 3V75A 1WKDA 3B4YA 4P8XA 2LLEA 1EWEA 2BVWA 3WD4A 4ACYA 4C5YA 3VPLA 2DPEA 3TLLA 3ONCA 1GQJA 3TTEA 4AG0A 1Z7AA 4WVXA 4XZWA 2G3IA 1UW9A 3BDKA 3VA8A 1MNSA 2QAFA 1BRLB 5FF3A 2Y2WA 3EDFA 2YYUA 1XIGA 4IICA 2EEXA 5JBDA 2DVTA 5LA1A 2POZA 4RZ5A 2WM0A 5I3FA 2Y7DA 3DKLA 5LA2A 1FCBA 1EGVA 3LNMA 4QAWA 1LUCA 4UTHA 1HXJA 2E9LA 1E4LA 4K7YA 4QJ4B 2VMFA 2W63A 2WJEA 2XFRA 4JTCA 1Y5XA 3OQEA 3CV2A 1XV8A 4CQ9A 1V6TA 2PF8A 3GTIA 4NILA 4RXGA 1DJHA 4B91A 3VNKA 5AHFA 3A5FA 2VT0A 2INFA 3S2NA 1KM6A 2V67A 1J79A 3M47A 2YIHA 4AZGA 3WFZA 4ML4A 4PA8A 1QR7A 2EO7A 4V1XA 1HJUA 3WLLA 2DQXA 4N9EA 4UFLA 3NQFA 4IH3A 3QPEA 2ATSA 3G1YA 3QGKC 4UB9A 1DJIA 2R91A 3G0SA 1XLLA 1ZB5A 5CKSA 1O6IA 1KCLA 3E0FA 2IXVA 5I5RA 2INEA 4NI3A 4WJEA 1GVYA 3GDRA 1VYPX 3KLLA 1A0EA 3LGEA 3UNDA 1UYQA 5CEWA 4R9OA 5BXSA 3T05A 1I2PA 2D69A 1UASA 1XLBA 4HNNA 2QPXA 3SQMA 3LA4A 1I6NA 3I68A 2NXHA 1VPYA 1C7SA 3VE9A 1WDQA 1EXBA 4LYRA 3THAA 4FALA 4GQ0A 4NKCA 3CO4A 4Q4SA 4BWLA 3GBDA 3FKRA 2X0HA 1GYLA 3F4DA 1OC5A 3LQGA 2P0OA 2ZUWA 3MUAA 1TO3A 3E12A 3GU1A 3E2VA 1RBLA 2QJJA 3WL1A 3BLOA 4ENLA 3NXLA 1W2VA 3LHYA 1SSDA 4K37A 1RJRA 1G5AA 2QKFA 5BOEA 4XVEA 4S39A 2WJZA 1E3ZA 1DWHM 4W7VA 4CCZA 1A50A 1F8MA 2BY2A 5ECUA 1HW6A 4AIUA 5HANA 2I5GA 4H8UA 1E4NA 2BZNA 3IGUA 1MW3A 1H0GA 3R7MA 3V0UA 1YQ2A 4DWSB 2PURA 1H5YA 1HKJA 2RGMA 3G18A 3JR2A 3M43A 1TTIA 3GDKA 1UBSA 5JXQA 4FNRA 1U1JA 3AJXA 1JUEA 1FWBC 3S2JA 2BOFX 3I65A 4X63A 1KA9F 4FXSA 3PTQA 1Z69A 3IJ8A 5AC6A 2W3ZA 3W6YA 4JHMA 1BWLA 3UR7A 1J01A 5FD0A 1E6PA 1MQRA 4PMZA 3KOFA 1XLDA 4HTYA 1TZ9A 5CPLA 2X42A 1IWBA 1W1VA 2QCFA 4GI4A 3GS6A 2GJLA 3LXBA 3WQEA 3LDVA 1RK5A 2GUYA 3GH4A 1A5LC 4R88A 5LNUA 6A3HA 3RF9A 1XLHA 3CQKA 3BC9A 1X1OA 5TQLA 5CBIA 3GIPA 3NQEA 4L61A 4PE8A 1TRDA 3W3OA 1ITCA 1R2TA 5BROA 1D7FA 3W00A 2EPOA 3MP3A 2PDNA 4E8CA 4MZ8A 5CPQA 3OW1A 3W01A 3N2BA 4XKMA 1OBAA 1VBGA 1W3NA 1RA0A 1F4HA 1PTDA 3PF3A 3WNKA 2YFNA 5BYWA 4DZIA 3L2MA 3VCRA 2ZYFA 4MG4A 4LUYA 4BJHA 5ABFB 1HQTA 4Q7NA 5AHLA 4B4HA 3ZSSA 4TX8A 3KLKA 2YX0A 4W85A 3EWYA 2QPUA 3E02A 4O17A 4BR1A 1R6WA 1TZ7A 3WQ4A 2GZXA 4Z17A 2NX1A 1DHPA 2C15A 4JIQA 5BOFA 3EX2A 1SZNA 1IR2A 3WBXA 1F8IA 2ZA1A 1KLYA 3Q67A 3V1HA 4MIMA 4C1LA 5E09A 4C6IA 1C8QA 5REQA 3VKCA 4IIGA 4LYQA 2WMHA 5EFFA 5PTDA 1UQYA 1EHNA 3RU8X 2VUYA 5FOOA 2ZRYA 2IPJA 2XZ9A 3BJSA 1SR9A 1Y5WA 3BAXA 2W9MA 4ERIA 3CZLA 1GUVA 1TPB1 1CGWA 4F0HA 2DZPA 3CIXA 4JAWA 3MUXA 4LUTA 3LK6A 1AG1O 3VD9A 3E2SA 4Y9MA 1E43A 4CEUC 4MSSA 2DSUA 1SZGA 3B8UA 2PP1A 3MSYA 1GYMA 2PDKA 4GNVA 2OODA 5CQ1A 4IX2A 4HVXA 4GACA 4RK8A 4MYAA 3UP8A 2AL2B 2WSQA 4Z2KA 2J13A 2PWGA 2FGBA 4HPNA 4O1FA 4LB4A 1SZEA 1I45A 1XDJA 4L1XA 4Q8WA 4DZ5A 4IP5A 1FBAA 5BW6A 2E25A 4W4QA 2OOFA 3SCVA 5A8OA 3P81A 4ZQCA 1C93A 3TXVA 5F1VA 3GNOA 2QCHA 3LS9A 3W25A 1XCWA 2TSYA 1ZS2A 3E0VA 1TA3B 1G69A 1FKXA 3CB8A 3BLEA 3SADA 4L7ZA 5HJXA 2J7EA 3GDMA 2D0HA 1OEPA 3WMLA 2QUNA 4QJ3B 1OSEA 4JIEA 2EKGA 2GDQA 3G1XA 3ONBA 6XIAA 5B80A 4UQCA 1IGWA 1ZAIA 3VMOA 3C2EA 5A6AA 1EC7A 3MB9A 4ZQNA 3KCJA 1BTCA 1LZOA 3BAIA 5CSRA 4GI9A 1JUKA 3GAKA 2YZRA 4PL2A 4M7SA 1LWJA 2A3HA 3DKJA 1FA2A 2XH0A 1AZ2A 1QO2A 4F0KA 2FPYA 3R1ZA 1DBTA 1AH0A 4P7QA 3CQHA 3FOKA 3PBUA 4AC1X 4NZFA 2OQLA 1AFSA 1ZJBA 3WK2A 3R6IA 4C1NB 3VOCA 1H2JA 2O9TA 3TV8A 1QK0A 3VKJA 4ZOAA 2ISDA 1JGIA 2XVGA 2BV9A 1R3TA 5JIWA 1JCLA 1E1CB 3FJNA 1XIEA 1H7WA 1KFJA 4GIAA 1CCWB 3EAUA 1VEMA 3F5JA 1BEUA 5G4EA 4DUWA 2C6QA 2PTWA 1OD0A 1EIBA 1QNSA 1MQPA 3DG3A 2W4XA 3BANA 3OGSA 3Q4DA 5D4YA 3MHUA 4WDTA 1VAHA 1KD0A 1EP3A 1QPNA 1X97A 4X3ZA 4IMGA 5FF0A 4XSLA 3UNTA 1C29A 4UFKA 1EJRC 4AHQA 3H70A 1HG3A 4QG9A 3F1QA 3NSNA 3K8LA 2YZ5A 3EZ4A 2ODOA 4U3CA 2ALRA 2AKMA 1TG7A 2BXVA 3ZM8A 1PKNA 2V2CA 4MUZA 3ITOA 1S3TC 4J3VA 4RE4A 4WGXA 3MWAA 4AZIA 2O55A 1YE4A 2DSWA 5BMWA 3E96A 2WYSA 5A2AA 1BKSA 3VNYA 4JIIX 3EEGA 3M44A 3PTKA 3A4WA 1K9FA 4FOKA 2PDLA 1UOKA 3GZ3A 2CW6A 4C90A 1UH3A 3K13A 1NOUA 4XTIA 1R0MA 4MDOA 5F4SA 4YTRA 4IPIA 4MNJA 3DH7A 3ALFA 3VMNA 4AD4A 4KFOA 1V4YA 1VYSX 3M0XA 1UZHA 3NZRA 2X2YA 2HISA 5I09A 1UZDA 3NQ2A 2QMJA 4LW7A 2BY0A 1TIMA 4GOAA 1P5BA 3ARQA 1ZJAA 5M3WA 4P5UA 2AQOA 4WK9A 4IGHA 5M2FX 2OPJA 5DQPA 3SAZA 1JRCA 5IBXC 1BXBA 3NGFA 4ASTA 1A5OC 4CU6A 4GIEA 3D3FA 1W0MA 1W6TA 2NQ9A 3BJTA 4DO6A 3VOIA 3WJXA 2Q09A 3QLDA 2FPTA 1XIDA 5DY2A 2WNWA 3CHEA 3WBWA 1GEHA 3RXZA 1H50A 1GG1A 1MI3A 3A6OA 4WUIA 1CZ1A 3IIOA 1K77A 4M6PA 4TVDA 3KL0A 1ECQA 3O7UA 1WKYA 1W3JA 3RILA 1EJSC 3VO0A 4F2UA 4JTAA 1EUNA 1PKYA 3PZUA 3MHFA 4DUOA 1JJKA 4MY8A 5HBFA 2ZADA 3H55A 1HGYA 1VCGA 4TV6A 2IKIA 3T44A 1NF7A 1KO0A 1M7JA 5EA9A 3FJLA 2BFGA 4H9UA 4PB5A 2PSNA 3CM4A 2PGRA 3WX7A 1M6JA 4NF7A 2GVLA 2JALA 1TR1A 5F2LA 3DFHA 3U9IA 2P3ZA 3AWOA 2DVUA 2CBUA 3UY8A 1EBGA 1BQCA 3EA2A 3DHUA 2J77A 3FEMA 2UY5A 3AS2A 5B7YA 2HTMA 3FY1A 3AIEA 1ME8A 2V2HA 3L5MA 1FVPA 1FDZA 3EWBX 1V3IA 3S6TA 3VOFA 2Q01A 4US6A 1OK4A 4QX4A 2DJLA 4EPEC 1F05A 2XSBA 2CBVA 4C6CA 4JGDA 4WKFA 1DJYA 2BHZA 4RNFA 1TMQA 2CEQA 4GGBA 3QQ1A 2VURA 3S1GA 5FJRA 1A0CA 4Q6JA 1JI2A 3HV9A 3N3MA 5LXXA 3GY1A 4M3PA 3W2JA 1NJJA 4J28A 3W7QA 3RYSA 3CGTA 1NAL1 1WDDA 4WDUA 5C9XA 3PK7A 3EOEA 1ZLPA 4Q8PA 4HJFA 1P7TA 2J9XA 2F8QA 1THFD 4YVPA 4FR6A 3HURA 1M65A 4HZ6A 3OVRA 2QVHA 4UR9A 2CNCA 4CD5A 1TIWA 3ABXA 4OWGA 5I2UA 2WPBA 4B2DA 4H9VA 1KCKA 4C6MA 3EMQA 3TCEA 3DC0A 3U4AA 2YCLA 1HJWA 1OFOA 3DAQA 4WD0A 3U3HA 1CXKA 2D24A 3HQ1A 4AD3A 3IIPA 4AWUA 2WLYA 4O16A 4DIAA 2CLIA 4KT2A 3TAOA 5HR7A 1B31A 2MUCA 3TYBA 3LRKA 3TFXA 3WN6A 4NZ3A 4IIHA 4JTIA 1MXSA 3CAKA 3C3NA 2YL5A 3G3MA 3MUY1 4V2XA 1IZCA 3BE7A 5AHMA 2DV0A 2A2IA 3S5YA 1K03A 5HUPA 3SEPA 1DQWA 3WQVA 1EGMA 1E0TA 1B54A 3RLHA 2Z7KA 3SCTA 1XBXA 2Z1VA 3B3DA 4K1WA 4NRRA 3SN0A 3PTDA 1I0DA 4XTDA 4JN8A 2D73A 2QUVA 3PSWA 2PWFA 3VC6A 1HUVA 4PFMA 4LS0A 1I60A 1VLWA 4NZJA 3C2VA 3BOFA 3NIYA 1XC6A 5CZ0A 1NP0A 1G7VA 1S2VA 4AU0A 4QQUA 3O06A 2ZRWA 3BMWA 4LUIA 4CN1A 2CESA 4V27A 1IV8A 1J6OA 3WELA 3UCDA 5JBFA 3M0ZA 3PZNA 3G1RA 4DYKA 4MB4A 4N0RA 4OT7A 4M80A 3W7KA 3W72A 4ZXLA 2G3NA 2J78A 1H62A 3ZLHA 3GX9A 1EGZA 3T9PA 1DXEA 2H8ZA 5D9NA 3K1GA 4ZFMA 3MHGA 3VFLA 5I78A 3TFCA 3WLNA 5BRBA 2IUZA 3N6QA 3A22A 4QR6A 1H1ZA 4O0ZA 5GJPA 3LD5A 1FWEC 1TPDA 1ZRQA 1UJPA 4GYPC 1GKPA 2OZ8A 3MT1A 3OYXA 1U33A 1VIWA 3GKFA 4MAZA 1IYXA 1IZKA 1JD9A 2G50A 1ADSA 5HMFA 3NM3A 5E9AA 1CXLA 1QBBA 5CC3A 5AY7A 5HNUA 1EP2A 3PS7A 3UG4A 3B9EA 4KWSA 2BHUA 4UOZA 1GVOA 3CC1A 5G2WA 4HHMA 3WD3A 3OGRA 4UR8A 5HMDA 3HGJA 3FNDA 4GH1A 2EXOA 4OUIA 3FGCB 1E4MM 4JKLA 5CC5A 5E6YA 3M6YA 1VBHA 1YXDA 5FJUA 3JS3A 4DJEC 3S46A 1SFTA 3TQPA 2HWGA 3G1FA 4PMXA 1OD8A 3U2ZA 4C7FA 3CV6A 4NY2A 3U4FA 2C91A 2VCAA 4MB1A 4E0CA 4JNYA 3VGEA 3WQDA 2L5HA 4JPGA 2C0AA 3SN4A 3WSUA 2F2KA 3KP1A 4WX2A 1XLAA 4S3BA 2YPIA 3TWBA 4CNTA 3WNOA 3W6MA 3BG5A 3EWUA 3TA9A 1PIIA 4HBKA 5BXRA 1QXLA 5K4ZA 3G1VA 4S2BA 4DI9A 4WCJA 2WSKA 3AWNA 1EH9A 3GDTA 4IIEA 1A3XA 4YJ5A 3O05A 1SJCA 2XVNA 4DAIA 3TJXA 3CQ0A 1IIHA 1PWMA 3UBPC 4A29A 1ZQ5A 4AX7A 1TTQA 3C2RA 2QDHA 5CPSA 3DYPA 2YXGA 4Z1BA 3PAJA 4DJFA 2A7RA 3GLCA 2BXYA 1Q66A 3N2TA 1O94A 1H1YA 2RJHA 3UG8A 2WVSA 5U7SA 2VCBA 4S23A 1KNWA 4O54A 3E1F1 4X22A 4PTVA 2PDJA 1CGXA 3LERA 2IPFA 4DRSA 3CNYA 2V5CA 3DFPA 4MFEA 4G56A 4C6BA 1C8VA 2D22A 2OEJA 4RCXA 3A4JA 3EOSA 3A21A 5KZMA 2Y8KA 1S1RA 4NJJA 3XINA 1ISVA 5FKYA 2YFOA 3O1NA 3W22A 2ZC8A 3AXIA 4N02A 1AJZA 4XAFA 3VM7A 1GOOA 1KKOA 3W76A 1CXHA 1Q4WA 1OCBA 2YW4A 2PBGA 1J5SA 1QASA 3PNZA 1VFHA 1IXOA 3IIVA 5CBJA 4GHRA 4UC5A 3VIPA 4J40A 1NY1A 1TVNA 3V5CA 1YDYA 6XIMA 1KRAC 2CLKA 1QPQA 4LJ3A 3GK0A 1V79A 3A9IA 2EKCA 4ZENA 5DMMA 1F2JA 2GJXB 5I3IA 3WK0A 4X0VA 3BURA 2E6DA 3SZ8A 2E0PA 5DX7A 4AZBA 3WZ0E 3WYZA 3OLGA 4ADTA 2E5BA 2FGZA 1OYCA 1WUFA 2FPVA 1R3QA 5ECVA 3TN5A 5TIMA 5AC5A 1W9XA 4OOUA 2H9AA 4LC6A 2OEMA 2AOSA 1PCWA 2YCJA 1MUCA 5AYYA 5A6MA 4MWAB 3L0NA 3VGHA 4AY7A 1O5KA 3KUMA 1OVDA 2QGHA 3H8AA 2R82A 4ZQRA 3BW4A 1N2VA 5D2TA 2D23A 2PCEA 5A6SA 4O50A 2DSZA 4IWWA 3W07A 3S0CA 1XD0A 4LAOA 4Q8NA 3T0AA 4OIFA 4AF0A 3HQNA 4BA0A 1UIPA 1XWYA 4AWTA 4E3TA 3TONA 2CKRA 4UQ9A 5EMYA 4I7WA 3DFTA 1PX3A 3W1UA 4GJIA 2ISSA 4LCRA 4H2HA 4IPNB 2NX3A 4GVHA 4D6EA 5C2GA 4EWND 3CUJA 3F4VA 5DF0A 1D2KA 4Z2HA 4WOZA 2J62A 2OSYA 1TRIA 3Q2DA 1L8NA 2NUXA 4FR1A 2GQAA 4ZCWA 5JBEA 4PMNA 1GOIA 3VIHA 4HCHA 1F4AA 1EIXA 3ALGA 4RUBA 5DT7A 4MKVA 2XM2A 3CPUA 4M6VA 3B9AA 4JEQA 3OO2A 1FHLA 2WHMA 4AMAA 5IHSA 5EMUA 1XYCA 3K4WA 3O15A 3WD1A 1P6CA 3TW9A 4IFKB 2BY3A 1U1UA 3W26A 4CKQA 1AJ0A 1X39A 2CETA 2V5LA 5D02A 2ZUTA 1YNPA 1BYCA 3QKZA 2CCRA 5AHIA 3N14A 4YTSA 1ZSXA 1VJZA 1KKRA 1Q7ZA 3FXYA 4BS0A 1C9DA 4WKHA 2YYTA 3GG1A 3WDPP 3QVQA 2VZOA 5HATA 4LC8A 4CQCA 2YXXA 3MP4A 1G4TA 4H9TA 4AIEA 1VR6A 1JDCA 3K30A 1JG9A 4J3SA 1UOZA 1QI0A 3WFAA 3VOGA 3L5LA 1QPOA 2FFIA 3BGGA 1NELA 3L5AA 3W02A 4GCXA 3WQCA 2GGJA 4AMCA 3D46A 2V82A 1HKMA 1GW1A 3EA3A 4NASA 3T7VA 5MKGA 3FVDA 2GWNA 2UY3A 1AVAA 1LLWA 3RIKA 3SUTA 3WH8A 3UERA 3S1XA 3ABZA 4PCTA 2PBOA 3GXNA 4DF2A 3LCLA 1M53A 4O1BA 2JEPA 4FNUA 4C1KA 2PDPA 1RCXB 3GTNA 1QNOA 1N7KA 4M29A 4M6QA 4WQ6A 1ELSA 3OIXA 2PCQA 1RR2A 2AQVA 3OBAA 3K46A 4FLOA 4EP8C 1RPKA 3SY1A 2GPTA 1J9YA 4CN6A 2BB0A 1W32A 2PWUA 1YKWA 4PUUA 2VGIA 1TKKA 3LBCA 1YADA 3LYEA 3EGJA 1A53A 3S1VA 4MNLA 3ZWSA 1UA7A 3UZWA 4YMZA 4FSAA 4S3CA 3THDA 5AC7A 4YTTA 3W38A 3KOYA 1PO9A 3ZS4A 3BGJA 2WVVA 4JN7A 3CMGA 1XSJA 5G5IA 1P43A 4GZIA 1PX4A 3DIPA 4UMBA 7ODCA 1J8VA 1E51A 3BOLA 5JMUA 3LLFA 4JX5A 4UQBA 1XF0A 4EXAA 4TIMA 5EB8A 4X61A 1XIHA 4HK7A 3UJEA 3HM7A 2BNJA 3NYZA 4HU3A 2VQUA 8RUCA 5FF7A 2XISA 1UD4A 2J8FA 1S2CA 4IP7A 2PWDA 3O9NA 4FA3A 2VEGA 3W29A 3MBDA 2I5IA 5HDRA 1QATA 2WKJA 4DBWA 4FF5A 1QI2A 5LIYX 3EMZA 3CTTA 4XD5A 1R3RA 1GONA 4O57A 4H9MA 3ABOA 5C55A 2J27A 2UY4A 2Z24A 1YMYA 3BQ6A 3IAPA 3LI0A 1QHPA 2X16A 1XICA 4QG6A 3V36A 5LNSA 2OX4A 2Y0FA 1FXQA 5TAOA 3VDHA 2GVYA 3O3RA 4V28A 1W8GA 2OR2A 1NDWA 2GSEA 2OQHA 3MTWA 1J2WA 4O28A 1REQA 5DCBA 3HBLA 2P53A 4QIUA 1RCOB 1ADOA 2QDGA 4Z1DA 3VUPA 5FSEC 2PC4A 1E6XM 5HOSA 3QPYA 4CU7A 3REQA 2QPSA 3ARWA 4HCLA 5LKYA 2AAAA 3V5OA 4XZMX 4IFRA 2ZZ4A 1LL7A 1CECA 4ZO7A 2WQPA 1EDQA 2BWGA 1F6KA 1TTPA 3BLKA 3SR7A 4Q22A 2EJAA 4A3UA 3KXQA 4W7UA 1R5YA 3TZFA 3H24A 3KS6A 2HXUA 4LCQA 5AFDA 3RG6A 2EG7A 2D1ZA 2W91A 4D71A 3LHTA 2V5BA 1R8LA 1AJ2A 5I3DA 5HQLA 1T8XA 2WC4A 4NAFB 1GQKA 4ZOEA 1A5NC 3IV3A 3G6MA 1WOAA 2WJFA 2DH3A 4JDYA 5F1UA 3SM0A 1VCFA 1S1PA 4HHLA 3T0DA 4S3DA 1T8QA 3TJIA 1PIGA 4A4AA 3IACA 4GX8A 3TX9A 1R87A 3WLKX 5T91A 3M41A 3QYSA 2NQ5A 2JIWA 4HYRA 1W3IA 3ME3A 3MMWA 4FNQA 3L4TA 2G41A 3LI1A 3EDDA 1LQ0A 1WQ5A 1YTEA 1TJ1A 3MV01 4FPSA 4YN5A 1GW9A 4FX6M 3BAYA 1W1IE 1JF6A 4QHRA 2GUUA 2Y88A 2HZGA 1V93A 4FO4A 2JGQA 4GC4A 4CQBA 4X60A 3R0KA 4ORMA 5I24A 1NSJA 2YDAA 1Z3NA 2VC6A 4XB3A 3OG3A 5SWUA 3H23A 3KCLA 2G3MA 3PULA 1QNRA 3CEUA 3PVFA 4JNZA 1D9EA 1RALA 2XFWA 3S8HA 2A79A 2FFCA 3P6LA 5C5YA 5CH9A 1NFBA 2BVTA 3PSVA 1JQXA 4JTDA 3NCOA 1P1MA 3UZXA 1HTIA 3GTFA 2ISWA 3W7OA 3ZIZA 3LM7A 3TYEA 5EFDA 2REQA 2PRMA 1UROA 1AK5A 2XDFA 3QYQA 4AC7C 3GU9A 1NWUA 3W7EA 1TUXA 5D2VA 1XUUA 3SCWA 1CDGA 1HP4A 4TX6A 4LVFA 1KXVA 2Z00A 4K8HA 3KL5A 1FP9A 4GRSA 4GUJA 5D37A 2ZWZA 1D8CA 1FTXA 2ZFAA 4H00A 2QS8A 4JFSA 1FXPA 3DEQA 2ZUVA 4XX6A 3MCOA 3HGOA 4JIRA 3C0QA 2ZXQA 1GT8A 2VENA 2ZX5A 1H60A 1IEQA 3O6AA 2PGFA 1LRQA 2DZVA 2Q71A 3IANA 2PFHA 1B3OA 2XVPA 2HK0A 2OKTA 1E72M 1UPPA 3A4XA 3HMCA 1FWWA 2XH2A 3I7QA 3FHAA 3PP7A 2VEKA 2ZZ7A 3TSMA 2FTPA 2VDHA 1SM9A 1N8IA 3S4TA 3R13A 1P0NA 4X9YA 4IXXA 2ACRA 5D30A 4Y96A 3KTCA 4DY1A 1K7XA 4Y2WA 2DORA 1LL4A 4F79A 2A0NA 2YL6A 2RUSA 4BEUA 4EWJA 2VWTA 1R3VA 3NSMA 3TTOA 1IE7C 1WE5A 4F0RA 2YLLA 3CH9A 4FX7A 4QAIA 2OELA 3VDBA 2G0WA 3VTRA 3PBYA 5ABGA 1EL3A 1XQKA 3C52A 3WNPA 3BZJA 4URIA 1UR9A 3UVAA 3W1QA 1KM5A 5EMKA 3UXLA 1OIMA 1QW9A 3IEBA 5CLTA 2RKXA 3UA4A 1OINA 3PB2A 4KESA 4NU7A 1RJQA 1P6WA 4DWSA <