3QMVA

Redj-thioesterase from the prodiginine biosynthetic pathway in streptomyces coelicolor
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
253
structure length
244
Chain Sequence
QRSAWFPRPVAAPAAEPPDPAAAPLRLVCFPYAGGTVSAFRGWQERLGDEVAVVPVQLPGRGLRLRERPYDTMEPLAEAVADALEEHRLTHDYALFGHSMGALLAYEVACVLRRRGAPRPRHLFVSGSRAPHLYGDRADHTLSDTALREVIRDLGGLDFDRRLPVLRADLRACERYDWHPRPPLDCPTTAFSAAADPIATPEMVEAWRPYTTGSFLRRHLPGNHFFLNGGPSRDRLLAHLGTEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Function of the RedJ Protein, a Thioesterase from the Prodiginine Biosynthetic Pathway in Streptomyces coelicolor.
pubmed doi rcsb
source organism Streptomyces coelicolor
molecule tags Hydrolase
molecule keywords Thioesterase
total genus 81
structure length 244
sequence length 253
chains with identical sequence B, C, D
ec nomenclature ec 3.1.2.-:
pdb deposition date 2011-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00975 Thioesterase Thioesterase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3qmvA00
5AI9A 2WHPA 4QWWA 4CCWA 1MN6A 4OU4A 4CI9A 4DNPA 5IVHA 2WUGA 2H1IA 3ESDA 4ARBA 1E89A 4Z49A 3R3ZA 3D7RA 1SCIA 3A70A 2B4KA 3W05A 2BGRA 1AZWA 1B41A 3FOBA 4CCYA 3R3WA 4UBOA 3I6ZA 5EIHA 1N8SA 3I1YA 3WKEA 3B3QA 1VJ5A 2CEKA 5T4FA 4C01A 4BZWA 7YASA 3HYSA 1JU4A 4BVKA 3IIIA 1XLVA 3RM3A 3FLAA 4EHBA 3C6ZA 3VVMA 2RHTA 3WL7A 3WZLA 3WKAA 2V9ZA 2OAGA 3AINA 3DOHA 5AK6A 2ECFA 2Y6VA 4MEAA 5LZ5A 3DYVA 2W6CX 4W9RA 5J3JA 1GKLA 1AX9A 1EK1A 2PSJA 3OC0A 1FFCA 1GQSA 2HRQA 4Q05A 4AB1A 4TGLA 3IUQA 3GELA 1P0MA 1CUAA 1CFJA 1HLGA 3DLTA 4RGYA 3LLCA 2QRUA 4H7KA 4OYYA 1YS1X 4OCZA 1UFOA 5AKYA 4UHFA 4GECA 2CUTA 4B9AA 1J1IA 3AIMA 3C6BA 2O2IA 3I6MA 1QONA 5CBKA 2EEPA 1UOOA 5HCUA 2P8SA 1WM1A 1GXSA 4G9EA 4ZXFA 5CT9A 2BCEA 4FLEA 4OB8A 2QR5A 2WFZA 5C7YA 2G5PA 4EA6A 4Q34A 5T4BA 1XZDA 1EDDA 3D4LA 4QDOA 2XLCA 3BL8A 4YK7A 3KWJA 1NU6A 3AZPA 5ALOA 3UMJA 1R4ZA 1KU0A 1XRRA 4C89A 2JBWA 4BAUA 3L1IA 2Z5GA 5SYMA 5HK8A 2QVBA 3QMVA 4BE4A 4KE6A 1TAHA 5EIAA 3O4HA 1UXOA 3L1JA 1XQYA 1A88A 2AJBA 4LXIA 1DQZA 1XZBA 1VLQA 4Y2RA 5DYYA 2XUFA 3STUA 1OILA 4EB0A 2ZJ6A 4K6KA 1CPYA 3BDIA 4HTAA 1R50A 2OAEA 5ALTA 1E66A 4JEIA 3OOSA 2XUIA 5C8VA 5JAOA 4PSUA 1ZD4A 3H2KA 3C5VA 5ALEA 3AILA 4B83A 3ZV7A 3FVRA 4UFOA 5LZ2A 3C70A 2QMQA 1ORWA 5CMLA 2WJ3A 1ODSA 5DJ5A 4Y2VA 1G4HA 5HF9A 2HHAA 2RONA 1X2EA 2XUPA 4IO0A 2J4FA 2BKLA 3YASA 2Q0XA 1H2WA 2G5TA 1JU3A 3TJMA 5E4TA 4KJXA 1G5FA 3PF9A 4RE6A 5DTIA 3SX4A 3ANSA 4W63A 2ACEA 5HQ3B 3D3NA 4GDMA 3G0BA 1E3QA 1BEEA 3WWDA 2D5LA 4Y2XA 2D0DA 4U2CA 1RP1A 3MVEA 2WSLA 2XUAA 3D59A 4FTWA 4K6GA 2X8BA 3DQZA 3IVMA 5DNWA 4MWSA 1YAHA 5AKZA 2XMRA 3FLEA 4KACA 3F67A 1XZHA 3T4UA 3QPCA 5E2IA 5CT6A 5AOAA 5EGNA 1Y7IA 1GPKA 3WYDA 4BC0A 1MNQA 2HFKA 4E46A 4RE5A 3V1KA 3VJMA 2H7XA 1TK3A 4Y2QA 3QM1A 3B5EA 2HFJA 3ZWQA 3WWEA 5AJHA 1QO9A 5FP0A 5K3DA 2WIKA 5K3BA 1E8MA 2J3DA 5LZ8A 3V1NA 4AN0A 3R3UA 1RYYA 5T4EA 3IB3A 1SOMA 4YASA 4B84A 5AM2A 1P0IA 1GPLA 2PPLA 2XMZA 3R0VA 3FNBA 2VF2A 1THGA 3HABA 1LZKA 4NMWA 5AO9A 2I3ZA 4AO8A 2HU8A 2EDAA 5DNVA 3H2GA 3QBJA 3JWEA 4N8DA 1XRLA 5C8ZA 4UBNA 1OCEA 4BBZA 1IZ8A 5ALUA 3F9CA 4X7BA 1FFAA 2PVSA 5K3CA 1UZAA 3BF7A 3IA2A 4AO6A 5A7HA 3BXPA 1LBSA 1EDEA 4MQMA 2WHPB 4G8DA 3KWFA 4BATA 4A23A 4PNZA 5JZ9A 3GFFA 5E4JA 3UUEA 1XZCA 4JH0A 5FUMA 2ONCA 4HAIA 4FLFA 1AQLA 4G4GA 3ZI7A 4CCYB 2CJPA 3FSGD 3S8YA 2H7YA 2Z8XA 3H1AA 3A2LA 3PFCA 4P08A 3D2BA 2Z8ZA 4AZ3A 2PX6A 5AKXA 2V96A 4ZGBA 1XFDA 4CIAA 4WDRA 3U1TA 1IVYA 4FLMA 2WG2A 5ALGA 3HLKA 3PF8A 5AK5A 5I7UA 1WPRA 4ZREA 1UKAA 3K6KA 1B6GA 3C6XA 5CH3A 1XZKA 3O95A 1K4YA 3BIXA 3H18A 5F4ZA 1M33A 1YB6A 2VEOA 3V9AA 4W1QA 1CUIA 1W52X 3G0GA 2J4CA 2AJCA 2IITA 2HA3A 4ITVA 2GBGA 5T4HA 2PUJA 3D2CA 5IVDA 1QIHA 3WK4A 4LKOA 4LYEA 2WG0A 1H2YA 4H7IA 1QIMA 3QH4A 1N5MA 1DQYA 5AM0A 1CUXA 4KYVA 2B61A 4QDZA 4AZ0A 4J0GA 4J0DA 3WL5A 2CZQA 4L9AA 3C43A 2WTMA 5LKRA 1ZGBA 5ALPA 4BB0A 2HA6A 1UK7A 1USWA 1JMYA 2XE4A 3DS8A 2DQZA 4DMKA 5JD6A 3ED1A 4UFPA 4JNCA 1I6WA 1XRMA 1XRQA 2QM0A 1GPNA 4JYPA 3M81A 3S2ZA 1VXRA 2OGZA 4HXFB 5BOVA 4ZV7A 3I2GA 2OQVA 2Y6UA 4BVLA 1ODCA 1SFRA 4K2AA 4DNOA 3PE6A 2QXTA 1LPSA 3KDAA 1TCBA 4F60A 1N1MA 1DU4A 3DOIA 1FFBA 3W9BA 2HIHA 1ZIYA 2VT6A 2I03A 3PUHA 4EUSA 5LLSA 3W04A 2HL6A 3PI6A 1CUHA 5AK3A 3IUJA 2DCMA 1YSCA 3TRDA 2AJDA 1OXMA 3D5EA 4WCVA 4K6HA 1XKTA 1CUBA 1YS2X 4BP8A 1C4XA 2CMFA 1EB9A 2C0PA 4DYHA 3VISA 1TCCA 1ZD2P 1PJAA 3AZOA 1LPOA 3WA7A 4H7JA 5JZBA 2H7CA 4AMZA 4IHAA 2O2GA 3QVMA 1HBJA 1QZ3A 1XRNA 4PO3X 1Y37A 4BYMA 5FLKA 3AZQA 3VVLA 2JEZA 2ACKA 4PSDA 3A2MA 1VE7A 1S8OA 2XT0A 4BDTA 5EIEA 2JGMA 1EH5A 5FXMA 4AX4A 5ALDA 3CXUA 3WMRA 1IUNA 4XVCA 1VXOA 3FLBA 2NW6A 2BGNA 4WDQA 4B80A 3DL7A 4YX9A 1LLFA 2GYWA 1XZGA 1ZI6A 4KAAA 3WK8A 2CKMA 1Q84A 3KSRA 1DX4A 2BUBA 4B81A 1ZI9A 1ZD3A 1KU6A 1X2BA 2WJ4A 1WHTA 5C8XA 2CB9A 1ZI8A 4DIUA 1MPXA 5ALYA 3BE8A 3DCNA 4CFSA 2Z3ZA 3G9UA 2QOEA 1SCQA 5AM3A 3STYA 1K6EA 4GEGA 1LNSA 3WJ1A 1K8QA 5KBYA 3E3AA 3WA6A 1TKRA 1QIGA 2BUAA 3H2IA 3LS2A 1MAAA 4HZGA 2Y1KA 3DKRA 2GZRA 4S0XA 1DWOA 2RI6A 2R8BA 2W22A 2Y2UA 3KOOA 3N0TA 1Y7HA 2OCIA 4L72A 1P0PA 2VTVA 1F0NA 4H77A 4PW0A 2G63A 3BDVA 3MGAA 4HS9A 5AKHA 3G9XA 1CUFA 2IX9A 1QIDA 1XZEA 1A7UA 4P9NA 3DEAA 3R3VA 2HA4A 5CH8A 5AKJA 1ACJA 4IH4A 4LXHA 4F5ZA 1VZ3A 4X00A 2RGUA 3AUKA 4D9JA 3HSSA 2O7RA 2O2HA 5AIBA 5IVKA 4DMFA 2GBCA 5C81A 4FFWA 1P0QA 3DNMA 1G42A 4ZV9A 2ROQA 5FPQA 1AC5A 3QITA 5CW2A 2WM2A 1E8DA 1XLWA 4FWBA 3G9ZA 5IVIA 1EXWA 4O08A 3QMMA 3VKFA 1W1IA 2DHEA 3EIOA 4Q3OA 1MX5A 3O4JA 3PUIA 5D3ZA 4P93A 3FAKA 4QDTA 5LZ4A 3SWWA 1CUZA 5ALRA 2WU4A 4X3CA 5ALFA 1CUEA 4RNCA 1XZAA 4BP9A 1NX9A 3R3XA 1CUDA 3OG9A 1HKHA 3WWPA 3K9BA 5HF6A 1DWPA 4NVRA 4PQEA 1IMJA 2XMDA 1EINA 5HFAA 2GYVA 5HK9A 1GZ7A 1WB5A 2YXPX 1ORVA 1MTZA 5ALKA 4E14A 4AN1A 5ALVA 1UK9A 1XROA 2JIDA 4X90A 1CIJA 4Y2PA 5JALA 5FV4A 5AK4A 3F97A 1CUGA 1IUOA 2V98A 5EHZA 1ZICA 5AICA 3LP5A 1QTIA 1A8QA 1WB6A 4B6GA 3STTA 1EVQA 2HM7A 4FBMA 4QEKA 1D07A 4UHDA 3RLIA 1H23A 3WYNA 3G0CA 5AKGA 5DNUA 1YR2A 1MO2A 4Y2YA 3ESCA 1HPLA 4B0PA 2JGJA 1UWCA 4DM7A 1BU8A 5AM1A 4J0HA 3O9VA 3HC7A 2XUJA 2GYUA 3Q8WA 1AGYA 1TRHA 4GWLA 2BFNA 5JD4A 1UK6A 4HXGA 2JEYA 4EY5A 2WHRA 2HA7A 4J0CA 2DHDA 4OYLA 3STWA 5AKEA 2JGKA 4N8SA 3DKKA 5JATA 4B0OA 2DFPA 1QIEA 4Q3LA 5EHQA 2C58A 3DD5A 3FVTA 1QIKA 4Q82A 3M82A 4HRXA 3CCCA 3FYUB 1QO7A 2HA2A 2ZYHA 3BIWA 1T2NA 3RK4A 4WFIA 2OG1A 5IH7A 2RAUA 3O4GA 1E8NA 5ALJA 5ALNA 5ALLA 4PF1A 3I2HA 1TQHA 1JJFA 3VJLA 1R3DA 2C7BA 5JAPA 1QE3A 4FFVA 1EK2A 2OCGA 1JI3A 4XX1A 1XZMA 1KEZA 4FHZA 1L7AA 3L1HA 3ZLVA 5K3EA 3HEAA 2WIJA 3W2TA 1UT6A 1U2EA 4B85A 2ZYRA 5I9IA 4FNMA 3G8YA 5K3FA 3A2NA 4ROTA 4U2BA 4K5QA 5KWJA 5ALZA 2PSFA 5CH5A 1L7RA 5HQ3A 2AJ8A 3NUZA 2I3DA 3C87A 4DMCA 2YH2A 3PDCA 4G4IA 3C8DA 1QFSA 1EB8A 3MUOA 2JGEA 4HXEB 3I2JA 5DYTA 1CQZA 1VE6A 5K5EA 2C4HA 3IUNA 5CT5A 3DYIA 5FPPA 1ZOIA 3M83A 4H7EA 1ISPA 1PFQA 3B12A 3JYHA 1JJIA 4FDMA 5A6VA 1AMNA 1SC9A 1XZIA 1W75A 2DQYA 5AIAA 2XB6A 4IH9A 2XMSA 3FYUC 3OPMA 1BEZA 4Y2SA 1VKHA 2PL5A 3FCYA 4X6UA 5I8PA 3ZPXA 3G02A 5A7FA 4A16A 2B20A 4X71A 4QZVA 1LZLA 4I19A 2JGFA 2PM8A 5LYYA 4ZRDA 1BE0A 2JGLA 2JF0A 1XRPA 2BAGA 4EY7A 3QPAA 3QZUA 5K3AA 1WB4A 2GBIA 3Q0TA 3FCXA 3FYTA 1BN7A 3I2FA 1XZJA 5FOQA 1LBTA 4I4CA 4E15A 3E0XA 5D6OA 1CUVA 1JT2A 4L3WA 4IQ4A 1J07A 2XQJA 3PICA 2PU7A 5IKXA 5AP9A 3STXA 1H2XA 4KR0A 1QOZA 2GZSA 3WWOA 3NWOA 5LP1A 1XQWA 2B9VA 4OPMA 1EVEA 2HA5A 4XIIA 1YA8A 2I78A 4G8CA 4M0EA 4G8BA 1LPNA 1MT3A 1J06A 2XQIA 4OU5A 3SC2A 1QLWA 3GBSA 5KWIA 1SCKA 2AXEA 3T52A 4HVTA 1LPMA 3EF3A 1QIFA 4U2DA 5AKLA 2XUDA 4OSEA 1A8SA 3AJAA 2OCKA 1W76A 5AI5A 4EY8A 1EX9A 5ALWA 4DSZA 4F0JA 2WFLA 4UBJA 5E4YA 1HL7A 3WWCA 1E5TA 2E3JA 3G0IA 3WK7A 4GW3A 4KRXA 3X3HA 2VA9A 4G5XA 4J03A 4X93A 2WHQA 2HU5A 2XUQA 4ARAA 4X6XA 1F0PA 2OXEA 4U2GA 3WK9A 5JAHA 2H9YA 3WJ2A 3HI4A 3WK6A 4F21A 4OUKX 4TVKA 2X5XA 3WZMA 4LHEA 1QGED 3DDUA 4KE9A 2UZ0A 5DTJA 4AXBA 3PFBA 4GXNA 1Q83A 2X76A 4Y2JA 2VJAA 4BRSA 4Y9SA 1CUCA 3I2IA 1BCSA 1LPPA 3ANTA 4X91A 2JGIA 2WTNA 3FSGA 1NU8A 4MEBA 2OGTA 4AMYA 1F8UA 3HXKA 4EY6A 5A71A 4CG1A 3O4IA 1R9NA 4J0IA 4KRYA 2WIGA 1U8EA 3R41A 4G1FA 5JADA 4FOLA 5JANA 3HZOA 3IBTA 3K2IA 1R9MA 1BRTA 1O6FA 2QTBA 5FDFA 2QJWA 4X94A 4INZA 4J3JA 1MNAA 1LGYA 2HADA 3V1MA 4C4YA 1CUWA 1CUYA 3RKSA 1GT6A 4BCBA 4H7HA 4U2FA 3VXKA 2PU5A 5HKAA 4UHCA 3LIIA 1FFEA 5AKIA 3NOXA 4HRYA 1Q0ZA 4OD0A 1ZJ5A 1ZD5A 3OURA 3QPDA 4KAJA 5AI8A 3TEJA 4OB6A 1XLUA 4H0CA 2PSDA 4MJ3A 1YB7A 4TPKA 3VDXA 4C6HA 2VAVA 2HRRA 3AFIA 3I6YA 1QIJA 4FMPA 1T4MA 4JYMA 4PSCA 5AKKA 4YPVA 4DTCA 1CV2A 5FKJA 4CIBA 2R11A 2OPHA 2WLSA 1DT3A 3FWHA 1VOTA 4OB7A 1BS9A 5AM4A 3QYJA 1MJ5A 3R40A 4H7DA 2WQZA 4DGQA 3WKCA 5HZGA 3JW8A 4W1PA 5AI6A 2O7VA 3GROA 3QMWA 4UBLA 2XI4A 4QDUA 4GI1A 5AH0A 1DINA 2G4LA 4U2EA 5EI5A 3WLAA 4GHWA 2VAXA 2WUDA 5JARA 3EQ9A 2IIVA 5BV7A 3CN7A 4E11A 1BROA 5BWCA 3I28A 1HDEA 4C88A 1U4NA 3H17A 5JAUA 2QJRA 3H1BA 3G7NA 4BDSA 4KAFA 5K3FB 4IH1A 2BUCA 2J3QA 4UBMA 1XQXA 2RIPA 2XUHA 3HACA 1VA4A 4UHEA 1IUPA 2ZYIA 5ALXA 4DNFA 2XMQA 2FJ0A 3C6YA 1O6GA 4LIPD 4G4JA 1JKMA 1F6WA 4QE3A 3W06A 1X70A 4CG2A 3IULA 2PSEA 3H2HA 5A7GA 5ALSA 1MAHA 4LYDA 3CN9A 3F96A 3ESAA 4WJLA 5EHNA 4AQDA 1UKCA 1J2EA 3WKBA 4NZZA 4UUQA 1GKKA 1R88A 2VJDA 4QLOA 4Q1VA 3NGMA 2ZYSA 1AKNA 1Z68A 1GQRA 3BF8A 4DMHA 3RARA 2AJLI 3H0CA 4QA9A 4UHHA 2OLEA 2FUKA 4L0CA 4WFKA 4QLAA 2WILA 5H3HA 4X95A 4UBIA 4A5SA 1YA4A 4M0MA 2DHCA 4X92A 4Y2UA 1DX6A 1EDBA 2QS9A 4MQLA 4UHBA 4FKBA 5ESRA 1QFMA 1CVLA 4UBKA 3UUFA 5CURA 4G9GA 1JMKC 2PKYX 3ICWA 1FJ2A 5JYCA 2ZSIA 4B9EA 2PSHA 2WG1A 3HJUA 4C4XA 3GUUA 4V2IA 4KEAA 3DL4A 5YASA 5AM5A 3M3DA 1CUSA 5CT4A 2WKWA 3BJMA 3WIOA 2FX5A 4BCCA 5AI4A 2Z3WA 2XMBA 5FRDA 4Y2TA 4EBBA 4N8EA 1YAJA 1HQDA 1TCAA 3WQHA 4MYSA 4CG3A 4EZIA 5ISMA 1W4LA 3E1GA 4H35A 4W1SA 2CBGA 3I1IA 1MU0A 5DWDA 1JFRA 3OM8A 2OGSA 3WI7A 1N5RA 4BAGA 4BZZA 3EQ8A 3DJYA 4BTVA 1WHSA 2WU3A 5LKAA 1ETHA 5A62A 2XQKA 4BAZA 2C5GA 2YYSA 2YASA 4DLNA 4UPDA 1MX1A 2OQIA 3D2AA 3F8SA 3VJKA 3ICVA 1YCDA 5JIBA 4QWMA 4WY8A 1U65A 2VJCA 1WPXA 4Q3KA 4XJVA 3WK5A 3V1LA 5AOCA 1AUOA 1CRLA 1ZGCA 3AIKA 3H2JA 4BRZA 3ZLTA 2C0QA 2QKYA 1W6RA 4BTLA 3O9MA 1XZLA 1IZ7A 1UOQA 1AURA 3ILSA 2ORYA 3E4DA 4MWTA 1TIBA 3EBLA 4C87A 4ZWNA 3H04A 3P2MA 4WY5A 4H7FA 4ETWA 5ALIA 1YASA 2XMGA 5BWBA 3KD2A 4BE9A 2K2QB 4KE8A 4QNNA 5JD5A 4J0JA 2ES4A 2QXUA 5CXXA 1BCRA 3LCRA 5ALHA 1XZFA 4P92A 2DSNA 1VA5A 2LIPA 2WFMA 4H18A 4AO7A 1CQWA 4UFNA 2QUAA 2WIFA 3D0KA 1DTEA 2C5FA 1UOPA 3IDAA 4XWGA 4Y7DA 1EHYA 1XQVA 5DYWA 1QIIA 5LZ7A 2WIDA 1LPAB 1G66A 4N5IX 3O0DA 2WJ6A 1BN6A 3N2ZB 1PV1A 1DWQA 3H19A 2VQ6A 4B7ZA 1FFDA 4B82A 1DT5A 1Q0RA 5SYNA 1THTA 5DLPA 4N5HX 4BC1A 1CUUA 1FSSA 5D3KA 3FYUA 5HFNA 5A2GA 1K63A 3WL6A 2Y2VA 2PUHA 2EDCA 2XDWA 3HRHA 3CCBA 2QT9A 1UKBA 3C8HA 3BWXA 1EI9A 3G9TA 5D7BA 5LZ9A 1H22A 3C45A 1ZIXA 3KXPA 3LIPA 4DNQA 4MYDA 4I3FA 2OCLA 2WFLB 4PV7A 5HF5A 1R1DA 4W1RA 2VT7A 5LIPA 3BJRA 1LPBB 4WFJA 2VSQA 1VZ2A 3SK0A 1CR6A 4QDXA 2RHWA 4BVJA 5KREA 6YASA 3U0VA 5ALQA 3WL8A 5ALMA 3I2KA 3MUNA 3WIBA 5HKBA 1A8UA 1C7JA 3EQ7A 4FBLA 1UK8A 2BJHA 3ZLUA 3STVA 3C5WP 1CUJA 2HDWA 1H2ZA 2HA0A 1JJBA 4X6YA 1C7IA 1QJ4A 3ESBA 4J7AA 4M0FA 2HU7A 1ZJ4A 4DSAA 2V97A 1WOMA 3G0DA 2DR0A 4BCDA 2XUGA 2XUOA 5CXUA 5AOBA 3OTQA 1CLEA 2ZJFA 2VATA 1WCYA 5HF8A 1K5PA 2QZPA 2QUBA 3GZJA 4RPCA 2XLBA 5JASA 4LXGA 3IUMA 1ACLA 1QTRA 2ZVDA 4MXDA 3FBWA 5EHXA 4NS4A 2WUEA 1CEXA 4GLBA 4ZI5A 1ODTC 5AI0A 5CTAA 3IURA 2XUKA 3V48A 4X85A 5CT8A 5AHXA 3AIOA 2PBLA 3TGLA 3WKDA 4GBGA 3R3YA 1EA5A 1MX9A 1RWQA 3A6ZA 5CRIA 5JZSA 4FNGA 2VJBA 2GBFA 4J0KA 4KE7A 1GGVA 4JUIA 4EY4A 2ZJ7A 2FJPA 4C4ZA 2XQGA 3W9UA 2ZSHA 2XMCA 3GA7A 1XKLA 2XQFA 1L7QA 3F98A 2WUFA 4X97A 5EFZA
chains in the Genus database with same CATH superfamily
2ZSDA 3AUFA 3FUTA 5FOWA 4GX0A 5AI9A 4RJTA 5JMOA 2ZRAA 2WHPA 4YO7A 1B26A 1X19A 4EP1A 4G85A 1XZ8A 3LPDA 1IK4A 1AK1A 4N03A 5DW0A 2C92A 2Y93A 1MN6A 3DO8A 1UBOS 3Q7QA 3QENA 3SICE 4BV9A 1CWUA 1OX4B 4BO4A 4KBYA 5K8IA 3OPYI 4IDHA 3LY5A 2O5CA 1T9AA 3RC8A 3ESDA 1GG5A 1ZNQO 4UZFA 2PKWA 2FOLA 3TX6A 3ZV3A 2NTVA 3DBRB 5IPFA 3HCBA 2RG7A 2GILA 4K05A 4EHDA 3PR2B 2BGRA 1GNPA 1XTTA 2QY6A 3GUZA 2BONA 3FOBA 1L9KA 1T0HB 1K68A 1YRQA 2BPOA 2AXPA 3HSKA 4PRLA 5H81A 3P9CA 2PLWA 4IHQA 5HSGA 4NOLA 4RIFA 3VNUA 5E4FA 2JIZD 2G25A 4JK3A 3THWB 2VFAA 4F5YA 1VI5A 3UA4A 5B12A 1Z17A 5HM6A 1IEVA 3URKA 3ZU3A 1NA5A 5L7TA 1NSFA 3NIWA 2D2FA 4UNSA 2B2NA 3QLUA 1ORDA 4C01A 2VC2B 3OT5A 3M6FA 3ZHOA 2SCUB 3QOYA 3EWSA 1YJ8A 2GWHA 4KH1A 4V38A 3T38A 1QR6A 3SC2B 4URXR 3F8WA 3HVHA 2GN4A 1NXSA 4ILEA 1YI1A 4D26A 4KDEA 1V2GA 4G41A 2PH1A 1S3GA 5EWJA 3H05A 3RM3A 3HBLA 1K7FB 1YOVA 2P4UA 3FLAA 4FEAA 5T67A 4M9SA 2PZLA 2DCUA 4GC5A 3C6ZA 2Z5LA 3PXBA 1ZISA 1SG6A 2W11A 1RKVA 1TJPB 5B6PA 2G36A 4ALNA 4RLFA 4XQEA 1DXOA 3H4MA 3OCXA 2ANBA 5DHAA 4L4SA 2QRZA 4O4IA 4IUDS 1OMOA 2N46A 1SIUA 1CHDA 2B1IA 4MR8B 5MDHA 1TEHA 3DYVA 2E4UA 1T43A 2W6CX 3JVEA 1WUTA 3UAOA 1SUBA 1WTCA 3DDZX 3FIUA 5H70A 1BXKA 2ZU0C 3D6JA 4L3OA 2A8YA 1NJSA 2QYHA 2PT9A 3WLHA 1O03A 4HDOB 3SS9X 1KZ4A 1GKLA 2KJQA 1AX9A 3GBVA 3MT8A 3JX9A 3SYNA 1T9HA 1EK1A 4KAXA 1FFCA 4Q9HA 3UJAA 1P3DA 1UKEA 3VU9B 2IUUA 1R0YA 3OP1A 3L7IA 2I87A 4IJ6A 2RE8A 3KFVA 1B1CA 1A69A 3JQAB 3BGVA 2ZTMA 3IBGA 4V03A 4Y9UA 2UZ4A 2Q2QA 4YQFA 1PV2A 3AF4A 3WRXA 2R3SA 1ZIPA 1ZN8A 1QPZA 3E2IA 4ONEA 2HMAA 3GUHA 1WDTA 3KQTA 1YO6A 1RXCA 4RGYA 5EERA 2VTKA 2GN0A 4GRIA 2W8BB 1KGSA 4NULA 3LYLA 3DLCA 4MGYR 1Z6PA 3U7JA 2PFGA 1BKYA 3E0QA 3GFGA 1NXPA 3L02A 1UZUA 4R7GA 4HWPA 4K3UA 3W5JA 3VH2A 1JJAA 4JASB 4GKJB 3IRUA 4WECA 4BQEA 4OHZA 4NEQA 5A1JA 5G3ZA 1I30A 2Q6KA 2R2AA 3QPWA 4HEHA 4UHFA 3UANA 5DTQA 4O2BB 1R3UA 4B3BA 4E30A 5DGDA 5C7OO 5LPNA 2Z83A 3I9LA 3EZ6A 4GECA 4WWHA 4KOAA 2XNKA 2A30A 5CIWA 2XXAA 7GPBA 4MMZB 4LFCB 1J1IA 4AF7A 1FUIA 1JS1X 2GOYA 2QI9F 3C6BA 2O2IA 4JA2A 4I3GA 5EZSA 1P1FA 4ZKEA 1JECA 4E1BA 1WF3A 3FY4A 4L78A 2XIQA 2YWCA 3I6MA 1KDTA 1A50B 1X1TA 3OZDA 5LDDC 3CLRD 2O05A 3S5UA 3UH1A 3OJFA 4GAEA 1YUMA 2EEPA 1W7AA 2C3PA 4I5EA 4R71A 2GPSA 2QM8A 2P8SA 5FTKA 1GXSA 4ZXFA 1KBOA 4KW7A 2FN4A 1A2OA 2BCEA 5CB4B 5BSGA 1J39A 4EEXA 5EC8A 3DH0A 4JNKA 2WWYA 1U31A 2AOTB 4Z54A 1PEAA 2QA5A 4EA6A 4AURA 4R51A 2RGCA 3L7YA 4B3JA 4RXUA 2QTVA 1EDDA 3TVYA 4MQFB 2ZBFA 2FE1A 4C3ZA 1A8HA 2E37A 3I62A 3V32A 4ITRC 5D1NA 1XVTA 3ET4A 2QN2A 3ST7A 1PL8A 1G20A 3B7PA 4AK9A 2X4IA 4MW4A 1QH8A 4EO7A 1VIMA 5A9TA 4DILA 1XBTA 3DTNA 3V4ZA 2ZUFA 3U16A 1JHDA 3NHYA 2BW0A 4IXTA 2FLVA 2ZCVA 3EY4A 4A0FA 3UTDA 1KU0A 1OI7A 1XRRA 2XNHA 3AY0A 4M7OA 4C89A 5LQJA 1XALA 2JBWA 3G82C 5CDGA 3L1IA 5LSAA 1GTRA 1NMZA 1DS6A 4L4RA 3UGTA 2IW1A 1FK8A 1UBMS 4KXVA 4ZO9A 3QU9A 4RFSA 3Q3GE 4A6XA 4AY3A 3P7MA 1CJBA 1VL2A 3IQZA 3KT3A 3M33A 5C80A 1OJ7A 3ZY4A 5ARDA 5LD2B 4LXIA 2AJBA 1BFKA 3VR3A 1DQZA 1G41A 4JLSA 2RB5A 2FN3A 1UPCA 5E8RA 1A4XA 5DYYA 2PGNA 3PEFA 1OILA 5BXYA 3NHSA 5GV8A 1TL7C 2O0JA 2ZJ6A 5LYJB 4HTAA 5F23A 1N57A 1WEHA 1QMPA 5LC1A 1NN3A 1XO1A 4FE7A 1E66A 3PX3A 3EVTA 3NEJA 3HKBB 4JEIA 4TZKA 4ENSA 3T7JA 1ZGZA 1ISFA 3T7IA 1BH2A 1NLFA 1PNTA 1W25A 2PHZA 4FDLA 3RWBA 1TZKA 2P5TB 3HCNA 2OGWA 2X86A 3MILA 5C8VA 5JAOA 3EVAA 2BDTA 3I52A 4FYHA 3OEWA 1X14A 5G4KA 4LRTB 3TMAA 3E1KA 1CY7A 2GK3A 4DDUA 5K99A 2FP3A 1C9EA 3H2KA 3AILA 2ZU6A 3GEDA 1NKSA 3N9IA 2ZIZA 4IOLA 3SYRA 4YMLA 2WW8A 3JXEA 5JAIA 4M3NA 3T95A 2Z9CA 5K4GA 4Z9XA 1XWIA 2QMQA 3WGTA 4ZK6A 5LQSA 2C8JA 2OPBA 1W0KD 1L5HB 1FL9A 1ORWA 1T1JA 3L6OO 3NBKA 4V0SA 5CMLA 4O2LA 3VH1A 3KFLA 5JE8A 3M5WA 2HJVA 3KJIA 4E5KA 5KC8A 3KQHA 4UW9A 3HO1A 1WCXA 3IIJA 1KYZA 2H1SA 3OI7A 4PLFA 4PANA 4Y2VA 3NHFA 3R6GA 5GONB 5K0LA 1P7PA 1SQGA 1FFWA 1UQUA 4PIPA 4ZU1X 1G4HA 1L8XA 2QY9A 4BJ3A 5HF9A 2OZKA 4KQMA 1EXVA 1T8UA 4IO0A 1A95A 1U4OA 4GLJA 3HJBA 1EBBA 2J0VA 2BH9A 1V3TA 2J4FA 2P3LA 2PDAA 3R23A 4NCXA 4K9NA 1J4AA 4X60A 2JRCA 5AW9A 3YASA 3EEIA 2Q0XA 3ZGXA 1U7DA 2B1JA 1TFRA 4JU8A 1JU3A 1EUDA 4LHYA 2GJSA 2ZXEA 4S12A 1U7XA 2FR8C 4B8YA 3CZRA 5KNCD 4XAQA 3R7AA 5IZ4A 3PNSA 1GSOA 2P1ZA 3JR7A 4HJXA 3D4IA 5FBLB 1F06A 3DE1X 1MENA 3Q85A 4BLQA 3DPIA 1HTBA 3O75A 4NBVA 4RQBA 4ZZIA 2BEWB 4CTNA 4J29A 4K26A 1AKMA 4OMUA 1IEWA 5BSHA 5LP6B 4O2AF 5HQ3B 3OC6A 5B3AA 4UTXA 1VIDA 3BMOA 3DB2A 3D3NA 3RADC 3SXPA 1L8OA 3B1XA 3IPLA 4RSGA 1W85B 3Q7PA 2R6CA 2FF5A 4OQYA 4U2CA 5IYZF 3W5IA 1DAIA 1Y1QA 3OD5A 4KVAA 4KR7A 5C1DA 4EHKA 1G21B 2ZUBA 4M53A 3EARA 4MI1A 5GMOA 3UPTA 4OKNA 5PNTA 3DDOA 1X87A 4ZVRA 4C22A 3WLSA 4RF4A 4XGQA 5EXPA 2X8BA 3EVGA 3VDMA 3ADOA 4X3PA 1Q1ZA 5DHTA 5C53B 1MEJA 1VE3A 1NC3A 4N5LA 1UDWA 3LHKA 4V0RA 5DNAA 3E9EA 4CIXA 3L0OA 3NM4A 3R5HA 2R8EA 3AY6A 1XZHA 1V11B 1VTKA 2FG5A 1OLSB 4TV9A 1Q3KA 1Z5OA 2G9QA 1R7RA 2FPLA 2ZRCA 3QPCA 2IHJA 3BWEA 4R9RA 3DVAA 4ZT5A 1OLUA 1K89A 3WGQA 4DQUA 5AOAA 2OOSA 1GPBA 4R1SA 1NBMA 4GI3A 4B3XA 1K7YA 1RM0A 4GBJA 4BC0A 2Q5LA 2UZ3A 2CVHA 1B4DA 2GNOA 4CUZA 1HYQA 1VECA 4BNDB 1QVAA 2IODA 2QM7A 4RDHA 3RBAA 4ENWA 4E46A 2VSFA 2B21A 2ISSD 4QUHA 1F38A 3THYA 2RDMA 2YW9A 5KIAA 4C2UA 1LY1A 2XX3A 3RVRA 1T5OA 2NG1A 1G7TA 2H7XA 3VPCA 2GO7A 5AW4A 1RJ9A 3B5EA 3ISJA 4JYBA 1XJQA 3WGIA 1DRVA 2QMOA 2HXSA 5C8DA 2QVCA 3WJAA 5AJHA 2I55A 3LC0A 1Y3AA 4IWNA 4P4UA 4CRWB 1OHHD 1SQFA 2UZ1A 1OQAA 3QE3A 4M55A 3L4EA 3EIHA 4JLKA 2H7VA 4Y8VA 1DKRA 4BVFA 2SNIE 5K3BA 1K3UB 1S02A 2GI4A 1CJUC 3QJGA 2N9UA 2J3DA 3B1YA 3RFVA 3E48A 1MC1A 4AN0A 4YRMA 2ZETA 4OHRA 5J63A 1TLLA 2QE7D 1PEKE 3IQGX 2YW2A 5J2UA 2AN5A 3G8BA 2W2OA 1NVTA 1SOMA 3BZBA 1A9XA 1ZMOA 2AMFA 4UE6A 1G5IA 1VKJA 4GMKA 1I3KA 5L6MB 5AM2A 1KDYA 4MRPA 2XMZA 4O3MA 4BLTA 2VF2A 4FZ3A 3FCAA 4EA8A 1FYDA 2GPTA 2JIMA 4M1WA 4TTAA 1IEQA 4XSGA 4LMPA 3ZWPA 1JHUA 4DARA 1PUIA 1YZUA 1KYQA 1Z5NA 1TMGE 2YN0A 1PGJA 4JGGA 4OFXA 2JLWA 4ZHQF 1TQ8A 1IXKA 2R7KA 4DMUB 4YBRA 1KHTA 3M9WA 3JYNA 1NR1A 4XGRA 5DNVA 5CVUA 3H2GA 2QGNA 3LP8A 1YHZA 3O8BA 1NNSA 1XRLA 1OGIA 3F90A 5C8ZA 1M5RA 1W4AA 5U9CA 4GNKA 5KNBA 1OCEA 3ANLA 2AG0A 5K4HA 5LQAA 1ZFNA 3P71T 1FFAA 3ET5A 4I3HA 4IR7A 5KHOC 2ZRKA 2YOHA 3E53A 4PPGA 3LTEA 1KR5A 5EL0A 1DTSA 5LBIA 4LECA 4PLZA 5AXCA 3RJ5A 2BF7A 3KDSE 4LV6A 5JBNA 3H9QA 3BXPA 3Q1KA 5TQ2A 4EJSA 5JZVA 4C2AA 4QTYA 1LC3A 1Q1GA 4ZN6A 1NULA 1Z2EA 2Q3FA 2W6QA 5BMVA 1PD1A 2Q8QA 3CJQA 4AUKA 4G8DA 4MULA 3E7WA 1KC3A 1RM5A 3KJHA 4QU0A 2PKRA 2DFNA 1Z82A 4OYHA 4I55F 4E5UA 2EW8A 4FR0A 4RY2A 2GZ3A 4QRDA 3D0OA 1LUAA 2ONCA 2PA3A 3MQFA 3LDAA 3GJTA 3PCXA 2HMUA 2XOXA 4MGKR 2QMZA 1QK4A 2F1KA 3ZK9A 1R0RE 2I9KA 2OBFA 3GRPA 3LC7O 3ZDEA 3GT0A 3BOSA 4G4GA 2V7UA 4C21A 4HAWA 3CSDA 4CCYB 3FSGD 1REQB 2I29A 3RWMB 2DTEA 5HHTA 3DWIA 2VQEB 1NVAA 3ZVLA 1FSPA 4RZSA 3WYAA 1ADJA 3LRXA 1FTSA 2P78A 3PXEA 4DJEC 1O5OA 2PD3A 1H8EA 5KVAA 3PC6A 3FWKA 3G8DA 3WB2A 2VOEA 1Z4IA 1SKYB 2YWXA 2HPAA 4LZWA 4NSNA 4ZOLA 1MT0A 1W88A 1F2UA 1YJQA 1MXHA 2ERXA 2E55A 2RHBA 3PGVA 3JVIA 3PDIB 3JPYA 1FFYA 2A7QA 1FFXB 2HIAA 4ODIA 2LWIA 3RROA 3KHUA 1A27A 1T0JB 3DTYA 2CDAA 4OBBA 4QG7A 4DLWA 1SXPA 5HKKA 2LDXA 2PUDA 5IC6A 5IAEA 2MCFA 2RHMA 3UCEA 4FLMA 5BYKA 1XPOA 4AJ1A 2PUAA 2GN9A 1UPFA 2COEA 1MR3F 1TVKA 1KL7A 1WHSB 5AK5A 3KSMA 5JRZA 1N9ZA 3DTVD 1WSAA 1UKAA 4CDRA 2L2QA 1R6BX 1YBHA 4KMMA 3NMUF 3BG5A 4YS6A 1XYGA 2G06A 2GD1O 3N6VA 4TYNA 5K0SA 3AMVA 4L5YA 1YFKA 4RTSA 1YD7A 2PCLA 2ODBA 4ZPXA 1I33A 3SVTA 4RY8A 1M33A 3EIEA 2Q5CA 4QATA 4M1OA 2EHJA 2WTBA 3DUFB 1K7EB 1Z75A 1E6UA 4B3MB 2VEOA 3IE0A 4MKGA 1M1XB 1WXIA 5B58C 3D5TA 4MPPA 3GA5A 4L9RA 1LBEA 1AKRA 2OBMA 5A3JA 5MHTA 4LA4A 3V1YA 3VHXB 1RRKA 4YDQA 2VHUA 1Y7LA 2QBYB 3LOUA 1KFKB 4F2DA 1ZU5A 2YWEA 2ZBDA 4N7BA 1AD2A 3EIUA 5GJCA 1MH1A 1U2GC 3MSXA 4MRAA 3WR5A 4CV0A 1NAHA 2XNSA 4FVTA 4QPNA 1W4ZA 2P1RA 4Z4CA 3HV2A 4FP9A 3GY0A 2GDJA 4HRAA 4CU5A 2W7TA 3LBHA 1JU9A 2AZDA 2GEVA 4P5PA 3IGFA 5E6UA 2PUJA 3O38A 1M6EX 4I1RA 1TYEB 4IGFA 3LLUA 4ND3A 2WINI 4U02A 3L7OA 3SAJA 3ZEAA 3RG8A 3JQ8B 4LBZA 1NMQA 3NG1A 4FT4A 3HJGA 3R24A 1ZIDA 2H08A 2KWIA 2PD6A 3LKZA 5K1ZA 3S99A 1YZYA 4LKOA 5K3OA 1VYVA 3DMGA 5LNK6 1OXXK 3G89A 4D9CA 3E18A 2W6PA 4FYKA 3X2SA 5I9TA 4Y30A 1VSTA 1U7OA 2CVZA 3MFQA 3HWWA 1XFAA 2NZXA 2XODA 2D00A 4BFYA 4DEXA 5LNK1 4EYOA 5F76A 3EC7A 4KYVA 4ZI2A 4R7ZA 4PQGA 3GLIA 4AZ0A 4J0GA 4ZO8A 5CA1A 4Q1BA 1GYRA 5ED0A 1D0VA 5DRYA 1UBTS 1WNTA 2NO6A 2AF4C 2HU2A 2CXTA 4TX1A 3IKJA 3ZVMA 4E51A 2P4QA 4D4JA 4I1PA 3KLPX 4CM3A 5IMBA 3C43A 1J0AA 2DULA 2WTMA 1ZGBA 4FYMA 4MPRA 4N9WA 5ALPA 5K09A 4LWZA 1IM2A 1ZHHA 2VZEA 3AM5A 3G2QA 4CE6A 4UDXX 2D1YA 1W2WB 4WHMA 2FZEA 3W6ZA 1OFGA 3KKEA 3U4QB 4HLNA 1V7PC 3THXA 4IQGA 2AYXA 2ILVA 2O8NA 3LQ4A 3V4PB 3ZE8A 4CLOB 5FX2A 2P6OA 3BTOA 3TTYA 2VZ0A 2W2QA 1QORA 4F9FA 5KI6A 2E21A 2EQAA 2Q27A 2NNLD 3QKTA 2QN9A 3ED1A 4YAGA 1CBUA 1RJFA 1U9ZA 3MT9A 4GUDA 5IJ0B 2WB2A 1O54A 3ASZA 3LQ1A 4YAOA 3H8JA 1L5QA 3L92A 4GOND 1ZH8A 2QUZA 2ZT5A 3HO6A 1GPNA 4NY1A 1NATA 3VDNB 4DKJA 3VR6D 3SDZA 2QZSA 2HD4A 1P7WA 4FSDA 4KXNA 4FCCA 4XSVA 1V2HE 2BEKA 4HEQA 5HOQA 2V8OA 2J6CA 5JPIA 3TZBA 4FOPA 3KPJA 1SFRA 3UV3A 4MQBA 1FP1D 1Q44A 4HTFB 4Q4AB 3R5FA 3KOXA 4UM5A 2ZTHA 2GNAA 3OX4A 1OYOA 1ZDMA 3RSFA 2CMKA 2CHEA 1LPSA 3KDAA 4KFCA 2J0SA 1TCBA 4NBRA 2OWDA 5KYGA 4NCBA 3BMCA 1F60A 4ZO7A 3UT0A 2Q7XA 2R6HA 4R2KA 3BWBA 1M75A 1PQWA 3CJRA 5EZYF 5FULA 4LFBB 2VPYA 2Q2NA 3KKQA 3O94A 1QRAA 4Q66C 2HIHA 3ZHCA 3N8HA 4Z4IA 1VPVA 2PWBA 3JSXA 4YRRA 3EIQA 3PUHA 1Z12A 1ZL2A 4GOOD 1QC5B 4I5GA 4EUSA 2ZI6A 2BBSA 2O50A 3PI6A 3HB0A 3HUFA 4G1EB 2AW3A 2CEAA 3P0IA 3GFBA 3NWJA 3TQIA 3IUJA 2I7VA 5FT9A 5I4BA 1JB1A 3VYRB 1C30B 3NBAA 2PZBA 3SEZA 5JS7A 1YOVB 5AHRA 3TRDA 5HEKA 1OXMA 4D46A 2LTAA 1X3LA 2DT5A 4WCVA 4Y2HA 5GVRA 3SVZA 5KYWB 3IL2A 1OFIA 2JD1A 2JNWA 3NKFA 5A4MS 2ZITA 1MG0A 4K6HA 4WV3A 3ORYA 3R7SA 3V8VA 4KPEC 4TS1A 3KTAB 4ZOCA 4BP8A 4EKEA 1EB9A 3B13B 2VJKA 1SA0B 2J45A 3ACDA 4CM4B 1P1JA 4NMMA 4PX9A 1CT9A 1DFGA 1Z36A 4RYDA 4O2AB 2FV8A 5AMXA 3QXGA 1Y1KE 2ODEA 4BVEA 3CMCO 3PB3A 3HE3A 3S0JA 1AE1A 3FHOA 4NJEA 3THRA 4DXDA 2QDKA 5CPFA 1M6VB 3BH6A 4H7JA 3RHTA 5M29A 2D0IA 2APJA 4YAEA 3UPDA 5HZHA 2KS6A 3WBFA 4D9GA 4AMZA 3RTCA 1N2CB 2A7XA 2SKDA 3D81A 5IJZA 5KYYB 3KVOA 3QVMA 4R2HA 1HBJA 4GGPA 1RI5A 2L19A 2J9ZB 2Z9DA 3L77A 4JIGA 2HV8A 1XRNA 4GIBA 3EXHB 3HM2A 4B33A 3QKIA 1P9RA 3EVEA 2YV5A 3TRKA 2HRDA 3EE6A 4NENA 2H07A 3FTDA 1KTVA 3OIWA 4NAVA 5TF0A 1GHTA 2I22A 3ID6C 4TKMA 4N6OA 3KR1A 3T3PB 3CRW1 2VRNA 3F3MA 1KRXA 1SZPA 2F43B 2R4QA 2PZJA 3I3OA 1IQPA 4TL6A 1U4SA 3G5LA 4P3KA 1EFHA 1JJVA 2FPXA 2QVZX 4MI3A 3A2MA 1OXKB 1Q50A 1VCOA 1GLGA 3DDSA 3K92A 2FW0A 3PXXA 1QYIA 2UVDA 4LHXA 5CYFA 1E2HA 1CE8A 1YB4A 4HDMB 1L4FA 3WB1A 3I4FA 8GPBA 4BDTA 4OHYA 5EIEA 3CHYA 2JGMA 4BMOB 1EH5A 1OVGA 2Q4TA 4HUQA 1X8LA 5L6LB 5FXMA 521PA 3SQDA 4G2TA 2WKRA 1SELA 2ZIFA 2QD5A 3RRYA 3VHQA 2XV1A 4EDFA 1KE2A 1VXOA 621PA 3FLBA 1Z0DA 1PFVA 1UC4B 3EGOA 3HH8A 2BGNA 4B80A 2CXQA 1MTOA 2XCUA 5JW6A 1UJ4A 2QT1A 2CY0A 4JLVA 3PUWA 4IXWA 1XTPA 5F1YA 3WGKA 4HAYA 3QVJA 4GI5A 5L3RA 3CJTA 1JHOA 1GPJA 3OO0A 2Y99A 2CKMA 2BLNA 1VKZA 2ZYAA 1I3LA 4HQ6A 1DX4A 2BUBA 1JAYA 1RXIA 3BB4A 1CJKC 5E7QA 1ZD3A 4RYLA 4B81A 4YRTA 2WJ4A 1DAGA 4LDNA 3ND6A 2CWDA 3ZHQA 4D4GA 1Q7EA 1WP9A 2V6BA 3HU1A 4BLUA 2UYYA 2CB9A 3B8HA 2FSVC 1ZI8A 3KPYA 4IJQA 2MDTA 5AW5A 4RNDB 5F2OA 1W9HA 5F1PA 1MPXA 5ALYA 3EZXA 5FTWA 4WK4B 2AOTA 4GM4A 3HB1A 1ORIA 4L8VA 2VPZA 3G2LA 2GRAA 1LDBA 3VSAA 3LMKA 4EVIA 2RSLA 3R77A 3Q12A 3AUUA 1JDVA 2GLUA 4GPZA 3DV0A 3TOCA 3N8IA 2H4ZA 2BRUC 1WTAA 3ZE0B 1LNSA 3B1FA 3KJEA 3VFDA 1ODFA 4LXYA 1NLZA 1K8QA 5D3MB 3O3CA 4CV2A 4DMLA 3TEFA 2GCPA 2IEGA 1RXWA 4Y9DA 3E9YA 3OZTA 3AETA 4P0TA 1WU7A 4XVQA 3DHYA 3WHKA 3PNPA 2XB4A 3PFWO 3SEAA 3PYLA 1U0JA 3H2IA 4L1KA 4MZDA 4W8OA 1NVVQ 5BVHB 1D2HA 1PN3A 2ZI9A 3LO5A 4FXOA 4QASA 1T0UA 3ZGNA 4ZYLA 2GZRA 3F7OA 2I3GA 4S0XA 3ZU4A 2GBLC 4O33A 3IVGA 2Y2UA 1RXUA 3KOOA 4TRJA 3CVYA 1KJ8A 1ECLA 3MTEA 3U1VA 4BMZA 1OH8A 1O87A 4AJPA 4L72A 2C3YA 1F0NA 2LCQA 2G63A 4MIKA 1FBNA 3NH9A 2WSIA 3AEQB 1DCFA 2P9EA 1KEWA 4DDTA 3RTDA 1CDZA 2OFPA 4LJKA 3T1HB 5SZJA 3C7KA 1SEPA 2Q3LA 2ZR0A 4CEJA 3CZMA 3FTCA 1B8UA 3BMQB 2X7XA 3U61B 1UC8A 3GT3A 3ZDCA 1L4GA 2Q0HA 5AKJA 4CM9D 3KG2A 3I73A 4LXHA 5KSPA 4EM6A 5FLXA 1SOVA 4KIUA 2GZ1A 3QG1A 4KN5A 1U0EA 2AK3A 4ZMSA 4X00A 3KS9A 1DJMA 3MHTA 4NECA 3SQOA 5IX8A 4KFUA 1L5ZA 2C7RA 1TEZA 4LFAB 1N33B 2WT9A 2IC5A 1X0XA 2COKA 4AW9A 2IV7A 4E88A 5ARCA 5A03A 2GD6A 5LU8A 3OT1B 1OC4A 4L5AA 3KKKA 3LPCA 3RFXA 1C8VB 3DMNA 2QTMA 3KOMA 1BX1A 2GBCA 3HBFA 1VP3A 2M32A 3IEUA 4BQRA 5C81A 4FFWA 4QPPA 1X74A 4LDZA 1AMOA 1O0SA 3R5XA 4HS4A 3PTAA 3QXCA 3K70C 4YRIA 5D3QA 4OYRA 2PD4A 2PJRA 1AC5A 4FYIA 2ZZMA 1BS2A 3TNYA 1P2UA 3ZBTA 1RR6A 3DT9A 4UEWA 3F74A 1WUIS 3OVMA 2ZE6A 4JL5A 2I6GA 5C35A 3G9ZA 5E9JA 4RIIA 1L5LA 5IVIA 3OQOA 5JECA 2ZTVA 1NIPA 3O2NA 1A97A 2Q4OA 1DJQA 3H9EO 2FWJA 2CN1A 2ZVJA 3LG2A 3L40A 2IF0A 1DADA 2ZAMA 5FUYA 2E4ZA 5F7ZA 1AG9A 1BZYA 1CKEA 3PUIA 1QP8A 4Q12A 3SJAA 5JYBA 2RGNC 4FDAA 1W1UA 3IBYA 1II0A 1N9GB 4QPDA 1SQ6A 5CB4F 4MRVA 3OJ0A 4KI7A 3I8SA 1HNWB 1P9NA 3M5CA 2V7GA 2WYHA 4JI7B 1PGOA 5LZ4A 1PJ8A 5CR9A 3SWWA 1JHPA 1LV7A 1PJBA 1CUZA 2C2ZA 1AHIA 3C4VA 1CEQA 3TFWA 1OYWA 2JCSA 2ZRBA 3KHTA 4X3CA 3WVNA 1TVCA 3GRAA 4LV5B 5AUOB 5JQGB 4HI0E 1VIAA 4GPBA 4A1FA 1AKEA 4RNCA 4D0NA 3KDPA 3ONFA 3F71A 1XZAA 4B3CA 3TZQA 2NVOA 5D84A 1XXHB 1L3IA 3EIXA 5IKMA 4UMVA 3OG9A 1UKYA 4DABA 2OBNA 3UXHA 3NEAA 1XZQA 4ABYA 2VCYA 3IQIX 3QFFA 5LP6C 1IMJA 2BSAA 3OAAD 4P86A 4BU1A 3EVZA 4C0XA 2JLVA 3U62A 3AL2A 3UMFA 5FHRA 4DHEA 2MSCB 3SR4A 1NUUA 1GZ7A 3T5GA 4HUTA 1QGZA 1NW9B 4M7PA 3PFGA 2YXPX 1Y3BE 3I5UA 1XEXA 4MW1A 5ALKA 3V2UA 4U7DA 4F9EA 4AN1A 4UTVA 3BRCA 3H5AA 2WP8J 5AWFC 2HEGA 1UK9A 1LQUA 2EIXA 2FQ1A 3LU1A 3SIWA 4HNGA 5BQOA 4ZIRB 5ARBA 2J30A 1KJ9A 2BKAA 3MQ2A 1CIJA 5F21A 2D1TA 2CNKA 1GO2A 2XTNA 5FYDA 1R66A 1IJBA 1DO0A 2BI4A 4Y2PA 3CH5A 1RMYA 2C9CA 5AVQA 5JNVA 4PYNA 3F97A 3TXAA 5H8WA 1DG1G 1CUGA 4XJSA 5AVTA 2JD0A 5KNCH 2B1GA 3DEZA 3LUPA 4EENA 2V9CA 1T2VA 3QLEA 1JEJA 5EXXA 2GA9A 2Q5OA 3OZVA 3IV6A 4IG4A 1QTIA 4OLBA 2NU8B 5CFRA 3H7IA 4IXMA 1WDWB 3GFVA 2E4AA 4C05A 4YRGA 1S8FA 1N5DA 3M3PA 2HF7A 1P1CA 1EVQA 5J40A 3WC4A 1NBHA 4HPWA 2NZVG 3PHCA 5FCDA 5TQJA 1XXHE 2ZTSA 1S2OA 4US0R 1COWA 2TMDA 5EINA 4EKYA 5IFKA 3WYNA 4MUHA 1DGQA 2GZAA 3UK6A 1K92A 1SCNE 1DZ3A 1U0GA 3TLXA 3KOYA 1UANA 1L1RA 5AKGA 4JU9A 1UFRA 2WJGA 4HGPA 1JGTA 3WMGA 4XRRA 1JBKA 4Q3EA 2X0IA 5L8VA 2QL9A 1PDWA 3GCZA 1MO2A 1HPLA 1KF0A 3HA2A 4IOKA 4NH0A 2C59A 1BX0A 1QSGA 2BE7A 2HTEA 3FPFA 1D0SA 4BP3A 4E1AA 1ILWA 1OWLA 2P9QA 3MS4A 1ZVMA 4O4LB 4YAWA 2HJWA 2DFKB 1KZ7B 4J0HA 3QHPA 5HDBB 2P2LA 3G13A 4OFZA 3K96A 3VC2A 2I2FA 1PLLA 4BGVA 4JZKA 4W5TA 2XBLA 2R00A 3HJNA 5JCJD 5DBEX 4CDNA 4MR9B 3U3KA 4GWLA 4W4TA 3BKWA 2AEJA 1XU7A 2JH3A 1OWOA 2QI9C 2O57A 1CY2A 2W00A 4G84A 2I54A 2X5KO 3KUKA 3NDRA 4TT3D 1JNXX 3QUAA 4P81A 2H06A 1ZGJA 1PK8A 2C9BA 3DP9A 4O4JB 4PINA 1J0DA 2JEYA 3H5LA 1XEAA 4RA9A 1OLXB 3HRIA 5ILQA 3EQZA 2HA7A 2XZLA 2A0XA 3OQBA 4OYLA 1F12A 1EX1A 2NXNA 4NBTA 2G9VA 3ADBA 1T4DA 1XU4A 3VO1A 5DT9A 3GLKA 2QUHA 1VSVA 2V3WA 5JATA 2YY5A 4OUDB 2W48A 1J5XA 3F6PA 3MM4A 2ZSAA 2OXIA 3CLHA 4KV9A 4UOQA 4Q3LA 5EJEA 1GCGA 4IZHA 2OQ2A 3AV3A 4HRVA 4OFWA 4QU5A 4H4CA 1X7YA 2QMHA 4NARA 1XD2A 5J23A 3A05A 3WSTA 2FOIA 1TTQB 5ITSA 5E6RA 3EGIA 4G5QA 3FVTA 1QIKA 4Q82A 3T9DA 4QIHA 4BL5A 5D86A 2DBZA 4WXMA 1LK0A 4HRXA 1XRSB 2PIDA 2X0RA 3G3EA 4WKPA 4MS3B 3EA4A 4I4IA 2G9NA 1SUFA 3E8XA 3AJ8A 3GQBA 1O57A 1L5GB 3TQFA 2AWOA 5H0IA 1YL6A 3CMMA 4EHFA 2CC2A 5DWQA 3BSWA 3CZ4A 3IEMA 3NEYA 2ZRIA 2JGNA 3C0KA 2RAUA 3ZKWB 4R1PA 3C3BA 2UKDA 3KYCA 2X2PA 5ALJA 1JEDA 1Y6FA 4KQJA 5DSZA 3CG4A 3DE4X 3RIEA 2JLQA 2YVLA 3D43A 4XASA 5ALLA 2XECA 3RYFB 3V42A 4XGNA 2CWWA 1L7EA 4C7KA 4D4LA 2XRFA 3D8HA 3DVRX 4ZJYA 1JJFA 2JLRA 1R3DA 1YR3A 2F8TA 4O02B 2HQSA 3ZU2A 1CFZA 4KWCA 3ZXUB 1Y9JA 1P73A 4IDOA 2O3UA 3OIYA 1OTHA 2H11A 3AVUA 3OHMA 3EXIB 4IMPA 1Q3TA 2IZ0A 4MKXA 3RU7A 5L7WA 4DB4A 1JI3A 3EZLA 1SKBA 1KP3A 5BWNA 1X0VA 4B47A 4OH7A 3V4FA 2P1DA 4OKIA 1NVGA 4BGEA 4ETNA 3FXAA 4MUFA 4ZVKA 4YI5A 1QPBA 4G01B 2W6MA 4D9BA 4QVGA 3R3HA 3TS1A 4JJZA 5HUHA 1P1BA 1PNQA 2IFTA 2ZBPA 5GADl 4RY0A 1BW9B 5JO9A 3H5VA 3IR5A 2C8LA 1OI4A 1UT6A 2H4HA 1DAEA 4P84A 3DWEX 3G8AA 2ZYRA 4XLZA 3UT6A 1JG7A 4IYRA 5I9IA 1IZ9A 2HMVA 5CX1A 4Q1CA 4HFRA 1ZH4A 3B9BA 3HXPA 4RHYA 4K5QA 5I9LA 5KWJA 2WSBA 2WMYA 5CNIA 5KO2A 4H17A 3FUWA 1RYBA 4EHNA 1D2GA 5JNTA 5IEBA 1PEDA 4V0LA 3WJ7A 1Z6ZA 4LC1A 1QE5A 4LJAA 5J5CA 3VHXA 2PSFA 1GDHA 3NR2A 3PDUA 2GMWA 5BMVF 1RRCA 3NUZA 3MJDA 2HZBA 2I3DA 3ZZUA 4C4PA 1E9BA 3D7MA 5DPMA 2YH2A 4XYGA 4DDVA 2C8KA 4G4IA 3C8DA 2ZR8A 4L22A 4LK3A 2PS9A 5KCMA 1S7CA 1ZITA 3LFHA 3OZIA 1A7KA 2OO7A 3A6JA 1U9IC 1JLHA 2QB5A 1KORA 2IZ5A 1CZRA 2FSPA 4OQEA 3ZWVA 1VMKA 2J0QA 1L4LA 1Z34A 3SZOA 1T3GA 4ASUA 3I9V6 3IQFA 5DK6A 5LA6F 5F2NA 3F6EX 2RKWA 2AX4A 2DKNA 2MIIA 3TR0A 2EJWA 3EX7C 1IBCA 1G6KA 1P9WA 1YF3A 3O1JC 4LVUA 5EYPB 4O4HA 2OXTA 1D4OA 4AY6A 2EZTA 3ESZA 4J0QA 3WL3A 1T2FA 4Y6PA 3WNCA 4XB6B 1IN8A 2QX8A 2A59A 3M83A 1AUQA 1VLLA 2AOXA 3MXTA 3LBAA 4I55B 4RL6A 3U3OA 2V7XA 1CY6A 5FUVA 1T10A 4KYTA 2NTYC 4RTPA 3K5WA 5AK0A 4HNSA 3B12A 1SCUB 2GPBA 5ESXA 2P3OA 5DCWA 4ZYTA 2NZYA 1SY7A 4MKFA 5A6VA 2PUGA 1ZRSA 1SC9A 2CYBA 2ZIXB 1N6NA 1S3FA 1W75A 4UTOA 1I7SB 4YT4A 3Q8MA 2H65A 3O73A 3GDOA 3OLCX 4H1VA 5AIAA 3IA7A 3Q7RA 2D54A 1J00A 3MTIA 4TSKA 4AJOA 3IS3A 5C3MA 2P67A 4DLXA 2HSEA 4MKRA 3PL1A 1JDSA 2H00A 3OWXA 1WL8A 4EGAA 4OIFA 3SM3A 2FEAA 1HG1A 2IYAA 2OHXA 3OPMA 3KZKA 3QGMA 1DIGA 4X7PA 4DQDA 5JSKA 3B3FA 1RLMA 2PL5A 3N58A 5HE8A 2X8WA 2YV4A 4HEA6 2PG3A 2HOQA 1UBKS 3P1JA 2WIAA 4A16A 2WICA 1ZRNA 4N18A 3KJFA 2G6TA 4CCSA 1UBGA 4RD1A 1NMSA 1NMXA 1ZGGA 2JGFA 2QXYA 3RF7A 3IPCA 1NQ5A 4KN9S 1WG8A 4Q18A 1GA6A 3IVRA 5FFFA 4L74A 3GEIA 2YJ3A 1AH2A 1TCUA 4ZGWA 3OPNA 4UMFA 1EPUA 4PLPA 4HEJA 8AT1A 4H6PA 2EKDA 4LRWA 3RVJA 1AU9A 3KB8A 4IQFA 2XCOA 4PS1A 5AYVA 3FB1A 4ALIA 4J49A 2QE6A 3Q0TA 4NPCA 3TLCA 3VO8A 3FCXA 4EQ6A 4FJ1A 5SZHB 4BUZA 3I2FA 3JQPA 3RVSA 4CMBA 1TJ4A 4F6RB 2QTGA 1J5EB 3GYGA 5AESA 1QO0A 2HCFA 3LXMA 5K6TA 4LCEA 3H6KA 5IKOA 3A6EA 3GAAA 1C9NA 3QEOA 1VKNA 1R4MA 3O8QA 3AKYA 3BD7A 4G5YA 4TTPA 2GM4A 3PNOA 5IBCA 2QDXA 5DTEA 1PRYA 5KYVA 5KTMA 2FPPA 3E70C 5IKXA 5DV9A 1DIRA 2G9ZA 5AP9A 3STXA 4O6VA 2VHZA 2X23A 4LXXA 4FU0A 4O4LF 3UF0A 1KDVA 1JSLA 2BGLA 2GZSA 3DJFA 1KDPA 3QOWA 4LYGA 1KJNA 4XOIA 4C1NA 2Z4RA 5A06A 3KQOA 3MK31 4LZOA 3CR7A 3T7EA 4BIMA 4IDFA 5FWYA 3CQ9A 3BKXA 5G2OA 4LZNA 2UXCB 1ZA1A 4I1OA 3KR2A 4TKLA 7ADHA 3FDIA 2O2EA 3CX6A 3NOQA 1J0CA 1RRGA 2CDRA 3KCQA 1TA4A 1YA8A 2I78A 3I0MA 4BKQA 4CM4A 2W43A 2ZUSA 4EG0A 4TTTS 3INNA 3SFZA 3BX1A 3W06A 4Q3CA 1WY7A 4MCHA 2QG4A 5B55A 1J06A 1M1UA 3FM9A 5LQKA 3NCHA 3PPVA 4NJEB 2RC6A 4OU5A 4EPXA 1NY6A 3SC2A 2VH5R 1QLWA 2E5FA 2C7OA 3Q3JB 4GYJA 4Q02A 5L4LA 3WICA 5D5PA 2CSUA 3MAAC 3DBOB 3DULA 1G4UR 2B78A 1PW5A 4WASA 3PPXA 1SCKA 1P72A 4EL0A 1AXRA 4K9MA 3LLSA 4EL5A 3SC6A 5DIZA 1QQTA 4FGLA 1XCLA 1SUIA 3OJCA 2XGJA 4QXQA 2GM3A 1NYRA 2I4RA 4R16A 1YZHA 3KSZO 1QHFA 3C3WA 4KVZA 2AOUB 5ERYA 1QGUA 3A3OA 1MOZA 4MWGA 2OCKA 3KFXA 1U0FA 4NZNA 2EBWA 2VL7A 4KMSA 4IHJF 2O8DA 1RM4A 3SR0A 2IPLA 4DSZA 3ESXA 4MITA 1LDYA 3EGXA 2WFLA 4W8GA 5DK4A 4HN4B 3BXFA 3CA8A 4I5DA 4V0OA 2P77A 1HL7A 1EG2A 1JLRA 1UKZA 2OCXA 1WMFA 3LT1A 3PQ5A 4HUQB 4RVUA 4CQLA 4LDQA 1UEXC 3KXDA 3FJYA 4OAQA 4AP6A 4U8GA 2KYRA 3PUJA 4MKIA 5JMWA 3FDXA 2WE8A 3VU9A 1D2RA 2HT1A 5I7WA 1FDIA 2FRDA 2R6JA 4QELA 4AQYB 1QANA 3HY6A 3WHPA 3WY9A 1NL3A 2C31A 3JQBA 3BE5A 1JAIA 3WHLA 1T9CA 1Z7BA 3UZUA 1QG6A 1WKCA 1EESA 2X0NA 2G04A 1NE2A 1UWKA 2JCBA 1NUTA 3OQPA 1CF4A 3LDFA 1KMIY 2AEMA 3G7UA 3ZDRA 2OLKA 5HX7A 1AB5A 5MFZA 3T5CA 3DDUA 1KK2A 1W4RA 1G3MA 5JD3A 4K81B 4E3ZA 2ADOA 1XPUA 1CY8A 3N74A 3EY9A 2OBBA 3K8YA 4AXBA 4BO9A 5WRFA 1V8DA 4N0PA 3HR7A 4BNIA 2Q5QA 4QU8A 3D6HA 2VSYA 1Z47A 4A2CA 4D5EA 1MPTA 1A7AA 4ND5A 1KO5A 4Y9SA 4BRSA 1CUCA 3VR3D 3I2IA 3M6MD 5I45A 4AUMA 1BCSA 2RHHA 3SR3A 4TV8F 4KH0A 2G70A 4ROSA 3VR5H 4D8WA 4X91A 1BJTA 2WTNA 4TL7A 2DH6A 1TI7A 4D3FA 1JHAA 1CS0A 1P8JA 1QNLA 3FB4A 4HNTA 4MVYA 4XPZA 4N3BA 1E63A 3HA7A 3LLVA 5HQJA 1JXAA 4P4GA 3EEBA 1L2TA 2X19A 3OZSA 1CNFA 3DE7X 4Q3AA 3QTBA 5DOVA 4HT3B 5JU6A 3DV9A 4NR0A 3VPXA 3BAFA 3EEQA 3H9UA 4DPKA 3O4IA 1R9NA 4NONA 4LF6B 3SQNA 1U2QA 3GRUA 1WJGA 2EIHA 1F4PA 4J0IA 1U1FA 4KRYA 2NX2A 1DQSA 2ONKA 2VDNB 1KQOA 2CFSA 1WWKA 1L5SA 5I47A 2H1VA 3CPJB 3TSOA 2Q3BA 5JANA 3W3ZB 1TEXA 1NZDA 3CO5A 3F5DA 1HDIA 3QXJA 4K9SA 3IBTA 2E0IA 4KPUA 4YGYA 5FI1B 2PGXA 2ZR7A 3EXG2 3IV9A 3U9TA 2A67A 1M1NA 1O6FA 2E2WA 2QTBA 2G1AA 2Q5FA 3ADPA 4HDAA 5FL3A 3ZHVA 2J9XB 3RJMA 4INZA 2F4NA 4J3JA 2R4UA 2W4IA 5HS6A 1MO5A 5LBUA 1A9PA 1QH8B 4WKNA 3WV4A 3BBLA 4JGBA 1LFDB 1TPYA 1GT6A 2ECQA 2P0AA 4FFDA 3H8WA 3VXKA 3FSRA 3L43A 2HCBA 3ETNA 4HDNA 4DWVA 3ZJUA 2NACA 5I9BA 3FCSB 1B76A 1PLJA 5EZYA 2IYVA 4YP6A 1Y9EA 4DLYA 3N7TA 3ZCVA 1JWAB 1NQVA 4RVNA 2ONJA 3R75A 5LIRA 1XPRA 5C9ZA 4OHVA 5JY6A 5BSMA 4C7BA 2AR9A 1DB3A 1P5JA 3BZWA 3QW4B 4JT2A 1SC4A 1ZK2A 4K6FA 3AP1A 2NV0A 2EEZA 2BGJA 1ZJ5A 2G72A 5BN5A 4MUIA 4Y9RA 4M7RA 3O03A 4OO3A 1WLSA 1ZQ1A 3OT1A 1JA1A 2W2LD 4JP3A 4KAJA 2OEPA 4MGEA 4B6SA 2RJNA 4R6WA 5BNIA 2P3QA 2F4VB 1XNQB 3WYCA 3VDXA 4MV3A 1TAGA 4EB6A 2VAVA 2C98A 2HRRA 1TA0A 2P65A 2HGZA 2FFQA 3IO3A 3MLAA 4U7TB 3G17A 3O93A 1JTFA 3RH0A 4DUGA 1L8AA 1QIJA 2CLHB 4I9HA 4E5DA 1ZJZA 2F3QA 3TG2A 4FMPA 2OENG 1UBUS 4C7OB 1KDRA 1XHFA 4XCQA 4PC7A 1QV6A 1C9MA 5I8ZA 5T6MA 3EODA 3SC4A 1KSFX 1SRRA 5FOUA 4BUCA 3DB1A 5DX8A 2G76A 1LQTA 1WR8A 1YH3A 3UNXA 4LNUA 3MB8A 5DI3B 4EGQA 4C30A 4CIBA 1QQ7A 1DNPA 3IP3A 5G4KB 2OPHA 1YC2A 2G71A 3AB7A 2XE6A 1EXMA 2GVDC 3ROGA 4RKWA 5IYZB 1K08A 3FTPA 3N76A 3CF0A 1E1CA 2ZEJA 1YRBA 3HADA 4BKRA 2Z58A 3ITDA 1T13A 4RKRA 2CHVA 3QYJA 4ESEA 2QORA 3C7DB 2EXXA 1WDLA 3AXSA 4GXQA 5DCUA 3SNKA 3ZIDA 3WKCA 5HZGA 3JW8A 1JLKA 4TMTA 1P2VA 4OLJA 1KGDA 3GROA 2HUPA 3ISTA 1Z4LA 4Q9NA 3UQZA 3KKNA 2FG6C 4YJHB 2X7JA 3E7XA 3WRWA 3ZDBA 4O2BF 1H5QA 2BSXA 2XIJA 5C5DA 1VJGA 4IS3A 6REQB 4MARA 1YI0A 5D87A 4QJ4A 4JKIA 3R4CA 3JYOA 5CCEA 3HCOA 1WP4A 1UIRA 2GBPA 1E3IA 3K0AA 3UKDA 1RHQA 3G59A 1BFDA 2EJBA 3A06A 4Q93A 2OVBA 2YS7A 4RCVA 2NO0A 4O0LA 4HAOA 5CFOA 4CIWA 2Z3VA 2HJRA 2G7ZA 4DLAA 2A1UA 1KPGA 4FYXA 1SXJC 2ZWVA 4U2EA 1NVKA 1WBJB 1G6OA 1XK7A 2PKEA 1SXJE 3B5IA 5EI5A 3EOZA 4J3NA 1E94E 2C97A 3WLAA 4D41A 2IY8A 2WUDA 4LJ8A 4WESA 4XUGB 5AVVA 5GVSA 2V8BA 5H4GA 2IIVA 1Z07A 2LZ0A 4S1WA 1RPZA 3TUZC 3FPLA 3P9QA 4UATA 3N6XA 4REQB 2B2CA 5KNDH 1XXLA 2FKNA 2R25B 4GNRA 3I28A 1YDFA 5CW1A 2C5AA 4B7CA 4WBNA 3PA8A 4DBLE 2ZRHA 1JEOA 2GCIA 1DARA 5DHFA 4EFNA 3RU2A 3ZY3A 3AR7A 4FB4A 1TNDA 4WD3A 3KQVA 4S1NA 3AF6A 2OTCA 5EMMA 2X0KA 1D7AA 4YXWA 2VF7A 3H1BA 2D8MA 5E6SB 3N86A 2Q1UA 3ZZ1A 4BDSA 4IKEA 4KO3S 2A4KA 2H9IA 3Q7EA 1NYTA 4GMFA 2PWYA 4H3SA 5L3VA 1IY8A 1Q20A 2SKEA 1EFVB 1ULZA 2WD9A 1N2BA 2V45A 1ODJA 4GGMX 4IH1A 2R1TA 1KO4A 3FCOA 4URFA 4L15A 2BUCA 5E95A 5B2ZA 4DCVA 4YDRA 5FHQA 2RIPA 3RYHA 2XUHA 2HHJA 3JSAA 4JC0A 4MAFA 5B1DA 4DWOA 5KOHA 4DNFA 5ALXA 3Q7IA 4DV0B 4M1ZA 5CJPA 3G5MA 1H6AA 3MLEA 4RXTA 4PFQA 4TV9B 5EZ6B 4DMGA 3CVUA 3I8OA 1QDUA 2A35A 2J5RA 5AJTA 1BQEA 3ZG6A 3I61A 1OPRA 4JXZA 5FIUA 1ODLA 3E7DA 1YA6A 4OI0A 3UJDA 1F6WA 1I6LA 1PWHA 1XTJA 2OV6A 3KM0A 4UU0A 2XEXA 2YNMD 4FMCB 4DCMA 2II6A 5KU7A 2C4VA 4DJ5X 3FR8A 2PZMA 4F3KA 3LUAA 4ZI3A 4F3TA 3E3MA 4DCTA 2PQ0A 4PZ0A 1NFFA 3GVIA 2W2KA 2QNBA 2AWNA 3GBPA 3ZE9A 1L9XA 2QR3A 4WJLA 2I91A 4IZ6A 3NP7A 1NT2A 5IDQA 4AT1A 2NSLA 5ECGC 1XV5A 3TPZA 1CRPA 1N32B 2I66A 1W47A 3BFPA 4CM8A 3DEHA 3UWKA 2FUEA 1MB2A 3JATA 4KI0A 5H80A 3AHCA 1L4HA 1P3JA 1FUKA 4Q1EA 2LBPA 4RHXA 1DC4A 1DDIA 3EZGA 3T7RA 1O3YA 3NI2A 4I08A 4UUQA 1E2DA 3O92A 3BIJA 5EJ2A 1Y1SA 3A9TA 4KR6A 1GKKA 2VJDA 2D59A 4L8GA 2FUNB 4DBLC 2EV9A 2DR2A 1QU3A 1XMIA 4JITA 1JHVA 2BDEA 4TLLB 5J5VA 1O89A 3UN1A 2VDWA 1WSDA 4GYKA 4UM8B 1M2OB 3HN6A 4FHDA 4Q1VA 2OCAA 3UWDA 4CT0A 2ZYSA 5KMGB 2O5EA 3KUCA 4ZICA 1Z68A 4IV8A 4UUMA 2EG5A 3B6EA 2ZUDA 1VIVA 1ZGHA 3H0CA 3K1JA 4FC7A 5H3CA 3RARA 4ADSG 4EZEA 1A8PA 1RAAA 3DNFA 1RHMA 3CGWA 2FUKA 4RM3A 1CDOA 5EJ5A 1SGWA 2O14A 5EIOA 3A2KA 4QLAA 1PNOA 5H3HA 3O90A 4X95A 4LYHA 2GFQA 4GYWA 4UHJA 2FW8A 3EGWA 4YJDA 1S2DA 2EZ4A 1Q7RA 1H2HA 1S1CA 4RSRA 2IZZA 2C5EA 1C81A 3GJ4A 3H16A 3NT5A 2Q5EA 3SSAA 4A1OA 3IR7A 1TMKA 1NI3A 4INOA 4R05A 1EDBA 1DBQA 1L3CA 3WNBA 4UC0A 4DQLA 3W6OA 3H4TA 4EJMA 1ZH6A 3VHLB 2I67A 4A03A 3WYFA 3MT0A 1HZZC 5ESRA 1IK6A 3G0OA 5A4KA 1SU6A 2JJ2A 4KO1S 2GEUA 2XDQB 2IU3A 3GP3A 3JASA 5CBPA 2N42A 2V74B 2CXRA 3UFBA 2H8KA 3D02A 1LB1B 3S4YA 3H87A 1V1MA 1K7XB 3WQBA 3OOEA 5K9ZA 1YBMA 2QROA 1JMKC 2YVKA 1YDMA 4G9GA 4LE0A 4X9XA 5TQ2B 2A5JA 3IQWA 3G5UA 4MX8A 2X40A 4ZT7A 4C2BA 5JYCA 1Z3CA 2VDLB 2ZSIA 2VHQA 3M4YA 4OHXA 4B9EA 4F4DA 2WG1A 4FFBB 4C4XA 4YQYA 5D6NA 5BYJA 3X1YA 2QPTA 1BMDA 3E15A 2AL7A 4KEAA 3O8DA 4JX9A 4MUNA 2O2YA 1E0SA 2ORVA 3PDWA 1JHQA 4R5MA 4WXEA 3FUUA 3K0FB 3M3DA 1Q74A 1Y1RA 3VYSB 1N2ZA 3IEVA 2EGGA 3U4CA 1EFRD 2A9KA 2GS9A 4UNNA 4YCAA 1P39A 1TIPA 1YV9A 1YE8A 3O3OB 2QYOA 3G1TA 4Q03A 4BCCA 2PAAA 5FORA 1KVUA 4RAOA 2B98A 1L5YA 3LT2A 3VO9A 3HNRA 5AI4A 3ER9A 1JEYA 4FX2A 4C7JA 4EBBA 1MA3A 1YAJA 4EJ0A 4KRFA 1RHRA 3OEED 1Q0PA 3ZWWA 1FFHA 4KVGA 4MUGA 4XLLA 5JHHB 3O8OA 5DGXA 1U7HA 5G1OA 1JHMA 3ZKAA 5HWSA 4GPD1 4W1SA 1AXGA 1K7CA 2BP7B 4JENA 1E3WB 3E9MA 5EPEA 3REGA 2J67A 3OKAA 4IX9A 3EG9B 1MO3A 3CUYA 2A9PA 2PXAA 4Q7KA 1MDFA 3R7WA 4ZOLB 2TMYA 2EFGA 4LJLA 3UWMA 3ZU5A 2X3FA 1T3HA 4LISA 5K03A 4P4LA 3WI7A 1NOJA 1P0CA 1UQRA 5TPZA 3LRTA 1WE2A 1CK4A 2I33A 4BFUA 3EXFA 4K9PA 4ZP1A 1KEKA 4XIGS 4BZZA 2FN7A 1M34E 4QARA 1LDEA 1KEEB 2VSXA 4RK6A 4IWYA 3OZEA 4P2GA 2ATEA 4X1YA 1DCMA 1M0TA 1S6YA 2PKXA 2RBEA 4WOKA 2CNNA 2XW6A 5BNFA 4OA8A 3RSGA 3SBDA 1VSUA 4DLNA 2QV7A 2FMFA 4QYIB 2VF8A 2DXIA 4MV4A 4ZOBA 4EG1A 1OBHA 2K2WA 1R5OA 4DJFC 3OHPA 1SUDA 3SEQA 1YCDA 2JVKA 4RQUA 3DUFA 3V46A 4MSUA 3R5JA 4QWMA 5EIBD 1B8VA 3B2EA 2HX1A 2I6SA 4LRXA 1C9JA 1U65A 4DAOA 4TUYB 4A0RA 4CIYA 1PI3A 4HYYA 3Q9SA 3L9XA 4Q3KA 3MUEA 5E1OA 3T1TA 2F55A 1L5RA 2QYSA 2P41A 2P75A 5IXJA 1U3DA 1EGMB 1U90A 1QF9A 2AMLA 1JKJB 5KKAA 2WYWA 2CJFA 4BRZA 3ZLTA 1VL0A 1ISMA 1CR1A 2IOFA 5LXTF 3MOIA 4BTLA 2GSWA 5L45A 4CM5A 2D1RA 1XZLA 1CR4A 1SCUA 3BXOA 3HZHA 4KX5A 1UOQA 3GGSA 3QEMB 3SE0A 2YICA 3LQFA 3AYXB 2ORYA 3FHLA 4QBHA 4ZVPA 4BEVA 5ADUS 1F48A 1FYEA 4XGIA 4ZCMA 3UOAB 1F3OA 3FI9A 1ODIA 4BOYA 4EUNA 3UJ8A 3L6RA 4C87A 4D3DA 4U9IS 1VJ0A 2QAJA 3RC9A 3N2GA 4K6OA 3SBXA 4F7WA 4WGGA 1ZXLA 3FVVA 4BQFA 4BLWA 5CIYA 3R3SA 4Z4EA 1CNMA 1U04A 3CT4A 2V7QD 4HMPA 4MVJM 1YASA 2R4TA 3ZQ4A 3L8ZA 4YT2A 1J2UA 1VG9B 4OP1A 2EZ8A 1PQPA 2ST1A 3GJ3A 1J8VA 3H3JA 3ETDA 4N40A 5FBZA 1UBFA 2H2DA 2QXUA 5EKUA 4AZTA 1D5WA 1OVMA 4BBJA 4CDMA 4WX2B 1FQKA 1TMOA 2HBZA 1RXEA 3D4PA 4QT4A 3FMGA 3ZGZA 2R1UA 2VRBA 3VJRA 2DX7A 2E87A 5DMHA 4M6WB 1VA5A 4H18A 3EWNA 1GILA 2NU6B 1YHNA 4QHTA 1NW8A 1T6YA 2EBFX 2H31A 4V02A 4WK0B 1I7DA 1OD6A 5KCZA 5TX7A 1G6HA 2WABA 2WP0A 1TYBE 4K8RB 3HQ4O 2A92A 3PKZA 5G3YA 5CB8A 3GEMA 2V3VA 5IFLA 1E64A 2RD2A 2YDYA 4TV9F 4U3JB 2ZPUA 1W5FA 4ACAA 2FFHA 3SKYA 2CL0X 4EECA 3E5MA 2OV4A 3CLKA 2Q9UA 4ZYZA 1ZVVA 4K8OA 2QSZA 3C6KA 4RFSB 1ZJWA 3FNQA 4QYSA 4MP8A 4RETA 4G0VA 2WF9A 5DKFA 1S4QA 2OLJA 4FSXA 3V00A 4EA7A 2AFHB 4KMOA 1UMCB 1Z3IX 3TR6A 5KOJA 2O8BB 2D62A 2HY7A 2PGDA 2OKGA 3G1UA 3O0DA 1KQNA 2WJ6A 3TXXA 1RTKA 4NOKA 3KR9A 2VP3A 2V9PA 3V3KA 2CT8A 3AO0B 2Z30A 2X2FA 3ABSB 5EXDA 3HGMA 1ZZGA 1DWQA 1G7CA 1X7DA 3H19A 1CVRA 1UZLA 2VQ6A 3PC3A 2YQ4A 3V97A 3NCTA 2XVXA 2ICAA 1BOOA 3O84A 2EBHX 4ARSA 3G2NA 4YLEA 3ICEA 5KHAA 1TXGA 3VC1A 4DCJA 1DT5A 4C1BA 1Q0RA 4WEOA 2ZSKA 4QSMA 5SYNA 2PWZA 3AFNA 3D6TB 3JD1A 3NDJA 4YGXB 1EVYA 4H31A 3SZUA 4PNEA 1ZOPA 1O0BA 3NORA 3FTNA 3O1LA 2G09A 3DMHA 4FMDB 5DLPA 5IW8A 2C9DA 1J8QA 1ZWLA 2J6IA 1KMCA 1VPDA 2O4UX 5ELMA 2JARA 4BC1A 5FDFA 3R09A 4BPBA 1FSSA 2XCIA 2XEDA 3ANXA 4RD2A 2P2SA 5HFNA 2W6ID 1CVIA 2IYWA 2HNKA 5ESWA 5JSZA 2BFBB 1K63A 3A3NA 1CQPA 1QJCA 5IG2A 1VKRA 1B8PA 4FE4A 2FWIA 1H1DA 2W37A 5E1DA 4HOYA 4Z9BA 1NP6A 2ZI5A 4FIDA 3VBCA 1Z4QA 3Q1LA 3IUPA 3GMIA 3QI7A 3EUEA 5J58A 1UKBA 4YIKA 1QQBA 5KYWA 3C8HA 2ZIAA 1MIOA 2WKSA 3MIIA 4JA0A 1UEIA 3MAJA 1K9SA 1H22A 4TYPA 1SVUA 1ZEJA 4JIMA 3QLJA 2VJNA 5AUQA 5FWDA 4J0EA 1E96A 3KZNA 4IEIA 1OU0A 4Q4DA 3ZTTA 3L7AA 3QP9A 2ZAYA 3AGPA 3T3DA 4RTJA 3J81A 1N5LA 1V5FA 1MIHA 4WXPA 2FQYA 1E2IA 1C7ZA 3KYBA 4NKRA 5IHXA 2V1UA 4J16C 4AJEA 2WFLB 1CJCA 2R6FA 2NT3A 1T1SA 2RKBA 1GRNA 2DE0X 2ATCA 3HNOA 4FFMA 4Y1RB 2JIZA 4DY4A 4U7JA 4B2YA 2O8FA 2Q4BA 1KH3A 5DMXA 4UPEA 5KTTA 2SKCA 3R3JA 2O2XA 4ZC1A 4WFJA 3UB4A 2VSQA 1R5NA 4DE5A 3LE8A 1CR6A 1E79A 1G4AE 3VH3A 1DKOA 3A4LA 3BHMA 2C99A 1SBCA 2JI6A 1GQYA 1NIJA 4PFSA 1Z4PX 3ETHA 3ENWA 3GFTA 5DX1A 3U0VA 3S1LA 1SXHA 3OA0A 3WL8A 1NTRA 2BN4A 3I2KA 4UMDA 4D45A 4E31A 2GZ2A 2IDMA 5HKBA 4OHPA 2ZYDA 2P35A 3PNBA 2FW7A 1EFTA 1ZSNA 3AKDA 3L6UA 1UK8A 2EKQA 2TS1A 4L02A 4GMGA 4M36A 1WULS 3WGYA 4AAYA 3STVA 4DC0A 2NP6A 3R7DA 3F4KA 4BE7B 5J4VA 3ZYCA 5E9WA 1H2ZA 3FR7A 4HAXA 1FNCA 2QZ9A 3EVDA 4KV7A 5K45A 2GJKA 1JJBA 1OFTA 2J87A 3A7DA 4DBVO 1VLJA 1UP6A 2E1PA 3MMXA 6GPBA 1B15A 2F90A 1ZKMA 3W2GA 1QJ4A 1C8KA 1MAUA 2I2XB 1OX5A 1K86A 1NPTO 2H1HA 1EAYA 3ASUA 3ND9A 1TQDA 3PQFA 4GWGA 4M0FA 4MVWA 4OXXA 4R40A 4XZ3A 4YAFA 3T7CA 4CMJA 4CHGA 2G17A 1ABFA 1KJIA 1XEWX 2V97A 2VNJA 3DE5X 3P52A 5DNCA 2ZATA 3CF2A 4WNAB 3G0DA 2G80A 3VM6A 2DECA 1GFWA 2AXNA 1G5HA 1OYVA 2MTBA 4OHKA 2Z5VA 3G6WA 4PSAA 5CVVA 5I5GA 3S70A 4ARZB 4F4UA 4F7DA 1T3ZA 1WV0A 2JD2A 2XUOA 3DOCA 3ZK8A 1H94A 3EC2A 1VJRA 3NBXX 4D8YA 2ZJFA 5JLAA 2VATA 1WCYA 1T24A 4DM4A 1E3EA 1OW3B 4I0WB 3VR6A 1JIJA 1G2IA 3B60A 2V4UA 4PX5A 2UZ1B 3IILA 2QZPA 2Q7OE 4W7SA 4RPCA 5IAJA 2JJQA 3SJZA 1TT7A 2XLBA 3KKOA 1JIIA 1OIWA 4MI6A 4UQLA 2XCQA 5JASA 1WZUA 1UP7A 4LXGA 4ZAZA 1XTQA 1ACLA 4PZ9A 5EE0A 5HQTA