3QN7A

Potent and selective bicyclic peptide inhibitor (uk18) of human urokinase-type plasminogen activator(upa)
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
245
structure length
245
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Urokinase-type plasminogen activator
publication title Bicyclic peptide inhibitor reveals large contact interface with a protease target
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 56
structure length 245
sequence length 245
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2011-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3qn7A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3qn7A01
1ETSH 1QURH 4WJG2 3P8FA 1CT2E 1IQIA 2ZIQH 5GXPA 1O2JA 2FWWA 3RMOH 1AWHB 1FY8E 2F9NA 4IMQA 1C1QA 5SGAE 1E38B 2WPKS 2IOTA 1UHBA 1T4UH 1ZOMA 2JETC 1P05A 1TNGA 2RA0A 1FN8A 3GYMA 4FUIA 1C1TA 4FU8A 2P93A 4DY7B 3ENSB 1O5GH 1C5YB 1MKXH 1L1NA 1O5AB 4JYUH 2FOMB 3SV8A 1OP8A 1WU1A 3CENA 1EZXC 3A87A 4GLYA 3M35A 3SU1A 5K7RA 2R2MB 4X6NA 3LH1A 1O3DA 3RU4E 3SNCA 1G32B 4ISOA 1KXDA 3S9AA 1K2I1 1HJ8A 3M36A 1GBFA 2A4RA 1HCGA 1Z1JA 1O2YA 2OP9A 1ELVA 2BZAA 3BTEE 4JYTA 2CXVA 1TGNA 1G36A 5ESTE 1SHHB 3V7TA 1P10A 2B7DH 2FOAA 2PV9B 2UUJB 5EXNA 1Y8TA 2CN0H 1SQAA 2FOGA 5FXLA 8KME2 2AGEX 1O2RA 2VIPA 4GPGA 5ABWA 1T32A 1C1VH 2NU4E 1NESE 3A88A 3SGAE 4Y10E 1Y5AT 1OP2A 4I8LA 3S7HB 2EI6A 3GDVA 5FPYA 1D3PB 2BQ7B 3ZVDA 4J2YB 4TPYA 3HK6B 1YLDA 4H6SB 3LH3A 2AIQA 1C2KA 2P59A 2YNAA 5DP3A 2FODA 1GBBA 5EOKA 1AKSB 5F03A 1A5HA 1CO7E 4BNRA 3UR9A 2RA3A 1RIWC 1Q31A 3Q3YA 2Z9GA 2WUCA 4GCHG 1EZQA 2VIOA 1EJMA 1V2LT 2XW9A 3U8TH 1EQ9A 1XM1A 2XBXA 1GJ8B 1O2GH 3LIWA 3VXFH 2Z9JA 1RTLA 3TH2H 3UREA 4AFUA 3UNQA 1H8IH 1MTSA 2F83A 4VGCC 4KTCA 1GMCG 2FOFA 3EAJA 3JZ1B 3A8CA 1D3QB 3A80A 1C5QA 5AHGH 1MH0A 3GYLB 4ISIH 3MH5A 3PWCA 3PO1B 1HV7A 1ELGA 1TX7A 2BB4A 4BTIB 3U1IB 3V12A 1P09A 1O2VA 4CRGA 3Q00A 1G37A 2BDHA 1TPOA 4A6LA 5A8ZA 1O2WA 3PLBA 3A8BA 3LGTA 4YTAA 1ZTKA 1Y3VA 2A32A 1IAUA 2FP7B 5HXFA 2XCNA 4B1TA 1HJAC 1HAPH 1GHWH 3STIA 1QNJA 2GV7A 3OY5U 4YLUA 2C8YB 1IQMA 1AY6H 1SR5C 2ZEBA 3EYDA 4HZHA 5LH8A 2O8UA 3NUMA 2QYIA 1O3NA 4MNWA 4QT8C 3QWCH 1MTNB 3ZVFA 2ZFQH 5GIBA 2Y82A 1EAIA 4B71A 1V3XA 4A1VA 4INKA 3LKWA 1S82A 1L4ZA 1QB6A 3ZYDA 4I8KA 3DHKH 3KEEA 1AQ7A 1W14U 4ISHH 2H6MA 3RXTA 8GCHG 4K60A 4X1PU 2A7CA 3K65B 2F91A 1SFIA 1GHBG 2UWLA 1Z6EA 3NWUA 3F9EA 1NRSH 2UUKB 5EU8A 2QAAA 2QCYA 1AVXA 2R0KA 2TBSA 1ZRKA 2ZGHA 3LGYA 4H42U 3U8OH 3TJNA 4FUEA 1N8OB 4XOJA 4CHAC 1O3BA 2ZI2H 3E6PH 1V2JT 2C90B 3KQBA 2JH6D 1WQVH 3SORA 1CVWH 1TIOA 3HKJB 4ABJA 1O3HA 2VINA 1P2KA 1MKWH 1EOLA 3CS0A 1NRQH 1GJCB 4NGAH 9LPRA 2G5NA 1F7ZA 2HPPH 5F8TA 1DANH 2BX3A 1XVMA 1OWIA 1T7CA 5HM9A 2C8WB 4YOJA 2QXHA 5GCHF 4UFEH 2O9QA 3I29A 1K1IA 3ZZ6A 4AFSA 1UJ1A 1QBNA 4ZAEA 4I33A 1HUTH 1OX1A 5A2MH 3ODFA 2A5KA 5CHAC 2RG3A 1EKBB 4HTCH 2XBVA 1AVWA 1Q2WA 1ZHRA 2WPIS 2A7HA 4KGAA 2Z94A 3GY4A 1O3IA 1EP5A 4TY7A 3AAVA 2AMQA 1GBMA 5A0CA 1WAYB 1BBRH 1ELAA 2P3TB 2GCHF 2GDDA 4F4OC 1GBDA 3RXJA 2BD2A 2GZ7A 3QO6A 1Y3UA 1VGCC 2VB0A 1ELEE 1L2EA 3M5OA 3VPKA 2PHBA 4HFPB 3F9FA 1RXPA 1B0FA 1F5RA 3ATMA 4WMEA 1DWEH 2A0QB 1XMNB 4NWKA 1QB1A 1W7GH 1ZRBA 1SGRE 1V2MT 1ABJH 1MAYA 3A8AA 1C2LA 1MUEB 2CGAA 4WWYA 8LPRA 2ZF0H 4BXSA 3BG8A 1MQ6A 1EJAA 3OX7U 3P70B 2BD5A 2BHGA 1QHRB 2JKHA 4UE7H 1DITH 4D9QA 1UO6A 1YPJH 4X8UH 1XUKA 3A7ZA 3ZVAA 1TWXB 4INHA 4Q2KA 1ETTH 1J15A 1SGCA 2FX4A 3O8RA 2H5DA 1ARBA 3O8CA 5GDSH 1MD8A 1O35A 2VIWA 4LK4A 4AFQA 3SV6A 3KQCA 2F9OA 3BTWE 4ZXXH 2ZU1A 3PTNA 4U2WA 3IG6B 3MNCA 1FQ3A 2PSXA 3RLWH 1FIZA 4FXGH 3ZZAA 1AUTC 1PQ5A 4XSKU 2P3FH 4FVBA 2AIPA 2BY6X 1O5FH 2ZU3A 3PWBA 1HLTH 1GCTB 1ZMNA 2BLWA 5E8EH 5I46H 2ZDNA 4BOHA 2WUBA 1P2NA 3MU5A 1C5RA 1GWAA 2WV4A 4X6OA 1MBMA 1O39A 1LVOA 1NFWA 2FI5E 3MU0A 3K6YA 1C1RA 5C1XA 1WYKA 1O2SA 1CGJE 1HIAB 2O8LA 3DT0H 1L4DA 1ZSJA 3KHVA 3TVJB 1SGEE 4FUCA 1GDUA 3RXLA 1EPTB 1NN6A 1BZXE 3LONA 5E0GA 1GJ9B 1P9SA 2NU2E 1ZMLA 3RXFA 2DE9A 2VVUA 5LPFA 1N6YA 4OS2A 1CBWB 2GZ8A 1ID5H 5F8XA 3SU2A 1YPGH 2GV6A 3VGCC 3ZZ7A 3UPEA 3KIDU 3H5CB 3C27B 4XE4A 2BD7A 1RJXB 1GI9B 2W7UA 1SGYE 2ZGCA 1ZHMA 3FP7E 5FHTA 1EJNA 1NZQH 3GY8A 4X1SU 1BMAA 3QGNB 2F9UA 1ZSKA 1OWHA 1EX3A 1J14A 1UTJA 1GHAF 1O2KA 4ABHA 2Z9KA 1J8AA 1KXEA 1QJ1B 1L0ZA 3KNXA 3FP8E 4O3UA 3E1XB 1QIXB 1UVSH 3KGPA 2STAE 1SOTA 1YBWA 2ZCKP 1YKTA 5CE1A 4KTSA 1GBLA 3M7QA 3ZZBA 5FBEA 4I32A 5G4BA 5C5OA 3TJOA 1DDJA 3A86A 3BN9A 5F6MA 4OS7A 2AGIX 4NCYA 1BHXF 1H9IE 2ZP0H 4ISLA 3TJUA 4MDSA 1O34A 2TGTA 1UHBB 1GBAA 1BRUP 4XBBA 1CA0C 1TA2A 4ABAA 1SGNE 1SLXB 3A82A 3RXSA 3MWIU 4IMZA 2XWBI 2OBQA 1ELDE 2GDEH 1O36A 5C1YA 3RLYH 1W13U 1D6WA 1GBIA 1T31A 1UTKA 1C9TA 4K8YA 4ABFA 1V2ST 1ZSLA 4WMDA 1T8OA 2ZNKH 2GMTB 1GHYH 1THRH 4BTUB 3UWJH 3P8OA 1C5XB 3RMLH 3E90B 4B76A 1P2MA 1PQ8A 1CSOE 3NCLA 3FFGA 5A0AE 1HXFH 3A7XA 3MU1A 6CHAB 3MU4A 1VITF 2OD3B 3R0FA 3L3TA 2FS8A 4K8BA 1O5CB 2C4FH 3MO6A 2B5TB 1TBRH 1MKWK 1FNIA 3GCHC 4CRCA 3ESTA 4Z6AH 1IHSH 1HAZB 1W7XH 1TLDA 4BAHB 1GJAB 1GG6C 1PPGE 1BIOA 4FU9A 5DP9A 2CF8H 1SHYA 3LGUA 1ETRH 1RFNA 3ZVCA 2GCTC 1PYTC 2F9BH 3T2NA 1GCDA 1QA7A 2ZDVH 1V2WT 4AORA 1TGCA 5DKMA 1KLJH 3VB4A 4MTBA 3RXDA 3URCA 1O2QA 1A0HB 3KN2A 1MMJN 2WINI 1NM6A 5EQSA 2ESTE 4ASHA 1VCWA 4AX9H 3T28A 2B0FA 4ZMAH 4TWWA 1W0YH 5FCKA 2LPRA 2V3HH 4FUHA 4JZFH 4WH8A 7GCHF 3AW1A 5EXMA 2SFAA 1C5PA 1A5GH 2NU1E 1Z7KA 1SB1H 2G5VA 1F2SE 3SUEA 1G3CA 3TGIE 1HGTH 2PLXA 1ESBA 4Q7ZA 4I31A 3N7OA 2J95A 3BIUH 3TITA 4GVUA 2R3UA 1FDPA 4Y11E 5PTPA 1MTUA 2ALPA 2FMJA 1CHOG 4ZKNU 3EDXB 2ZHWH 4AB9A 4NFFA 2QY0B 1QBVH 1C2IA 3TH3H 2R9PA 1FONA 4RKOB 1HYLA 5FPSA 2NU0E 2ZHFH 3H7TA 1AMHA 2G81E 1SG8B 1DS2E 1K1PA 3O8BA 1SOZA 1ABIH 4DG4A 2J9NA 1WV7H 4DVAU 2A7JA 5L30H 1K21H 1O2MA 2ZHEH 1AE5A 3KF2A 4D7GA 2FYQA 3QDZB 4RSPA 4CRFA 5DP7A 1BCUH 2EI7A 7ESTE 2VGCB 1O31A 1VCQA 3M7UA 3W94A 1MZAA 1C5ZB 3HPTB 3MHWU 3PLKA 1EB2A 3TLOA 5B6OA 1L1JA 3QN7A 1QRZA 1D6RA 3RXIA 2VWMA 2P94A 2PKSB 1FXYA 4CR9A 4X6MA 1C5TA 4XFQA 4CRDA 3WY8A 5EQRA 1TRMA 4UDWH 4WH6A 3RXCA 1T8NA 5FCRA 1WBGB 1W2KH 2Y5GA 3LU9B 4JK6A 4AOQA 2ZECA 1GMHG 2OC7A 1T8MA 3D62A 1O32A 2WV5A 1SLVB 1D3DB 2XBYA 4B73A 1GI7B 1QL7A 2UWOA 4AYYB 3LGIA 3URDA 8GCHF 1FY4A 1WSSH 1FPHH 1INCA 4XBDA 4A92A 1VCPA 1ZTLA 2BVRH 3ZVEA 1MQ5A 4ABBA 1ZGIA 1MU8B 1AFQB 1ORFA 3GCTG 1YCPK 3LGWA 4ZUHA 4ZKOU 1TMBH 1P11E 1FZZA 2FOEA 1CT4E 2ZGXH 3NPSA 2D8WA 1DLKB 3BG4B 4KELA 4WXIA 3M5MA 3A7TA 1NU7B 3M3VA 3VFEA 1LVYA 3M37A 2FTLE 1C1OA 3T26A 4O3TA 4KP0A 3PV4A 4NIVA 4MG3A 1FAKH 1O3GA 5TJXA 1F0UA 5HMAA 4Y79A 1OWJA 3LT3A 2SGAA 4KKDA 2OQUA 4IC5A 3RC4A 1DPOA 1WCZA 1RTKA 2PGQB 2BDBA 4HGCA 4NFEA 1BTHH 2SGFE 1QTFA 1OXGA 1G3DA 2P3UB 4HI3A 3E16B 3FZDA 5JYIA 1HAOH 1O2UA 2ZCHP 1JXPA 2UUFB 1XUGA 1P0SH 2FEQH 3UFAA 2QXJA 6GCHF 1O2ZA 1TPSA 2BLVA 4IS5A 4TWYA 2BVXH 1J17T 1FAXA 1QCPA 3UQOA 1K1OA 2Q1JA 3ZZ3A 4O97A 3MO3A 3TH4H 5K0HA 4XBCA 1BQYA 1EAUA 3ZZ5A 3LGVA 5EQQA 9ESTA 3I77A 1GI5A 1XKAC 2ZGBH 1N8OC 4MNYA 3BTHE 1J16A 1JIRA 1XKBC 4ESTE 1T4VH 1BITA 4JK5A 1BTPA 2Y7XA 5GJ4B 1LKAA 3QX5H 3P6ZB 1F5LA 2H1UA 2QIQA 5J4SA 1ESAA 5A8XA 3GCNA 2BD3A 3ZZ4A 1UVPA 4A1XA 2FLRH 1GJ6A 1ZJDA 2FZZA 2V3OH 4OS1A 3VEQB 1THSH 1S81A 1BMNH 2SGQE 1C1SA 2FS9A 1YPLH 4MPUA 2BDIA 2BQWB 4I7YH 3UY9A 3B9FH 1DXWA 4SGAE 2OTVA 2JETB 1MAXA 1GJ4H 2BLOA 1KLTA 4Y0ZE 5AVDA 2VH6A 1C5VA 2VWOA 3MMGA 1MBQA 3EA9A 3AVZA 1LMWB 2AGGX 1V2UT 1F0TA 3FZZA 3SHCH 3SV9A 1WOFA 2BLQA 3T5FH 3GOVB 4MPVA 3KL6A 2BD4A 1NU9A 3RXBA 3A84A 1NFXA 3MU8A 1ZR0A 1YC0A 2V6NA 1S0QA 3E91A 5EXLA 1Z1IA 3MNXA 1KXBA 1EXFA 5T3HA 1GGDC 1ELTA 3S9CA 1DXPA 2BDAA 4WY3A 4GHQA 1QBOA 2ZDMA 1C5LH 1TBZH 1V6DA 4AN7A 3TGKE 3UR6A 2F9VA 1YM0A 1O37A 3TJVA 1BTWA 4MQAA 1Y3WA 3U98H 5LPEA 3KQEA 1GI4A 1O38A 3BTKE 1KDQA 1TA6A 1VZQH 1BA8B 1C5NH 4R8TB 4Y8YA 4NWLA 1BTUA 1HB0B 5JBCS 6LPRA 3SO3A 1GMDG 2J4IA 3SQEE 5JBAS 5C5NA 1OOKB 2F9PA 1OWKA 2G55A 3EQ0H 2VVVA 3PTBA 4X2YA 4A1TA 1QJ7B 4ABGA 1RIWB 1SI5H 1DUAA 3T29A 1PPCE 1CGIE 1UMAH 1C1PA 1LPGB 2BY7X 1DWBH 3S0NA 1O3EA 1TRNA 3T62A 1BMMH 2FM2A 3PMBB 4CR5A 4GSOA 5JB9S 2XYAA 1FIWA 1BT7A 1G9IE 1DY9A 2G00A 3RXKA 1DM4B 3ATKA 1A4WH 4YLQH 5J4QA 1K1LA 1XX9A 2R0LA 2SGPE 1YF4A 2ALVA 1DLEA 2ULLA 1LVBA 2ZU4A 3PB1E 2BD8A 3MO9A 1A7SA 4GAWA 3TGJE 1ZHPA 4Y8ZA 2OUAA 2I6QA 3SUGA 4IN1A 3V13A 1QQ4A 2BQ6B 1YYY1 1UTPA 1GBJA 1K28D 2BD9A 2PTNA 3MOCA 4MPWA 3UUZA 1PYTD 1O5EH 1CBWC 2VIDA 2BDYA 4FU7A 1P2IA 2ZPQA 1TFXA 2OCVB 1TGSZ 1KLIH 1VJAU 1MTVA 1NRRH 4NSYA 3SU3A 2ZG0H 1LPKB 4CBNA 3SBKA 2P95A 4X2XA 1UTLM 3TPIZ 4D76A 2SNVA 4AFZA 3UTUH 3SNAA 1MKXK 2OXSA 1EZSC 3RM0H 2OLGA 4ZHLU 4IN2A 1X7AC 4I8HA 2ZO3H 2BXTH 3U8RH 1YPKH 1PPZA 3GY3A 4YOIA 2EA3A 1V2QT 1C5MD 2CHAC 1A0LA 1CU1A 1XVOA 1LHCH 2A31A 3BF6H 3SJ8A 1TNHA 1C5UA 2G4UA 3VB7A 4Y7BA 2FOBA 2J34A 2OBOA 1XUIA 1EP6A 1SMFE 1P57B 1U6QA 1G2MA 3O8DA 3ZV8A 2PUXB 1C4V2 1SGPE 2AS9A 3UIRA 4K5ZA 5C1UA 3RUOA 1Y5UT 2BXUH 3AW0A 4ISNA 1GBHA 1G3BA 2K1QA 4CHAB 2W3IA 1NC6A 3D49H 2WYGA 4MLFB 1JRTA 2CF9H 1LCYA 3PMHB 3TK5A 1QJ6B 2BMGB 3E0PB 1H4WA 2C8ZB 3RMNH 2GTBA 1QY6A 2GMTC 3DFJA 1AUJA 2YOLA 2GP9B 1HXEH 2FDAA 1SQOA 1BTXA 1OPHB 3DA9B 4LZ1H 4NIXA 3KCGH 4OS6A 1YPHE 6CHAC 1C5SA 1GHZA 2FI3E 1ZPZA 4JMYA 4B2BA 2VWNA 3P92A 4ZH8A 4Q7YA 2Z9IA 2STBE 1P12E 1GJBB 2PUQH 1C5WB 1CHOF 3RC6A 1EUFA 3UWIA 1NFUA 3A7VA 1GDQA 3SNEA 4YO9A 3F9HA 4BAMB 1YCPM 4X8SH 3QLPH 2HALA 1D9IA 1ESTA 3ATIA 3RU4D 4CRAA 3QZQA 2M5TA 2V0BA 3P8NA 4BANB 2BY5X 5TCAA 2PFEA 5JB8S 1VGCB 2G52A 1DT2A 2XXLA 2OC8A 2ZFPH 2FX6A 1SGDE 1ZGVA 2BTCE 1CE5A 2OINA 1TOMH 5GCHG 1QR3E 1NY22 2ZHDA 1C2GA 5HM2A 1ELBA 1GL1A 2ZTXA 3M5LA 3RXVA 3BTQE 4O03A 3GY5A 2ODPA 1SC8U 3Q3XA 2P16A 2PTCE 3TK9A 2A4GA 1WTHD 2Y7ZA 2RDLA 3C1KA 4THNH 6ESTA 2PSYA 3M3SA 3S69A 3DD2H 1JBUH 2H5CA 1G3EA 1DOJA 3DUXH 2J94A 1DWCH 3T25A 3A81A 3U1JB 2P8OC 2BVSH 5DK1A 1F0SA 2WPHS 1P02A 4JCNA 4NZQA 5BRRE 4TPIZ 1SLUB 1YPMH 1TBQH 3SNBA 1O3MA 3D65E 1PPFE 3BTTE 1ANCA 4MNXA 2A4OA 5A0BA 2VIQA 2PWXA 1AB9C 4D9RA 4BXWA 2AERH 2Q6GA 2J92A 4X2WA 4AZ2B 2QV1A 3BV9B 2FOHA 3E8LA 3K9XB 1F92A 1UVOA 3A85A 4NG9H 3LPRA 1K1NA 2EI8A 1Z8GA 1O30A 3UNRA 1K1JA 1LDTT 3GDUA 1NO9H 1C2EA 2GKVE 4Y6DA 3SNDA 3MI4A 1S0RA 2ODQA 1W12U 2ZU2A 5ETXA 3SJKA 3UQVA 1O3LA 1HAVA 1VR1H 4ZROA 3ZVBA 5JDUB 4D8NA 1O5BB 1S5SA 2D26C 1C2JA 5JBTA 5C20A 5L6NH 3EA7A 4YESB 1A2CH 1C1NA 1SQTA 2HWLB 1C5OH 3F6UH 1O3JA 1HAXB 3HGNA 3UOPA 5EW1H 1AZ8A 1S83A 1TNIA 2A45B 2Y5HA 2ZPSA 1AFQC 1O3PB 2VH0A 2XBWA 4B74A 1DSUA 3PM3A 3OSYA 1FUJA 1O3FA 5TCCA 1ANDA 1A3BH 1DFPA 4YOGA 1UCYH 4GCHF 2NU3E 1IHTH 1DX5M 2KAIA 1BBRK 3BG4C 4MVNA 5DP4A 3E0NB 1E35B 1QRWA 2IN2A 1P9UA 1AZZA 3A89A 2FTMA 2PGBB 1GI2A 1KXAA 1FPCH 2AEIH 4IBLH 1HAIH 1O5DH 1P03A 3ZYEA 1RTFB 1Q3XA 1W10U 3EE0B 2A2XH 1FY3A 1GMCF 1UTMA 2OC1A 2DE8A 4X6PA 1IQLA 4NA7A 2FOCA 4WVPE 2FIRH 1UVUH 4NA9H 3V3MA 3CS7A 2ASUB 5JPMH 1QB9A 1Z8RA 1NPMA 3HKIB 1LHGH 1V2VT 1GHVH 1G2LA 1P3CA 2TGDA 2HOBA 1B5GH 4LOYH 1GBCA 4CH2B 3Q76A 3A7WA 1AIXH 3A8DA 3K6ZA 1GVZA 1MCVA 2ANYA 1NFYA 3VXEH 4KTUA 1P04A 1TE0A 3LC3A 4DURA 3RXQA 4X8VH 4ABDA 4UFGH 4Y8XA 2FYRA 2G4TA 4SGBE 2G51A 1D4PB 5EODA 1OWEA 1GHAG 3PLPA 1GL0E 1UTOA 2BY8X 4YT6H 3RC5A 2WPLS 1L1GA 3VB5A 1O33A 1F5KU 3GCHB 1YGCH 2GVFA 2W3KA 1UK2A 4Y7AA 1AI8H 1JWTA 3ODDA 4JYVH 1GG6B 1GJ5H 4R0IA 3VB3A 5FBIA 4JZEH 1E37B 1FY5A 1ZLRA 1ZMJA 5FX6A 1IQHA 1KDQB 1O3CA 4NA8A 2HPQH 1GHBF 1BDAA 1GBKA 4UEHH 4FUBA 4CBOA 1V2RT 4ABIA 4AG2A 5IDKA 3CP7A 3MH7A 3PO1C 3STJA 2A5IA 3BSQA 3ZV9A 2B9LA 1A61H 2Y5FA 4Q80A 4AGJA 2Z6BD 4BTTB 1AE8H 1IQKA 3LC5A 1AHTH 1GMDF 2C93B 2J38A 3L6PA 5EG4A 4AYVB 3AAUA 4ABEA 3GY7A 1V2NT 1O2OA 1SGQE 2XWAA 2QC2A 3OTJE 2EC9H 1AFEH 1ANEA 3L33A 3D23A 1EASA 1HJ9A 1J9CH 1NTPA 1ZPCA 1NRNH 3BTME 1VITG 2PKAA 2BZ6H 2ZDKA 1O2TA 2BDCA 2FO9A 1MTNC 3RXEA 4TY6A 1HNEE 4NZLA 3RXMA 5HYOA 1O3AA 1RS0A 2HRVA 3ZZ8A 4K2YA 1V2PT 1KXCA 3RXPA 5E2OA 5F8ZA 3EGKH 4AG1A 1RRKA 2BOKA 3PMAB 4Y71A 3QTVH 3QUMP 1SGFG 1H8DH 1SL3A 5DP6A 5I25A 4JZ1A 2TGAA 1A1RA 2FLBH 4X1QU 1BBRE 1ZJKA 1TGBA 1Y59T 4DGJA 5LGOA 1TNLA 4TYDA 3AASA 3TNTA 1KTTB 1YLCA 4DIIH 7GCHG 2RCEA 4E05H 2Y80A 1GI6A 4UFDH 1P8VC 1JIMA 5EW2H 1AVGH 1GPZA 1O3OA 4XDEA 3LJJA 3RDZA 1E0FD 1NRPH 4B75A 1S85A 2J2UA 2ZGJA 3M61U 2Z9LA 1HBTH 3RXGA 2WYJA 1KY9A 2UUYA 4FUJA 1Y5BT 1SGFA 1IQNA 5DG6A 4OS5A 4ZKRU 2Z3EA 3LOXA 2QXGA 1C1UH 5E2PA 2D1JA 2ZQ2A 1ZTJA 2ANMH 4K1TA 2QA9E 3UNSA 3U69H 1JMOH 3Q77A 1A5IA 3SU0A 1UTQA 4A7IB 2GX4A 3OU0A 3S7KB 2F3CE 1HAHH 2BDGA 1A46H 4Q7XA 2AFQB 4E06H 5H4IB 3BTDE 3SQHE 2GZ9A 1EB1H 4DW2U 1S6HA 1MZDA 4U30A 4BAQB 1OWDA 1AO5A 3RXOA 2ZFTA 1QFKH 2HVXA 1TQ7B 1GJDB 1T8LA 1HAGE 4WF8A 4PROA 2ZA5A 1OYQA 1HDTH 1UCYK 5A09A 1Z8IB 2YNBA 3QK1A 2GT7A 1SSXA 2XTTB 2QF0A 3TU7H 2HLCA 1TB6H 2ILNA 1LTOA 2BM2A 1P2JA 1IQFA 3H7OA 4DOQA 7KMEH 1WUNH 1O2NA 5DO4H 2ZZUH 1AGJA 1MTWA 2GT8A 5L2ZH 3ITIA 5EGMA 1Y3XA 4X8TH 2BOHB 1UVTH 5DP8A 3HATH 1QL9A 2TPIZ 1LPZB 2AYWA 3ZZ9A 4WXVA 4X1RU 5C67A 1DY8A 2ANWA 3PYHA 1FJSA 4MNVA 1GCTC 3M7TA 2ZTYA 3M3TA 2VU8E 4X2VA 3K2UA 2HGTH 1N1LA 2ZKSA 4BAKB 3SV7A 3MTYA 1OP0A 1TGTA 2Z3DA 3RXAA 3TNSA 3RP2A 1OKXA 1B7XB 1LHEH 1O2XA 3IITA 4VGCB 4IC6A 4MPXA 1OYTH 1QGFA 2XC4A 5DPAA 3SU4A 3ATWA 3RXUA 1HPGA 1TAWA 1AU8A 1M9UA 5BPEA 1C2FA 1EPTC 3GY2A 2FPZA 3SUFA 4H6TA 1G30B 1GHXH 2I6SA 2ODYB 3GICB 3SJ9A 1XUJA 1ZPBA 2AMDA 2D2DA 4LZ4B 2FI4E 3A83A 1O2HA 1PFXC 1GVKB 4YT7H 4ZXYH 2BY9X 1V2TT 2ZCLP 3B8JA 1GBEA 3OYPA 1MD7A 6GCHG 1O2IA 3R3GB 2ZWLH 1CHGA 1SVPA 1IQEA 2CV3A 3P17H 1QQUA 1ZYOA 2IJOB 2XNIA 3BIVH 1HJAB 1GJ7B 3SOSA 3RM2H 1WTGH 1SFQB 1CGHA 2AMPA 3BTGE 1PPHE 2GGVB 3RU4T 3BEIB 1AKSA 4ZHAA 3RXRA 5E0JA 4DIHH 3E3TA 2Z7FE 1LQDB 3BTFE 1FI8A 4IW4E 5A8YA 1GGDB 3QTOH 3QZRA 3SGBE 3KQDA 2O8TA 5FPTA 1GI8B 2Y6TA 5AF9H 4YM9A 4WMFA 1EATA 1LKBA 1BRBE 1GI3A 2H9HA 2WPJS 3P8GA 1TALA 3RXHA 2ZPRA 1HAVB 2ANKH 1EAWA 1C1WH 1LHFH 2ZDAH 2H9EH 1QL8A 3RMMH 1BRCE 2ZQ1A 2R3YA 3TK6A 1ELCA 3P95A 2C3SA 3LJOA 4I8GA 1TMUH 2ZFSA 2UWPA 3FAOA 2BYAX 2TIOA 2GD4B 1YPEH 2R2WU 3SGQE 1BUIA 2DUCA 4Z0KA 3SW2B 1TPAE 2TRMA 2PW8H 1P2OA 2Y81A 1H1BA 3A7YA 2IPHA 1OS8A 1TONA 4CH8B 2VNTA 3GY6A 1YPHC 1BTZA 2KAIB 2ZDLA 2OQ5A 1TRYA 3HK3B 1HAYB 3MH4A 4AGKA 4X1NU 1KXFA 4UONA 4A5TS 1XXFA 4FUFA 5DJ7A 3FP6E 1AWFH 2BX4A 3SJOA 2A2QH 1FLEE 4RN6A 1UCYE 5FX5A 4E7NA 5AFYH 4GUXA 1P01A 4NIWA 1EAXA 1WQSA 4U01A 4UFFH 4OS4A 1FMGA 1TMTH 2CMYA 5C3NA 2HNTC 3MYWA 1BJUA 4ZHMU 4K3JA 1HRTH 2A1DB 1Y3YA 1SLWB 5HGGA 1P06A 2FXRA 2XCFA 4UD9H 1BJVA 1K1MA 2QXIA 5CHAB 3NXPA 1YP9A 1VJ9U 5LPRA 1P2QA 3UOUA 4O9VA 1YCPH 2HNTE 3MFJA 1JRSA 4INLA 2XC0A 3JZ2B 1BRAA 1D3TB 3IWMA 1K9OE 3QGJA 1JOUB 1HFDA 4CREA 1UK4A 1DVAH 2ZU5A 2EEKA 2ZFRH 4CRBA 2G8TA 2VJ1A 3F1SB 3MNSA 2H2ZA 4RKJB 3SHAH 1GDNA 2ZFFH 4IGDA 3SI4H 4Y76A 2OC0A 1Z71A 5CMXH 2FESH 2VIVA 2V35A 5C2ZA 2SGEE 2C8XB 1NS3A 3ZZCA 4FVDA 3OY6U 5GWZA 2ZHQH 2CHAB 2W5EA 1H9HE 1XUHA 2HNTF 3NKKA 1GMHF 1RGQA 3SU6A 1TNJA 1C9PA 4DT7B 3I78A 4DCDA 1GBTA 2TGPZ 1PPEE 4M7GA 1CA8B 2VVCA 1FV9A 4OGYA 3GCTF 1ZZZA 3PMJA 3SUDA 3PROA 1PQ7A 1FN6A 1ACBE 2Z3CA 3B23B 1NROH 1MU6B 4FUGA 4OGXA 1FY1A 3SN8A 5AFZH 1E34B 2GCHG 1ANBA 1F0RA 1C4Y2 2H9TH 1TABE 5DP5A 3SU5A 4K69A 3FANA 1A3EH 1SGIB 5L2YH 1N6XA 1S84A 1XUFA 1V2KT 2VGCC 4J1YA 1TQ0B 3F68H 1XXDA 2PKAB 2JH5D 2O8WA 4NSVA 1EZUC 1LHDH 5JBBS 4U32A 1TOCB 1MCTA 2NWNA 5GPIB 1W8BH 1LVMA 2PKSC 4Y0YE 2W7SA 1BHXB 1QRXA 3ELAH 4B2AA 1S6FA 1UK3A 4BAOB 2LNCA 4E7RG 2ZTZA 4GHTA 1LO6A 1C1MA 1KTSB 1C2HA 5FAHA 1ARCA 1Z8JB 2A4QA 3U9AH 3S9BA 3VGCB 3TIUA 1E36B 1BOQA 2SGDE 1BTYA 1QA0A 1W3CA 3F9GA 4D7FA 2QN5T 3G01A 5DGJA 1TYNA 3M5NA 3GISB 4K1EA 1PPBH 1DWDH 1GVLA 1TNKA 2ZC9H 1B0EA 3NK8A 1KYNA 1TX6A 1C2DA 1DSTA 2SNWA 3SJIA 3ATLA 7LPRA 1DICA 4AB8A 1W11U 5EPNA 2Q6FA 2PR3A 2WPMS 4H4FA 1IQJA 2VWLA 1LQEA 1GI1A 4JZDH 2Q6DA 3GDSA 5T6FA 4NIYA 3ZZDA 1BMLA 4I8JA 4ZKSU 1O2LA 2QGRA 2XC5A 1DE7H 2AH4X 3BEUA 3MNBA 1KIGH 1CT0E 1HIAA 1K22H 1Z6JH 5T6GA 1O2PA 1UTNA 2A5AA 4LXBH 1EPTA 1GI0A 3BEFB 1PQAA 4K1SA 1CA0B 1EOJA 1PJPA 1IOEA 1IQGA 1TX8A 3Q3KA 3SZNA 3GCOA 5T6DA 1SPJA 1O0DH 2P8OB 3MH6A 3LDXH 1KSNA 1CQQA 3EA8A 4YZUA 2O8MA 2W26A 2CJIA 1RD3B 1P3EA 1AD8H 1NT1A 3DFLA 3VB6A 3HGPA 2QF3A 5EPYA 1ELFA 1AB9B 1A0JA 1H9LB 5E0HA 4F49A 1C4U2 2B8OH 4X0WU 4DJZB 1AN1E 3V0XA 1TPPA 3W95A 1C2MA 4JZIA 1THPB 5IYTA 1BB0B 8ESTE 1SGTA 4B2CA 3SI3H 1W0ZU 1SBWA 2THFB 4FUDA 1VITH 3SV2H 1OSSA 2XRCA 3NZIA 1DUEA 2GCTB 3T27A 2JH0D 5ESBA 1O3KA 1V2OT 3ZVGA 3FVFB
chains in the Genus database with same CATH superfamily
1ETSH 1QURH 4WJG2 2RDEA 3P8FA 1CT2E 1IQIA 2ZIQH 5GXPA 1O2JA 2FWWA 3RMOH 1AWHB 1FY8E 2F9NA 4IMQA 1C1QA 5SGAE 1E38B 2WPKS 2IOTA 1UHBA 1T4UH 1ZOMA 2JETC 1P05A 1TNGA 2RA0A 1FN8A 3GYMA 4FUIA 1C1TA 4FU8A 2P93A 4DY7B 3ENSB 1O5GH 1C5YB 1MKXH 1L1NA 1O5AB 4JYUH 2FOMB 3SV8A 1OP8A 1WU1A 3CENA 1EZXC 3A87A 3DSOA 4GLYA 3M35A 3SU1A 5K7RA 2R2MB 4X6NA 3LH1A 1O3DA 3RU4E 3SNCA 1G32B 3N7DA 4ISOA 1KXDA 3S9AA 1K2I1 1HJ8A 2GJGA 3M36A 1GBFA 2A4RA 1HCGA 1Z1JA 1O2YA 2OP9A 1ELVA 2BZAA 3BTEE 4JYTA 2CXVA 1TGNA 1G36A 5ESTE 1SHHB 3V7TA 1P10A 2B7DH 2FOAA 2PV9B 2UUJB 5EXNA 1Y8TA 2CN0H 1SQAA 2FOGA 5FXLA 8KME2 2AGEX 3CNRA 1O2RA 2VIPA 4GPGA 5ABWA 1T32A 1C1VH 2NU4E 1NESE 3A88A 3SGAE 4Y10E 1Y5AT 1EFRD 1OP2A 4I8LA 3S7HB 2EI6A 3GDVA 5FPYA 1D3PB 2BQ7B 3ZVDA 4J2YB 4TPYA 5C0UA 3HK6B 1YLDA 4H6SB 3LH3A 2AIQA 1C2KA 2P59A 2YNAA 5DP3A 2FODA 1GBBA 5EOKA 1AKSB 5F03A 1A5HA 1CO7E 4BNRA 3UR9A 2RA3A 1RIWC 1Q31A 3Q3YA 2Z9GA 3FN8A 2WUCA 4GCHG 1EZQA 2VIOA 1EJMA 1V2LT 2XW9A 3U8TH 1EQ9A 1XM1A 2XBXA 1GJ8B 1O2GH 3LIWA 3KYGA 3VXFH 2Z9JA 1RTLA 3TH2H 3UREA 4AFUA 3UNQA 1H8IH 1MTSA 2F83A 4VGCC 4KTCA 1GMCG 2FOFA 3EAJA 3JZ1B 3A8CA 1D3QB 3A80A 1C5QA 5AHGH 1MH0A 3GYLB 2M2AA 3MH5A 4ISIH 3PWCA 3PO1B 1COWD 1HV7A 1ELGA 1TX7A 2BB4A 4BTIB 3U1IB 3V12A 1P09A 1O2VA 4CRGA 3Q00A 1G37A 2BDHA 1TPOA 4A6LA 5A8ZA 1O2WA 3PLBA 3A8BA 3LGTA 4YTAA 1ZTKA 3OEHD 1Y3VA 2A32A 1IAUA 2FP7B 5HXFA 2XCNA 4B1TA 1HJAC 1HAPH 1GHWH 3STIA 1QNJA 2GV7A 3OY5U 4YLUA 2C8YB 1IQMA 1AY6H 1SR5C 2ZEBA 3EYDA 4HZHA 5LH8A 2O8UA 3NUMA 1YWUA 2QYIA 1O3NA 4MNWA 4QT8C 3QWCH 1MTNB 3ZVFA 2ZFQH 5GIBA 2Y82A 1EAIA 4B71A 1V3XA 4A1VA 4INKA 3LKWA 1S82A 1L4ZA 1QB6A 3ZYDA 4I8KA 3DHKH 3KEEA 1AQ7A 1W14U 4ISHH 2H6MA 3RXTA 8GCHG 4K60A 4X1PU 1SKYE 2A7CA 3K65B 2F91A 1SFIA 1GHBG 2UWLA 1Z6EA 3NWUA 3F9EA 1NRSH 2UUKB 5EU8A 2QAAA 2QCYA 1AVXA 2R0KA 2TBSA 1ZRKA 2ZGHA 3LGYA 4H42U 3U8OH 1NBME 3TJNA 4FUEA 1N8OB 4XOJA 4CHAC 1O3BA 2ZI2H 3E6PH 1V2JT 2C90B 3KQBA 2JH6D 1WQVH 3SORA 1CVWH 1TIOA 3HKJB 4ABJA 1O3HA 2VINA 1P2KA 1MKWH 1EOLA 2IJD1 3CS0A 1NRQH 1GJCB 4NGAH 9LPRA 2G5NA 1F7ZA 2HPPH 5F8TA 1DANH 2BX3A 1XVMA 1OWIA 1T7CA 5HM9A 2C8WB 4YOJA 2QXHA 5GCHF 4UFEH 3FKSD 2O9QA 3I29A 1K1IA 3ZZ6A 4AFSA 1UJ1A 2YMSC 4ACBA 1QBNA 4ZAEA 4I33A 1HUTH 1OX1A 5A2MH 3ODFA 2A5KA 5CHAC 2RG3A 1EKBB 4HTCH 2XBVA 1AVWA 1Q2WA 1ZHRA 2WPIS 2A7HA 4KGAA 2Z94A 3GY4A 1O3IA 1EP5A 4TY7A 3AAVA 2AMQA 1GBMA 5A0CA 1WAYB 1BBRH 1ELAA 2P3TB 3PRDA 2GCHF 4XRNA 2GDDA 4F4OC 1GBDA 3RXJA 2BD2A 2GZ7A 3QO6A 1Y3UA 1VGCC 2VB0A 1ELEE 1L2EA 3M5OA 3VPKA 2PHBA 4HFPB 3U28C 3F9FA 1RXPA 1B0FA 1F5RA 3ATMA 4WMEA 1DWEH 2A0QB 1XMNB 4NWKA 1QB1A 1W7GH 1ZRBA 1E79D 1V2MT 1SGRE 1ABJH 1MAYA 2W6JD 1C2LA 1MUEB 2CGAA 3A8AA 4WWYA 8LPRA 2ZF0H 4BXSA 3BG8A 1MQ6A 1EJAA 2KCYA 3OX7U 3P70B 2BD5A 2BHGA 1QHRB 2JKHA 4UE7H 1DITH 4D9QA 1UO6A 5C94A 1YPJH 4X8UH 1XUKA 3A7ZA 3ZVAA 1TWXB 4INHA 4Q2KA 1ETTH 1J15A 1KMHB 1SGCA 2FX4A 2H5DA 3O8RA 1ARBA 3O8CA 3EE7A 5GDSH 1MD8A 1O35A 2VIWA 4LK4A 4AFQA 3SV6A 3SYJA 3KQCA 2F9OA 3BTWE 4ZXXH 2ZU1A 3PTNA 4U2WA 3IG6B 3MNCA 1FQ3A 2PSXA 3RLWH 1FIZA 4FXGH 3ZZAA 1AUTC 1PQ5A 4XSKU 2P3FH 4FVBA 2AIPA 2BY6X 1O5FH 2ZU3A 3PWBA 1HLTH 1GCTB 1ZMNA 2BLWA 5E8EH 4ZCNA 3SZEA 5I46H 2ZDNA 4BOHA 2WUBA 1P2NA 3MU5A 1C5RA 1GWAA 2QE7D 2WV4A 4X6OA 1MBMA 1O39A 1LVOA 1NFWA 2FI5E 3MU0A 3K6YA 1C1RA 5C1XA 1WYKA 1O2SA 1CGJE 1HIAB 2O8LA 3DT0H 3F3BA 1L4DA 1ZSJA 3F2GA 3KHVA 3TVJB 1SGEE 4FUCA 1GDUA 3RXLA 4TSFD 1EPTB 1NN6A 1BZXE 3LONA 5E0GA 1GJ9B 1P9SA 2NU2E 1ZMLA 3RXFA 2DE9A 2VVUA 5LPFA 1N6YA 4OS2A 1CBWB 2GZ8A 1ID5H 5F8XA 3SU2A 1YPGH 2EY4C 2GV6A 3VGCC 3ZZ7A 3UPEA 3KIDU 3H5CB 3C27B 4XE4A 5EIYA 2BD7A 1RJXB 1GI9B 2W7UA 1SGYE 2ZGCA 1ZHMA 3FP7E 5FHTA 1EJNA 1NZQH 3GY8A 4X1SU 1BMAA 3QGNB 2F9UA 1ZSKA 1OWHA 1EX3A 1J14A 1UTJA 1GHAF 1O2KA 4ABHA 2Z9KA 1J8AA 1KXEA 1QJ1B 1L0ZA 3KNXA 3FP8E 4O3UA 3E1XB 1QIXB 1UVSH 3KGPA 2STAE 1SOTA 1YBWA 2ZCKP 1YKTA 5CE1A 4KTSA 1GBLA 3M7QA 3ZZBA 5FBEA 4I32A 5G4BA 5C5OA 3TJOA 1DDJA 3A86A 3BN9A 5F6MA 4OS7A 2AGIX 4NCYA 1BHXF 1H9IE 2ZP0H 4ISLA 3TJUA 4MDSA 1O34A 2TGTA 1UHBB 2AHME 1GBAA 1BRUP 5GNDA 5T1VA 4XBBA 1CA0C 1TA2A 4ABAA 1SGNE 1SLXB 3A82A 3RXSA 3MWIU 4IMZA 4B6EA 2XWBI 2OBQA 1ELDE 2GDEH 1O36A 5C1YA 3RLYH 1W13U 1D6WA 1GBIA 1T31A 1UTKA 1C9TA 4P02A 4K8YA 4ABFA 1V2ST 1ZSLA 4WMDA 1T8OA 2ZNKH 2GMTB 1GHYH 1THRH 4BTUB 3UWJH 3P8OA 1C5XB 3RMLH 1UW7A 3E90B 4B76A 1P2MA 1PQ8A 1CSOE 3NCLA 3FFGA 5A0AE 1HXFH 3A7XA 3MU1A 6CHAB 3MU4A 1VITF 2OD3B 3R0FA 3L3TA 2FS8A 4K8BA 1O5CB 2C4FH 3MO6A 2B5TB 1TBRH 1MKWK 1FNIA 3GCHC 4CRCA 3ESTA 4Z6AH 1IHSH 1HAZB 1W7XH 1TLDA 4BAHB 4TT3D 1GJAB 1GG6C 1PPGE 1BIOA 4FU9A 5DP9A 2CF8H 1SHYA 3LGUA 1ETRH 1RFNA 3ZVCA 2GCTC 1PYTC 2F9BH 1QZ8A 3T2NA 1GCDA 1QA7A 2ZDVH 1V2WT 4AORA 1TGCA 5DKMA 1KLJH 3VB4A 4MTBA 3RXDA 2K8IA 3URCA 1O2QA 1A0HB 3KN2A 1S6LA 1MMJN 2WINI 1NM6A 5EQSA 2ESTE 4ASHA 1VCWA 4AX9H 3T28A 2B0FA 4ZMAH 4TWWA 1W0YH 5FCKA 2LPRA 2V3HH 4FUHA 4JZFH 4WH8A 7GCHF 3AW1A 5EXMA 2SFAA 1C5PA 1A5GH 2NU1E 1Z7KA 2KFWA 1SB1H 2G5VA 1F2SE 3SUEA 1G3CA 3TGIE 1HGTH 2PLXA 1ESBA 4Q7ZA 4I31A 3N7OA 2J95A 3BIUH 3TITA 4GVUA 3UAIC 2R3UA 2F43B 1FDPA 4Y11E 5PTPA 2L74A 1MTUA 2ALPA 2FMJA 1CHOG 4ZKNU 3EDXB 3WW7A 2ZHWH 4AB9A 4NFFA 3PV5A 2QY0B 1QBVH 1C2IA 3TH3H 2R9PA 1NBMD 1FONA 4RKOB 1HYLA 5FPSA 2NU0E 2ZHFH 5C0TA 3H7TA 1AMHA 2G81E 1SG8B 1DS2E 1K1PA 3O8BA 1SOZA 1ABIH 4DG4A 2J9NA 1WV7H 4DVAU 2A7JA 5L30H 1K21H 1O2MA 2ZHEH 1AE5A 3KF2A 4D7GA 2FYQA 3QDZB 4RSPA 4CRFA 5DP7A 1BCUH 2EI7A 7ESTE 2VGCB 1O31A 1VCQA 3M7UA 3W94A 1MZAA 1C5ZB 3HPTB 3MHWU 3PLKA 1EB2A 3TLOA 5B6OA 1L1JA 3QN7A 1QRZA 5FL7D 1D6RA 3RXIA 2VWMA 2QF4A 2P94A 2PKSB 1FXYA 4CR9A 4X6MA 1C5TA 4XFQA 4CRDA 3WY8A 5EQRA 1TRMA 4UDWH 4WH6A 3RXCA 1T8NA 5FCRA 1WBGB 1W2KH 2Y5GA 3LU9B 2IPQX 4JK6A 2ZECA 4AOQA 1GMHG 2OC7A 1T8MA 3D62A 1O32A 2WV5A 1SLVB 1D3DB 2XBYA 3OAAD 4B73A 1GI7B 1QL7A 2UWOA 2YMSD 3LGIA 4AYYB 3URDA 8GCHF 1FY4A 1WSSH 1FPHH 1INCA 4XBDA 4A92A 1VCPA 1ZTLA 2BVRH 3ZVEA 1MQ5A 4ABBA 1ZGIA 1MU8B 1AFQB 1ORFA 3GCTG 1YCPK 3LGWA 4ZUHA 4ZKOU 1TMBH 1P11E 1FZZA 2FOEA 2HLDD 1CT4E 2ZGXH 3NPSA 2D8WA 1DLKB 3BG4B 4KELA 4WXIA 3M5MA 3A7TA 1NU7B 3M3VA 3VFEA 1LVYA 3M37A 2FTLE 1C1OA 5HKKD 3T26A 4O3TA 4KP0A 3PV4A 4NIVA 4MG3A 1FAKH 1O3GA 5TJXA 1F0UA 5HMAA 4Y79A 1OWJA 3LT3A 2SGAA 4KKDA 2OQUA 4IC5A 3RC4A 1DPOA 1WCZA 1RTKA 2PGQB 2BDBA 4HGCA 4NFEA 1BTHH 2SGFE 1QTFA 3DSPA 1OXGA 1G3DA 2P3UB 4HI3A 3WWBA 3E16B 3FZDA 5JYIA 1HAOH 1O2UA 2ZCHP 1JXPA 2UUFB 1XUGA 1P0SH 2FEQH 3UFAA 2QXJA 6GCHF 1O2ZA 1TPSA 2BLVA 4IS5A 4TWYA 2BVXH 1J17T 1FAXA 1QCPA 3UQOA 1K1OA 2Q1JA 3ZZ3A 3OE7D 4O97A 3MO3A 3TH4H 5K0HA 4XBCA 1BQYA 1EAUA 3ZZ5A 3LGVA 5EQQA 9ESTA 3I77A 1GI5A 1XKAC 2ZGBH 1N8OC 4MNYA 3BTHE 1J16A 1JIRA 1XKBC 4ESTE 1T4VH 1BITA 4JK5A 1BTPA 2Y7XA 5GJ4B 1LKAA 3QX5H 3P6ZB 1F5LA 2H1UA 2QIQA 5J4SA 1ESAA 5A8XA 3GCNA 2BD3A 3ZZ4A 5KEDA 1UVPA 2KZ4A 3AK5A 4A1XA 2FLRH 1GJ6A 1ZJDA 2FZZA 2V3OH 4OS1A 3VEQB 1THSH 1S81A 2XOKD 1BMNH 4Q4LA 2SGQE 1C1SA 2FS9A 1YPLH 4MPUA 2BDIA 2BQWB 4OM9A 4I7YH 3UY9A 3B9FH 1DXWA 4SGAE 2OTVA 2JETB 1MAXA 1GJ4H 2BLOA 1KLTA 4Y0ZE 5AVDA 2VH6A 1C5VA 2VWOA 3MMGA 1MBQA 5EJ1A 3EA9A 3AVZA 1LMWB 2AGGX 1V2UT 1F0TA 3FZZA 3SHCH 3SV9A 1WOFA 2BLQA 3T5FH 3GOVB 4MPVA 3KL6A 2BD4A 1NU9A 3RXBA 3A84A 5EJLA 1NFXA 3MU8A 1ZR0A 1YC0A 2V6NA 1S0QA 3E91A 5EXLA 1Z1IA 3MNXA 1KXBA 1EXFA 5T3HA 1GGDC 1ELTA 3S9CA 1DXPA 2BDAA 4WY3A 4GHQA 1QBOA 2ZDMA 1C5LH 1TBZH 1V6DA 4AN7A 3TGKE 3UR6A 4F55A 2F9VA 1YM0A 5DSFA 1O37A 3TJVA 1BTWA 4MQAA 1Y3WA 3U98H 5LPEA 3KQEA 5KGOA 1GI4A 1O38A 3BTKE 1KDQA 1TA6A 3H09A 1VZQH 2EQNA 1BA8B 1C5NH 4R8TB 4Y8YA 4NWLA 1BTUA 1HB0B 5JBCS 6LPRA 3SO3A 1GMDG 2J4IA 3SQEE 5JBAS 5C5NA 1OOKB 2F9PA 1OWKA 2G55A 3F2HA 3EQ0H 1E1QD 4FOUC 2VVVA 3PTBA 4X2YA 4A1TA 1QJ7B 4ABGA 1RIWB 1SI5H 4FETA 1DUAA 3T29A 3WWFA 1PPCE 1CGIE 1UMAH 1C1PA 1LPGB 2BY7X 1DWBH 3S0NA 4ACAA 1O3EA 1TRNA 3T62A 1BMMH 2FM2A 3PMBB 4CR5A 4GSOA 5JB9S 2XYAA 1FIWA 1BT7A 1G9IE 1DY9A 2G00A 3RXKA 1DM4B 3ATKA 1A4WH 4YLQH 5J4QA 1K1LA 1XX9A 2R0LA 2SGPE 1YF4A 2ALVA 1DLEA 2ULLA 1LVBA 2ZU4A 3PB1E 2BD8A 3MO9A 1A7SA 4GAWA 3TGJE 1ZHPA 4Y8ZA 2OUAA 2I6QA 3SUGA 1SQRA 4IN1A 3V13A 1QQ4A 2BQ6B 1YYY1 1UTPA 1GBJA 1K28D 2BD9A 2PTNA 3MOCA 4MPWA 3UUZA 1PYTD 1O5EH 1CBWC 2VIDA 2BDYA 4FU7A 1P2IA 2ZPQA 1TFXA 2OCVB 1TGSZ 1KLIH 1VJAU 1MTVA 1NRRH 4NSYA 3SU3A 2ZG0H 2WHXA 1LPKB 4CBNA 3SBKA 2P95A 4X2XA 1UTLM 3TPIZ 4D76A 3FOAA 2SNVA 4AFZA 3UTUH 3W1EA 3SNAA 1MKXK 2OXSA 1EZSC 3RM0H 2OLGA 4ZHLU 4IN2A 1X7AC 4I8HA 2ZO3H 2BXTH 3U8RH 1YPKH 1PPZA 2LP6A 3GY3A 4YOIA 2V3MA 2EA3A 1V2QT 1C5MD 2CHAC 1A0LA 1CU1A 1XVOA 1LHCH 2A31A 3BF6H 3SJ8A 1TNHA 2KR7A 1C5UA 2G4UA 2KCAA 3VB7A 4Y7BA 2FOBA 2J34A 2OBOA 1XUIA 1EP6A 1SMFE 1P57B 1U6QA 1G2MA 3O8DA 3ZV8A 1WXRA 2PUXB 1C4V2 1SGPE 2AS9A 3UIRA 4K5ZA 5C1UA 3RUOA 1Y5UT 2BXUH 3AW0A 4ISNA 1GBHA 1G3BA 3FO8D 2K1QA 4CHAB 2W3IA 1NC6A 3D49H 2WYGA 4MLFB 1JRTA 2CF9H 1LCYA 3PMHB 3TK5A 1QJ6B 2BMGB 3E0PB 1H4WA 2C8ZB 3RMNH 2GTBA 1QY6A 2GMTC 3DFJA 1AUJA 5C17A 2YOLA 2GP9B 1HXEH 2FDAA 1SQOA 1BTXA 1OPHB 3DA9B 4LZ1H 4NIXA 3KCGH 4OS6A 1YPHE 6CHAC 1C5SA 1GHZA 2FI3E 3UB0A 1ZPZA 4JMYA 4B2BA 2VWNA 3P92A 2YMSB 4ZH8A 3KYFA 4Q7YA 2Z9IA 2STBE 1P12E 1GJBB 2PUQH 4AC9A 1C5WB 1CHOF 3RC6A 1EUFA 3UWIA 3MQKC 1NFUA 3A7VA 1GDQA 3SNEA 4YO9A 3F9HA 4BAMB 1YCPM 4X8SH 3QLPH 2HALA 1D9IA 1ESTA 3ATIA 3RU4D 4CRAA 3QZQA 2M5TA 2V0BA 3P8NA 4BANB 2BY5X 2J97A 5TCAA 2PFEA 5JB8S 1VGCB 2G52A 1DT2A 2XXLA 2OC8A 2ZFPH 2FX6A 1SGDE 1ZGVA 2BTCE 1CE5A 2OINA 1TOMH 5GCHG 1QR3E 1NY22 2ZHDA 1C2GA 5HM2A 1ELBA 1GL1A 2ZTXA 3M5LA 3RXVA 3BTQE 4O03A 3GY5A 2ODPA 1SC8U 3Q3XA 2P16A 2PTCE 3TK9A 2A4GA 1WTHD 2Y7ZA 2RDLA 3C1KA 4THNH 6ESTA 2PSYA 3M3SA 3S69A 3DD2H 1JBUH 2H5CA 1G3EA 1DOJA 2F4LA 3DUXH 2J94A 1DWCH 3T25A 3A81A 3U1JB 2P8OC 2BVSH 5DK1A 1F0SA 2XNDD 2WPHS 1P02A 4JCNA 4NZQA 5BRRE 4TPIZ 1SLUB 1YPMH 1TBQH 3SNBA 1O3MA 3D65E 1PPFE 3BTTE 1H8ED 1ANCA 4MNXA 5IK2D 2A4OA 5A0BA 2VIQA 2PWXA 1AB9C 4D9RA 4BXWA 2AERH 2Q6GA 2J92A 4X2WA 4AZ2B 2QV1A 3BV9B 2FOHA 3E8LA 3K9XB 1F92A 2WSSD 1UVOA 3A85A 2K0QA 4NG9H 3LPRA 1K1NA 2EI8A 1Z8GA 1O30A 3UNRA 2JJ2D 1K1JA 1LDTT 3GDUA 1NO9H 1C2EA 2GKVE 4Y6DA 4YXWD 3SNDA 3MI4A 1S0RA 4HG6A 2ODQA 1W12U 2ZU2A 5ETXA 3SJKA 3UQVA 1O3LA 1HAVA 1VR1H 4ZROA 3ZVBA 5JDUB 4D8NA 1O5BB 1S5SA 2D26C 1C2JA 5JBTA 5C20A 5L6NH 3EA7A 4YESB 1A2CH 1C1NA 1SQTA 2HWLB 1C5OH 3F6UH 2KX4A 1O3JA 1HAXB 3HGNA 3UOPA 5EW1H 1AZ8A 1S83A 1TNIA 2A45B 2Y5HA 2ZPSA 1AFQC 5F53A 1O3PB 2VH0A 2XBWA 4B74A 1DSUA 3PM3A 3OSYA 1FUJA 1O3FA 5TCCA 1ANDA 1A3BH 1DFPA 4YOGA 1UCYH 4GCHF 2NU3E 1IHTH 1DX5M 2KAIA 1BBRK 3BG4C 4MVNA 5DP4A 3E0NB 1E35B 1QRWA 2IN2A 1P9UA 1AZZA 3A89A 2FTMA 2PGBB 1GI2A 1KXAA 1FPCH 2LELA 2AEIH 4IBLH 1HAIH 1O5DH 1P03A 3ZYEA 1RTFB 1Q3XA 1W10U 3EE0B 2A2XH 1FY3A 1GMCF 1UTMA 2OC1A 2DE8A 4X6PA 1IQLA 4NA7A 2FOCA 4WVPE 2FIRH 1UVUH 4NA9H 3V3MA 3CS7A 2ASUB 5JPMH 1QB9A 5B6LA 1Z8RA 1NPMA 3HKIB 1LHGH 1V2VT 1GHVH 1G2LA 1P3CA 2TGDA 3PV2A 2HOBA 1B5GH 1MABB 4LOYH 1GBCA 1YLNA 4CH2B 3Q76A 3A7WA 1AIXH 3A8DA 3K6ZA 1GVZA 1MCVA 2ANYA 1NFYA 3VXEH 4KTUA 1P04A 1TE0A 3LC3A 4DURA 3RXQA 4X8VH 4ABDA 5CHBA 4UFGH 4Y8XA 2FYRA 2G4TA 4SGBE 2G51A 1D4PB 5EODA 1OWEA 1GHAG 3PLPA 1GL0E 1UTOA 2BY8X 4YT6H 3RC5A 2WPLS 1L1GA 3VB5A 1O33A 1F5KU 3GCHB 1YGCH 5KECA 2J98A 2GVFA 2W3KA 1UK2A 4Y7AA 1AI8H 1JWTA 3ODDA 4JYVH 1GG6B 1GJ5H 4R0IA 3VB3A 5FBIA 4JZEH 1E37B 1FY5A 1ZLRA 1ZMJA 5FX6A 1IQHA 1KDQB 1O3CA 4NA8A 2HPQH 1GHBF 1BDAA 1GBKA 4UEHH 4FUBA 4CBOA 1V2RT 4ABIA 4AG2A 5IDKA 3CP7A 3MH7A 3PO1C 3STJA 2A5IA 3BSQA 3ZV9A 2B9LA 1A61H 2Y5FA 4Q80A 4AGJA 2Z6BD 4BTTB 1AE8H 1IQKA 3LC5A 1AHTH 1GMDF 2C93B 2J38A 3L6PA 5EG4A 4AYVB 3AAUA 4ABEA 3GY7A 1V2NT 1O2OA 1SGQE 2XWAA 2QC2A 1H8HD 3OTJE 2EC9H 1AFEH 1ANEA 3L33A 3D23A 1EASA 1HJ9A 1J9CH 1NTPA 1ZPCA 1NRNH 3BTME 3F0PA 1VITG 2PKAA 2BZ6H 2ZDKA 1O2TA 2BDCA 2FO9A 1MTNC 3RXEA 4TY6A 1HNEE 4NZLA 3RXMA 5HYOA 1O3AA 1RS0A 2HRVA 3ZZ8A 2JJ1D 4K2YA 1V2PT 1KXCA 3RXPA 5E2OA 5F8ZA 3EGKH 4AG1A 1RRKA 2BOKA 3PMAB 4Y71A 3QTVH 3QUMP 1OHHD 1WDIA 4Z1MD 1SGFG 1H8DH 1SL3A 5DP6A 5I25A 4JZ1A 2TGAA 1A1RA 2FLBH 2W6ID 4X1QU 1BBRE 1ZJKA 1TGBA 1Y59T 4DGJA 5LGOA 1TNLA 4TYDA 3AASA 3TNTA 1KTTB 1W0KD 1YLCA 4DIIH 7GCHG 2RCEA 3KQ5A 4E05H 2Y80A 1GI6A 2KCOA 4I86A 4UFDH 1P8VC 1JIMA 5EW2H 1AVGH 1GPZA 1O3OA 4XDEA 3LJJA 3RDZA 1E0FD 1NRPH 3F0OA 4B75A 1S85A 2J2UA 2ZGJA 3M61U 2Z9LA 2CK3D 1HBTH 3RXGA 2WYJA 1KY9A 2UUYA 4FUJA 1Y5BT 1SGFA 1IQNA 5DG6A 4OS5A 4ZKRU 2Z3EA 3LOXA 2QXGA 1C1UH 5E2PA 2D1JA 2ZQ2A 1ZTJA 2ANMH 4K1TA 2QA9E 3UNSA 3U69H 2WZQA 1JMOH 3Q77A 1A5IA 3SU0A 1UTQA 4A7IB 2GX4A 1VKYA 3OU0A 3S7KB 2F3CE 1HAHH 2BDGA 1A46H 4Q7XA 2AFQB 4E06H 5H4IB 3BTDE 3SQHE 2GZ9A 1EB1H 4DW2U 1S6HA 1MZDA 4U30A 5CDFE 4BAQB 1OWDA 1AO5A 3RXOA 2ZFTA 1QFKH 2HVXA 1TQ7B 4XD7D 1YY3A 1GJDB 1T8LA 1HAGE 4ASUD 4WF8A 4PROA 2ZA5A 1OYQA 1HDTH 1UCYK 5A09A 1Z8IB 2YNBA 3QK1A 5EJZA 2GT7A 1SSXA 2XTTB 2QF0A 3TU7H 2HLCA 1TB6H 2ILNA 1LTOA 2BM2A 1P2JA 1IQFA 3H7OA 4DOQA 7KMEH 1WUNH 1O2NA 5DO4H 2ZZUH 1AGJA 1MTWA 2GT8A 5L2ZH 4F48B 3ITIA 4RT1A 1Y3XA 4X8TH 5EGMA 2BOHB 1UVTH 5DP8A 3HATH 1QL9A 2TPIZ 1LPZB 2AYWA 2OK5A 3ZZ9A 4WXVA 4X1RU 5C67A 1DY8A 2ANWA 3PYHA 1FJSA 4MNVA 1GCTC 3M7TA 2ZTYA 3M3TA 2VU8E 4X2VA 3K2UA 2HGTH 2L6OA 1N1LA 2ZKSA 4BAKB 3SV7A 3MTYA 1OP0A 1TGTA 2Z3DA 3NRLA 3RXAA 3TNSA 3RP2A 3N7EA 1OKXA 1B7XB 1LHEH 1O2XA 3IITA 4VGCB 4IC6A 4MPXA 1OYTH 1QGFA 2XC4A 5DPAA 3SU4A 3ATWA 3PRBA 3RXUA 1HPGA 1TAWA 1AU8A 1M9UA 5BPEA 1C2FA 1EPTC 3GY2A 2FPZA 3SUFA 4H6TA 1G30B 1GHXH 2I6SA 2ODYB 3GICB 3SJ9A 1XUJA 1ZPBA 2AMDA 2D2DA 4LZ4B 2FI4E 3OFND 3A83A 1O2HA 1PFXC 1GVKB 4YT7H 4ZXYH 2BY9X 1V2TT 2ZCLP 3B8JA 1GBEA 3OYPA 1MD7A 6GCHG 1O2IA 3R3GB 2ZWLH 1CHGA 1SVPA 1IQEA 2CV3A 3P17H 1QQUA 1ZYOA 2IJOB 2XNIA 3BIVH 1HJAB 1GJ7B 3SOSA 3RM2H 1WTGH 1SFQB 1CGHA 2AMPA 3BTGE 1PPHE 2GGVB 3RU4T 3BEIB 4RI0A 1AKSA 4ZHAA 3RXRA 4P00A 5E0JA 4DIHH 3E3TA 2Z7FE 1LQDB 3BTFE 1FI8A 4IW4E 5A8YA 1GGDB 3QTOH 3QZRA 3SGBE 3KQDA 2O8TA 5FPTA 1E1RD 1GI8B 2Y6TA 5AF9H 4YM9A 2J5UA 4WMFA 1EATA 1LKBA 1BRBE 3OTPA 2HVYB 1GI3A 2H9HA 2WPJS 3P8GA 1TALA 3RXHA 2ZPRA 1HAVB 2ANKH 3F2FA 1EAWA 1C1WH 1LHFH 2ZDAH 2H9EH 1QL8A 3RMMH 1BRCE 2ZQ1A 2R3YA 3TK6A 1ELCA 3P95A 2C3SA 3LJOA 4I8GA 1TMUH 2ZFSA 2UWPA 2JIZD 3FAOA 2BYAX 2TIOA 2GD4B 1YPEH 2R2WU 3SGQE 1BUIA 3N99A 2DUCA 1K0HA 4Z0KA 3SW2B 1TPAE 2TRMA 2PW8H 1P2OA 2Y81A 1H1BA 3A7YA 2IPHA 1OS8A 1TONA 4CH8B 2VNTA 3GY6A 1YPHC 1BTZA 2KAIB 2ZDLA 2OQ5A 1TRYA 3HK3B 1HAYB 3MH4A 4AGKA 4X1NU 1KXFA 4UONA 4A5TS 1XXFA 4FUFA 5DJ7A 3FP6E 1AWFH 2BX4A 3SJOA 2A2QH 1FLEE 4RN6A 1UCYE 4Q63A 5FX5A 4E7NA 5AFYH 4GUXA 1P01A 4NIWA 1EAXA 1WQSA 4U01A 4UFFH 4OS4A 1FMGA 1TMTH 2CMYA 5C3NA 2HNTC 3MYWA 1BJUA 4ZHMU 4K3JA 1HRTH 2A1DB 1Y3YA 1SLWB 5HGGA 1P06A 5HIYA 3ZIAD 2FXRA 2XCFA 2WPDD 2PP6A 4UD9H 1BJVA 1K1MA 2QXIA 3DCLA 5CHAB 3NXPA 1YP9A 1VJ9U 5LPRA 1P2QA 3UOUA 4O9VA 1YCPH 2HNTE 2WV9A 3MFJA 1JRSA 4INLA 2XC0A 3JZ2B 1BRAA 1D3TB 3IWMA 1K9OE 3QGJA 1JOUB 1HFDA 4CREA 1UK4A 2JDID 1DVAH 2ZU5A 2EEKA 2ZFRH 4CRBA 2G8TA 2VJ1A 3F1SB 3MNSA 2H2ZA 4RKJB 3SHAH 1GDNA 2ZFFH 4IGDA 3SI4H 4Y76A 2OC0A 1Z71A 5CMXH 2FESH 2VIVA 2V35A 4DT4A 5C2ZA 2SGEE 2C8XB 1NS3A 5HIZA 3ZZCA 4FVDA 2J98B 3OY6U 5GWZA 2ZHQH 3DSGA 2CHAB 2W5EA 1H9HE 1XUHA 2HNTF 3NKKA 2RFKC 1GMHF 1RGQA 3SU6A 1TNJA 4M9FA 1C9PA 4DT7B 3I78A 4DCDA 1GBTA 2TGPZ 1PPEE 4M7GA 1CA8B 2VVCA 1FV9A 4OGYA 3GCTF 1ZZZA 3PMJA 2VBCA 3SUDA 3PROA 1PQ7A 1FN6A 1ACBE 2Z3CA 3B23B 1NROH 1MU6B 4FUGA 4OGXA 1FY1A 3SN8A 5AFZH 1E34B 2GCHG 1ANBA 1F0RA 1C4Y2 2H9TH 1TABE 5DP5A 3SU5A 4K69A 3FANA 1A3EH 1SGIB 5L2YH 1N6XA 1S84A 1XUFA 1V2KT 2VGCC 4J1YA 1TQ0B 3F68H 3OEED 1XXDA 2PKAB 2JH5D 2O8WA 4NSVA 1EZUC 1LHDH 5JBBS 4U32A 1TOCB 1MCTA 2NWNA 5GPIB 1W8BH 1LVMA 2PKSC 4Y0YE 2W7SA 1BHXB 1QRXA 3ELAH 4B2AA 1S6FA 1UK3A 4BAOB 2LNCA 4E7RG 2ZTZA 4GHTA 1LO6A 1C1MA 1KTSB 1C2HA 5FAHA 1ARCA 1Z8JB 2A4QA 3U9AH 3S9BA 3VGCB 3TIUA 1E36B 1BOQA 2SGDE 1BTYA 1QA0A 1W3CA 3F9GA 4D7FA 2QN5T 3G01A 5DGJA 1TYNA 3M5NA 3GISB 4K1EA 1PPBH 1DWDH 1GVLA 1TNKA 2ZC9H 1B0EA 3NK8A 1KYNA 1TX6A 1C2DA 1DSTA 2SNWA 3SJIA 3ATLA 7LPRA 1DICA 4AB8A 1W11U 5EPNA 2Q6FA 2PR3A 2WPMS 4H4FA 1IQJA 2VWLA 1LQEA 1GI1A 4JZDH 2Q6DA 1FX0B 3GDSA 5T6FA 4NIYA 3ZZDA 1BMLA 4I8JA 4ZKSU 1O2LA 2QGRA 2XC5A 1DE7H 2AH4X 3BEUA 3MNBA 4RT0A 1KIGH 1CT0E 1HIAA 3GS9A 2KM0A 1K22H 1Z6JH 5T6GA 1O2PA 1UTNA 2A5AA 4LXBH 1EPTA 1GI0A 3BEFB 1PQAA 4K1SA 1CA0B 1EOJA 1PJPA 1IOEA 1IQGA 1TX8A 3Q3KA 3SZNA 3GCOA 5T6DA 1SPJA 1O0DH 2P8OB 3MH6A 3LDXH 1KSNA 4B6FA 1CQQA 3EA8A 4YZUA 2O8MA 2W26A 2CJIA 1RD3B 1P3EA 1AD8H 3VG8A 1NT1A 3DFLA 3VB6A 3HGPA 2QF3A 5EPYA 1ELFA 1AB9B 1A0JA 1H9LB 5E0HA 4F49A 1BMFD 1C4U2 2B8OH 1W0JD 2QF5A 4X0WU 5DN6D 4DJZB 1AN1E 3V0XA 1TPPA 3W95A 1C2MA 4JZIA 1THPB 5IYTA 1BB0B 8ESTE 1SGTA 4B2CA 3SI3H 1W0ZU 1SBWA 2THFB 4FUDA 1VITH 3SV2H 1OSSA 2XRCA 3NZIA 1DUEA 2GCTB 3T27A 2V7QD 2JH0D 5ESBA 1O3KA 1V2OT 2KCPA 3ZVGA 3FVFB
chains in the Genus database with same CATH topology
1ETSH 1QURH 4WJG2 3P8FA 1CT2E 1IQIA 2ZIQH 5GXPA 1O2JA 2FWWA 3RMOH 1AWHB 1FY8E 2F9NA 4IMQA 1C1QA 5SGAE 1E38B 2WPKS 2IOTA 1UHBA 1T4UH 1ZOMA 2JETC 1P05A 1TNGA 2RA0A 1FN8A 3GYMA 4FUIA 1C1TA 4FU8A 2P93A 4DY7B 3ENSB 1O5GH 1C5YB 1MKXH 1L1NA 1O5AB 4JYUH 2FOMB 3SV8A 1OP8A 1WU1A 3CENA 1EZXC 3A87A 4GLYA 3M35A 3SU1A 5K7RA 2R2MB 4X6NA 3LH1A 1O3DA 3RU4E 3SNCA 1G32B 4ISOA 1KXDA 3S9AA 1K2I1 1HJ8A 3M36A 1GBFA 2A4RA 1HCGA 1Z1JA 1O2YA 2OP9A 1ELVA 2BZAA 3BTEE 4JYTA 2CXVA 1TGNA 1G36A 5ESTE 1SHHB 3V7TA 1P10A 2B7DH 2FOAA 2PV9B 2UUJB 5EXNA 1Y8TA 2CN0H 1SQAA 2FOGA 5FXLA 8KME2 2AGEX 1O2RA 2VIPA 4GPGA 5ABWA 1T32A 1C1VH 2NU4E 1NESE 3A88A 3SGAE 4Y10E 1Y5AT 1OP2A 4I8LA 3S7HB 2EI6A 3GDVA 5FPYA 1D3PB 2BQ7B 3ZVDA 4J2YB 4TPYA 3HK6B 1YLDA 4H6SB 3LH3A 2AIQA 1C2KA 2P59A 2YNAA 5DP3A 2FODA 1GBBA 5EOKA 1AKSB 5F03A 1A5HA 1CO7E 4BNRA 3UR9A 2RA3A 1RIWC 1Q31A 3Q3YA 2Z9GA 2WUCA 4GCHG 1EZQA 2VIOA 1EJMA 1V2LT 2XW9A 3U8TH 1EQ9A 1XM1A 2XBXA 1GJ8B 1O2GH 3LIWA 3VXFH 2Z9JA 1RTLA 3TH2H 3UREA 4AFUA 3UNQA 1H8IH 1MTSA 2F83A 4VGCC 4KTCA 1GMCG 2FOFA 3EAJA 3JZ1B 3A8CA 1D3QB 3A80A 1C5QA 5AHGH 1MH0A 3GYLB 4ISIH 3MH5A 3PWCA 3PO1B 1HV7A 1ELGA 1TX7A 2BB4A 4BTIB 3U1IB 3V12A 1P09A 1O2VA 4CRGA 3Q00A 1G37A 2BDHA 1TPOA 4A6LA 5A8ZA 1O2WA 3PLBA 3A8BA 3LGTA 4YTAA 1ZTKA 1Y3VA 2A32A 1IAUA 2FP7B 5HXFA 2XCNA 4B1TA 1HJAC 1HAPH 1GHWH 3STIA 1QNJA 2GV7A 3OY5U 4YLUA 2C8YB 1IQMA 1AY6H 1SR5C 2ZEBA 3EYDA 4HZHA 5LH8A 2O8UA 3NUMA 2QYIA 1O3NA 4MNWA 4QT8C 3QWCH 1MTNB 3ZVFA 2ZFQH 5GIBA 2Y82A 1EAIA 4B71A 1V3XA 4A1VA 4INKA 3LKWA 1S82A 1L4ZA 1QB6A 3ZYDA 4I8KA 3DHKH 3KEEA 1AQ7A 1W14U 4ISHH 2H6MA 3RXTA 8GCHG 4K60A 4X1PU 2A7CA 3K65B 2F91A 1SFIA 1GHBG 2UWLA 1Z6EA 3NWUA 3F9EA 1NRSH 2UUKB 5EU8A 2QAAA 2QCYA 1AVXA 2R0KA 2TBSA 1ZRKA 2ZGHA 3LGYA 4H42U 3U8OH 3TJNA 4FUEA 1N8OB 4XOJA 4CHAC 1O3BA 2ZI2H 3E6PH 1V2JT 2C90B 3KQBA 2JH6D 1WQVH 3SORA 1CVWH 1TIOA 3HKJB 4ABJA 1O3HA 2VINA 1P2KA 1MKWH 1EOLA 3CS0A 1NRQH 1GJCB 4NGAH 9LPRA 2G5NA 1F7ZA 2HPPH 5F8TA 1DANH 2BX3A 1XVMA 1OWIA 1T7CA 5HM9A 2C8WB 4YOJA 2QXHA 5GCHF 4UFEH 2O9QA 3I29A 1K1IA 3ZZ6A 4AFSA 1UJ1A 1QBNA 4ZAEA 4I33A 1HUTH 1OX1A 5A2MH 3ODFA 2A5KA 5CHAC 2RG3A 1EKBB 4HTCH 2XBVA 1AVWA 1Q2WA 1ZHRA 2WPIS 2A7HA 4KGAA 2Z94A 3GY4A 1O3IA 1EP5A 4TY7A 3AAVA 2AMQA 1GBMA 5A0CA 1WAYB 1BBRH 1ELAA 2P3TB 2GCHF 2GDDA 4F4OC 1GBDA 3RXJA 2BD2A 2GZ7A 3QO6A 1Y3UA 1VGCC 2VB0A 1ELEE 1L2EA 3M5OA 3VPKA 2PHBA 4HFPB 3F9FA 1RXPA 1B0FA 1F5RA 3ATMA 4WMEA 1DWEH 2A0QB 1XMNB 4NWKA 1QB1A 1W7GH 1ZRBA 1SGRE 1V2MT 1ABJH 1MAYA 3A8AA 1C2LA 1MUEB 2CGAA 4WWYA 8LPRA 2ZF0H 4BXSA 3BG8A 1MQ6A 1EJAA 3OX7U 3P70B 2BD5A 2BHGA 1QHRB 2JKHA 4UE7H 1DITH 4D9QA 1UO6A 1YPJH 4X8UH 1XUKA 3A7ZA 3ZVAA 1TWXB 4INHA 4Q2KA 1ETTH 1J15A 1SGCA 2FX4A 3O8RA 2H5DA 1ARBA 3O8CA 5GDSH 1MD8A 1O35A 2VIWA 4LK4A 4AFQA 3SV6A 3KQCA 2F9OA 3BTWE 4ZXXH 2ZU1A 3PTNA 4U2WA 3IG6B 3MNCA 1FQ3A 2PSXA 3RLWH 1FIZA 4FXGH 3ZZAA 1AUTC 1PQ5A 4XSKU 2P3FH 4FVBA 2AIPA 2BY6X 1O5FH 2ZU3A 3PWBA 1HLTH 1GCTB 1ZMNA 2BLWA 5E8EH 5I46H 2ZDNA 4BOHA 2WUBA 1P2NA 3MU5A 1C5RA 1GWAA 2WV4A 4X6OA 1MBMA 1O39A 1LVOA 1NFWA 2FI5E 3MU0A 3K6YA 1C1RA 5C1XA 1WYKA 1O2SA 1CGJE 1HIAB 2O8LA 3DT0H 1L4DA 1ZSJA 3KHVA 3TVJB 1SGEE 4FUCA 1GDUA 3RXLA 1EPTB 1NN6A 1BZXE 3LONA 5E0GA 1GJ9B 1P9SA 2NU2E 1ZMLA 3RXFA 2DE9A 2VVUA 5LPFA 1N6YA 4OS2A 1CBWB 2GZ8A 1ID5H 5F8XA 3SU2A 1YPGH 2GV6A 3VGCC 3ZZ7A 3UPEA 3KIDU 3H5CB 3C27B 4XE4A 2BD7A 1RJXB 1GI9B 2W7UA 1SGYE 2ZGCA 1ZHMA 3FP7E 5FHTA 1EJNA 1NZQH 3GY8A 4X1SU 1BMAA 3QGNB 2F9UA 1ZSKA 1OWHA 1EX3A 1J14A 1UTJA 1GHAF 1O2KA 4ABHA 2Z9KA 1J8AA 1KXEA 1QJ1B 1L0ZA 3KNXA 3FP8E 4O3UA 3E1XB 1QIXB 1UVSH 3KGPA 2STAE 1SOTA 1YBWA 2ZCKP 1YKTA 5CE1A 4KTSA 1GBLA 3M7QA 3ZZBA 5FBEA 4I32A 5G4BA 5C5OA 3TJOA 1DDJA 3A86A 3BN9A 5F6MA 4OS7A 2AGIX 4NCYA 1BHXF 1H9IE 2ZP0H 4ISLA 3TJUA 4MDSA 1O34A 2TGTA 1UHBB 1GBAA 1BRUP 4XBBA 1CA0C 1TA2A 4ABAA 1SGNE 1SLXB 3A82A 3RXSA 3MWIU 4IMZA 2XWBI 2OBQA 1ELDE 2GDEH 1O36A 5C1YA 3RLYH 1W13U 1D6WA 1GBIA 1T31A 1UTKA 1C9TA 4K8YA 4ABFA 1V2ST 1ZSLA 4WMDA 1T8OA 2ZNKH 2GMTB 1GHYH 1THRH 4BTUB 3UWJH 3P8OA 1C5XB 3RMLH 3E90B 4B76A 1P2MA 1PQ8A 1CSOE 3NCLA 3FFGA 5A0AE 1HXFH 3A7XA 3MU1A 6CHAB 3MU4A 1VITF 2OD3B 3R0FA 3L3TA 2FS8A 4K8BA 1O5CB 2C4FH 3MO6A 2B5TB 1TBRH 1MKWK 1FNIA 3GCHC 4CRCA 3ESTA 4Z6AH 1IHSH 1HAZB 1W7XH 1TLDA 4BAHB 1GJAB 1GG6C 1PPGE 1BIOA 4FU9A 5DP9A 2CF8H 1SHYA 3LGUA 1ETRH 1RFNA 3ZVCA 2GCTC 1PYTC 2F9BH 3T2NA 1GCDA 1QA7A 2ZDVH 1V2WT 4AORA 1TGCA 5DKMA 1KLJH 3VB4A 4MTBA 3RXDA 3URCA 1O2QA 1A0HB 3KN2A 1MMJN 2WINI 1NM6A 5EQSA 2ESTE 4ASHA 1VCWA 4AX9H 3T28A 2B0FA 4ZMAH 4TWWA 1W0YH 5FCKA 2LPRA 2V3HH 4FUHA 4JZFH 4WH8A 7GCHF 3AW1A 5EXMA 2SFAA 1C5PA 1A5GH 2NU1E 1Z7KA 1SB1H 2G5VA 1F2SE 3SUEA 1G3CA 3TGIE 1HGTH 2PLXA 1ESBA 4Q7ZA 4I31A 3N7OA 2J95A 3BIUH 3TITA 4GVUA 2R3UA 1FDPA 4Y11E 5PTPA 1MTUA 2ALPA 2FMJA 1CHOG 4ZKNU 3EDXB 2ZHWH 4AB9A 4NFFA 2QY0B 1QBVH 1C2IA 3TH3H 2R9PA 1FONA 4RKOB 1HYLA 5FPSA 2NU0E 2ZHFH 3H7TA 1AMHA 2G81E 1SG8B 1DS2E 1K1PA 3O8BA 1SOZA 1ABIH 4DG4A 2J9NA 1WV7H 4DVAU 2A7JA 5L30H 1K21H 1O2MA 2ZHEH 1AE5A 3KF2A 4D7GA 2FYQA 3QDZB 4RSPA 4CRFA 5DP7A 1BCUH 2EI7A 7ESTE 2VGCB 1O31A 1VCQA 3M7UA 3W94A 1MZAA 1C5ZB 3HPTB 3MHWU 3PLKA 1EB2A 3TLOA 5B6OA 1L1JA 3QN7A 1QRZA 1D6RA 3RXIA 2VWMA 2P94A 2PKSB 1FXYA 4CR9A 4X6MA 1C5TA 4XFQA 4CRDA 3WY8A 5EQRA 1TRMA 4UDWH 4WH6A 3RXCA 1T8NA 5FCRA 1WBGB 1W2KH 2Y5GA 3LU9B 4JK6A 4AOQA 2ZECA 1GMHG 2OC7A 1T8MA 3D62A 1O32A 2WV5A 1SLVB 1D3DB 2XBYA 4B73A 1GI7B 1QL7A 2UWOA 4AYYB 3LGIA 3URDA 8GCHF 1FY4A 1WSSH 1FPHH 1INCA 4XBDA 4A92A 1VCPA 1ZTLA 2BVRH 3ZVEA 1MQ5A 4ABBA 1ZGIA 1MU8B 1AFQB 1ORFA 3GCTG 1YCPK 3LGWA 4ZUHA 4ZKOU 1TMBH 1P11E 1FZZA 2FOEA 1CT4E 2ZGXH 3NPSA 2D8WA 1DLKB 3BG4B 4KELA 4WXIA 3M5MA 3A7TA 1NU7B 3M3VA 3VFEA 1LVYA 3M37A 2FTLE 1C1OA 3T26A 4O3TA 4KP0A 3PV4A 4NIVA 4MG3A 1FAKH 1O3GA 5TJXA 1F0UA 5HMAA 4Y79A 1OWJA 3LT3A 2SGAA 4KKDA 2OQUA 4IC5A 3RC4A 1DPOA 1WCZA 1RTKA 2PGQB 2BDBA 4HGCA 4NFEA 1BTHH 2SGFE 1QTFA 1OXGA 1G3DA 2P3UB 4HI3A 3E16B 3FZDA 5JYIA 1HAOH 1O2UA 2ZCHP 1JXPA 2UUFB 1XUGA 1P0SH 2FEQH 3UFAA 2QXJA 6GCHF 1O2ZA 1TPSA 2BLVA 4IS5A 4TWYA 2BVXH 1J17T 1FAXA 1QCPA 3UQOA 1K1OA 2Q1JA 3ZZ3A 4O97A 3MO3A 3TH4H 5K0HA 4XBCA 1BQYA 1EAUA 3ZZ5A 3LGVA 5EQQA 9ESTA 3I77A 1GI5A 1XKAC 2ZGBH 1N8OC 4MNYA 3BTHE 1J16A 1JIRA 1XKBC 4ESTE 1T4VH 1BITA 4JK5A 1BTPA 2Y7XA 5GJ4B 1LKAA 3QX5H 3P6ZB 1F5LA 2H1UA 2QIQA 5J4SA 1ESAA 5A8XA 3GCNA 2BD3A 3ZZ4A 1UVPA 4A1XA 2FLRH 1GJ6A 1ZJDA 2FZZA 2V3OH 4OS1A 3VEQB 1THSH 1S81A 1BMNH 2SGQE 1C1SA 2FS9A 1YPLH 4MPUA 2BDIA 2BQWB 4I7YH 3UY9A 3B9FH 1DXWA 4SGAE 2OTVA 2JETB 1MAXA 1GJ4H 2BLOA 1KLTA 4Y0ZE 5AVDA 2VH6A 1C5VA 2VWOA 3MMGA 1MBQA 3EA9A 3AVZA 1LMWB 2AGGX 1V2UT 1F0TA 3FZZA 3SHCH 3SV9A 1WOFA 2BLQA 3T5FH 3GOVB 4MPVA 3KL6A 2BD4A 1NU9A 3RXBA 3A84A 1NFXA 3MU8A 1ZR0A 1YC0A 2V6NA 1S0QA 3E91A 5EXLA 1Z1IA 3MNXA 1KXBA 1EXFA 5T3HA 1GGDC 1ELTA 3S9CA 1DXPA 2BDAA 4WY3A 4GHQA 1QBOA 2ZDMA 1C5LH 1TBZH 1V6DA 4AN7A 3TGKE 3UR6A 2F9VA 1YM0A 1O37A 3TJVA 1BTWA 4MQAA 1Y3WA 3U98H 5LPEA 3KQEA 1GI4A 1O38A 3BTKE 1KDQA 1TA6A 1VZQH 1BA8B 1C5NH 4R8TB 4Y8YA 4NWLA 1BTUA 1HB0B 5JBCS 6LPRA 3SO3A 1GMDG 2J4IA 3SQEE 5JBAS 5C5NA 1OOKB 2F9PA 1OWKA 2G55A 3EQ0H 2VVVA 3PTBA 4X2YA 4A1TA 1QJ7B 4ABGA 1RIWB 1SI5H 1DUAA 3T29A 1PPCE 1CGIE 1UMAH 1C1PA 1LPGB 2BY7X 1DWBH 3S0NA 1O3EA 1TRNA 3T62A 1BMMH 2FM2A 3PMBB 4CR5A 4GSOA 5JB9S 2XYAA 1FIWA 1BT7A 1G9IE 1DY9A 2G00A 3RXKA 1DM4B 3ATKA 1A4WH 4YLQH 5J4QA 1K1LA 1XX9A 2R0LA 2SGPE 1YF4A 2ALVA 1DLEA 2ULLA 1LVBA 2ZU4A 3PB1E 2BD8A 3MO9A 1A7SA 4GAWA 3TGJE 1ZHPA 4Y8ZA 2OUAA 2I6QA 3SUGA 4IN1A 3V13A 1QQ4A 2BQ6B 1YYY1 1UTPA 1GBJA 1K28D 2BD9A 2PTNA 3MOCA 4MPWA 3UUZA 1PYTD 1O5EH 1CBWC 2VIDA 2BDYA 4FU7A 1P2IA 2ZPQA 1TFXA 2OCVB 1TGSZ 1KLIH 1VJAU 1MTVA 1NRRH 4NSYA 3SU3A 2ZG0H 1LPKB 4CBNA 3SBKA 2P95A 4X2XA 1UTLM 3TPIZ 4D76A 2SNVA 4AFZA 3UTUH 3SNAA 1MKXK 2OXSA 1EZSC 3RM0H 2OLGA 4ZHLU 4IN2A 1X7AC 4I8HA 2ZO3H 2BXTH 3U8RH 1YPKH 1PPZA 3GY3A 4YOIA 2EA3A 1V2QT 1C5MD 2CHAC 1A0LA 1CU1A 1XVOA