3QNWB

Caspase-6 in complex with z-vad-fmk inhibitor
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
93
structure length
93
Chain Sequence
LPAGADFLMCYSVAEGYYSHRETVNGSWYIQDLCEMLGKYGSSLEFTELLTLVNRKVSQRRVDFCKDPSAIGKKQVPCFASMLTKKLHFFPKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Caspase-6
publication title Structure of human caspase-6 in complex with Z-VAD-FMK: New peptide binding mode observed for the non-canonical caspase conformation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 19
structure length 93
sequence length 93
chains with identical sequence D, F, H
ec nomenclature ec 3.4.22.59: Caspase-6.
pdb deposition date 2011-02-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 3qnwB00
1GFWB 2CJYB 1RWOB 2QL7B 2QL9B 3GJRB 2HBZB 1RE1B 2H54B 1SC1B 2C2MB 3GJQB 2Y0BB 4ZVPB 2Y1LB 2FQQB 2XZTB 3KJNB 1PAUB 1RWPB 3D6FB 2H48B 3NS7B 4JB8B 1RHKB 1ICEB 4DCJB 3EDRB 2CNNB 3D6HB 1RWVB 1RHRB 2C2KB 2C1EB 1I51B 3IBFB 3EDQB 1QTNB 3RJMB 1RHJB 3KJQB 3QNWB 3KJFB 3GJSB 3P4UB 2C2ZB 2H4YB 2CNLB 2XYHB 2H5JB 3R6LB 3SIPB 2QLBB 2QL5B 2CNKB 1SC3B 3R5JB 2XYGB 2QLFB 3R6GB 2H65B 5IC4B 5K20B 4ZVTB 1I3OB 2C2OB 2HBYB 2XYPB 2QLJB 3GJTB 4LSZB 4ZVSB 4ZVOB 1RHUB 3IBCB 1RWWB 3D6MB 2H5IB 5IC6B 1IBCB 3R7BB 4ZVRB 1SC4B 1F9EB 1NMEB 2DKOB 3R7NB 2HBRB 4DCOB 2CDRB 4ZVUB 1RWNB 3P45B 2CNOB 1RWMB 2HBQB 2XZDB 1PYOB 1RHQB 1RWXB 2H51B 4ZVQB 3R7SB 1RHMB 1QDUB 2CJXB 1RWKB 2P2CB 2H4WB 4DCPB 1BMQB
chains in the Genus database with same CATH superfamily
2R3VA 2MQLA 4YR3A 3LWMA 4M5DA 3DGPA 2HGMA 3U1MA 2B5JB 1S48A 3AQOA 2VG5A 2Y0SD 2KT3A 3GTYX 2B0GA 4F0KA 3I96A 2FTRA 3ILJA 4E98A 4CO2A 2BYCA 1X31C 4MJKA 2FHJA 3DLGA 3NP5A 2RS2A 1ZAXA 4FYWB 4GVBB 4NCGA 2F63A 4P2SA 1X4AA 2C2OB 4K4UA 3WDOA 2XI3A 4OL8A 1AA1B 3S01A 4C8YA 5K14A 3PDNA 1IJFB 2WSEC 4RW7A 1HFEL 3PW0A 4WJBA 4XDCA 1XNQF 3FQKA 2E9ZA 1NK5A 5KFQA 1FCAA 4O4GA 2UUBJ 2M8DB 4CNYA 1IN0A 4HACB 2V63A 3RAQA 3GYNA 4AD6A 2HVEA 1IQTA 2P2CB 3GMGA 5KT5A 2LQ8A 1Q81T 1NPPA 2HFUA 2DHSA 1ROFA 1DLOA 3VAMA 1FRJA 1RT6B 3R27A 1AZSA 1AFIA 3WIUA 4HYKA 2ZBRA 2RD5C 1Q5VA 3WX4A 1EAYC 3KMSA 1Y0HA 2M70A 3CXCR 4RW4A 2QA4G 2VFUA 1SJ1A 3N5FA 3PKYA 2CNKB 2KT2A 2QSFA 3R5JB 4ED1A 4RWWA 4OQJA 2MPUA 3SFGA 3M6VA 4IRKA 1CJTB 4L73A 1Q8IA 4WIIA 2AT1B 2FDNA 1BWVA 3KLGA 4ZDNA 4L76A 1WKLA 1XIQA 2DNGA 3BH6B 2HPUA 2V94A 4C48A 2VBZA 2F9DA 2YBVA 4YDDB 4URSA 2BJ3A 2FGOA 4GKKF 1JXEA 1SQFA 2B4UA 3CD0A 3VAIA 5DM7Q 4HTJA 2DPJA 3UN3A 2YQ3A 1RT7B 1JLQB 5FDLA 2HQGA 1OJ4A 2HGNA 3OD2A 4O4RA 2H1YA 2FJAB 2R2TA 5DGBA 1CQNA 5GADI 3TJAA 5KFGA 3FFIA 3PYEA 2VH7A 3AQPA 2I0XA 3JSMA 3KG0A 1N5SA 4PABA 4A46A 5GMEA 3IR5B 4YR2A 2FVSA 5ETTA 3MMBA 1I51B 5L8RC 2V67A 3TAPA 1HNWF 3MTJA 3BB5A 2IIHA 3RBEA 5E3PA 1S6PA 2LXFA 3T19A 3UR3C 1YJWS 4DV4F 4PXBA 3OFGA 2E9TA 1C0TB 2JC1A 2LCWA 3MI7X 4ZIWA 2AYBA 4QCLA 2EPIA 3PW5A 2MLXA 5D0EA 3BR9A 4Q5VA 5F3ZA 2CVEA 3MWBA 2CZVC 2PC6A 3WZ0A 2CDQA 1JLGA 3GYXB 2Y3YA 4FVCA 3CMAS 7FDRA 3PJ9A 3LF0A 2VOPA 2Q3PA 1RAGB 5L39A 3GFYA 2VQEF 3H40A 1XK8A 4HTIA 2PMWA 3R5BA 3M32A 3BGRB 2QFIA 5L1JA 2NXNA 4DL0C 4LQ3A 2GIFA 3F44A 1GFWB 1WKKA 1Y4ZB 1KP6A 1QD1A 2CQ2A 2B9YA 4P2MA 4V19X 1SVDA 1S7IA 4X65F 1D9AA 2DY9A 1SQGA 4PQUB 1RWPB 4Q8EA 2KYZA 3R2DJ 4KGXB 1U1LA 3MUTP 1RK8A 5ETLA 4FBTA 2LMIA 2PA3A 2OD6A 2XYHB 3HHLC 4K2JA 3PY8A 3HD2A 2J9DE 4PR6A 1BQMB 1TFYA 3NCQA 4EO6A 3A1YG 2FC9A 4CO5A 3H20A 3ISZA 2UU9F 1BUXA 4ENOA 4AT1B 5KG4A 1RWWB 4DL6A 4DUTA 1YRUA 2IRXA 3R7BB 3M1VB 1EKSA 4BC7A 1Y9OA 3W3SA 3E3XA 1S76D 4CP5A 3OTBA 3VVUA 2YH0A 1T8EA 5E0OA 4OI0A 4B9MA 1RABB 4KV8A 3LPEA 2OTLS 1KTQA 3UFCX 5DDRC 4OHWA 2ZE2A 3IBWA 4C2MA 1FEEA 1S1VB 3MM9B 2HHHF 2OPRA 2XSFA 3FEYB 2BOPA 1NHUA 4LUBA 1J27A 1Z2ZA 4WBFA 1F6TA 2QN6B 2LYVA 2BM0A 2HS3A 4RWXA 3LWLA 4B17A 4WTYA 1ZOTA 2JX2A 2CKWA 1EETB 2N7CA 3FQLA 5HP1B 2AJQA 3QATA 1L3SA 2M52A 2P5VA 4Y28C 1HNIA 2ILYA 1X0PA 1W2BR 3NBPB 2W7OA 5GAEU 2FJBB 2FPHX 3N9UC 3BO2A 4RU2A 3CD7A 4V1Ak 2KVIA 2ZC3A 2VKRA 3D1QA 3UDCA 4JI3F 2KXNB 4CT8A 3G8SA 1HNZF 4A48A 1JJ2R 3TVZA 4X4QA 4G1QA 1JNRB 2OMLA 2VKZG 1RT2A 3WQPA 1TL4A 4A8SA 2OSQA 3ZZZA 2PI4A 4PQAA 2WAQD 1M1HA 1WNEA 3MXHP 2GCFA 2C2MB 3NAHA 3UI3A 5CAAA 3HSJA 3CCQS 1TKXB 2OEKA 1HLWA 3SQGB 2ZFHA 3ISND 3ZTRA 1TVRB 2E7VA 1WC3A 3J81j 1VYAA 4EBCA 3RW6A 1M5VC 1FD8A 5EGYA 1LWEA 2EWHA 4O3OA 1VQ8S 5IT0A 3PRBA 4JI0J 4Q2MA 3WC2A 3J81U 4ZVTB 4L74A 4IFYB 2BEFA 2KH9A 3UQSA 4F3QA 4OZLA 2G0CA 1EB0A 4LSZB 4ID8A 3ZZYA 3DC2A 1T9UA 3K5OA 3W7BA 3NKYA 1DQAA 5KG1A 1XQIA 3HVRA 2XTJP 4W90B 1HI0P 2BRLA 2WOMA 2JHEA 4RW6B 1U24A 4F4WA 3C19A 1CPZA 2HWTA 1JJ4A 1N8RT 1FJGF 4EMDA 1UWBB 2V4RA 1VHIA 1N0UA 1ZYQA 1D1UA 3W2WA 2PMHA 1OMSA 2H54B 3H8YA 3BSCA 3RBXA 3D3CJ 5DDQC 4GVLA 3MTKA 7AT1B 3KG4A 2ZBIA 1WC4A 1QUPA 1Z2LA 3CJ3A 3LALA 4OJGA 4ZS6A 3RBZA 3OVAA 3BZQA 3HHKA 3GILA 1T9WA 2IBKA 2LDIA 2OPQB 4ZN1A 2SXLA 3UDVA 3TJ8A 4B3MF 2ILZA 4PG4A 4P52A 3PR4A 2UUCJ 2VIHA 2JVOA 1N34J 3MUMP 1JLBA 3ZZ0A 3CIZA 4CH0S 1ZPVA 2JRSA 1GNKA 1H7XA 2QO3A 5HQ8A 4CLPA 3PZPA 3VZHA 3VALA 1DTTA 2R7XA 1IBCB 1YJTA 3OJUA 4P75A 1NDKA 3MURP 3MOZA 4CWBA 4RW8A 3KK3A 5KFCA 3IG1B 4WU2A 4NEYA 4F4ZA 5KFBA 1JKHA 4DUYJ 2MDAA 4YEAA 2HRTA 5ETRA 3VCDA 2XWXA 4ZPTR 4JV0A 3K59A 1QVGR 1NPRA 4DJBA 3Q8RB 1WDDA 2HW3A 1PAUB 5C2GA 4B3RJ 2I6WA 3KLHB 2MQ8A 4ZVHA 2YKMB 1JMTA 3GLJA 3TUZC 3QNWB 1S1UB 1LW2A 1CJKA 2DITA 3KLIB 2R8JA 2VU5A 3P8BB 4URGA 1S9GB 3M6XA 1YHQS 4F67A 3D1OA 1I94J 3G8TA 3ELHA 1JLAB 4LBPA 4HDGA 4QIEA 2IVFB 5KFHA 1T9TA 2YWHA 3MEDA 3R7NB 2RU9A 1OS5A 2BQ3A 4AUKA 3KK2B 1U25A 1N32F 1LWCA 1N33J 4U67Q 3MD1A 4USHA 5KG6A 4DX7A 3SCLE 5A8KA 2HIYA 4K5RA 1WG4A 4LF1A 1A6LA 2WVBA 1NB7A 1NDCA 2IVMA 3BSOA 3M2UB 3BSNA 2B4PA 2ZBCA 4B3OA 1SJ4P 2RT3A 1UVMA 2BANB 1PAEX 3QGHA 1NK4A 3ULHA 4K50A 4DV2J 2ZM6J 3GSIA 3NGKA 5HROB 2Q6CA 3EGZA 4PAAA 2V8VA 5DM6Q 2V0NA 3TA2A 1RAAB 3OTDA 4H4OB 4USIA 4C8NA 1F5BA 3HVAA 3E51A 2XMMA 3G96A 4DCOB 3V81A 1OSCA 1FX4A 2V4JB 5EUHA 2V2ZA 4FKXA 3CPWR 4MK8A 3AXMA 1FKOB 4K8RA 1PYOB 4YN3B 3FEZA 2PMZD 4A8YA 2CPIA 4QYZJ 1V9OA 4Y2KA 3LP2B 4OV1A 4ED7A 1H3DA 2W7PA 2JEIA 1VK8A 4KHMA 4Y3CA 1Q1KA 5ETNA 3MEGA 3H90A 4Z37A 2E1AA 3A3OB 1O5JA 3M8QA 1UJ4A 2C2KB 1CBKA 2KB2A 1YZ6A 4OI1A 1A7GE 1VBKA 4A4JA 4KTQA 3IMQJ 5J2MB 1FHTA 4I7FA 4DLGA 2XY7A 1PO6A 4UUWA 1TKZB 1H98A 2PE8A 2ZVSA 3EWGA 2RHSB 4K4ZA 3SZ2A 2HLUA 1GXLA 2KRRA 5HL7Q 2BKNA 1SJ3P 3D4JA 4WYLA 1RZMA 3BGLA 1P8GA 3E01A 3AY0A 5E5NA 4M1KA 3H5SA 3IM8A 4FYVB 1N48A 4LFBF 4USWA 3WC0A 1S79A 5CA5A 2AJ0A 3J7ZT 1HW9A 3ENAA 3HHLB 3VAHA 3CCVS 1VMBA 1REVA 2ZD1A 1D9DA 2E66A 2CJXB 5HBMA 2FUG9 5ETOA 1QAXA 1FO1A 2ZNZA 4ZCKA 3GJRB 3QJLA 2DEJA 3IN5A 1N5YB 1D3WA 5E41A 4ECXA 3HKZD 1IVZA 1RTJA 3JQMA 1APSA 4EU0A 3UVJB 3H0PA 3HVTB 4GKKJ 3OFHA 2NXJA 1V3ZA 1H6KX 1YGYA 5LJ5Y 2J8SA 3W8GA 3T6BA 3OUYA 2M9KA 3DXSX 4FZVA 2ZHBA 3VV2B 1QM9A 3ILLA 1C0UB 3C3LA 2KTQA 2HHXA 3ENVA 4NLVA 1UL3A 2ADCA 2DXEA 1CSJA 1CJVA 3IO1A 1LK5A 3QQCD 2ATCB 2PIIA 5GAHU 3M4XA 4J9MA 4DV4J 4WXOA 1S0VA 2BR0A 2M4MA 2KZMA 4TY9A 1R8CA 3LTOA 4HR2A 4XPEA 4P71A 4CO3A 1AROP 3EZ5A 5CYMA 3EGNA 1IKXB 1BD6A 1WACA 1R8PA 1T94A 4AYBD 2VF3A 1X5OA 3UDEA 1J5EF 3PO4A 3JB9k 4GO7X 2VUGA 3N79A 1BY9A 1K0VA 2DNQA 2VQEJ 2NXCA 3FVYA 2HVDA 1XBWA 4FNIA 3D0HE 2ZH2A 4DR3F 3NS6A 2JDJA 2M0GB 1E6VB 5L38A 1JJHA 1RHUB 4NPOA 4X65J 5LOQA 3KLFB 3CE8A 2YWWA 4NLXA 1HQUA 4O4GB 1SC4B 1JLFB 2L9NA 3MR7A 3LW5C 1RT4B 3ZTOA 4DSFA 1L3KA 2QMWA 4QWEA 4B3TJ 4RU9A 1WOOA 4LVNP 4DSKA 4LRCA 2G4BA 4LR8A 4NA2A 3FMWA 4QR0A 2J5AA 3O5TB 4P10A 1UPPA 4KFBA 2FVPA 4A8QA 5DJBA 2APOA 3O44A 2UU9J 3DI6A 1J5OA 1WTBA 3ZTQA 1KONA 1TL3B 4CH1A 1Q82T 1ZM9A 5DGAA 2DIVA 2ZHOA 3IRXB 2M5YA 5AXLA 3OSNA 1UWAA 4ECWA 3CMQA 2O3DA 3ZZUA 4DQSA 2O01C 4QWAA 5HVHA 1F9FA 4ZVEA 4B9LA 4ELVA 1CJUB 3CCTA 2J6UA 1SPBP 1T9XA 3KLGB 1U48A 5DQGA 2Y1IA 3BQ2A 4ES1A 1UA1A 2DJWA 1HL6A 3MAHA 4WF9Q 2H5IB 3CF5Q 2DHGA 4HHHA 4IOBA 3S8SA 4F2SA 5J1PA 1YKWA 5H9EK 5A76A 2HMIA 3GCWP 2GS8A 2HK3A 1TAQA 3SSQA 1Y10A 4F0HA 3UN5A 3PW7A 1VQOS 4IO9Q 1URNA 4ZVPB 3VTIA 3KHLA 2D3ZA 1FDDA 1TFWA 1JLEA 3E8OA 2WONA 4LRBA 3KNGA 1NHVA 1D0EA 4FBUA 4BWJA 4E0DA 1FKPA 1KSPA 1QTNB 4R5PB 5D78A 2JLEA 2ZZMA 3AA9A 2R7RA 2YNFA 3FJ2A 2UZAA 2MKYA 4LVOP 2MJNA 4TY8B 3T5JA 3MCSA 3C6TA 3HHDA 3RB0A 2HZVA 1KQKA 3R97A 1JLGB 5HSPA 4F4YA 3M2RB 5KFUA 5H1SV 4C8KA 1ZH5A 2R7VA 3FC9A 2CPZA 1IWAA 2N7YA 3F73A 5D4PA 3HCXA 1MLAA 2EVZA 3VGUA 3BO4A 1UFKA 3MM7A 4DN9A 5I3UB 3HI9A 2KG0A 3DDNA 1N36F 3L7UA 1YJ7A 4RKUC 1S1XA 4M5MA 4FF2A 2OPSA 2KHDA 2RH3A 2M3DA 3P6YC 4K2XA 4KPYA 1ZPWX 2CJKA 1WTFA 1UW9A 2YNGB 3QGIA 3KJNB 4LF2A 3TUJC 3NWGA 5M2UA 1VRUA 7FD1A 3KK1A 4F2RA 1VS3A 5SZTA 2VPZB 2GMLA 3JSRA 4JI8F 4UOCA 2OPPB 3ZZRA 4PYAA 1FEHA 2CIMA 2JOQA 3UCGA 5AXMA 2VDIA 1OY8A 2DHAA 1UTAA 2UXBF 1RDRA 3T9ZA 4WXWA 4ZPVR 2HBYB 4CIOA 4Q0BB 3OHAA 1TP7A 3MM8B 2HRYA 3D67A 4J5OA 2WVCA 5G0RA 4CNZA 3HZGA 5I42B 4ZVGA 4QIWD 1WG1A 1PGZA 2IHR1 3M2VA 2H4WB 4UW2A 3D0IE 3AAWB 3C66A 4B3MJ 1RTHB 2OPRB 1U7LA 1AUDA 5A8RB 1OYDA 4I68A 3R5CA 4IR9A 2Q43A 4YS2A 1Y11A 1S4EA 2WBMA 3IS9A 3CTRA 1WD6A 2DD8S 1JX4A 1RU2A 4KHPF 3CCES 1WEYA 4DSJA 3FSXA 2CQ0A 2QGFB 2GVDA 3KJVA 1CC8A 4EGLA 2RRNA 2E1PA 2IMOA 2DNHA 4F3MA 2VG7B 4I6AA 2MEWA 4KGKA 4ZVOB 2JEFA 4WP9A 2KXFA 5J1NA 4NEZA 2YWGA 1HYSA 4J37A 4G1QB 3OXFA 5K5MA 1VFJA 1HHSA 4C8OA 2DR6A 1G7CB 3NCPA 1WF0A 3DLKA 4IH7A 2UVUA 2EKNA 2HS0A 4J9LA 3SCKE 3LQVA 5CD4A 2B5JA 2BQRA 2I38A 2MQMA 5J2PA 5LM7E 2XMAA 2M2BA 5CXTA 3VGSA 2MKSA 1GAOA 2GX8A 1HD0A 1X9WA 3B82A 1DFDA 3GONA 3I55S 3F56A 2WTFA 1VBXA 3J7YU 4UOFA 1FVSA 3H25A 1YJVA 4USMA 2R8HA 1SBRA 1TK0A 3I0SA 3NMRA 2CUYA 3MAQA 4GVBA 1RXOB 4OYAA 1N32J 2XY5A 5F8GA 5FIIA 4CM0A 3HK2A 3OLAA 1URRA 1EP4A 2CPFA 2HFZA 4HEA9 4X62F 2B9EA 8AT1B 3KFWX 4ZP9A 4BWMA 3A3NB 2R7SA 1NO8A 5IT4A 4YUDA 1OQ6A 4HACA 2WOMB 4LF6F 3R5DA 3DLJA 4TN2A 3NNCA 1T95A 1F0XA 3BS9A 2BE9B 2BE7D 3EGWB 1NK0A 1SI9A 4EZ6A 2C28A 4BC9A 1RT6A 1VBZA 3Q22A 3M9MB 2MMYA 5IT9Y 1DHMA 3P49B 3H59A 2DNOA 1T05B 4O3QA 1FDAA 2AZ3A 3NMAA 4USVA 1VLOA 4JB8B 2AD9A 4A47A 3X1LB 2KZZA 5KG2A 2J9CA 1C1BB 5LL6d 5FJ4A 5CZVA 4MK9A 3OBIA 1CULB 4IDKB 3EMTA 3OV7A 1CJTA 4LF4F 3J80U 3BGOP 1JLBB 2JEGA 5KFVA 2DHHA 4OLOA 1J2VA 3AOCA 2V2VA 2W2QP 3K89A 4WFNQ 3RRHA 3A4TA 1B0PA 2HZAA 1JWWA 2ZDOA 4F02A 4ZVSB 4RW9A 2FVRA 3Q2SC 3L7PA 1SKWA 4IG0B 1RT7A 1JLQA 3QRRA 1VDHA 2I2YA 3TQ1A 4UY85 1UVJA 5C25B 3K5PA 2FLNA 5HLFB 1RAJA 1NSQA 2CQGA 1FXRA 2ZH3A 1UP1A 1KEKA 1FNXH 2FYXA 3MR2A 3W9HA 2GA7A 4IKAA 2HHTA 5D77A 1S99A 2C3PA 2XEXA 1FI4A 1KNZA 2DH8A 1P9YA 4P2XA 3CJ0A 3OXLA 2L48A 2G0JA 3EVMA 2YVSA 2HNZB 1JK9B 3EDRB 1Q7YT 4QOTA 1UAWA 4LFBJ 1S5ZA 2YKNA 1TL7B 4LFCF 1HNXJ 4ZP6A 4A8KA 1C0TA 1IKVB 4CYUB 1RYSA 4F4XA 4H54A 2XHCA 4AQYF 3FGVA 2CQDA 2VODA 4ELTA 2CADA 3DCAA 3MHYA 1S1WB 2R8IA 4KGMA 3PCOB 4JI2F 4KRWA 3VGVA 1RTZA 4C6AA 2Z56B 3FBCA 3VAKA 4B9NA 2N4DA 2J0QD 3G2XA 1LWCB 3K7RA 2K8GA 5HAOA 2NUHA 4M63A 4Y2IA 2HZCA 4QU7A 5GVQA 2HIQA 3TEGA 5F8IA 1MNEA 3B6BA 5F41A 2FIUA 3I82A 3QAEA 5HJXA 3C15B 1FWKA 4CH7A 3ZNUA 1NH7A 4JV5F 2W24A 1FE0A 4B08A 3R1LA 2RIJA 2OELA 3G6XA 1VQNS 3RZAA 2IC3A 3R5AA 4M8LA 2V8GA 4O0NA 4C0HA 3G6VA 1B4SA 1P1TA 2AJ2A 2MYFA 5F0WA 4NLOA 3DHWC 4G1IA 5D3GA 1BQXA 2XO7A 2BJ8A 3M1VA 3L7OA 1N54B 3NGSA 4ZN3A 5IXUA 3BSAA 4FKYA 4JV1A 4NLRA 2HFSA 3ET6B 2AGQA 3UD4P 1QTMA 1ZETA 2KVQE 3HF5A 2OLWA 4GMKA 1J5EJ 3LANA 4OFZA 1AXQA 2MKIA 4UQTA 1VQ6S 3GIMA 3TR5A 4AL5A 1LQ9A 1RAEB 4AXJA 2ZH5A 2HVIA 1S1VA 4I2QA 3MM9A 2UUWA 4QU6A 4N7TA 1R0BG 3D0GE 4DR3J 1SC1B 2NXUA 3PIOQ 1S59A 4J9KA 1SJRA 3T5HA 1X4GA 5C7PA 1EETA 4WFAQ 4ANCA 5BYQA 2VV5A 1VJWA 3ETOA 5HP1A 3KJQB 2XULA 3SFUA 4NRUA 5FD1A 3P96A 4WP3A 1EJ7L 3NBPA 1P27B 3GSDA 2KDOA 3UO0A 1YZ7A 2H65B 3H5YA 1N5TA 4PUOB 2AJFE 3L09A 3QFWA 2D9OA 2JL9A 3RB6A 1U8SA 3DN9A 5IC6B 1NH8A 2MQPA 1X7VA 5ITHA 2KFNA 1REVB 2DCUB 4LSNA 3IFEA 3GFHA 2FY8A 3ETMA 3HHLD 4B9SA 3N4WA 3TEHB 4NRTA 4ICLB 1FFWB 5ETKA 2A0FB 4P9SA 1Q8LA 2MQQA 3CT9A 1WELA 4L72B 1TKXA 2Q6BA 5HVGA 2XMTA 4WK1A 3SQGA 1RA6A 1TVRA 1WSVA 2MZJA 3NOCA 3G86A 2YKAA 5KFDA 4LREA 1WDTA 4MH8A 2ZOFA 4TYBA 3D1HA 1P9QC 1NU4A 3LP0B 2E1RA 3MR5A 2C3YA 3O2IA 4C8LA 1XMOF 1FF2A 4B02A 1PCAA 1H2UX 3V4IB 4IFYA 2EFNA 2LQBA 1FERA 4J90A 5F9LA 4WFYA 2HQIA 4WPAA 3IAS9 2I8EA 2VHGA 2ZITA 3AJ2A 4LF8J 4FF1A 4DR2F 1R31A 5AE3A 2PEBA 3HP6A 2WVFA 4WWSA 4RW6A 4HHUA 5D4NA 1YITS 1UWBA 2FZCB 1FNOA 2C2EA 2G2ZA 2L3MA 1Q86T 3G82B 3NL0A 4KH0B 2ROGA 4DCPB 1SL1A 2CPJA 3AFGA 3KHRA 4X4RA 3BQ0A 3T1YJ 4FXVA 2IAJB 1JNZB 2XZTB 1NHKL 2P6TA 2OPQA 5AJ3F 3CJSA 1S72S 3RAXA 1FRLA 2POKA 2CQHA 1BQNB 2PGCA 4EO8A 5J2NB 1SCJB 2XY6A 4FN5A 1W2IA 4D3HA 3NNHA 1LWFB 2K2PA 1G4CA 1N36J 2XNRA 1IKYB 1HQUB 1ZZNA 2M7SA 2NLWA 4OX8A 2HAFA 2HKEA 1M1KT 3IG1A 2FLPA 4DR5F 2J0XA 4J9NA 2LP4A 5D4OA 4ZVUB 2DISA 2EC2A 5FLXY 3N0VA 2YH1A 4JI8J 1Y3KA 1VCTA 5B0AA 5GAEI 4XPCA 3ENWA 1ZM3A 2XMJA 3UWTA 2D3OR 1XC9A 2KM8C 1SH2A 3BBCA 3MR3A 5A0YA 3LO3A 2RQ4A 3DI6B 2UXBJ 2GIQA 2QL7B 2V8HA 2B3TB 1IUJA 1GX5A 2V8DA 2ZBQA 1S1UA 1M5SA 2RQCA 1S9GA 2D41A 3IBFB 5ETPA 1FDBA 3T1HJ 3BF4A 2G13A 2QIFA 2RUGA 2P9GA 4KE5A 4QWBA 4WFZA 5IOLA 5L1IA 1Q5YA 1TV6B 1JLAA 1U8WA 1UEVA 2MGZB 4W98A 4G1PA 1Q7LB 1HBUB 1RT1A 4A8OA 4CQ1A 3FCWA 1W7WA 3LGHA 4M5IA 5M2RA 3KK2A 2W9CB 3W9IA 1X8DA 5I4MA 3BDPA 4WZQA 2W4DA 3EM1A 2ZVIA 4Z7YA 4ZK7M 1HR0F 2UUAF 2W8LA 1X9MA 3NXZA 4ZCIA 2IYGA 3RW7A 1FESA 3FBEA 3TZYA 3ILOA 1IQZA 3M9NB 2VC0A 4KHPJ 4TU8A 3M8PB 4O23A 3BGUA 2DGVA 2G2OA 2CG8A 3M2UA 2YWKA 4L3NA 2IFXA 3KXDA 2X3GA 2BANA 3BQ1A 3N28A 2PFFB 1X4BA 4WKYA 3NNAA 2QYGA 1YVFA 1VQPS 2AWZA 5KFWA 4YMEA 1HW8A 1CS4B 3IA0A 5THWA 5HI7A 4OX9F 2HHPA 1R0AB 2D3UA 2MHEA 5HROA 2W01A 4K59A 2A18A 5A2QU 1E6YA 2DB1A 3PM9A 1WEZA 2QA4S 2GFFA 2VDHA 1L3UA 2PSZA 4UOHA 3TQEA 2DO0A 3KG1A 1BGXT 1OQ3A 1AYEA 4NYOA 4KH1B 4NMLA 2V4JA 1IBKF 3CDUA 4BS2A 1NKBA 2E5HA 2HNYA 1FKOA 5CD4H 1O6XA 4IG3A 1UCNA 3QIDA 4F50A 3LP1B 3LP2A 2LDYA 1HPZB 1MWYA 1ZZFA 2OFGX 5KFOA 1S1XB 2OPSB 4IUFA 5KFIA 1GXTA 2OUGA 2BW2A 4IQMA 4X62J 1RAHB 2HHWA 1YLXA 5KFXA 2DRDA 1VRUB 2ZUAA 2ROPA 4Y2AA 4DUZF 1T3NA 3C6UA 1QAYA 5LSOA 3D6FB 4UZBA 2QYCA 2XO6A 5J2MA 2KHCA 1DZ5A 3MPDA 1TKZA 1VQSA 2VC1A 1ZS6A 1SV5B 3A13A 4X4SA 3TYTA 3VGTA 2IA0A 2FGCA 3FRYA 2LEPA 4K4TA 2DR5A 2WZ1A 5H9FJ 3TRGA 1FJEB 1CVJA 4DN0A 2AF6A 4I4BA 1FTCA 3MD3A 2KN4A 4O3RA 2WCXA 4QIFA 1X9SA 3IBCB 1SJFA 2IY5B 1TL5A 4NLUA 6FDRA 2LEAA 3HXMA 2UXCF 3I56S 3HHLA 4NASA 2BOAA 1FJCA 3TARA 2I1RA 2Y1RI 5KG5A 2RKIA 3QSYB 1Q95G 2QFJA 5BYRA 2DGTA 1IWGA 3G6YA 4Y00A 4F8RA 3MPUB 2ZH9A 3JTPA 1KHVA 3R7SB 4LF4J 4TKTA 2K3KA 2RMLA 2K1RB 2HYIB 1UZDA 1N5YA 3T5KA 2J7UA 2OTJS 3CD6S 1ZAVA 2HG4A 4QZVB 3IS9B 3UVJA 2ALZA 4XTTA 3HVTA 4OV6A 2CWXA 1NKCA 2BXJA 2FZKB 2GJFA 1A0OB 4Z2XA 2NYHA 2XCPA 2R2UA 2DR7A 1YJNS 1XR6A 1KD1T 2BDPA 3NRBA 4PCQA 2F4VF 4O3SA 2U2FA 2QV6A 3BR8A 4NZ7A 1X5SA 2E5LF 1U45A 3G71S 2YX4A 4CO4A 2DNNA 2HHVA 1NZAA 4QWDA 3QIPB 3TVYA 2HQ3A 2XG8A 1LOUA 4IRDA 1RACB 2ZH6A 4LFCJ 4HI1A 2YKPA 2ADBA 1CQMA 3FZBA 4N8NA 3P5TL 2FJWA 1KRPA 4X66J 1IKXA 2IM3A 5J2PB 4AQYJ 3LAMA 1JIHA 4K4WA 3M8WA 3TANA 4PXCA 1Y7PA 4BLGA 3MEEB 4JI2J 4QR1A 2QL9B 4F4KA 4DV0J 2FHOB 3I32A 3I0SB 5CH7B 2XMUA 4DX5A 1SKRA 3RR7A 5HMXA 3KJFB 4NA1A 2H4YB 1EP4B 2WBRA 1U0HB 2HWHA 2NYIA 4X84A 4ATNA 1E6VA 2HFOA 3KLFA 1O0PA 3OR2B 1RYRA 4J9SA 2GNKA 3GCXP 1JLFA 2DY1A 1YK9A 3OR1B 5EWEA 1RT4A 2YKOA 1VLYA 4A8FA 4JV5J 1Y5NB 3B4MA 1FXLA 1TUWA 5LSRA 3SV4A 2QEXS 3T41A 3FBBA 2DEIA 2AIRB 4FF4A 3SEOA 4OI4A 3MM6B 4CLLA 1HD1A 3AJDA 1TL3A 5CCLA 3Q0AA 3KUHA 3RBDA 3IRXA 3W65A 3RRGA 5K8PA 5KFFA 4NE9C 3DRRB 4CLFA 1RHKB 2ZDPA 5D0HA 1KLNA 1S0NA 4F04B 2AJ4A 2UUTA 4KSEB 3BYRA 2LXUA 4YP3A 2WK4A 4LSLB 3G4SS 2KT5A 2MSTA 2BW7A 1CJUA 1PYTA 5KFAA 3SIPB 1NJIT 2J0WA 2JSXA 2HFNA 4WFXA 3CCWA 2HK2A 5DRKA 3GIIA 4RW9B 1DY3A 2CG4A 1K1SA 4TQRA 1EKRA 2GZOA 1PJ7A 2CPHA 4ELUA 2B9XA 2B6AB 1SH0A 1RLCL 5J1EB 3DGVA 1VI7A 3OQ2A 5B0CA 3KOAA 1PG5B 3EJMA 5LJ3Y 3H98A 3W60A 1ELOA 2ZH4A 1NJZA 3SQOP 2DGQA 4C11B 2NS1B 3U02A 1VHFA 2IBOA 1QVFR 4DOZA 4R5PA 1S57A 1DJ0A 4IFVA 1S0OA 2YKNB 4AXIA 5GAHI 3KNAA 2HAIA 3PX4A 2KU7A 2QG9B 2QJ3A 1RWVB 5K8MA 1UVIA 3K58A 2RUSA 3CMES 3H5UA 4IQXA 4TY8A 1KWMA 3QT6A 1SUQA 1KC8T 3IC1A 2J8AA 2H5EA 4PWWA 2QL5B 4DL7A 2KM8B 3IGNA 2DNRA 4WTOB 3M2RA 4Y65A 4LIWA 4WYWA 4O0IA 3MM5B 4J9QA 2UUBF 2X51A 5KAKA 1XR5A 1R27B 1LW0B 3FKBA 1WOSA 5KT6A 2C42A 5H9EJ 1Q16B 1GH8A 5KFPA 3KHHA 2X3DA 5I3UA 5IM0B 4I2PB 3R8YA 4YY3J 4IH6A 2OSRA 1XMOJ 3PIPQ 4ZIVA 3DRYA 1RHQB 3L95X 1UKUA 4H4KA 2XS7A 1T9VA 3ZC4A 4ZLLA 3MMAB 1DARA 5T7LB 2YNGA 4C9DA 2VPYB 4DR6F 4O44B 1ITPA 2IC3B 3I4PA 4ITSA 3O6QA 2OPPA 5KT3A 4AFFA 4B9UA 3V5RA 6FD1A 2CNLB 3P3DA 3R6LB 5D3GB 2W9BB 4RUCA 2H3EB 3QZ7A 4Q0BA 3PX6A 4I1TA 3MM8A 1WJ9A 4P74A 1WI6A 2FY1A 3F41A 3DM2B 4TNOA 4JI1F 2Z2MA 2HHSA 1C4AA 4K5SA 5I42A 3PACA 3PKMA 4RNFA 3GV8B 5DDPC 4DV5F 3CC7S 5DLGA 2CZ4A 5AJ3J 3NLCA 3K8WA 2D74B 3JYTB 3MPYA 4ECYA 4I2QB 2Q1LA 2FJXA 1RAOA 4F3OA 1RTHA 2EFPA 1HWLA 5A8RA 2WSCC 4ED2A 3IR6B 1TKDA 5EWFA 2MKJA 5B08A 2GHWA 4I69A 3TUIC 4WIQA 4FXWA 5GMKa 3Q2TC 2RQKA 1NJWA 3CIMA 3PNIA 2W4CA 4LRAA 4DCJB 3MEKA 2G1DA 2Z0GA 3CCMS 4DR5J 3PXGa 2BV3A 4NXMF 2MZQA 1OPIA 2C22A 2VG7A 4M5KA 4LF5J 1HBOB 2VL1A 4NCBA 1G3OA 3DOLA 5HMZA 2XNQA 2B4VA 4DL3A 3AD8C 2ERRA 2DR9A 3N5BA 4LSNB 2IPOB 1YBTA 3C2PA 3HX9A 4MT1A 3HULA 3Q89A 1GX6A 5HANA 2UV8A 2LQ5A 1KQSR 3GIJA 3GQCA 4MYTA 1D09B 2ZJPQ 2RHQB 2K7JA 2WW8A 2CXEA 2IJNA 3FSYA 2CJYB 4TU7A 1RWOB 1GK8A 2GGPB 2VA3A 4QPXA 5U47A 3MCNA 3DLLQ 3W8PA 1TKTB 2HURA 3AXKA 1R7IA 2OO4A 2EW9A 5D0RA 1R8BA 2F8HA 1HR0J 2ZEJA 3UPFA 2UUAJ 4A8WA 2NR0A 3RB4A 3M6UA 4J7CA 1DTQB 3SDEB 4XO0A 3QPIA 4IO1A 1R8HA 1MWZA 3EYZA 2C2DA 2CQBA 5B0GA 2DRAA 4KPCA 2XCAA 2E9RX 3W5ZA 1FJ7A 3MPWA 4ECRA 2HBRB 1VC0A 4DSLA 4KBIA 3CO9A 3QYYA 1MWQA 3ADAC 4C98A 3SYZA 3AOBA 1RT3B 3VWSA 1T05A 1N6QA 1RKJA 3ILIA 2AEFA 2Z2ZA 1I6JA 2NSCA 4KY3A 4H4MB 2YNIB 1T03A 1NK9A 5J2QA 4J9VA 3HSZA 4FYYB 1C1BA 2V8PA 2NZCA 5HK4A 1Y5LB 2Z58B 1CULA 5EDWA 4IDKA 1IBKJ 2CPYA 1T9YA 1U49A 4NXNJ 2DXFA 1N5VA 4I67A 3PEJA 4QPTA 4U8YA 2X1BA 2F4FA 4ZJQA 4C8MA 3O1LA 4DR4F 2BKPA 4ILMA 2WHOA 2MKKA 4IG0A 2V50A 2DGOA 3LAKA 4NMXA 2VFRA 1U6FA 5C25A 2DNLA 4DUZJ 4RLEA 3BYPA 3AT1B 2UVRA 5HLFA 2JC0A 3SI8A 2CDRB 4YDXA 3GIKA 3SMZA 1ZA2B 4HH0A 5KT2A 2BM1A 4ALZA 3J81Y 2WW4A 1NK7A 5A0YB 4ILRA 3BKUA 2KL8A 3JAMU 5EHHA 2R7QA 3CSKA 1S6UA 4EK2A 2HNZA 2HBZB 2NCKL 3BBFA 1TL7A 2BJDA 4EBDA 3U1NA 2XHWA 2B8PA 1CLFA 1LXNA 1IKVA 4CYUA 2UXCJ 3BV8A 1MSWD 1WC5A 4MIBA 1S1WA 1U1PA 4H4KC 5IS2A 3T9NA 5E2QA 1HWJA 4OZ3A 2H5JB 3PRDA 3K8VA 1HKAA 2QLBB 2QC3A 1RT1B 3CJTA 2F8EX 4DLEA 4JBCA 1WF1A 4P2FA 3QLHA 4LRFA 4IH5A 3J7YI 2BVZA 5IQ6A 4C3MA 2AYMA 4F0MA 4LF9F 4FDFA 4ZVRB 4M5LA 3CJQA 1VIXA 2HFVA 2R8GA 2V9KA 2VPXB 2HNDB 1X4CA 2AEJA 3C15A 1H2TZ 4TLQA 2H51B 2ASDA 1U2RA 3Q8YA 3TW0A 4DF4A 2CQ1A 3QZ8A 3TWZA 2VBYA 3FUYA 5LMNF 2F4VJ 2DNZA 2DGSA 2P9CA 5L9NA 4OHYA 5KFNA 1MW7A 2KJVA 3S7RA 4DG1B 2W1BA 2E5LJ 5KFJA 4EFAC 4X4VA 3IWLA 2JJ4D 3NS7B 2H48B 4DFJA 1O51A 3M30A 1MMLA 4DS4A 1N34F 1E6YB 2UVWA 4RJVA 3TAMB 4K4XA 4RNMA 2PFDA 4FPRA 3OSPA 3PYGA 2FVCA 1V3RA 1EQMA 1NB2A 4FS2A 1PC4A 3ENQA 3ET6A 5F8NA 2GQCA 4ZHRB 2HNYB 4ZPBA 4IG3B 5AT1B 1K73T 5KFEA 4L75A 3SCJE 1LKZA 4G3IA 1R8AA 1VQ7S 4LIRA 5C5JA 1YRTA 1M5KC 2CPXA 2R42A 3T3FA 3G87A 3KLEB 2JEJA 4Y0FA 1YJRA 5MAOA 3T5LA 1VRQC 1U6ZA 2GO9A 2D7SA 1FD2A 3C6UB 1XNQJ 2B43A 3NGRA 1B7FA 4DZ6A 4UT4A 1P1LA 3JXOA 4LR9A 2IDEA 4BDPA 5KT7A 1VC6A 2B8QA 2DPIA 1MROB 1RAIB 3MFHA 2MLYA 1WG5A 2WVEA 5D6GA 4UOGA 4X4NA 1H74A 1NJXA 5DO2A 4WZMA 3TX0A 4NLYA 4EUVA 4U8VA 3DKDA 4PUOA 2DNPA 4B9VA 1YG0A 1Q4RA 2KI2A 1SC3B 4OI2A 3GV7B 3D54A 2XI2A 1FE4A 4DFKA 1V6HA 1FRKA 2YQ1A 1N33F 1VGYA 2ZWOA 1W26A 1NRKA 1YBAA 3Q83A 3GZ7A 2RKIB 2LXIA 3I0RB 2GHPA 2R7OA 3FZ2A 2NPFA 5GAGU 1RADB 4ICLA 2PEHA 4HT7A 4MK7A 1TZ0A 3AOAA 1M0SA 2YX1A 1DQ8A 1XWLA 3W63A 1M5HA 1SKUB 1GTHA 2DIUA 4ED0A 4PXDA 3THVA 2W4PA 3EXYA 1CG2A 4L6V3 1HNVB 1LK7A 4M5GA 2Y9HA 1TL1B 3LP0A 4DV2F 5KG3A 2F1FA 2AGOA 2WB4A 2CQ4A 4RBTA 4W4MA 3FRZA 4ZCLA 3CWJA 3V4IA 1QUVA 4U7CA 3CEDA 2J76E 3CC4S 1KQGB 3V6DB 1MU2B 3MECB 4RPFA 1U1OA 2MJUA 3RGIA 2UV8G 2QMUB 4QYRA 3UDLA 3H2UB 2ACYA 2KFYA 3I31A 3V6KA 1HNWJ 5A6WA 3ZZOA 2CVIA 3D66A 3THTA 5DG7A 2RF2B 4Q7AA 1RA7A 3G82A 5HMYA 2E5GA 5K8OA 5KT4A 1SIWB 1RWMB 3UNYA 1MN7A 4OZNA 4X64F 5JVGQ 3POTB 1RWXB 1IM4A 3GIRA 2CJQA 1NSKL 1ZTTA 4N8OA 4NLDA 2IAJA 5MLCV 3CULA 4XK8C 2J6SA 1BQNA 1O8BA 5J2NA 1VQ9S 4LMZA 3LGMA 3IWXA 3CDWA 1LWFA 2OMOA 4ANDA 2DHXA 4OYWA 2RILA 8RUCA 5EN1A 1IKYA 5T41A 4J9UE 1B99A 4W92B 3IP0A 4CCHA 4P72A 4K4YA 3HHEA 4M95A 5C42B 4AL7A 2Y8WA 2V4QA 2JWNA 2PI5A 3RUBL 5DZ6A 1S12A 4XAKA 3R9LA 4DR6J 3BPDA 5C2CA 2XLIA 2VQFF 4DV6F 3TZWA 3K5LA 5F8LA 2E1MC 4ID5A 4E2FB 1VJQA 1KQFB 2XMWA 4LQ9A 2CQCA 2GQQA 4B3SF 2LU2A 3N6MA 3CJ5A 3E2EA 2EFGA 3IM9A 1S7HA 4WE1A 3HFZB 4G65A 1G6BA 1NDLA 1D8YA 2VFVA 4Q8FA 3VF0B 1WHWA 2LVWA 1IXKA 4HDHA 1VRTB 5HMWA 4YB5A 5L1LA 2DRBA 1K44A 1KFDA 5KFZA 4JI1J 1S0MA 1F5AA 2LQ9A 2AKWB 1ACMB 4EYIB 4DV5J 2FHMA 1TV6A 2HQCA 5I3PA 4CM2A 2MGZA 3W9JA 3PFOA 3LA0A 2ZH1A 2L41A 1PSDA 1HBUA 2J6TA 1TELA 1UPMB 3CJ2A 2HHHJ 3S1TA 2W9CA 1C1CB 5IC4B 3FSIA 5KFKA 4P73A 2AGPA 4RZRA 3D3BJ 5CHCB 2JFKA 1OIAA 5C24A 1OYEA 5AXKA 5L9XA 2CWKA 1WOPA 4DBQA 5A6PA 2OP5A 3PYDA 3M8PA 1GMVA 4M5HA 5D15A 2FB0A 2ALYB 4C8ZA 1X4FA 4JI7F 5KFTA 3GPAA 4NXMJ 1S10A 3A8JA 4ZVQB 1NUEA 2RSQA 5CYJA 3K5MA 4JI3J 2ATLA 5CYQA 3I6PA 5AE1A 4R0JA 3CCLS 4IFVB 1CS4A 1H2VZ 1HNZJ 3JSYA 3DMJB 4UF4A 1R0AA 3HKWA 1T02A 2E5JA 4MKBA 1RHRB 1SUQB 3CJ8A 4DU8A 1VQ4S 4KB7A 2ZKTA 1TUVA 1LWXA 1Y5IB 2D1CA 1PJ6A 1VR6A 1LFWA 2MY8A 3K2YA 1NM2A 4UQGA 2GC8A 1UVNA 4B3TF 2HHUA 1XEZA 2RDJA 3C14B 3LP1A 3DYAB 2YPZA 1HPZA 3P5BP 3OL6A 2RB7A 4USJC 4CLKA 3MAAB 2QA1A 5T14A 2VB6A 1VQ5S 4YB6A 5JVHQ 2G1HA 1HMVA 1RAFB 4OYBA 1KLMB 5M2PA 4FYDA 4PKDB 4Q44A 3D2WA 1S9EB 2HSEB 4BBYA 4J91A 1C2PA 2EBGA 2EG2A 3QRPA 2MKHA 4C0OC 4CLZA 2CJAA 3H4DA 1Z4UA 1SV5A 4DR7F 1IR1A 2CNNB 1FJGJ 3DOMB 1IKWB 4ER8A 3EDQB 1QLNA 1HQEB 1H7WA 4K7QA 4CLTA 4DS5A 1I1GA 3CJKB 2FJDB 1VC5A 3C16B 3PX0A 2NPIA 2AV5A 3CW2C 3U27A 1IBLF 4PWDB 4DSEA 4U9RA 2HHQA 3B8HA 4YB7A 2QSWA 3DRSB 1FRHA 4K4VA 3CVKA 2Z8QA 4JYAF 2HWIA 2XLJA 1M90T 4KO0B 4I56A 4DSIA 1X5TA 3WIVA 4Z7CA 3TNVA 2CA9A 2K1RA 2LECA 4OHXA 2RNEA 2MQNA 3QGPA 3J7Z5 3MPVA 5KTQA 1WC1A 2GHVC 4JI5F 3L3CA 1KVKA 4DR4J 1R43A 1RQ0A 2NSBA 4ILLA 4CZCA 2COLA 1XMQF 2GV1A 2VFSA 3V6HA 3TAQA 2IMWP 3NG8A 4LF7F 3HD1A 3HDSA 2DNYA 2OEMA 3DOLB 3OTEA 4V19J 2EKYA 2PD1A 2RRAA 4M5JA 3EXCX 5HATA 2CAJA 5D0GA 2NREA 1NK8A 2A6MA 2GIRA 3DRPB 2KO1A 1GT8A 3PHEA 3QIPA 3NOGA 2KKHA 3KDNA 4HH1A 4YQWA 5B0FA 1RBAA 1XMBA 3GB0A 5DQHA 4DR1F 2XB2D 2YPYA 1KVIA 5DDOC 1XTZA 3MEEA 1KS2A 2EK1A 4IOAQ 3UE2A 1JLCB 3N01A 1QDUB 1HBNA 3QAUA 3M8RA 2YX7A 4PZVA 5SUHA 3JTNA 3Q8QB 3PR5B 2DH7A 2Y1LB 2FQQB 3OHBA 2XSJB 3W62A 3H4BA 1U0HA 1RTIB 4LF9J 5IWAF 5G4DA 1F2HA 3OR2A 3N6LA 3DNCA 1JB0C 1KOOA 3OR1A 1EHWA 5BR8F 5DQIA 2LA6A 2AMCB 9RUBA 5LMNJ 2R7TA 4TXSA 5K8NA 3BJYA 3DOKB 4EZ9A 2XMKA 3KDOA 4DPXA 1H73A 3QT5A 4LBIA 1FRIA 1OWXA 2R8KA 2P6SA 4Q45A 2MB0B 4P7TA 1WSRA 3HHNB 2O5DA 3GE9A 1V5IB 2K7KA 1EZZB 4GRSA 4YOEA 4GO5X 2YKQA 4RUAA 4KGZB 3MM6A 3MMJA 3QO9B 4MYUA 1UZHA 2UXDF 2V9WA 3RG6A 3CCSS 1N6QB 1NDPA 1FFGB 2XZWA 2YNHB 1T03B 5J2QB 3QT8A 5KFYA 1U1RA 4I0WA 3DRRA 5DLFA 4ZITA 3ONQA 3MCMA 3PO5A 4DHVA 4NI2B 4LSLA 4JI4F 3HPOA 2QMXA 3A3PB 3HMJG 5GMDA 1UMJA 1HBMB 1R3NA 1K1QA 3IWNC 2MZRA 2V69A 3W2VB 4MFBB 5HQMA 1FK9B 3AJ1A 4N56A 3A8IA 2BUNA 2OJ3A 4KKOB 1X5PA 5E7OB 3Q8PB 1YJ9S 3KTQA 1XNRF 4UZCA 4ED5A 2B6AA 1N0VC 1WC0A 4EI2A 2QA2A 5J1EA 4RNNA 1WHYA 1N52B 4N76A 4X2BA 4DL4A 4JI6F 1AUSL 2Z4PA 3AD9C 1F9EB 4PG6A 2R7WA 4OHVA 4I64A 3WBZA 2MKCA 2UVVA 4RL1A 4C11A 1IBMF 3DU5A 2K3IA 1FNMA 5KOXA 3IXQA 2IM0A 4DPOA 2WRMA 5LXRA 4QW8A 2AW0A 2YXLA 2VZ9A 4FPIA 3DFEA 1VQMS 5F8HA 2RE1A 3U7JA 3ZFVA 4HI2A 3Q8VA 2HQFA 4PXEA 4F36A 2BJEA 1WC6A 1KFSA 4FYXB 3RTVA 5HN0A 3KYLA 2M8HA 2KRBA 2MZSA 3MM5A 4FXDA 3QLHB 1B0VA 1S1TA 1NXIA 1RT5A 1FWPA 1LW0A 1Q8KA 2O66A 5ADZA 1SL0A 3JQJA 4JV2A 1FRMA 2IA6A 3UCUP 4NLTA 2B56A 1TMJA 5IM0A 3VAFA 4I2PA 2G9OA 3I5CA 1MMNA 3GG1A 4DL5A 1UVLA 3NAIA 4OZJA 2LU1A 4YR0A 3J80Y 3M8ZA 2IDLA 1RTDB 2WVDA 3MMAA 1F1BB 5T7LA 5H9FK 1ZAWA 3VZIA 4DZDA 1XJWB 4LR7A 1VK3A 4DMZA 5D4LA 4O44A 1ZM2A 5LMUF 1OO0B 3X3UA 5BJRA 1PBUA 2MQOA 4QBUA 2HLTA 2VJVA 2I9SA 1KR4A 2QLWA 5KFLA 1CC7A 3W66A 3M30B 3M8YA 2RDDA 2W7AA 4L3KA 3V6JA 3FNNA 2ZWPA 3HVWA 1YQHA 4ETXA 2CPDA 2FZGB 4R8UB 2RRBA 3H42A 2W9BA 3MZIA 1B64A 4IOCQ 1S6QB 1HIYA 2JVRA 4ES3A 1X60A 3DLEB 5AXNA 2A1BA 4LRDA 5IV4A 3B4DA 3KUGA 4X64J 3DM2A 4DFMA 1Q53A 2PT0A 4EWTA 2B7BB 2KXHA 3NS5A 2A2CA 2VG6B 4MKVA 2IJRA 2XYPB 3MFIA 2QLJB 3TOQA 4ERDA 1S97A 3JYTA 3BKTA 2O1PA 2CYYA 1AW0A 2DKOB 3FDSA 2J7WA 2PDAA 2YQ0A 1UJ6A 3KMQA 3Q86A 2XGQA 2F8MA 3TZXA 3QGGA 5L46A 2DGWA 4M5NA 2AX0A 2BJ9A 3QRQA 2AP6A 1HNXF 1RISA 2R9LA 1RB0A 2LA4A 2AYGA 3Q23A 4DV7F 1AFJA 2BJ7A 1W25A 1EARA 2VASA 3ITHA 1SIZA 2VQFJ 4DV6J 4DQIA 1HBOA 3IAM9 5DG8A 4YHHF 3GR0A 5EWGA 1T3OA 3D9BA 4NX9A 4OYOA 4C7QA 4LJMA 4BCAA 1HI8A 1F3FA 3CCZA 3LH2S 3I87A 5CABA 3MMCB 4B3SJ 2MZ1A 4KR0B 3SBMA 3UN2A 4J9RA 4OZ0A 3GJTB 2ZZNA 3BN7A 1RCXB 3MCOA 3D6MB 1R6YA 1TQLA 1U1NA 4UUXA 5GADU 1PKUA 2AJ1A 4R0EA 3R5GA 1R89A 3FBFA 3HFVA 2X1GA 2F40A 2GGPA 1RHMB 4N41A 3CO0P 2R7UA 4DL2A 5KOWA 2GVZB 1TKTA 2KYXA 2VD3A 5A8WB 3GV5B 2BE2B 3ZTSA 4GC6A 2AZ1A 4A8XA 4M5DB 1DTQA 3DLBA 5F0UA 3DGPB 4DDFA 4MAKA 3SDEA 3RYLA 2VG5B 5F3TA 3PV8A 4N5SA 4TQSA 3AH6A 2R4FA 2EK6A 4JI7J 1NSPA 3WHIA 2LKZA 4DV1F 2DCLA 1RSCA 3D28A 8ATCB 2JLGA 3DLGB 2IJFA 1BLUA 4WKRA 1CEZA 1B7YB 4XDDA 4TU9A 3QFHA 1DRZA 4NCGB 4C3LA 3D68A 2XS2A 1UJ5A 2I5JA 4LBHA 1RT3A 1S77D 4IYQA 5K14B 2B4OA 2YTCA 1BE4A 3I9ZA 4RW7B 4H4MA 2YNIA 2HBQB 1GMUA 3N6NA 3FCHA 2GAGC 4ED3A 1HWIA 4ZPWR 1RE1B 2LFVA 2BX6A 3M9OB 2W2NP 2D3O1 3H2LA 1GXUA 3BN4A 1EIYB 3OL9A 1FA0A 3R3TA 2DTJA 1DLOB 3GR1A 1L3TA 3CGIA 3PW4A 4ZP8A 1AZSB 2Z2LA 5K9FA 3CUNA 2L9WA 3IR7B 3QMQA 4ETZA 1T11A 1QSYA 4OI3A 1QJHA 1FKAF 2KJWA 4OYPA 3BDEA 3CJ4A 2AU0A 4RW4B 2M88A 4UY8T 2GMHA 1QE1A 4CRJA 1UVKA 2E7XA 4WFBQ 1S4FA 1UETA 4CTAA 1UEUA 4ID5B 4MTPA 2ZUGA 4J9PA 4DR7J 3QSIA 1Q79A 4OMFG 1VQYA 3P45B 2EG1A 3UR0A 4KYZA 4WE1B 1L3VA 2MXYA 1TMMA 5LT5A 3PYFA 1TR0A 4O3NA 1RWUA 4EEYA 3LPYA 1I5OB 4TYAA 1ZTWA 3HSGA 4U7UD 3PEHA 5ETVA 1IBLJ 5FDLB 2VBXA 1SXLA 2RDIA 1IM6A 3MUVP 3SCIE 1HARA 2VBWA 3M8SA 3GWCA 3FFIB 1FWLA 4NCAA 3JSMB 4DEZA 4JYAJ 1K8AT 4JUZA 1V3SA 4LF8F 4RNHA 4BHQA 3MMBB 1WUUA 1GQEA 3OFEA 1NLKL 4OZ1A 4X4OA 1P6TA 4DQPA 3GG0A 1U6BA 1S6PB 4J9OA 1NNDA 5C24B 2H9ZA 3CCUS 2EXUA 2ZJRQ 4ZJLA 4JI5J 3EPIA 1R6VA 3OVBA 3BREA 3UNGC 2BZ2A 3HO1A 4AL6A 1XMQJ 4OHZA 1YJUA 2HNDA 3A8KA 3HT3A 1H0HB 2OFHX 4LF7J 2A2DA 2RJZA 3W5XA 3H2VE 2QLXA 3T1YF 3KUEA 3EUNA 2U1AA 5CYQB 4B9TA 3NY0A 1X4EA 1TK8A 4CLWA 3OPKA 4DG1A 5CQGA 4FS1A 3EZUA 4RUBA 4DQRA 3OL8A 1RKIA 2YWEA 1RP5A 5ETQA 3M32B 3VAJA 4OJ3A 3S6EA 2VA2A 3HM9A 4RUHA 3TAMA 1L5UA 1Q0NA 2DVIA 3GJSB 4HHJA 1WEXA 4K0KF 4RBVA 4DR1J 4OX6A 3HZEA 3HJFA 2CFXA 4KAIA 4ZHRA 1HI1A 2FD2A 5LSLA 3BPSP 3EICA 4NWBA 2ZHAA 1X0FA 4DPUA 3TVKA 3PTWA 4OYXA 5JMNA 1RUSA 4NLWA 1SC6A 4LFAF 5L1KA 3TJ9A 2DK2A 3KLEA 3ISNC 5IWAJ 2ASJA 1HMVB 5CCMA 1K0TA 1U1QA 4X4TA 1JQGA 2EFVA 4EYHB 3F0NA 2R2RA 1HQ2A 1SJQA 2KG1A 4PG7A 1RJJA 2HVHA 1B70B 3T1HF 1MROA 1OPZA 5BR8J 4LF6J 1XN9A 4ECUA 2Y1JA 1H72C 1KTVA 2Y0BB 4KV8B 2WB1D 2V68A 4MIAA 5F8MA 2ZE2B 2DGXA 4PPZA 2ROEA 5KFRA 4OYMA 2E7WA 1R0CB 3FK4A 2V6AA 1UFWA 4F4AA 1FRXA 2ASLA 4NL5A 1S49A 2XC9A 2UXDJ 2PA8D 2BACA 2GMJA 1YRXA 2GJ2A 1LV5A 5F8JA 1JJCB 3TA1A 1DBDA 4PG5A 3I0RA 2W8KA 1HNIB 5B0DA 4ES2A 4URQU 3BH7B 5IT9U 4XIUA 4JI4J 3OFFA 1QSLA 5A2QY 2BMBA 4OZ2A 3TP2A 1OY6A 5F9NA 2C2RA 3OLBA 3O8WA 3AODA 4DF8A 2ZOMA 2EEYA 1HNVA 4F7VA 1LEOA 4NA3A 4CLSA 3OJSA 5BXIA 2HGLA 2C3OA 1TL1A 1V5VA 1PC5A 3IGVA 3O3LA 3PRVA 1RWKB 1XNRJ 2VICA 4U96A 1RT2B 2HVZA 3D7SB 4ANEA 3TI0A 3BKFA 3W1YC 3V6DA 4OLPA 1MU2A 3MECA 3ZO7A 1MG7A 1VBYA 4C4WA 4JI6J 4C0BA 4NYZA 3L4BC 3OTOF 1OSDA 1JXLA 3W61A 2C2ZB 1SH3A 1UFLA 2BABA 1NJYA 2OH2A 2CJBA 1IBMJ 4GC7A 4ZJOA 1S9FA 2BQUA 1U1KA 2DT9A 1LWEB 2RF2A 1VISA 2P8IA 3JQKA 1Z1ZA 3M7VA 4WU3A 2AYEA 2ZJQQ 1M5OC 2ZZTA 2VFTA 3KLVA 3FCVA 4CLUA 4CT9A 4QJVA 3POTA 3US5A 1NSAA 2O67A 2FC8A 1F3VA 2CRLA 3TA0A 1YSJA 4DU7A 4Y34A 3VVTA 4ZOSA 3TZZA 3EZOA 4KQZA 3W64A 1HBNB 3RU0A 5E3RA 4F25A 1GMWD 1NCLA 1BMQB 3AD7C 1WHXA 1WF2A 2FJVA 4DV3F 3OXGA 1XERA 1WWHA 5DZ7A 3OW2R 2J9EA 5D8HB 2OI2A 1B3TA 5EX3A 1TK5A 3U1LA 2BA9A 3ICLA 3W2WB 2KFZA 2C1EB 1EQ0A 2JH3A 4DFPA 2W2OP 3H5XA 2ZC4A 1QAIA 4ZPAA 4UTGA 2OHDA 3OVSA 2DR8A 5C42A 3DLHA 4P6QA 2XYGB 1U4BA 1GEHA 1GTEA 1N56A 5K20B 3GFZA 5LMUJ 1C4CA 4Q43A 5DETA 2F5GA 5DS7A 2JFDA 2CPEA 2OEJA 2RVJA 3SV3A 2MZTA 3W5YA 4X4PA 2FJEB 2ZNYA 4EBEA 3PJXA 3TX8A 2QT7A 4Y2MA 3PG9A 4G6VB 2BRKA 3AA8A 1MN9A 3JSBA 1DTTB 1QAJA 3TUPA 2MLZA 4FNHA 4K4SA 4ECZA 1ULRA 2GAHC 2OD4A 4RW8B 3KK3B 2EBEA 1U02A 1LXJA 5JXSA 1VRTA 3D6TB 3QWPA 4LT6A 1T7PA 1JKHB 1F60B 4OJ1A 4DPYA 2L08A 1U2FA 4RNOA 1HHQA 4CO0A 1FTRA 3NEKA 5GAGI 3VR1A 1KBRA 1FXDA 1ICEB 2AQ4A 4ZKAA 4I6WA 3RJMB 3CD5A 4YFUA 1WORA 1UEKA 3FMBA 4GKJF 1C1CA 2IVYA 3R1HA 4DX8H 4OYIA 1YX2A 1UA0A 2CJ9A 4I6YA 5ETSA 4MMOA 1LW2B 3RB3A 1CJKB 2RAQA 2J0SD 3GU0A 1NKEA 2BBEA 2DYAA 4MKAA 4ZPCA 1FDNA 4QIVA 3A8EA 5IZHA 4X66F 5HQLA 2F9JA 4DV7J 3I4HX 3LGNA 4YHHJ 4DV0F 5I3QA 2JNJA 3MEDB 2C3UA 2E1CA 3HFKA 2E29A 2W25A 3DMJA 2RS8A 1EX8A 1YBUA 3KKFA 4QYZK 3BGRA 4DI6A 2C2NA 3GYGA 4OI6A 3THPA 2ZKUA 5A8KB 3EGVA 2W9AA 3UD5A 3ZXWA 1MMDA 1UW4A 4ED4A 1RBOB 1TUGB 3LUYA 1G1XA 4PQUA 2LQJA 1JXVA 2VJUA 1U1MA 2XWYA 1S1TB 4B3OB 1RT5B 4TVAB 5JJBA 1PYSB 1RGVA 2V5HG 1N88A 3ZTPA 3QJPA 1LFPA 3C14A 1YTYA 3BBBA 4WK3A 3R6GB 3DYAA 4NLQA 3I5AA 1RI7A 3BO3A 4HT5A 1BQMA 1U0SA 3MAAA 1IJEB 3KWMA 1NK6A 4ED6A 2ZH8A 5E3CA 2IRUA 1PBAA 4DX6A 3NCRA 1SKSA 2WSFC 4ZLPA 1KDNA 4ZP7A 5E3QA 1KLMA 2CNOB 4ECVA 1QSSA 1S9EA 4IRCA 4DR2J 3V81B 3C8YA 3R2CJ 2ZBPA 4PG8A 3PW2A 4DV1J 2AHOB 1AB8A 1F9HA 3G8QA 5RUBA 3T6JA 3DOMA 1IKWA 2X1AA 3AHPA 1HQEA 3PVXA 4X4UA 1T0TV 5CZXA 4FVMA 1PILA 1PJ5A 2W2PP 3CJKA 3C16A 3UCZP 2HS4A 3MEGB 2XS5A 3JS9A 3P4UB 3M8QB 3G6ES 4KT0C 3B78A 2JLFA 4PWDA 1K9MT 5KFSA 3T1AA 1PIEA 3QWUA 3HLUA 1DAXA 3VQTA 3DRSA 4KJIA 4I7FB 3BEGB 1K47A 2QX0A 1RLDA 2IM1A 4OYZA 4KGVB 4KO0A 2RU3A 2DBBA 1HWUA 3CCRS 4ZCMA 5HO4A 1B0TA 2K06A 3E01B 2DNMA 4QWCA 2V2KA 2F65A 3KHGA 1DURA 2XBPA 2VOOA 5KFMA 2XM3A 4MKYA 4A8MP 2MHNA 3CJRA 3B54A 3M05A 3Q24A 4HKQA 1NPKA 3SXLA 3HSDA 4C97A 3J7AN 1XR7A 2PO4A 2MTLA 5ETMA 2ZD1B 3ITHB 4CO1A 5HBMB 3DXBA 4ZA1A 2XQCA 4WCEQ 2V2QA 3C46A 4RO0A 1RHJB 1VQKS 1HA1A 1S6OA 4KIAA 2HEKA 3DRPA 3I9V9 1RTJB 3EVOA 2X1FA 4QIGA 5FLXU 2Z30B 3MF5A 4QR2A 2VPWB 4YY3F 4RX6A 3OUYB 1AT1B 1NEEA 2Q79A 2Z57B 3K57A 3NGTA 3CDEA 1NMEB 4R25A 4S0MA 4N77A 2W2MP 5IFMA 1SB6A 2EI5A 1JLCA 1GMWA 2LLZA 4M94A 1RCOB 1REGX 4USTA 1ZM4A 2GJIA 2X7IA 2F7VA 2N82B 3DDIA 2MY7A 2N3OA 2CQPA 1RU1A 4JOUA 1CJVB 2RQMA 4ZLJA 4O3PA 2XSJA 2DXDA 5EX0A 1RTIA 3MDFA 1TAUA 1HWKA 4Y2CA 2G2YA 4PRFA 1FFSB 1YIJS 5CYMB 3UW1A 4HVZA 4IR1A 2ACMA 3I5BA 3K5NA 1Y3JA 2IRYA 2ZOGA 3DOKA 2Q66A 3RR8A 4YB1P 5IV3A 1N4LA 2EFQA 3D5MA 4D3GA 5E3AA 5HJYA 3M6WA 1WKJA 2FHJD 2OIHA 3BM7A 2UP1A 4OX9J 1Q78A 4NLSA 2I5JB 4Y6IA 2NXEA 3HJVA 4Q2LA 1G2EA 3QO9A 1F2GA 1IR2A 1Q8BA 4TLRA 2YNHA 2E44A 2CZ9A 5B7WA 5DG9A 2IYIA 2OKQA 1F5CA 4C3KA 2ZH7A 5KG0A 1IR0A 1KHWA 4ZPDA 3EE3A 2QTWA 2XZDB 4K0KJ 2EC0A 1U2CA 2YWFA 4NI2A 1TU0B 5KG7A 2B9WA 3CCJS 2XMVA 3QJJA 3EX7B 3V4MA 3MOJB 2HRUA 2OAUA 1HBMA 3VAGA 2OGUA 2PN6A 4OIXA 4LF5F 3W2VA 3NGDA 4MFBA 1FK9A 3PFEA 4KFBB 3V2UC 4LFAJ 1D8ZA 3D6HB 1KN6A 4RR5A 2V34A 4CDIA 4KKOA 2YY3A 3Q8UA 4DWIA 3K0JA 2MSSA 3ZZTA 1M5PC 3K17A 3KLHA 2GO8A 5JUMA 1J5OB 2YKMA 2QE5A 3EVWA 3KLIA 2ABYA 2C3MA 4ED8A 1QE1B 1NZ8A 1TTHB 4CTAB 4U95A 4RBUA 2XGPA 5IQQA 3PJWA 4U7UK 4ZMMA 1U09A 3H7HB 2NQPA 2ASYA 3HT0A 3QT7A 5AE2A 1D9FA 2FHKA 4JI0F 2N3LA 2BJ1A 2HMIB 3BGFA 3SSRA 4ZLNA 1U47A 2B7CB 4OZ5A 5E33A 2J7KA 1NAQA 3UD3P 1X4HA 3DRXA 3OL7A 2Z2YB 2P9EA 1N5QA 1VOMA 1U26A 1BXNA 1SQEA 3TO8A 1JLEB 4DXLA 3A12A 2WONB 4PYDA 2B51A 1BWEA 1FKPB 3EPGA 3J7A1 1KOHA 2QLFB 2CQ3A 2YNFB 3DU6A 1HHTP 2DGUA 4KHRA 2A10A 4P7VA 3ZNJ1 3C6TB 1RBLA 1RTDA 2DH9A 2N4CA 1Y00A 3VQSA 1SL2A 1YWXA 3AB4B 3LOUA 4H4OA 4DPWA 1BHNA 4ZVFA 4FF3A 3OTOJ 3CDBA 2GW8A 3CDAA 3PHTA 1FVQA 3IRWP 2Y8YA 5HVFA 3OTCA 2G0IA 2JZ5A 2UUCF 2R2SA 1BC6A 2AEMA 4NXNF 3MM7B 4HLBA 4HL9A 4R8UA 4QQBA 2QRRA 2A6OA 3GJQB 4ECTA 1S6QA 4MIWA 4PEOA 4OJHA 3MR6A 4USKA 3DLEA 3JAMY 4PWUA 3OT9A 1FT8A 4DUYF 4AE5A 2HQDA 2VG6A 2CQIA 2DO4A 1WHVA 3KK1B 1QY7A 5BYSA 2BKOA 4USUA 5B09A 3AB2B 4DPTA 2DNKA 5LXYA 4CLYA 1ZA1B 2EFOA 3RRKA 9ATCB 4DV3J 5B0BA 4B3RF 1NBEB 2D9PA 4F26A 1ZBTA 1X4DA 3GFXA 3G9CA 1VQLS 3DHXA 2A3JA 1YI2S 3SSSA 4NOHA 2GQ2A 2LEBA 3DDKA 1WI8A 3GP9A 1FX2A 3FEXB 1I94F 2D69A 2AX1A 5G0RB 3MGJA 5B0EA 1A9NB 1KVJA 4U6PA 3JTOA 3NWRA 2NUUG 2FLOA 3CC2S 1DQ9A 4OX7A 1LNQA 3QBCA 3M2VB 1YDLA 4WP8A 3ZZPA 4NLGA 4KC5A 3WX8A 3VHQA 4E8UA 3MMCA 1H38A 4ECSA 2F3JA 4PPDA 2J9DA 2FLLA 4DQQA 2L9DA 2E5IA 2VONA 2IM2A 2XLKA 4NZ0A 1I3OB 4NLPA 4JP8A 6AT1B 2GVDB 3KJVB 3NGUA 3CB4A 1VIOA 1C0UA 4NZ6A 3L9ZA 4N47A 4NYPA 2QZ8A 1RWNB 2FVQA 1HYSB 4CI0B 2GVZA 2ZM6F 4GKJJ 3Q8SB 3CNQP 5A8WA 4ECQA 1M1GA 3RAMA 2BE2A 2NZ4A 1KKHA 4QW9A 1OY9A 3DLKB 4FP9A
chains in the Genus database with same CATH topology
1GFWB 2CJYB 1RWOB 2QL7B 2QL9B 3GJRB 2HBZB 1RE1B 2H54B 1SC1B 2C2MB 3GJQB 2Y0BB 4ZVPB 2Y1LB 2FQQB 2XZTB 3KJNB 1PAUB 1RWPB 3D6FB 2H48B 3NS7B 4JB8B 1RHKB 1ICEB 4DCJB 3EDRB 2CNNB 3D6HB 1RWVB 1RHRB 2C2KB 2C1EB 1I51B 3IBFB 3EDQB 1QTNB 3RJMB 1RHJB 3KJQB 3QNWB 3KJFB 3GJSB 3P4UB 2C2ZB 2H4YB 2CNLB 2XYHB 2H5JB 3R6LB 3SIPB 2QLBB 2QL5B 2CNKB 1SC3B 3R5JB 2XYGB 2QLFB 3R6GB 2H65B 5IC4B 5K20B 4ZVTB 1I3OB 2C2OB 2HBYB 2XYPB 2QLJB 3GJTB 4LSZB 4ZVSB 4ZVOB 1RHUB 3IBCB 1RWWB 3D6MB 2H5IB 5IC6B 1IBCB 3R7BB 4ZVRB 1SC4B 1F9EB 1NMEB 2DKOB 3R7NB 2HBRB 4DCOB 2CDRB 4ZVUB 1RWNB 3P45B 2CNOB 1RWMB 2HBQB 2XZDB 1PYOB 1RHQB 1RWXB 2H51B 4ZVQB 3R7SB 1RHMB 1QDUB 2CJXB 1RWKB 2P2CB 2H4WB 4DCPB 1BMQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GFW B;  2CJY B;  1RWO B;  2QL7 B;  2QL9 B;  3GJR B;  2HBZ B;  1RE1 B;  2H54 B;  1SC1 B;  2C2M B;  3GJQ B;  2Y0B B;  4ZVP B;  2Y1L B;  2FQQ B;  2XZT B;  3KJN B;  1PAU B;  1RWP B;  3D6F B;  2H48 B;  3NS7 B;  4JB8 B;  1RHK B;  1ICE B;  4DCJ B;  3EDR B;  2CNN B;  3D6H B;  1RWV B;  1RHR B;  2C2K B;  2C1E B;  1I51 B;  3IBF B;  3EDQ B;  1QTN B;  3RJM B;  1RHJ B;  3KJQ B;  3QNW B;  3KJF B;  3GJS B;  3P4U B;  2C2Z B;  2H4Y B;  2CNL B;  2XYH B;  2H5J B;  3R6L B;  3SIP B;  2QLB B;  2QL5 B;  2CNK B;  1SC3 B;  3R5J B;  2XYG B;  2QLF B;  3R6G B;  2H65 B;  5IC4 B;  5K20 B;  4ZVT B;  1I3O B;  2C2O B;  2HBY B;  2XYP B;  2QLJ B;  3GJT B;  4LSZ B;  4ZVS B;  4ZVO B;  1RHU B;  3IBC B;  1RWW B;  3D6M B;  2H5I B;  5IC6 B;  1IBC B;  3R7B B;  4ZVR B;  1SC4 B;  1F9E B;  1NME B;  2DKO B;  3R7N B;  2HBR B;  4DCO B;  2CDR B;  4ZVU B;  1RWN B;  3P45 B;  2CNO B;  1RWM B;  2HBQ B;  2XZD B;  1PYO B;  1RHQ B;  1RWX B;  2H51 B;  4ZVQ B;  3R7S B;  1RHM B;  1QDU B;  2CJX B;  1RWK B;  2P2C B;  2H4W B;  4DCP B;  1BMQ B; 
#chains in the Genus database with same CATH topology
 2R3V A;  2MQL A;  4YR3 A;  3LWM A;  4M5D A;  3DGP A;  2HGM A;  3U1M A;  2B5J B;  1S48 A;  3AQO A;  2VG5 A;  2Y0S D;  2KT3 A;  3GTY X;  2B0G A;  4F0K A;  3I96 A;  2FTR A;  3ILJ A;  4E98 A;  4CO2 A;  2BYC A;  1X31 C;  4MJK A;  2FHJ A;  3DLG A;  3NP5 A;  2RS2 A;  1ZAX A;  4FYW B;  4GVB B;  4NCG A;  2F63 A;  4P2S A;  1X4A A;  2C2O B;  4K4U A;  3WDO A;  2XI3 A;  4OL8 A;  1AA1 B;  3S01 A;  4C8Y A;  5K14 A;  3PDN A;  1IJF B;  2WSE C;  4RW7 A;  1HFE L;  3PW0 A;  4WJB A;  4XDC A;  1XNQ F;  3FQK A;  2E9Z A;  1NK5 A;  5KFQ A;  1FCA A;  4O4G A;  2UUB J;  2M8D B;  4CNY A;  1IN0 A;  4HAC B;  2V63 A;  3RAQ A;  3GYN A;  4AD6 A;  2HVE A;  1IQT A;  2P2C B;  3GMG A;  5KT5 A;  2LQ8 A;  1Q81 T;  1NPP A;  2HFU A;  2DHS A;  1ROF A;  1DLO A;  3VAM A;  1FRJ A;  1RT6 B;  3R27 A;  1AZS A;  1AFI A;  3WIU A;  4HYK A;  2ZBR A;  2RD5 C;  1Q5V A;  3WX4 A;  1EAY C;  3KMS A;  1Y0H A;  2M70 A;  3CXC R;  4RW4 A;  2QA4 G;  2VFU A;  1SJ1 A;  3N5F A;  3PKY A;  2CNK B;  2KT2 A;  2QSF A;  3R5J B;  4ED1 A;  4RWW A;  4OQJ A;  2MPU A;  3SFG A;  3M6V A;  4IRK A;  1CJT B;  4L73 A;  1Q8I A;  4WII A;  2AT1 B;  2FDN A;  1BWV A;  3KLG A;  4ZDN A;  4L76 A;  1WKL A;  1XIQ A;  2DNG A;  3BH6 B;  2HPU A;  2V94 A;  4C48 A;  2VBZ A;  2F9D A;  2YBV A;  4YDD B;  4URS A;  2BJ3 A;  2FGO A;  4GKK F;  1JXE A;  1SQF A;  2B4U A;  3CD0 A;  3VAI A;  5DM7 Q;  4HTJ A;  2DPJ A;  3UN3 A;  2YQ3 A;  1RT7 B;  1JLQ B;  5FDL A;  2HQG A;  1OJ4 A;  2HGN A;  3OD2 A;  4O4R A;  2H1Y A;  2FJA B;  2R2T A;  5DGB A;  1CQN A;  5GAD I;  3TJA A;  5KFG A;  3FFI A;  3PYE A;  2VH7 A;  3AQP A;  2I0X A;  3JSM A;  3KG0 A;  1N5S A;  4PAB A;  4A46 A;  5GME A;  3IR5 B;  4YR2 A;  2FVS A;  5ETT A;  3MMB A;  1I51 B;  5L8R C;  2V67 A;  3TAP A;  1HNW F;  3MTJ A;  3BB5 A;  2IIH A;  3RBE A;  5E3P A;  1S6P A;  2LXF A;  3T19 A;  3UR3 C;  1YJW S;  4DV4 F;  4PXB A;  3OFG A;  2E9T A;  1C0T B;  2JC1 A;  2LCW A;  3MI7 X;  4ZIW A;  2AYB A;  4QCL A;  2EPI A;  3PW5 A;  2MLX A;  5D0E A;  3BR9 A;  4Q5V A;  5F3Z A;  2CVE A;  3MWB A;  2CZV C;  2PC6 A;  3WZ0 A;  2CDQ A;  1JLG A;  3GYX B;  2Y3Y A;  4FVC A;  3CMA S;  7FDR A;  3PJ9 A;  3LF0 A;  2VOP A;  2Q3P A;  1RAG B;  5L39 A;  3GFY A;  2VQE F;  3H40 A;  1XK8 A;  4HTI A;  2PMW A;  3R5B A;  3M32 A;  3BGR B;  2QFI A;  5L1J A;  2NXN A;  4DL0 C;  4LQ3 A;  2GIF A;  3F44 A;  1GFW B;  1WKK A;  1Y4Z B;  1KP6 A;  1QD1 A;  2CQ2 A;  2B9Y A;  4P2M A;  4V19 X;  1SVD A;  1S7I A;  4X65 F;  1D9A A;  2DY9 A;  1SQG A;  4PQU B;  1RWP B;  4Q8E A;  2KYZ A;  3R2D J;  4KGX B;  1U1L A;  3MUT P;  1RK8 A;  5ETL A;  4FBT A;  2LMI A;  2PA3 A;  2OD6 A;  2XYH B;  3HHL C;  4K2J A;  3PY8 A;  3HD2 A;  2J9D E;  4PR6 A;  1BQM B;  1TFY A;  3NCQ A;  4EO6 A;  3A1Y G;  2FC9 A;  4CO5 A;  3H20 A;  3ISZ A;  2UU9 F;  1BUX A;  4ENO A;  4AT1 B;  5KG4 A;  1RWW B;  4DL6 A;  4DUT A;  1YRU A;  2IRX A;  3R7B B;  3M1V B;  1EKS A;  4BC7 A;  1Y9O A;  3W3S A;  3E3X A;  1S76 D;  4CP5 A;  3OTB A;  3VVU A;  2YH0 A;  1T8E A;  5E0O A;  4OI0 A;  4B9M A;  1RAB B;  4KV8 A;  3LPE A;  2OTL S;  1KTQ A;  3UFC X;  5DDR C;  4OHW A;  2ZE2 A;  3IBW A;  4C2M A;  1FEE A;  1S1V B;  3MM9 B;  2HHH F;  2OPR A;  2XSF A;  3FEY B;  2BOP A;  1NHU A;  4LUB A;  1J27 A;  1Z2Z A;  4WBF A;  1F6T A;  2QN6 B;  2LYV A;  2BM0 A;  2HS3 A;  4RWX A;  3LWL A;  4B17 A;  4WTY A;  1ZOT A;  2JX2 A;  2CKW A;  1EET B;  2N7C A;  3FQL A;  5HP1 B;  2AJQ A;  3QAT A;  1L3S A;  2M52 A;  2P5V A;  4Y28 C;  1HNI A;  2ILY A;  1X0P A;  1W2B R;  3NBP B;  2W7O A;  5GAE U;  2FJB B;  2FPH X;  3N9U C;  3BO2 A;  4RU2 A;  3CD7 A;  4V1A k;  2KVI A;  2ZC3 A;  2VKR A;  3D1Q A;  3UDC A;  4JI3 F;  2KXN B;  4CT8 A;  3G8S A;  1HNZ F;  4A48 A;  1JJ2 R;  3TVZ A;  4X4Q A;  4G1Q A;  1JNR B;  2OML A;  2VKZ G;  1RT2 A;  3WQP A;  1TL4 A;  4A8S A;  2OSQ A;  3ZZZ A;  2PI4 A;  4PQA A;  2WAQ D;  1M1H A;  1WNE A;  3MXH P;  2GCF A;  2C2M B;  3NAH A;  3UI3 A;  5CAA A;  3HSJ A;  3CCQ S;  1TKX B;  2OEK A;  1HLW A;  3SQG B;  2ZFH A;  3ISN D;  3ZTR A;  1TVR B;  2E7V A;  1WC3 A;  3J81 j;  1VYA A;  4EBC A;  3RW6 A;  1M5V C;  1FD8 A;  5EGY A;  1LWE A;  2EWH A;  4O3O A;  1VQ8 S;  5IT0 A;  3PRB A;  4JI0 J;  4Q2M A;  3WC2 A;  3J81 U;  4ZVT B;  4L74 A;  4IFY B;  2BEF A;  2KH9 A;  3UQS A;  4F3Q A;  4OZL A;  2G0C A;  1EB0 A;  4LSZ B;  4ID8 A;  3ZZY A;  3DC2 A;  1T9U A;  3K5O A;  3W7B A;  3NKY A;  1DQA A;  5KG1 A;  1XQI A;  3HVR A;  2XTJ P;  4W90 B;  1HI0 P;  2BRL A;  2WOM A;  2JHE A;  4RW6 B;  1U24 A;  4F4W A;  3C19 A;  1CPZ A;  2HWT A;  1JJ4 A;  1N8R T;  1FJG F;  4EMD A;  1UWB B;  2V4R A;  1VHI A;  1N0U A;  1ZYQ A;  1D1U A;  3W2W A;  2PMH A;  1OMS A;  2H54 B;  3H8Y A;  3BSC A;  3RBX A;  3D3C J;  5DDQ C;  4GVL A;  3MTK A;  7AT1 B;  3KG4 A;  2ZBI A;  1WC4 A;  1QUP A;  1Z2L A;  3CJ3 A;  3LAL A;  4OJG A;  4ZS6 A;  3RBZ A;  3OVA A;  3BZQ A;  3HHK A;  3GIL A;  1T9W A;  2IBK A;  2LDI A;  2OPQ B;  4ZN1 A;  2SXL A;  3UDV A;  3TJ8 A;  4B3M F;  2ILZ A;  4PG4 A;  4P52 A;  3PR4 A;  2UUC J;  2VIH A;  2JVO A;  1N34 J;  3MUM P;  1JLB A;  3ZZ0 A;  3CIZ A;  4CH0 S;  1ZPV A;  2JRS A;  1GNK A;  1H7X A;  2QO3 A;  5HQ8 A;  4CLP A;  3PZP A;  3VZH A;  3VAL A;  1DTT A;  2R7X A;  1IBC B;  1YJT A;  3OJU A;  4P75 A;  1NDK A;  3MUR P;  3MOZ A;  4CWB A;  4RW8 A;  3KK3 A;  5KFC A;  3IG1 B;  4WU2 A;  4NEY A;  4F4Z A;  5KFB A;  1JKH A;  4DUY J;  2MDA A;  4YEA A;  2HRT A;  5ETR A;  3VCD A;  2XWX A;  4ZPT R;  4JV0 A;  3K59 A;  1QVG R;  1NPR A;  4DJB A;  3Q8R B;  1WDD A;  2HW3 A;  1PAU B;  5C2G A;  4B3R J;  2I6W A;  3KLH B;  2MQ8 A;  4ZVH A;  2YKM B;  1JMT A;  3GLJ A;  3TUZ C;  3QNW B;  1S1U B;  1LW2 A;  1CJK A;  2DIT A;  3KLI B;  2R8J A;  2VU5 A;  3P8B B;  4URG A;  1S9G B;  3M6X A;  1YHQ S;  4F67 A;  3D1O A;  1I94 J;  3G8T A;  3ELH A;  1JLA B;  4LBP A;  4HDG A;  4QIE A;  2IVF B;  5KFH A;  1T9T A;  2YWH A;  3MED A;  3R7N B;  2RU9 A;  1OS5 A;  2BQ3 A;  4AUK A;  3KK2 B;  1U25 A;  1N32 F;  1LWC A;  1N33 J;  4U67 Q;  3MD1 A;  4USH A;  5KG6 A;  4DX7 A;  3SCL E;  5A8K A;  2HIY A;  4K5R A;  1WG4 A;  4LF1 A;  1A6L A;  2WVB A;  1NB7 A;  1NDC A;  2IVM A;  3BSO A;  3M2U B;  3BSN A;  2B4P A;  2ZBC A;  4B3O A;  1SJ4 P;  2RT3 A;  1UVM A;  2BAN B;  1PAE X;  3QGH A;  1NK4 A;  3ULH A;  4K50 A;  4DV2 J;  2ZM6 J;  3GSI A;  3NGK A;  5HRO B;  2Q6C A;  3EGZ A;  4PAA A;  2V8V A;  5DM6 Q;  2V0N A;  3TA2 A;  1RAA B;  3OTD A;  4H4O B;  4USI A;  4C8N A;  1F5B A;  3HVA A;  3E51 A;  2XMM A;  3G96 A;  4DCO B;  3V81 A;  1OSC A;  1FX4 A;  2V4J B;  5EUH A;  2V2Z A;  4FKX A;  3CPW R;  4MK8 A;  3AXM A;  1FKO B;  4K8R A;  1PYO B;  4YN3 B;  3FEZ A;  2PMZ D;  4A8Y A;  2CPI A;  4QYZ J;  1V9O A;  4Y2K A;  3LP2 B;  4OV1 A;  4ED7 A;  1H3D A;  2W7P A;  2JEI A;  1VK8 A;  4KHM A;  4Y3C A;  1Q1K A;  5ETN A;  3MEG A;  3H90 A;  4Z37 A;  2E1A A;  3A3O B;  1O5J A;  3M8Q A;  1UJ4 A;  2C2K B;  1CBK A;  2KB2 A;  1YZ6 A;  4OI1 A;  1A7G E;  1VBK A;  4A4J A;  4KTQ A;  3IMQ J;  5J2M B;  1FHT A;  4I7F A;  4DLG A;  2XY7 A;  1PO6 A;  4UUW A;  1TKZ B;  1H98 A;  2PE8 A;  2ZVS A;  3EWG A;  2RHS B;  4K4Z A;  3SZ2 A;  2HLU A;  1GXL A;  2KRR A;  5HL7 Q;  2BKN A;  1SJ3 P;  3D4J A;  4WYL A;  1RZM A;  3BGL A;  1P8G A;  3E01 A;  3AY0 A;  5E5N A;  4M1K A;  3H5S A;  3IM8 A;  4FYV B;  1N48 A;  4LFB F;  4USW A;  3WC0 A;  1S79 A;  5CA5 A;  2AJ0 A;  3J7Z T;  1HW9 A;  3ENA A;  3HHL B;  3VAH A;  3CCV S;  1VMB A;  1REV A;  2ZD1 A;  1D9D A;  2E66 A;  2CJX B;  5HBM A;  2FUG 9;  5ETO A;  1QAX A;  1FO1 A;  2ZNZ A;  4ZCK A;  3GJR B;  3QJL A;  2DEJ A;  3IN5 A;  1N5Y B;  1D3W A;  5E41 A;  4ECX A;  3HKZ D;  1IVZ A;  1RTJ A;  3JQM A;  1APS A;  4EU0 A;  3UVJ B;  3H0P A;  3HVT B;  4GKK J;  3OFH A;  2NXJ A;  1V3Z A;  1H6K X;  1YGY A;  5LJ5 Y;  2J8S A;  3W8G A;  3T6B A;  3OUY A;  2M9K A;  3DXS X;  4FZV A;  2ZHB A;  3VV2 B;  1QM9 A;  3ILL A;  1C0U B;  3C3L A;  2KTQ A;  2HHX A;  3ENV A;  4NLV A;  1UL3 A;  2ADC A;  2DXE A;  1CSJ A;  1CJV A;  3IO1 A;  1LK5 A;  3QQC D;  2ATC B;  2PII A;  5GAH U;  3M4X A;  4J9M A;  4DV4 J;  4WXO A;  1S0V A;  2BR0 A;  2M4M A;  2KZM A;  4TY9 A;  1R8C A;  3LTO A;  4HR2 A;  4XPE A;  4P71 A;  4CO3 A;  1ARO P;  3EZ5 A;  5CYM A;  3EGN A;  1IKX B;  1BD6 A;  1WAC A;  1R8P A;  1T94 A;  4AYB D;  2VF3 A;  1X5O A;  3UDE A;  1J5E F;  3PO4 A;  3JB9 k;  4GO7 X;  2VUG A;  3N79 A;  1BY9 A;  1K0V A;  2DNQ A;  2VQE J;  2NXC A;  3FVY A;  2HVD A;  1XBW A;  4FNI A;  3D0H E;  2ZH2 A;  4DR3 F;  3NS6 A;  2JDJ A;  2M0G B;  1E6V B;  5L38 A;  1JJH A;  1RHU B;  4NPO A;  4X65 J;  5LOQ A;  3KLF B;  3CE8 A;  2YWW A;  4NLX A;  1HQU A;  4O4G B;  1SC4 B;  1JLF B;  2L9N A;  3MR7 A;  3LW5 C;  1RT4 B;  3ZTO A;  4DSF A;  1L3K A;  2QMW A;  4QWE A;  4B3T J;  4RU9 A;  1WOO A;  4LVN P;  4DSK A;  4LRC A;  2G4B A;  4LR8 A;  4NA2 A;  3FMW A;  4QR0 A;  2J5A A;  3O5T B;  4P10 A;  1UPP A;  4KFB A;  2FVP A;  4A8Q A;  5DJB A;  2APO A;  3O44 A;  2UU9 J;  3DI6 A;  1J5O A;  1WTB A;  3ZTQ A;  1KON A;  1TL3 B;  4CH1 A;  1Q82 T;  1ZM9 A;  5DGA A;  2DIV A;  2ZHO A;  3IRX B;  2M5Y A;  5AXL A;  3OSN A;  1UWA A;  4ECW A;  3CMQ A;  2O3D A;  3ZZU A;  4DQS A;  2O01 C;  4QWA A;  5HVH A;  1F9F A;  4ZVE A;  4B9L A;  4ELV A;  1CJU B;  3CCT A;  2J6U A;  1SPB P;  1T9X A;  3KLG B;  1U48 A;  5DQG A;  2Y1I A;  3BQ2 A;  4ES1 A;  1UA1 A;  2DJW A;  1HL6 A;  3MAH A;  4WF9 Q;  2H5I B;  3CF5 Q;  2DHG A;  4HHH A;  4IOB A;  3S8S A;  4F2S A;  5J1P A;  1YKW A;  5H9E K;  5A76 A;  2HMI A;  3GCW P;  2GS8 A;  2HK3 A;  1TAQ A;  3SSQ A;  1Y10 A;  4F0H A;  3UN5 A;  3PW7 A;  1VQO S;  4IO9 Q;  1URN A;  4ZVP B;  3VTI A;  3KHL A;  2D3Z A;  1FDD A;  1TFW A;  1JLE A;  3E8O A;  2WON A;  4LRB A;  3KNG A;  1NHV A;  1D0E A;  4FBU A;  4BWJ A;  4E0D A;  1FKP A;  1KSP A;  1QTN B;  4R5P B;  5D78 A;  2JLE A;  2ZZM A;  3AA9 A;  2R7R A;  2YNF A;  3FJ2 A;  2UZA A;  2MKY A;  4LVO P;  2MJN A;  4TY8 B;  3T5J A;  3MCS A;  3C6T A;  3HHD A;  3RB0 A;  2HZV A;  1KQK A;  3R97 A;  1JLG B;  5HSP A;  4F4Y A;  3M2R B;  5KFU A;  5H1S V;  4C8K A;  1ZH5 A;  2R7V A;  3FC9 A;  2CPZ A;  1IWA A;  2N7Y A;  3F73 A;  5D4P A;  3HCX A;  1MLA A;  2EVZ A;  3VGU A;  3BO4 A;  1UFK A;  3MM7 A;  4DN9 A;  5I3U B;  3HI9 A;  2KG0 A;  3DDN A;  1N36 F;  3L7U A;  1YJ7 A;  4RKU C;  1S1X A;  4M5M A;  4FF2 A;  2OPS A;  2KHD A;  2RH3 A;  2M3D A;  3P6Y C;  4K2X A;  4KPY A;  1ZPW X;  2CJK A;  1WTF A;  1UW9 A;  2YNG B;  3QGI A;  3KJN B;  4LF2 A;  3TUJ C;  3NWG A;  5M2U A;  1VRU A;  7FD1 A;  3KK1 A;  4F2R A;  1VS3 A;  5SZT A;  2VPZ B;  2GML A;  3JSR A;  4JI8 F;  4UOC A;  2OPP B;  3ZZR A;  4PYA A;  1FEH A;  2CIM A;  2JOQ A;  3UCG A;  5AXM A;  2VDI A;  1OY8 A;  2DHA A;  1UTA A;  2UXB F;  1RDR A;  3T9Z A;  4WXW A;  4ZPV R;  2HBY B;  4CIO A;  4Q0B B;  3OHA A;  1TP7 A;  3MM8 B;  2HRY A;  3D67 A;  4J5O A;  2WVC A;  5G0R A;  4CNZ A;  3HZG A;  5I42 B;  4ZVG A;  4QIW D;  1WG1 A;  1PGZ A;  2IHR 1;  3M2V A;  2H4W B;  4UW2 A;  3D0I E;  3AAW B;  3C66 A;  4B3M J;  1RTH B;  2OPR B;  1U7L A;  1AUD A;  5A8R B;  1OYD A;  4I68 A;  3R5C A;  4IR9 A;  2Q43 A;  4YS2 A;  1Y11 A;  1S4E A;  2WBM A;  3IS9 A;  3CTR A;  1WD6 A;  2DD8 S;  1JX4 A;  1RU2 A;  4KHP F;  3CCE S;  1WEY A;  4DSJ A;  3FSX A;  2CQ0 A;  2QGF B;  2GVD A;  3KJV A;  1CC8 A;  4EGL A;  2RRN A;  2E1P A;  2IMO A;  2DNH A;  4F3M A;  2VG7 B;  4I6A A;  2MEW A;  4KGK A;  4ZVO B;  2JEF A;  4WP9 A;  2KXF A;  5J1N A;  4NEZ A;  2YWG A;  1HYS A;  4J37 A;  4G1Q B;  3OXF A;  5K5M A;  1VFJ A;  1HHS A;  4C8O A;  2DR6 A;  1G7C B;  3NCP A;  1WF0 A;  3DLK A;  4IH7 A;  2UVU A;  2EKN A;  2HS0 A;  4J9L A;  3SCK E;  3LQV A;  5CD4 A;  2B5J A;  2BQR A;  2I38 A;  2MQM A;  5J2P A;  5LM7 E;  2XMA A;  2M2B A;  5CXT A;  3VGS A;  2MKS A;  1GAO A;  2GX8 A;  1HD0 A;  1X9W A;  3B82 A;  1DFD A;  3GON A;  3I55 S;  3F56 A;  2WTF A;  1VBX A;  3J7Y U;  4UOF A;  1FVS A;  3H25 A;  1YJV A;  4USM A;  2R8H A;  1SBR A;  1TK0 A;  3I0S A;  3NMR A;  2CUY A;  3MAQ A;  4GVB A;  1RXO B;  4OYA A;  1N32 J;  2XY5 A;  5F8G A;  5FII A;  4CM0 A;  3HK2 A;  3OLA A;  1URR A;  1EP4 A;  2CPF A;  2HFZ A;  4HEA 9;  4X62 F;  2B9E A;  8AT1 B;  3KFW X;  4ZP9 A;  4BWM A;  3A3N B;  2R7S A;  1NO8 A;  5IT4 A;  4YUD A;  1OQ6 A;  4HAC A;  2WOM B;  4LF6 F;  3R5D A;  3DLJ A;  4TN2 A;  3NNC A;  1T95 A;  1F0X A;  3BS9 A;  2BE9 B;  2BE7 D;  3EGW B;  1NK0 A;  1SI9 A;  4EZ6 A;  2C28 A;  4BC9 A;  1RT6 A;  1VBZ A;  3Q22 A;  3M9M B;  2MMY A;  5IT9 Y;  1DHM A;  3P49 B;  3H59 A;  2DNO A;  1T05 B;  4O3Q A;  1FDA A;  2AZ3 A;  3NMA A;  4USV A;  1VLO A;  4JB8 B;  2AD9 A;  4A47 A;  3X1L B;  2KZZ A;  5KG2 A;  2J9C A;  1C1B B;  5LL6 d;  5FJ4 A;  5CZV A;  4MK9 A;  3OBI A;  1CUL B;  4IDK B;  3EMT A;  3OV7 A;  1CJT A;  4LF4 F;  3J80 U;  3BGO P;  1JLB B;  2JEG A;  5KFV A;  2DHH A;  4OLO A;  1J2V A;  3AOC A;  2V2V A;  2W2Q P;  3K89 A;  4WFN Q;  3RRH A;  3A4T A;  1B0P A;  2HZA A;  1JWW A;  2ZDO A;  4F02 A;  4ZVS B;  4RW9 A;  2FVR A;  3Q2S C;  3L7P A;  1SKW A;  4IG0 B;  1RT7 A;  1JLQ A;  3QRR A;  1VDH A;  2I2Y A;  3TQ1 A;  4UY8 5;  1UVJ A;  5C25 B;  3K5P A;  2FLN A;  5HLF B;  1RAJ A;  1NSQ A;  2CQG A;  1FXR A;  2ZH3 A;  1UP1 A;  1KEK A;  1FNX H;  2FYX A;  3MR2 A;  3W9H A;  2GA7 A;  4IKA A;  2HHT A;  5D77 A;  1S99 A;  2C3P A;  2XEX A;  1FI4 A;  1KNZ A;  2DH8 A;  1P9Y A;  4P2X A;  3CJ0 A;  3OXL A;  2L48 A;  2G0J A;  3EVM A;  2YVS A;  2HNZ B;  1JK9 B;  3EDR B;  1Q7Y T;  4QOT A;  1UAW A;  4LFB J;  1S5Z A;  2YKN A;  1TL7 B;  4LFC F;  1HNX J;  4ZP6 A;  4A8K A;  1C0T A;  1IKV B;  4CYU B;  1RYS A;  4F4X A;  4H54 A;  2XHC A;  4AQY F;  3FGV A;  2CQD A;  2VOD A;  4ELT A;  2CAD A;  3DCA A;  3MHY A;  1S1W B;  2R8I A;  4KGM A;  3PCO B;  4JI2 F;  4KRW A;  3VGV A;  1RTZ A;  4C6A A;  2Z56 B;  3FBC A;  3VAK A;  4B9N A;  2N4D A;  2J0Q D;  3G2X A;  1LWC B;  3K7R A;  2K8G A;  5HAO A;  2NUH A;  4M63 A;  4Y2I A;  2HZC A;  4QU7 A;  5GVQ A;  2HIQ A;  3TEG A;  5F8I A;  1MNE A;  3B6B A;  5F41 A;  2FIU A;  3I82 A;  3QAE A;  5HJX A;  3C15 B;  1FWK A;  4CH7 A;  3ZNU A;  1NH7 A;  4JV5 F;  2W24 A;  1FE0 A;  4B08 A;  3R1L A;  2RIJ A;  2OEL A;  3G6X A;  1VQN S;  3RZA A;  2IC3 A;  3R5A A;  4M8L A;  2V8G A;  4O0N A;  4C0H A;  3G6V A;  1B4S A;  1P1T A;  2AJ2 A;  2MYF A;  5F0W A;  4NLO A;  3DHW C;  4G1I A;  5D3G A;  1BQX A;  2XO7 A;  2BJ8 A;  3M1V A;  3L7O A;  1N54 B;  3NGS A;  4ZN3 A;  5IXU A;  3BSA A;  4FKY A;  4JV1 A;  4NLR A;  2HFS A;  3ET6 B;  2AGQ A;  3UD4 P;  1QTM A;  1ZET A;  2KVQ E;  3HF5 A;  2OLW A;  4GMK A;  1J5E J;  3LAN A;  4OFZ A;  1AXQ A;  2MKI A;  4UQT A;  1VQ6 S;  3GIM A;  3TR5 A;  4AL5 A;  1LQ9 A;  1RAE B;  4AXJ A;  2ZH5 A;  2HVI A;  1S1V A;  4I2Q A;  3MM9 A;  2UUW A;  4QU6 A;  4N7T A;  1R0B G;  3D0G E;  4DR3 J;  1SC1 B;  2NXU A;  3PIO Q;  1S59 A;  4J9K A;  1SJR A;  3T5H A;  1X4G A;  5C7P A;  1EET A;  4WFA Q;  4ANC A;  5BYQ A;  2VV5 A;  1VJW A;  3ETO A;  5HP1 A;  3KJQ B;  2XUL A;  3SFU A;  4NRU A;  5FD1 A;  3P96 A;  4WP3 A;  1EJ7 L;  3NBP A;  1P27 B;  3GSD A;  2KDO A;  3UO0 A;  1YZ7 A;  2H65 B;  3H5Y A;  1N5T A;  4PUO B;  2AJF E;  3L09 A;  3QFW A;  2D9O A;  2JL9 A;  3RB6 A;  1U8S A;  3DN9 A;  5IC6 B;  1NH8 A;  2MQP A;  1X7V A;  5ITH A;  2KFN A;  1REV B;  2DCU B;  4LSN A;  3IFE A;  3GFH A;  2FY8 A;  3ETM A;  3HHL D;  4B9S A;  3N4W A;  3TEH B;  4NRT A;  4ICL B;  1FFW B;  5ETK A;  2A0F B;  4P9S A;  1Q8L A;  2MQQ A;  3CT9 A;  1WEL A;  4L72 B;  1TKX A;  2Q6B A;  5HVG A;  2XMT A;  4WK1 A;  3SQG A;  1RA6 A;  1TVR A;  1WSV A;  2MZJ A;  3NOC A;  3G86 A;  2YKA A;  5KFD A;  4LRE A;  1WDT A;  4MH8 A;  2ZOF A;  4TYB A;  3D1H A;  1P9Q C;  1NU4 A;  3LP0 B;  2E1R A;  3MR5 A;  2C3Y A;  3O2I A;  4C8L A;  1XMO F;  1FF2 A;  4B02 A;  1PCA A;  1H2U X;  3V4I B;  4IFY A;  2EFN A;  2LQB A;  1FER A;  4J90 A;  5F9L A;  4WFY A;  2HQI A;  4WPA A;  3IAS 9;  2I8E A;  2VHG A;  2ZIT A;  3AJ2 A;  4LF8 J;  4FF1 A;  4DR2 F;  1R31 A;  5AE3 A;  2PEB A;  3HP6 A;  2WVF A;  4WWS A;  4RW6 A;  4HHU A;  5D4N A;  1YIT S;  1UWB A;  2FZC B;  1FNO A;  2C2E A;  2G2Z A;  2L3M A;  1Q86 T;  3G82 B;  3NL0 A;  4KH0 B;  2ROG A;  4DCP B;  1SL1 A;  2CPJ A;  3AFG A;  3KHR A;  4X4R A;  3BQ0 A;  3T1Y J;  4FXV A;  2IAJ B;  1JNZ B;  2XZT B;  1NHK L;  2P6T A;  2OPQ A;  5AJ3 F;  3CJS A;  1S72 S;  3RAX A;  1FRL A;  2POK A;  2CQH A;  1BQN B;  2PGC A;  4EO8 A;  5J2N B;  1SCJ B;  2XY6 A;  4FN5 A;  1W2I A;  4D3H A;  3NNH A;  1LWF B;  2K2P A;  1G4C A;  1N36 J;  2XNR A;  1IKY B;  1HQU B;  1ZZN A;  2M7S A;  2NLW A;  4OX8 A;  2HAF A;  2HKE A;  1M1K T;  3IG1 A;  2FLP A;  4DR5 F;  2J0X A;  4J9N A;  2LP4 A;  5D4O A;  4ZVU B;  2DIS A;  2EC2 A;  5FLX Y;  3N0V A;  2YH1 A;  4JI8 J;  1Y3K A;  1VCT A;  5B0A A;  5GAE I;  4XPC A;  3ENW A;  1ZM3 A;  2XMJ A;  3UWT A;  2D3O R;  1XC9 A;  2KM8 C;  1SH2 A;  3BBC A;  3MR3 A;  5A0Y A;  3LO3 A;  2RQ4 A;  3DI6 B;  2UXB J;  2GIQ A;  2QL7 B;  2V8H A;  2B3T B;  1IUJ A;  1GX5 A;  2V8D A;  2ZBQ A;  1S1U A;  1M5S A;  2RQC A;  1S9G A;  2D41 A;  3IBF B;  5ETP A;  1FDB A;  3T1H J;  3BF4 A;  2G13 A;  2QIF A;  2RUG A;  2P9G A;  4KE5 A;  4QWB A;  4WFZ A;  5IOL A;  5L1I A;  1Q5Y A;  1TV6 B;  1JLA A;  1U8W A;  1UEV A;  2MGZ B;  4W98 A;  4G1P A;  1Q7L B;  1HBU B;  1RT1 A;  4A8O A;  4CQ1 A;  3FCW A;  1W7W A;  3LGH A;  4M5I A;  5M2R A;  3KK2 A;  2W9C B;  3W9I A;  1X8D A;  5I4M A;  3BDP A;  4WZQ A;  2W4D A;  3EM1 A;  2ZVI A;  4Z7Y A;  4ZK7 M;  1HR0 F;  2UUA F;  2W8L A;  1X9M A;  3NXZ A;  4ZCI A;  2IYG A;  3RW7 A;  1FES A;  3FBE A;  3TZY A;  3ILO A;  1IQZ A;  3M9N B;  2VC0 A;  4KHP J;  4TU8 A;  3M8P B;  4O23 A;  3BGU A;  2DGV A;  2G2O A;  2CG8 A;  3M2U A;  2YWK A;  4L3N A;  2IFX A;  3KXD A;  2X3G A;  2BAN A;  3BQ1 A;  3N28 A;  2PFF B;  1X4B A;  4WKY A;  3NNA A;  2QYG A;  1YVF A;  1VQP S;  2AWZ A;  5KFW A;  4YME A;  1HW8 A;  1CS4 B;  3IA0 A;  5THW A;  5HI7 A;  4OX9 F;  2HHP A;  1R0A B;  2D3U A;  2MHE A;  5HRO A;  2W01 A;  4K59 A;  2A18 A;  5A2Q U;  1E6Y A;  2DB1 A;  3PM9 A;  1WEZ A;  2QA4 S;  2GFF A;  2VDH A;  1L3U A;  2PSZ A;  4UOH A;  3TQE A;  2DO0 A;  3KG1 A;  1BGX T;  1OQ3 A;  1AYE A;  4NYO A;  4KH1 B;  4NML A;  2V4J A;  1IBK F;  3CDU A;  4BS2 A;  1NKB A;  2E5H A;  2HNY A;  1FKO A;  5CD4 H;  1O6X A;  4IG3 A;  1UCN A;  3QID A;  4F50 A;  3LP1 B;  3LP2 A;  2LDY A;  1HPZ B;  1MWY A;  1ZZF A;  2OFG X;  5KFO A;  1S1X B;  2OPS B;  4IUF A;  5KFI A;  1GXT A;  2OUG A;  2BW2 A;  4IQM A;  4X62 J;  1RAH B;  2HHW A;  1YLX A;  5KFX A;  2DRD A;  1VRU B;  2ZUA A;  2ROP A;  4Y2A A;  4DUZ F;  1T3N A;  3C6U A;  1QAY A;  5LSO A;  3D6F B;  4UZB A;  2QYC A;  2XO6 A;  5J2M A;  2KHC A;  1DZ5 A;  3MPD A;  1TKZ A;  1VQS A;  2VC1 A;  1ZS6 A;  1SV5 B;  3A13 A;  4X4S A;  3TYT A;  3VGT A;  2IA0 A;  2FGC A;  3FRY A;  2LEP A;  4K4T A;  2DR5 A;  2WZ1 A;  5H9F J;  3TRG A;  1FJE B;  1CVJ A;  4DN0 A;  2AF6 A;  4I4B A;  1FTC A;  3MD3 A;  2KN4 A;  4O3R A;  2WCX A;  4QIF A;  1X9S A;  3IBC B;  1SJF A;  2IY5 B;  1TL5 A;  4NLU A;  6FDR A;  2LEA A;  3HXM A;  2UXC F;  3I56 S;  3HHL A;  4NAS A;  2BOA A;  1FJC A;  3TAR A;  2I1R A;  2Y1R I;  5KG5 A;  2RKI A;  3QSY B;  1Q95 G;  2QFJ A;  5BYR A;  2DGT A;  1IWG A;  3G6Y A;  4Y00 A;  4F8R A;  3MPU B;  2ZH9 A;  3JTP A;  1KHV A;  3R7S B;  4LF4 J;  4TKT A;  2K3K A;  2RML A;  2K1R B;  2HYI B;  1UZD A;  1N5Y A;  3T5K A;  2J7U A;  2OTJ S;  3CD6 S;  1ZAV A;  2HG4 A;  4QZV B;  3IS9 B;  3UVJ A;  2ALZ A;  4XTT A;  3HVT A;  4OV6 A;  2CWX A;  1NKC A;  2BXJ A;  2FZK B;  2GJF A;  1A0O B;  4Z2X A;  2NYH A;  2XCP A;  2R2U A;  2DR7 A;  1YJN S;  1XR6 A;  1KD1 T;  2BDP A;  3NRB A;  4PCQ A;  2F4V F;  4O3S A;  2U2F A;  2QV6 A;  3BR8 A;  4NZ7 A;  1X5S A;  2E5L F;  1U45 A;  3G71 S;  2YX4 A;  4CO4 A;  2DNN A;  2HHV A;  1NZA A;  4QWD A;  3QIP B;  3TVY A;  2HQ3 A;  2XG8 A;  1LOU A;  4IRD A;  1RAC B;  2ZH6 A;  4LFC J;  4HI1 A;  2YKP A;  2ADB A;  1CQM A;  3FZB A;  4N8N A;  3P5T L;  2FJW A;  1KRP A;  4X66 J;  1IKX A;  2IM3 A;  5J2P B;  4AQY J;  3LAM A;  1JIH A;  4K4W A;  3M8W A;  3TAN A;  4PXC A;  1Y7P A;  4BLG A;  3MEE B;  4JI2 J;  4QR1 A;  2QL9 B;  4F4K A;  4DV0 J;  2FHO B;  3I32 A;  3I0S B;  5CH7 B;  2XMU A;  4DX5 A;  1SKR A;  3RR7 A;  5HMX A;  3KJF B;  4NA1 A;  2H4Y B;  1EP4 B;  2WBR A;  1U0H B;  2HWH A;  2NYI A;  4X84 A;  4ATN A;  1E6V A;  2HFO A;  3KLF A;  1O0P A;  3OR2 B;  1RYR A;  4J9S A;  2GNK A;  3GCX P;  1JLF A;  2DY1 A;  1YK9 A;  3OR1 B;  5EWE A;  1RT4 A;  2YKO A;  1VLY A;  4A8F A;  4JV5 J;  1Y5N B;  3B4M A;  1FXL A;  1TUW A;  5LSR A;  3SV4 A;  2QEX S;  3T41 A;  3FBB A;  2DEI A;  2AIR B;  4FF4 A;  3SEO A;  4OI4 A;  3MM6 B;  4CLL A;  1HD1 A;  3AJD A;  1TL3 A;  5CCL A;  3Q0A A;  3KUH A;  3RBD A;  3IRX A;  3W65 A;  3RRG A;  5K8P A;  5KFF A;  4NE9 C;  3DRR B;  4CLF A;  1RHK B;  2ZDP A;  5D0H A;  1KLN A;  1S0N A;  4F04 B;  2AJ4 A;  2UUT A;  4KSE B;  3BYR A;  2LXU A;  4YP3 A;  2WK4 A;  4LSL B;  3G4S S;  2KT5 A;  2MST A;  2BW7 A;  1CJU A;  1PYT A;  5KFA A;  3SIP B;  1NJI T;  2J0W A;  2JSX A;  2HFN A;  4WFX A;  3CCW A;  2HK2 A;  5DRK A;  3GII A;  4RW9 B;  1DY3 A;  2CG4 A;  1K1S A;  4TQR A;  1EKR A;  2GZO A;  1PJ7 A;  2CPH A;  4ELU A;  2B9X A;  2B6A B;  1SH0 A;  1RLC L;  5J1E B;  3DGV A;  1VI7 A;  3OQ2 A;  5B0C A;  3KOA A;  1PG5 B;  3EJM A;  5LJ3 Y;  3H98 A;  3W60 A;  1ELO A;  2ZH4 A;  1NJZ A;  3SQO P;  2DGQ A;  4C11 B;  2NS1 B;  3U02 A;  1VHF A;  2IBO A;  1QVF R;  4DOZ A;  4R5P A;  1S57 A;  1DJ0 A;  4IFV A;  1S0O A;  2YKN B;  4AXI A;  5GAH I;  3KNA A;  2HAI A;  3PX4 A;  2KU7 A;  2QG9 B;  2QJ3 A;  1RWV B;  5K8M A;  1UVI A;  3K58 A;  2RUS A;  3CME S;  3H5U A;  4IQX A;  4TY8 A;  1KWM A;  3QT6 A;  1SUQ A;  1KC8 T;  3IC1 A;  2J8A A;  2H5E A;  4PWW A;  2QL5 B;  4DL7 A;  2KM8 B;  3IGN A;  2DNR A;  4WTO B;  3M2R A;  4Y65 A;  4LIW A;  4WYW A;  4O0I A;  3MM5 B;  4J9Q A;  2UUB F;  2X51 A;  5KAK A;  1XR5 A;  1R27 B;  1LW0 B;  3FKB A;  1WOS A;  5KT6 A;  2C42 A;  5H9E J;  1Q16 B;  1GH8 A;  5KFP A;  3KHH A;  2X3D A;  5I3U A;  5IM0 B;  4I2P B;  3R8Y A;  4YY3 J;  4IH6 A;  2OSR A;  1XMO J;  3PIP Q;  4ZIV A;  3DRY A;  1RHQ B;  3L95 X;  1UKU A;  4H4K A;  2XS7 A;  1T9V A;  3ZC4 A;  4ZLL A;  3MMA B;  1DAR A;  5T7L B;  2YNG A;  4C9D A;  2VPY B;  4DR6 F;  4O44 B;  1ITP A;  2IC3 B;  3I4P A;  4ITS A;  3O6Q A;  2OPP A;  5KT3 A;  4AFF A;  4B9U A;  3V5R A;  6FD1 A;  2CNL B;  3P3D A;  3R6L B;  5D3G B;  2W9B B;  4RUC A;  2H3E B;  3QZ7 A;  4Q0B A;  3PX6 A;  4I1T A;  3MM8 A;  1WJ9 A;  4P74 A;  1WI6 A;  2FY1 A;  3F41 A;  3DM2 B;  4TNO A;  4JI1 F;  2Z2M A;  2HHS A;  1C4A A;  4K5S A;  5I42 A;  3PAC A;  3PKM A;  4RNF A;  3GV8 B;  5DDP C;  4DV5 F;  3CC7 S;  5DLG A;  2CZ4 A;  5AJ3 J;  3NLC A;  3K8W A;  2D74 B;  3JYT B;  3MPY A;  4ECY A;  4I2Q B;  2Q1L A;  2FJX A;  1RAO A;  4F3O A;  1RTH A;  2EFP A;  1HWL A;  5A8R A;  2WSC C;  4ED2 A;  3IR6 B;  1TKD A;  5EWF A;  2MKJ A;  5B08 A;  2GHW A;  4I69 A;  3TUI C;  4WIQ A;  4FXW A;  5GMK a;  3Q2T C;  2RQK A;  1NJW A;  3CIM A;  3PNI A;  2W4C A;  4LRA A;  4DCJ B;  3MEK A;  2G1D A;  2Z0G A;  3CCM S;  4DR5 J;  3PXG a;  2BV3 A;  4NXM F;  2MZQ A;  1OPI A;  2C22 A;  2VG7 A;  4M5K A;  4LF5 J;  1HBO B;  2VL1 A;  4NCB A;  1G3O A;  3DOL A;  5HMZ A;  2XNQ A;  2B4V A;  4DL3 A;  3AD8 C;  2ERR A;  2DR9 A;  3N5B A;  4LSN B;  2IPO B;  1YBT A;  3C2P A;  3HX9 A;  4MT1 A;  3HUL A;  3Q89 A;  1GX6 A;  5HAN A;  2UV8 A;  2LQ5 A;  1KQS R;  3GIJ A;  3GQC A;  4MYT A;  1D09 B;  2ZJP Q;  2RHQ B;  2K7J A;  2WW8 A;  2CXE A;  2IJN A;  3FSY A;  2CJY B;  4TU7 A;  1RWO B;  1GK8 A;  2GGP B;  2VA3 A;  4QPX A;  5U47 A;  3MCN A;  3DLL Q;  3W8P A;  1TKT B;  2HUR A;  3AXK A;  1R7I A;  2OO4 A;  2EW9 A;  5D0R A;  1R8B A;  2F8H A;  1HR0 J;  2ZEJ A;  3UPF A;  2UUA J;  4A8W A;  2NR0 A;  3RB4 A;  3M6U A;  4J7C A;  1DTQ B;  3SDE B;  4XO0 A;  3QPI A;  4IO1 A;  1R8H A;  1MWZ A;  3EYZ A;  2C2D A;  2CQB A;  5B0G A;  2DRA A;  4KPC A;  2XCA A;  2E9R X;  3W5Z A;  1FJ7 A;  3MPW A;  4ECR A;  2HBR B;  1VC0 A;  4DSL A;  4KBI A;  3CO9 A;  3QYY A;  1MWQ A;  3ADA C;  4C98 A;  3SYZ A;  3AOB A;  1RT3 B;  3VWS A;  1T05 A;  1N6Q A;  1RKJ A;  3ILI A;  2AEF A;  2Z2Z A;  1I6J A;  2NSC A;  4KY3 A;  4H4M B;  2YNI B;  1T03 A;  1NK9 A;  5J2Q A;  4J9V A;  3HSZ A;  4FYY B;  1C1B A;  2V8P A;  2NZC A;  5HK4 A;  1Y5L B;  2Z58 B;  1CUL A;  5EDW A;  4IDK A;  1IBK J;  2CPY A;  1T9Y A;  1U49 A;  4NXN J;  2DXF A;  1N5V A;  4I67 A;  3PEJ A;  4QPT A;  4U8Y A;  2X1B A;  2F4F A;  4ZJQ A;  4C8M A;  3O1L A;  4DR4 F;  2BKP A;  4ILM A;  2WHO A;  2MKK A;  4IG0 A;  2V50 A;  2DGO A;  3LAK A;  4NMX A;  2VFR A;  1U6F A;  5C25 A;  2DNL A;  4DUZ J;  4RLE A;  3BYP A;  3AT1 B;  2UVR A;  5HLF A;  2JC0 A;  3SI8 A;  2CDR B;  4YDX A;  3GIK A;  3SMZ A;  1ZA2 B;  4HH0 A;  5KT2 A;  2BM1 A;  4ALZ A;  3J81 Y;  2WW4 A;  1NK7 A;  5A0Y B;  4ILR A;  3BKU A;  2KL8 A;  3JAM U;  5EHH A;  2R7Q A;  3CSK A;  1S6U A;  4EK2 A;  2HNZ A;  2HBZ B;  2NCK L;  3BBF A;  1TL7 A;  2BJD A;  4EBD A;  3U1N A;  2XHW A;  2B8P A;  1CLF A;  1LXN A;  1IKV A;  4CYU A;  2UXC J;  3BV8 A;  1MSW D;  1WC5 A;  4MIB A;  1S1W A;  1U1P A;  4H4K C;  5IS2 A;  3T9N A;  5E2Q A;  1HWJ A;  4OZ3 A;  2H5J B;  3PRD A;  3K8V A;  1HKA A;  2QLB B;  2QC3 A;  1RT1 B;  3CJT A;  2F8E X;  4DLE A;  4JBC A;  1WF1 A;  4P2F A;  3QLH A;  4LRF A;  4IH5 A;  3J7Y I;  2BVZ A;  5IQ6 A;  4C3M A;  2AYM A;  4F0M A;  4LF9 F;  4FDF A;  4ZVR B;  4M5L A;  3CJQ A;  1VIX A;  2HFV A;  2R8G A;  2V9K A;  2VPX B;  2HND B;  1X4C A;  2AEJ A;  3C15 A;  1H2T Z;  4TLQ A;  2H51 B;  2ASD A;  1U2R A;  3Q8Y A;  3TW0 A;  4DF4 A;  2CQ1 A;  3QZ8 A;  3TWZ A;  2VBY A;  3FUY A;  5LMN F;  2F4V J;  2DNZ A;  2DGS A;  2P9C A;  5L9N A;  4OHY A;  5KFN A;  1MW7 A;  2KJV A;  3S7R A;  4DG1 B;  2W1B A;  2E5L J;  5KFJ A;  4EFA C;  4X4V A;  3IWL A;  2JJ4 D;  3NS7 B;  2H48 B;  4DFJ A;  1O51 A;  3M30 A;  1MML A;  4DS4 A;  1N34 F;  1E6Y B;  2UVW A;  4RJV A;  3TAM B;  4K4X A;  4RNM A;  2PFD A;  4FPR A;  3OSP A;  3PYG A;  2FVC A;  1V3R A;  1EQM A;  1NB2 A;  4FS2 A;  1PC4 A;  3ENQ A;  3ET6 A;  5F8N A;  2GQC A;  4ZHR B;  2HNY B;  4ZPB A;  4IG3 B;  5AT1 B;  1K73 T;  5KFE A;  4L75 A;  3SCJ E;  1LKZ A;  4G3I A;  1R8A A;  1VQ7 S;  4LIR A;  5C5J A;  1YRT A;  1M5K C;  2CPX A;  2R42 A;  3T3F A;  3G87 A;  3KLE B;  2JEJ A;  4Y0F A;  1YJR A;  5MAO A;  3T5L A;  1VRQ C;  1U6Z A;  2GO9 A;  2D7S A;  1FD2 A;  3C6U B;  1XNQ J;  2B43 A;  3NGR A;  1B7F A;  4DZ6 A;  4UT4 A;  1P1L A;  3JXO A;  4LR9 A;  2IDE A;  4BDP A;  5KT7 A;  1VC6 A;  2B8Q A;  2DPI A;  1MRO B;  1RAI B;  3MFH A;  2MLY A;  1WG5 A;  2WVE A;  5D6G A;  4UOG A;  4X4N A;  1H74 A;  1NJX A;  5DO2 A;  4WZM A;  3TX0 A;  4NLY A;  4EUV A;  4U8V A;  3DKD A;  4PUO A;  2DNP A;  4B9V A;  1YG0 A;  1Q4R A;  2KI2 A;  1SC3 B;  4OI2 A;  3GV7 B;  3D54 A;  2XI2 A;  1FE4 A;  4DFK A;  1V6H A;  1FRK A;  2YQ1 A;  1N33 F;  1VGY A;  2ZWO A;  1W26 A;  1NRK A;  1YBA A;  3Q83 A;  3GZ7 A;  2RKI B;  2LXI A;  3I0R B;  2GHP A;  2R7O A;  3FZ2 A;  2NPF A;  5GAG U;  1RAD B;  4ICL A;  2PEH A;  4HT7 A;  4MK7 A;  1TZ0 A;  3AOA A;  1M0S A;  2YX1 A;  1DQ8 A;  1XWL A;  3W63 A;  1M5H A;  1SKU B;  1GTH A;  2DIU A;  4ED0 A;  4PXD A;  3THV A;  2W4P A;  3EXY A;  1CG2 A;  4L6V 3;  1HNV B;  1LK7 A;  4M5G A;  2Y9H A;  1TL1 B;  3LP0 A;  4DV2 F;  5KG3 A;  2F1F A;  2AGO A;  2WB4 A;  2CQ4 A;  4RBT A;  4W4M A;  3FRZ A;  4ZCL A;  3CWJ A;  3V4I A;  1QUV A;  4U7C A;  3CED A;  2J76 E;  3CC4 S;  1KQG B;  3V6D B;  1MU2 B;  3MEC B;  4RPF A;  1U1O A;  2MJU A;  3RGI A;  2UV8 G;  2QMU B;  4QYR A;  3UDL A;  3H2U B;  2ACY A;  2KFY A;  3I31 A;  3V6K A;  1HNW J;  5A6W A;  3ZZO A;  2CVI A;  3D66 A;  3THT A;  5DG7 A;  2RF2 B;  4Q7A A;  1RA7 A;  3G82 A;  5HMY A;  2E5G A;  5K8O A;  5KT4 A;  1SIW B;  1RWM B;  3UNY A;  1MN7 A;  4OZN A;  4X64 F;  5JVG Q;  3POT B;  1RWX B;  1IM4 A;  3GIR A;  2CJQ A;  1NSK L;  1ZTT A;  4N8O A;  4NLD A;  2IAJ A;  5MLC V;  3CUL A;  4XK8 C;  2J6S A;  1BQN A;  1O8B A;  5J2N A;  1VQ9 S;  4LMZ A;  3LGM A;  3IWX A;  3CDW A;  1LWF A;  2OMO A;  4AND A;  2DHX A;  4OYW A;  2RIL A;  8RUC A;  5EN1 A;  1IKY A;  5T41 A;  4J9U E;  1B99 A;  4W92 B;  3IP0 A;  4CCH A;  4P72 A;  4K4Y A;  3HHE A;  4M95 A;  5C42 B;  4AL7 A;  2Y8W A;  2V4Q A;  2JWN A;  2PI5 A;  3RUB L;  5DZ6 A;  1S12 A;  4XAK A;  3R9L A;  4DR6 J;  3BPD A;  5C2C A;  2XLI A;  2VQF F;  4DV6 F;  3TZW A;  3K5L A;  5F8L A;  2E1M C;  4ID5 A;  4E2F B;  1VJQ A;  1KQF B;  2XMW A;  4LQ9 A;  2CQC A;  2GQQ A;  4B3S F;  2LU2 A;  3N6M A;  3CJ5 A;  3E2E A;  2EFG A;  3IM9 A;  1S7H A;  4WE1 A;  3HFZ B;  4G65 A;  1G6B A;  1NDL A;  1D8Y A;  2VFV A;  4Q8F A;  3VF0 B;  1WHW A;  2LVW A;  1IXK A;  4HDH A;  1VRT B;  5HMW A;  4YB5 A;  5L1L A;  2DRB A;  1K44 A;  1KFD A;  5KFZ A;  4JI1 J;  1S0M A;  1F5A A;  2LQ9 A;  2AKW B;  1ACM B;  4EYI B;  4DV5 J;  2FHM A;  1TV6 A;  2HQC A;  5I3P A;  4CM2 A;  2MGZ A;  3W9J A;  3PFO A;  3LA0 A;  2ZH1 A;  2L41 A;  1PSD A;  1HBU A;  2J6T A;  1TEL A;  1UPM B;  3CJ2 A;  2HHH J;  3S1T A;  2W9C A;  1C1C B;  5IC4 B;  3FSI A;  5KFK A;  4P73 A;  2AGP A;  4RZR A;  3D3B J;  5CHC B;  2JFK A;  1OIA A;  5C24 A;  1OYE A;  5AXK A;  5L9X A;  2CWK A;  1WOP A;  4DBQ A;  5A6P A;  2OP5 A;  3PYD A;  3M8P A;  1GMV A;  4M5H A;  5D15 A;  2FB0 A;  2ALY B;  4C8Z A;  1X4F A;  4JI7 F;  5KFT A;  3GPA A;  4NXM J;  1S10 A;  3A8J A;  4ZVQ B;  1NUE A;  2RSQ A;  5CYJ A;  3K5M A;  4JI3 J;  2ATL A;  5CYQ A;  3I6P A;  5AE1 A;  4R0J A;  3CCL S;  4IFV B;  1CS4 A;  1H2V Z;  1HNZ J;  3JSY A;  3DMJ B;  4UF4 A;  1R0A A;  3HKW A;  1T02 A;  2E5J A;  4MKB A;  1RHR B;  1SUQ B;  3CJ8 A;  4DU8 A;  1VQ4 S;  4KB7 A;  2ZKT A;  1TUV A;  1LWX A;  1Y5I B;  2D1C A;  1PJ6 A;  1VR6 A;  1LFW A;  2MY8 A;  3K2Y A;  1NM2 A;  4UQG A;  2GC8 A;  1UVN A;  4B3T F;  2HHU A;  1XEZ A;  2RDJ A;  3C14 B;  3LP1 A;  3DYA B;  2YPZ A;  1HPZ A;  3P5B P;  3OL6 A;  2RB7 A;  4USJ C;  4CLK A;  3MAA B;  2QA1 A;  5T14 A;  2VB6 A;  1VQ5 S;  4YB6 A;  5JVH Q;  2G1H A;  1HMV A;  1RAF B;  4OYB A;  1KLM B;  5M2P A;  4FYD A;  4PKD B;  4Q44 A;  3D2W A;  1S9E B;  2HSE B;  4BBY A;  4J91 A;  1C2P A;  2EBG A;  2EG2 A;  3QRP A;  2MKH A;  4C0O C;  4CLZ A;  2CJA A;  3H4D A;  1Z4U A;  1SV5 A;  4DR7 F;  1IR1 A;  2CNN B;  1FJG J;  3DOM B;  1IKW B;  4ER8 A;  3EDQ B;  1QLN A;  1HQE B;  1H7W A;  4K7Q A;  4CLT A;  4DS5 A;  1I1G A;  3CJK B;  2FJD B;  1VC5 A;  3C16 B;  3PX0 A;  2NPI A;  2AV5 A;  3CW2 C;  3U27 A;  1IBL F;  4PWD B;  4DSE A;  4U9R A;  2HHQ A;  3B8H A;  4YB7 A;  2QSW A;  3DRS B;  1FRH A;  4K4V A;  3CVK A;  2Z8Q A;  4JYA F;  2HWI A;  2XLJ A;  1M90 T;  4KO0 B;  4I56 A;  4DSI A;  1X5T A;  3WIV A;  4Z7C A;  3TNV A;  2CA9 A;  2K1R A;  2LEC A;  4OHX A;  2RNE A;  2MQN A;  3QGP A;  3J7Z 5;  3MPV A;  5KTQ A;  1WC1 A;  2GHV C;  4JI5 F;  3L3C A;  1KVK A;  4DR4 J;  1R43 A;  1RQ0 A;  2NSB A;  4ILL A;  4CZC A;  2COL A;  1XMQ F;  2GV1 A;  2VFS A;  3V6H A;  3TAQ A;  2IMW P;  3NG8 A;  4LF7 F;  3HD1 A;  3HDS A;  2DNY A;  2OEM A;  3DOL B;  3OTE A;  4V19 J;  2EKY A;  2PD1 A;  2RRA A;  4M5J A;  3EXC X;  5HAT A;  2CAJ A;  5D0G A;  2NRE A;  1NK8 A;  2A6M A;  2GIR A;  3DRP B;  2KO1 A;  1GT8 A;  3PHE A;  3QIP A;  3NOG A;  2KKH A;  3KDN A;  4HH1 A;  4YQW A;  5B0F A;  1RBA A;  1XMB A;  3GB0 A;  5DQH A;  4DR1 F;  2XB2 D;  2YPY A;  1KVI A;  5DDO C;  1XTZ A;  3MEE A;  1KS2 A;  2EK1 A;  4IOA Q;  3UE2 A;  1JLC B;  3N01 A;  1QDU B;  1HBN A;  3QAU A;  3M8R A;  2YX7 A;  4PZV A;  5SUH A;  3JTN A;  3Q8Q B;  3PR5 B;  2DH7 A;  2Y1L B;  2FQQ B;  3OHB A;  2XSJ B;  3W62 A;  3H4B A;  1U0H A;  1RTI B;  4LF9 J;  5IWA F;  5G4D A;  1F2H A;  3OR2 A;  3N6L A;  3DNC A;  1JB0 C;  1KOO A;  3OR1 A;  1EHW A;  5BR8 F;  5DQI A;  2LA6 A;  2AMC B;  9RUB A;  5LMN J;  2R7T A;  4TXS A;  5K8N A;  3BJY A;  3DOK B;  4EZ9 A;  2XMK A;  3KDO A;  4DPX A;  1H73 A;  3QT5 A;  4LBI A;  1FRI A;  1OWX A;  2R8K A;  2P6S A;  4Q45 A;  2MB0 B;  4P7T A;  1WSR A;  3HHN B;  2O5D A;  3GE9 A;  1V5I B;  2K7K A;  1EZZ B;  4GRS A;  4YOE A;  4GO5 X;  2YKQ A;  4RUA A;  4KGZ B;  3MM6 A;  3MMJ A;  3QO9 B;  4MYU A;  1UZH A;  2UXD F;  2V9W A;  3RG6 A;  3CCS S;  1N6Q B;  1NDP A;  1FFG B;  2XZW A;  2YNH B;  1T03 B;  5J2Q B;  3QT8 A;  5KFY A;  1U1R A;  4I0W A;  3DRR A;  5DLF A;  4ZIT A;  3ONQ A;  3MCM A;  3PO5 A;  4DHV A;  4NI2 B;  4LSL A;  4JI4 F;  3HPO A;  2QMX A;  3A3P B;  3HMJ G;  5GMD A;  1UMJ A;  1HBM B;  1R3N A;  1K1Q A;  3IWN C;  2MZR A;  2V69 A;  3W2V B;  4MFB B;  5HQM A;  1FK9 B;  3AJ1 A;  4N56 A;  3A8I A;  2BUN A;  2OJ3 A;  4KKO B;  1X5P A;  5E7O B;  3Q8P B;  1YJ9 S;  3KTQ A;  1XNR F;  4UZC A;  4ED5 A;  2B6A A;  1N0V C;  1WC0 A;  4EI2 A;  2QA2 A;  5J1E A;  4RNN A;  1WHY A;  1N52 B;  4N76 A;  4X2B A;  4DL4 A;  4JI6 F;  1AUS L;  2Z4P A;  3AD9 C;  1F9E B;  4PG6 A;  2R7W A;  4OHV A;  4I64 A;  3WBZ A;  2MKC A;  2UVV A;  4RL1 A;  4C11 A;  1IBM F;  3DU5 A;  2K3I A;  1FNM A;  5KOX A;  3IXQ A;  2IM0 A;  4DPO A;  2WRM A;  5LXR A;  4QW8 A;  2AW0 A;  2YXL A;  2VZ9 A;  4FPI A;  3DFE A;  1VQM S;  5F8H A;  2RE1 A;  3U7J A;  3ZFV A;  4HI2 A;  3Q8V A;  2HQF A;  4PXE A;  4F36 A;  2BJE A;  1WC6 A;  1KFS A;  4FYX B;  3RTV A;  5HN0 A;  3KYL A;  2M8H A;  2KRB A;  2MZS A;  3MM5 A;  4FXD A;  3QLH B;  1B0V A;  1S1T A;  1NXI A;  1RT5 A;  1FWP A;  1LW0 A;  1Q8K A;  2O66 A;  5ADZ A;  1SL0 A;  3JQJ A;  4JV2 A;  1FRM A;  2IA6 A;  3UCU P;  4NLT A;  2B56 A;  1TMJ A;  5IM0 A;  3VAF A;  4I2P A;  2G9O A;  3I5C A;  1MMN A;  3GG1 A;  4DL5 A;  1UVL A;  3NAI A;  4OZJ A;  2LU1 A;  4YR0 A;  3J80 Y;  3M8Z A;  2IDL A;  1RTD B;  2WVD A;  3MMA A;  1F1B B;  5T7L A;  5H9F K;  1ZAW A;  3VZI A;  4DZD A;  1XJW B;  4LR7 A;  1VK3 A;  4DMZ A;  5D4L A;  4O44 A;  1ZM2 A;  5LMU F;  1OO0 B;  3X3U A;  5BJR A;  1PBU A;  2MQO A;  4QBU A;  2HLT A;  2VJV A;  2I9S A;  1KR4 A;  2QLW A;  5KFL A;  1CC7 A;  3W66 A;  3M30 B;  3M8Y A;  2RDD A;  2W7A A;  4L3K A;  3V6J A;  3FNN A;  2ZWP A;  3HVW A;  1YQH A;  4ETX A;  2CPD A;  2FZG B;  4R8U B;  2RRB A;  3H42 A;  2W9B A;  3MZI A;  1B64 A;  4IOC Q;  1S6Q B;  1HIY A;  2JVR A;  4ES3 A;  1X60 A;  3DLE B;  5AXN A;  2A1B A;  4LRD A;  5IV4 A;  3B4D A;  3KUG A;  4X64 J;  3DM2 A;  4DFM A;  1Q53 A;  2PT0 A;  4EWT A;  2B7B B;  2KXH A;  3NS5 A;  2A2C A;  2VG6 B;  4MKV A;  2IJR A;  2XYP B;  3MFI A;  2QLJ B;  3TOQ A;  4ERD A;  1S97 A;  3JYT A;  3BKT A;  2O1P A;  2CYY A;  1AW0 A;  2DKO B;  3FDS A;  2J7W A;  2PDA A;  2YQ0 A;  1UJ6 A;  3KMQ A;  3Q86 A;  2XGQ A;  2F8M A;  3TZX A;  3QGG A;  5L46 A;  2DGW A;  4M5N A;  2AX0 A;  2BJ9 A;  3QRQ A;  2AP6 A;  1HNX F;  1RIS A;  2R9L A;  1RB0 A;  2LA4 A;  2AYG A;  3Q23 A;  4DV7 F;  1AFJ A;  2BJ7 A;  1W25 A;  1EAR A;  2VAS A;  3ITH A;  1SIZ A;  2VQF J;  4DV6 J;  4DQI A;  1HBO A;  3IAM 9;  5DG8 A;  4YHH F;  3GR0 A;  5EWG A;  1T3O A;  3D9B A;  4NX9 A;  4OYO A;  4C7Q A;  4LJM A;  4BCA A;  1HI8 A;  1F3F A;  3CCZ A;  3LH2 S;  3I87 A;  5CAB A;  3MMC B;  4B3S J;  2MZ1 A;  4KR0 B;  3SBM A;  3UN2 A;  4J9R A;  4OZ0 A;  3GJT B;  2ZZN A;  3BN7 A;  1RCX B;  3MCO A;  3D6M B;  1R6Y A;  1TQL A;  1U1N A;  4UUX A;  5GAD U;  1PKU A;  2AJ1 A;  4R0E A;  3R5G A;  1R89 A;  3FBF A;  3HFV A;  2X1G A;  2F40 A;  2GGP A;  1RHM B;  4N41 A;  3CO0 P;  2R7U A;  4DL2 A;  5KOW A;  2GVZ B;  1TKT A;  2KYX A;  2VD3 A;  5A8W B;  3GV5 B;  2BE2 B;  3ZTS A;  4GC6 A;  2AZ1 A;  4A8X A;  4M5D B;  1DTQ A;  3DLB A;  5F0U A;  3DGP B;  4DDF A;  4MAK A;  3SDE A;  3RYL A;  2VG5 B;  5F3T A;  3PV8 A;  4N5S A;  4TQS A;  3AH6 A;  2R4F A;  2EK6 A;  4JI7 J;  1NSP A;  3WHI A;  2LKZ A;  4DV1 F;  2DCL A;  1RSC A;  3D28 A;  8ATC B;  2JLG A;  3DLG B;  2IJF A;  1BLU A;  4WKR A;  1CEZ A;  1B7Y B;  4XDD A;  4TU9 A;  3QFH A;  1DRZ A;  4NCG B;  4C3L A;  3D68 A;  2XS2 A;  1UJ5 A;  2I5J A;  4LBH A;  1RT3 A;  1S77 D;  4IYQ A;  5K14 B;  2B4O A;  2YTC A;  1BE4 A;  3I9Z A;  4RW7 B;  4H4M A;  2YNI A;  2HBQ B;  1GMU A;  3N6N A;  3FCH A;  2GAG C;  4ED3 A;  1HWI A;  4ZPW R;  1RE1 B;  2LFV A;  2BX6 A;  3M9O B;  2W2N P;  2D3O 1;  3H2L A;  1GXU A;  3BN4 A;  1EIY B;  3OL9 A;  1FA0 A;  3R3T A;  2DTJ A;  1DLO B;  3GR1 A;  1L3T A;  3CGI A;  3PW4 A;  4ZP8 A;  1AZS B;  2Z2L A;  5K9F A;  3CUN A;  2L9W A;  3IR7 B;  3QMQ A;  4ETZ A;  1T11 A;  1QSY A;  4OI3 A;  1QJH A;  1FKA F;  2KJW A;  4OYP A;  3BDE A;  3CJ4 A;  2AU0 A;  4RW4 B;  2M88 A;  4UY8 T;  2GMH A;  1QE1 A;  4CRJ A;  1UVK A;  2E7X A;  4WFB Q;  1S4F A;  1UET A;  4CTA A;  1UEU A;  4ID5 B;  4MTP A;  2ZUG A;  4J9P A;  4DR7 J;  3QSI A;  1Q79 A;  4OMF G;  1VQY A;  3P45 B;  2EG1 A;  3UR0 A;  4KYZ A;  4WE1 B;  1L3V A;  2MXY A;  1TMM A;  5LT5 A;  3PYF A;  1TR0 A;  4O3N A;  1RWU A;  4EEY A;  3LPY A;  1I5O B;  4TYA A;  1ZTW A;  3HSG A;  4U7U D;  3PEH A;  5ETV A;  1IBL J;  5FDL B;  2VBX A;  1SXL A;  2RDI A;  1IM6 A;  3MUV P;  3SCI E;  1HAR A;  2VBW A;  3M8S A;  3GWC A;  3FFI B;  1FWL A;  4NCA A;  3JSM B;  4DEZ A;  4JYA J;  1K8A T;  4JUZ A;  1V3S A;  4LF8 F;  4RNH A;  4BHQ A;  3MMB B;  1WUU A;  1GQE A;  3OFE A;  1NLK L;  4OZ1 A;  4X4O A;  1P6T A;  4DQP A;  3GG0 A;  1U6B A;  1S6P B;  4J9O A;  1NND A;  5C24 B;  2H9Z A;  3CCU S;  2EXU A;  2ZJR Q;  4ZJL A;  4JI5 J;  3EPI A;  1R6V A;  3OVB A;  3BRE A;  3UNG C;  2BZ2 A;  3HO1 A;  4AL6 A;  1XMQ J;  4OHZ A;  1YJU A;  2HND A;  3A8K A;  3HT3 A;  1H0H B;  2OFH X;  4LF7 J;  2A2D A;  2RJZ A;  3W5X A;  3H2V E;  2QLX A;  3T1Y F;  3KUE A;  3EUN A;  2U1A A;  5CYQ B;  4B9T A;  3NY0 A;  1X4E A;  1TK8 A;  4CLW A;  3OPK A;  4DG1 A;  5CQG A;  4FS1 A;  3EZU A;  4RUB A;  4DQR A;  3OL8 A;  1RKI A;  2YWE A;  1RP5 A;  5ETQ A;  3M32 B;  3VAJ A;  4OJ3 A;  3S6E A;  2VA2 A;  3HM9 A;  4RUH A;  3TAM A;  1L5U A;  1Q0N A;  2DVI A;  3GJS B;  4HHJ A;  1WEX A;  4K0K F;  4RBV A;  4DR1 J;  4OX6 A;  3HZE A;  3HJF A;  2CFX A;  4KAI A;  4ZHR A;  1HI1 A;  2FD2 A;  5LSL A;  3BPS P;  3EIC A;  4NWB A;  2ZHA A;  1X0F A;  4DPU A;  3TVK A;  3PTW A;  4OYX A;  5JMN A;  1RUS A;  4NLW A;  1SC6 A;  4LFA F;  5L1K A;  3TJ9 A;  2DK2 A;  3KLE A;  3ISN C;  5IWA J;  2ASJ A;  1HMV B;  5CCM A;  1K0T A;  1U1Q A;  4X4T A;  1JQG A;  2EFV A;  4EYH B;  3F0N A;  2R2R A;  1HQ2 A;  1SJQ A;  2KG1 A;  4PG7 A;  1RJJ A;  2HVH A;  1B70 B;  3T1H F;  1MRO A;  1OPZ A;  5BR8 J;  4LF6 J;  1XN9 A;  4ECU A;  2Y1J A;  1H72 C;  1KTV A;  2Y0B B;  4KV8 B;  2WB1 D;  2V68 A;  4MIA A;  5F8M A;  2ZE2 B;  2DGX A;  4PPZ A;  2ROE A;  5KFR A;  4OYM A;  2E7W A;  1R0C B;  3FK4 A;  2V6A A;  1UFW A;  4F4A A;  1FRX A;  2ASL A;  4NL5 A;  1S49 A;  2XC9 A;  2UXD J;  2PA8 D;  2BAC A;  2GMJ A;  1YRX A;  2GJ2 A;  1LV5 A;  5F8J A;  1JJC B;  3TA1 A;  1DBD A;  4PG5 A;  3I0R A;  2W8K A;  1HNI B;  5B0D A;  4ES2 A;  4URQ U;  3BH7 B;  5IT9 U;  4XIU A;  4JI4 J;  3OFF A;  1QSL A;  5A2Q Y;  2BMB A;  4OZ2 A;  3TP2 A;  1OY6 A;  5F9N A;  2C2R A;  3OLB A;  3O8W A;  3AOD A;  4DF8 A;  2ZOM A;  2EEY A;  1HNV A;  4F7V A;  1LEO A;  4NA3 A;  4CLS A;  3OJS A;  5BXI A;  2HGL A;  2C3O A;  1TL1 A;  1V5V A;  1PC5 A;  3IGV A;  3O3L A;  3PRV A;  1RWK B;  1XNR J;  2VIC A;  4U96 A;  1RT2 B;  2HVZ A;  3D7S B;  4ANE A;  3TI0 A;  3BKF A;  3W1Y C;  3V6D A;  4OLP A;  1MU2 A;  3MEC A;  3ZO7 A;  1MG7 A;  1VBY A;  4C4W A;  4JI6 J;  4C0B A;  4NYZ A;  3L4B C;  3OTO F;  1OSD A;  1JXL A;  3W61 A;  2C2Z B;  1SH3 A;  1UFL A;  2BAB A;  1NJY A;  2OH2 A;  2CJB A;  1IBM J;  4GC7 A;  4ZJO A;  1S9F A;  2BQU A;  1U1K A;  2DT9 A;  1LWE B;  2RF2 A;  1VIS A;  2P8I A;  3JQK A;  1Z1Z A;  3M7V A;  4WU3 A;  2AYE A;  2ZJQ Q;  1M5O C;  2ZZT A;  2VFT A;  3KLV A;  3FCV A;  4CLU A;  4CT9 A;  4QJV A;  3POT A;  3US5 A;  1NSA A;  2O67 A;  2FC8 A;  1F3V A;  2CRL A;  3TA0 A;  1YSJ A;  4DU7 A;  4Y34 A;  3VVT A;  4ZOS A;  3TZZ A;  3EZO A;  4KQZ A;  3W64 A;  1HBN B;  3RU0 A;  5E3R A;  4F25 A;  1GMW D;  1NCL A;  1BMQ B;  3AD7 C;  1WHX A;  1WF2 A;  2FJV A;  4DV3 F;  3OXG A;  1XER A;  1WWH A;  5DZ7 A;  3OW2 R;  2J9E A;  5D8H B;  2OI2 A;  1B3T A;  5EX3 A;  1TK5 A;  3U1L A;  2BA9 A;  3ICL A;  3W2W B;  2KFZ A;  2C1E B;  1EQ0 A;  2JH3 A;  4DFP A;  2W2O P;  3H5X A;  2ZC4 A;  1QAI A;  4ZPA A;  4UTG A;  2OHD A;  3OVS A;  2DR8 A;  5C42 A;  3DLH A;  4P6Q A;  2XYG B;  1U4B A;  1GEH A;  1GTE A;  1N56 A;  5K20 B;  3GFZ A;  5LMU J;  1C4C A;  4Q43 A;  5DET A;  2F5G A;  5DS7 A;  2JFD A;  2CPE A;  2OEJ A;  2RVJ A;  3SV3 A;  2MZT A;  3W5Y A;  4X4P A;  2FJE B;  2ZNY A;  4EBE A;  3PJX A;  3TX8 A;  2QT7 A;  4Y2M A;  3PG9 A;  4G6V B;  2BRK A;  3AA8 A;  1MN9 A;  3JSB A;  1DTT B;  1QAJ A;  3TUP A;  2MLZ A;  4FNH A;  4K4S A;  4ECZ A;  1ULR A;  2GAH C;  2OD4 A;  4RW8 B;  3KK3 B;  2EBE A;  1U02 A;  1LXJ A;  5JXS A;  1VRT A;  3D6T B;  3QWP A;  4LT6 A;  1T7P A;  1JKH B;  1F60 B;  4OJ1 A;  4DPY A;  2L08 A;  1U2F A;  4RNO A;  1HHQ A;  4CO0 A;  1FTR A;  3NEK A;  5GAG I;  3VR1 A;  1KBR A;  1FXD A;  1ICE B;  2AQ4 A;  4ZKA A;  4I6W A;  3RJM B;  3CD5 A;  4YFU A;  1WOR A;  1UEK A;  3FMB A;  4GKJ F;  1C1C A;  2IVY A;  3R1H A;  4DX8 H;  4OYI A;  1YX2 A;  1UA0 A;  2CJ9 A;  4I6Y A;  5ETS A;  4MMO A;  1LW2 B;  3RB3 A;  1CJK B;  2RAQ A;  2J0S D;  3GU0 A;  1NKE A;  2BBE A;  2DYA A;  4MKA A;  4ZPC A;  1FDN A;  4QIV A;  3A8E A;  5IZH A;  4X66 F;  5HQL A;  2F9J A;  4DV7 J;  3I4H X;  3LGN A;  4YHH J;  4DV0 F;  5I3Q A;  2JNJ A;  3MED B;  2C3U A;  2E1C A;  3HFK A;  2E29 A;  2W25 A;  3DMJ A;  2RS8 A;  1EX8 A;  1YBU A;  3KKF A;  4QYZ K;  3BGR A;  4DI6 A;  2C2N A;  3GYG A;  4OI6 A;  3THP A;  2ZKU A;  5A8K B;  3EGV A;  2W9A A;  3UD5 A;  3ZXW A;  1MMD A;  1UW4 A;  4ED4 A;  1RBO B;  1TUG B;  3LUY A;  1G1X A;  4PQU A;  2LQJ A;  1JXV A;  2VJU A;  1U1M A;  2XWY A;  1S1T B;  4B3O B;  1RT5 B;  4TVA B;  5JJB A;  1PYS B;  1RGV A;  2V5H G;  1N88 A;  3ZTP A;  3QJP A;  1LFP A;  3C14 A;  1YTY A;  3BBB A;  4WK3 A;  3R6G B;  3DYA A;  4NLQ A;  3I5A A;  1RI7 A;  3BO3 A;  4HT5 A;  1BQM A;  1U0S A;  3MAA A;  1IJE B;  3KWM A;  1NK6 A;  4ED6 A;  2ZH8 A;  5E3C A;  2IRU A;  1PBA A;  4DX6 A;  3NCR A;  1SKS A;  2WSF C;  4ZLP A;  1KDN A;  4ZP7 A;  5E3Q A;  1KLM A;  2CNO B;  4ECV A;  1QSS A;  1S9E A;  4IRC A;  4DR2 J;  3V81 B;  3C8Y A;  3R2C J;  2ZBP A;  4PG8 A;  3PW2 A;  4DV1 J;  2AHO B;  1AB8 A;  1F9H A;  3G8Q A;  5RUB A;  3T6J A;  3DOM A;  1IKW A;  2X1A A;  3AHP A;  1HQE A;  3PVX A;  4X4U A;  1T0T V;  5CZX A;  4FVM A;  1PIL A;  1PJ5 A;  2W2P P;  3CJK A;  3C16 A;  3UCZ P;  2HS4 A;  3MEG B;  2XS5 A;  3JS9 A;  3P4U B;  3M8Q B;  3G6E S;  4KT0 C;  3B78 A;  2JLF A;  4PWD A;  1K9M T;  5KFS A;  3T1A A;  1PIE A;  3QWU A;  3HLU A;  1DAX A;  3VQT A;  3DRS A;  4KJI A;  4I7F B;  3BEG B;  1K47 A;  2QX0 A;  1RLD A;  2IM1 A;  4OYZ A;  4KGV B;  4KO0 A;  2RU3 A;  2DBB A;  1HWU A;  3CCR S;  4ZCM A;  5HO4 A;  1B0T A;  2K06 A;  3E01 B;  2DNM A;  4QWC A;  2V2K A;  2F65 A;  3KHG A;  1DUR A;  2XBP A;  2VOO A;  5KFM A;  2XM3 A;  4MKY A;  4A8M P;  2MHN A;  3CJR A;  3B54 A;  3M05 A;  3Q24 A;  4HKQ A;  1NPK A;  3SXL A;  3HSD A;  4C97 A;  3J7A N;  1XR7 A;  2PO4 A;  2MTL A;  5ETM A;  2ZD1 B;  3ITH B;  4CO1 A;  5HBM B;  3DXB A;  4ZA1 A;  2XQC A;  4WCE Q;  2V2Q A;  3C46 A;  4RO0 A;  1RHJ B;  1VQK S;  1HA1 A;  1S6O A;  4KIA A;  2HEK A;  3DRP A;  3I9V 9;  1RTJ B;  3EVO A;  2X1F A;  4QIG A;  5FLX U;  2Z30 B;  3MF5 A;  4QR2 A;  2VPW B;  4YY3 F;  4RX6 A;  3OUY B;  1AT1 B;  1NEE A;  2Q79 A;  2Z57 B;  3K57 A;  3NGT A;  3CDE A;  1NME B;  4R25 A;  4S0M A;  4N77 A;  2W2M P;  5IFM A;  1SB6 A;  2EI5 A;  1JLC A;  1GMW A;  2LLZ A;  4M94 A;  1RCO B;  1REG X;  4UST A;  1ZM4 A;  2GJI A;  2X7I A;  2F7V A;  2N82 B;  3DDI A;  2MY7 A;  2N3O A;  2CQP A;  1RU1 A;  4JOU A;  1CJV B;  2RQM A;  4ZLJ A;  4O3P A;  2XSJ A;  2DXD A;  5EX0 A;  1RTI A;  3MDF A;  1TAU A;  1HWK A;  4Y2C A;  2G2Y A;  4PRF A;  1FFS B;  1YIJ S;  5CYM B;  3UW1 A;  4HVZ A;  4IR1 A;  2ACM A;  3I5B A;  3K5N A;  1Y3J A;  2IRY A;  2ZOG A;  3DOK A;  2Q66 A;  3RR8 A;  4YB1 P;  5IV3 A;  1N4L A;  2EFQ A;  3D5M A;  4D3G A;  5E3A A;  5HJY A;  3M6W A;  1WKJ A;  2FHJ D;  2OIH A;  3BM7 A;  2UP1 A;  4OX9 J;  1Q78 A;  4NLS A;  2I5J B;  4Y6I A;  2NXE A;  3HJV A;  4Q2L A;  1G2E A;  3QO9 A;  1F2G A;  1IR2 A;  1Q8B A;  4TLR A;  2YNH A;  2E44 A;  2CZ9 A;  5B7W A;  5DG9 A;  2IYI A;  2OKQ A;  1F5C A;  4C3K A;  2ZH7 A;  5KG0 A;  1IR0 A;  1KHW A;  4ZPD A;  3EE3 A;  2QTW A;  2XZD B;  4K0K J;  2EC0 A;  1U2C A;  2YWF A;  4NI2 A;  1TU0 B;  5KG7 A;  2B9W A;  3CCJ S;  2XMV A;  3QJJ A;  3EX7 B;  3V4M A;  3MOJ B;  2HRU A;  2OAU A;  1HBM A;  3VAG A;  2OGU A;  2PN6 A;  4OIX A;  4LF5 F;  3W2V A;  3NGD A;  4MFB A;  1FK9 A;  3PFE A;  4KFB B;  3V2U C;  4LFA J;  1D8Z A;  3D6H B;  1KN6 A;  4RR5 A;  2V34 A;  4CDI A;  4KKO A;  2YY3 A;  3Q8U A;  4DWI A;  3K0J A;  2MSS A;  3ZZT A;  1M5P C;  3K17 A;  3KLH A;  2GO8 A;  5JUM A;  1J5O B;  2YKM A;  2QE5 A;  3EVW A;  3KLI A;  2ABY A;  2C3M A;  4ED8 A;  1QE1 B;  1NZ8 A;  1TTH B;  4CTA B;  4U95 A;  4RBU A;  2XGP A;  5IQQ A;  3PJW A;  4U7U K;  4ZMM A;  1U09 A;  3H7H B;  2NQP A;  2ASY A;  3HT0 A;  3QT7 A;  5AE2 A;  1D9F A;  2FHK A;  4JI0 F;  2N3L A;  2BJ1 A;  2HMI B;  3BGF A;  3SSR A;  4ZLN A;  1U47 A;  2B7C B;  4OZ5 A;  5E33 A;  2J7K A;  1NAQ A;  3UD3 P;  1X4H A;  3DRX A;  3OL7 A;  2Z2Y B;  2P9E A;  1N5Q A;  1VOM A;  1U26 A;  1BXN A;  1SQE A;  3TO8 A;  1JLE B;  4DXL A;  3A12 A;  2WON B;  4PYD A;  2B51 A;  1BWE A;  1FKP B;  3EPG A;  3J7A 1;  1KOH A;  2QLF B;  2CQ3 A;  2YNF B;  3DU6 A;  1HHT P;  2DGU A;  4KHR A;  2A10 A;  4P7V A;  3ZNJ 1;  3C6T B;  1RBL A;  1RTD A;  2DH9 A;  2N4C A;  1Y00 A;  3VQS A;  1SL2 A;  1YWX A;  3AB4 B;  3LOU A;  4H4O A;  4DPW A;  1BHN A;  4ZVF A;  4FF3 A;  3OTO J;  3CDB A;  2GW8 A;  3CDA A;  3PHT A;  1FVQ A;  3IRW P;  2Y8Y A;  5HVF A;  3OTC A;  2G0I A;  2JZ5 A;  2UUC F;  2R2S A;  1BC6 A;  2AEM A;  4NXN F;  3MM7 B;  4HLB A;  4HL9 A;  4R8U A;  4QQB A;  2QRR A;  2A6O A;  3GJQ B;  4ECT A;  1S6Q A;  4MIW A;  4PEO A;  4OJH A;  3MR6 A;  4USK A;  3DLE A;  3JAM Y;  4PWU A;  3OT9 A;  1FT8 A;  4DUY F;  4AE5 A;  2HQD A;  2VG6 A;  2CQI A;  2DO4 A;  1WHV A;  3KK1 B;  1QY7 A;  5BYS A;  2BKO A;  4USU A;  5B09 A;  3AB2 B;  4DPT A;  2DNK A;  5LXY A;  4CLY A;  1ZA1 B;  2EFO A;  3RRK A;  9ATC B;  4DV3 J;  5B0B A;  4B3R F;  1NBE B;  2D9P A;  4F26 A;  1ZBT A;  1X4D A;  3GFX A;  3G9C A;  1VQL S;  3DHX A;  2A3J A;  1YI2 S;  3SSS A;  4NOH A;  2GQ2 A;  2LEB A;  3DDK A;  1WI8 A;  3GP9 A;  1FX2 A;  3FEX B;  1I94 F;  2D69 A;  2AX1 A;  5G0R B;  3MGJ A;  5B0E A;  1A9N B;  1KVJ A;  4U6P A;  3JTO A;  3NWR A;  2NUU G;  2FLO A;  3CC2 S;  1DQ9 A;  4OX7 A;  1LNQ A;  3QBC A;  3M2V B;  1YDL A;  4WP8 A;  3ZZP A;  4NLG A;  4KC5 A;  3WX8 A;  3VHQ A;  4E8U A;  3MMC A;  1H38 A;  4ECS A;  2F3J A;  4PPD A;  2J9D A;  2FLL A;  4DQQ A;  2L9D A;  2E5I A;  2VON A;  2IM2 A;  2XLK A;  4NZ0 A;  1I3O B;  4NLP A;  4JP8 A;  6AT1 B;  2GVD B;  3KJV B;  3NGU A;  3CB4 A;  1VIO A;  1C0U A;  4NZ6 A;  3L9Z A;  4N47 A;  4NYP A;  2QZ8 A;  1RWN B;  2FVQ A;  1HYS B;  4CI0 B;  2GVZ A;  2ZM6 F;  4GKJ J;  3Q8S B;  3CNQ P;  5A8W A;  4ECQ A;  1M1G A;  3RAM A;  2BE2 A;  2NZ4 A;  1KKH A;  4QW9 A;  1OY9 A;  3DLK B;  4FP9 A; 
#chains in the Genus database with same CATH homology
 1GFW B;  2CJY B;  1RWO B;  2QL7 B;  2QL9 B;  3GJR B;  2HBZ B;  1RE1 B;  2H54 B;  1SC1 B;  2C2M B;  3GJQ B;  2Y0B B;  4ZVP B;  2Y1L B;  2FQQ B;  2XZT B;  3KJN B;  1PAU B;  1RWP B;  3D6F B;  2H48 B;  3NS7 B;  4JB8 B;  1RHK B;  1ICE B;  4DCJ B;  3EDR B;  2CNN B;  3D6H B;  1RWV B;  1RHR B;  2C2K B;  2C1E B;  1I51 B;  3IBF B;  3EDQ B;  1QTN B;  3RJM B;  1RHJ B;  3KJQ B;  3QNW B;  3KJF B;  3GJS B;  3P4U B;  2C2Z B;  2H4Y B;  2CNL B;  2XYH B;  2H5J B;  3R6L B;  3SIP B;  2QLB B;  2QL5 B;  2CNK B;  1SC3 B;  3R5J B;  2XYG B;  2QLF B;  3R6G B;  2H65 B;  5IC4 B;  5K20 B;  4ZVT B;  1I3O B;  2C2O B;  2HBY B;  2XYP B;  2QLJ B;  3GJT B;  4LSZ B;  4ZVS B;  4ZVO B;  1RHU B;  3IBC B;  1RWW B;  3D6M B;  2H5I B;  5IC6 B;  1IBC B;  3R7B B;  4ZVR B;  1SC4 B;  1F9E B;  1NME B;  2DKO B;  3R7N B;  2HBR B;  4DCO B;  2CDR B;  4ZVU B;  1RWN B;  3P45 B;  2CNO B;  1RWM B;  2HBQ B;  2XZD B;  1PYO B;  1RHQ B;  1RWX B;  2H51 B;  4ZVQ B;  3R7S B;  1RHM B;  1QDU B;  2CJX B;  1RWK B;  2P2C B;  2H4W B;  4DCP B;  1BMQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...