3QNXB

Orthorhombic form of human iga1 fab fragment, sharing same fv as igg
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
219
structure length
219
Chain Sequence
QLVESGGGLVQPGGSLKLSCAASGFTLSGSNVHWVRQASGKGLEWVGRIKRNAESDATAYAASMRGRLTISRDDSKNTAFLQMNSLKSDDTAMYYCVIRGDVYNRQWGQGTLVTVSSASPTSPKVFPLSLCSTQPDGNVVIACLVQGFFPQEPLSVTWSESGQGVTARNFPPSQDASGDLYTTSSQLTLPATQCLAGKSVTCHVKHYTNPSQDVTVPCP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a human IgA1 Fab fragment at 1.55 angstrom resolution: potential effect of the constant domains on antigen-affinity modulation
pubmed doi rcsb
molecule tags Immune system
molecule keywords Fab fragment of IMMUNOGLOBULIN A1 LIGHT CHAIN
total genus 43
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2011-02-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qnxB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qnxB02
2P44B 1MQ8A 1AQDA 1LGVA 4NP4H 3BWAB 5C0BA 4NQDD 4YE4L 3GMMB 4MNQB 2ICCA 4WWID 3MJ8A 1W0WA 1QLFB 2Q7NA 1IAII 1J8HA 4NGHL 1MWAH 5FGCE 2IBGA 4IJ3C 5BVJA 4OLZL 2QL1A 5BMFL 1QFOA 2QQKH 5IESL 2VDLL 4BQ9A 4H26A 3U0PA 2Q3AA 5B38G 1IQWL 1CFSA 2AERT 5FV1L 4CVZB 1FAIL 3CC5B 2XG4A 4NJ9H 4K3HA 4WUUA 5I30L 5EA0L 4HFUL 2VDPH 5M94B 4KVNH 4LIQH 3MREB 4Q6IC 5FA4A 2BC4B 3CMOL 3QI9D 3GHEL 2ZCKL 4RIRB 1CFNA 1AO7E 2OJZH 4RISL 2ZOKB 3MJ7B 1BZ7B 2XPGB 4R0LC 5I18H 5FUCC 1YEGL 1A1MB 2BVTA 1HCVA 4LFHG 4QRPA 5B22A 1F42A 2EO9A 4F7MA 1G7MA 4JZJC 1KGCE 5I1CL 3DXAD 1S7RB 2NLJB 2C3WA 4BKLA 3HPLB 3KLHD 4WEUD 3WV0A 1E6OH 1P7QD 1A6TA 4NZRL 3IGAA 1I9JH 1UG9A 2XQYK 4U6XA 1NFIA 5E94B 1SY6H 2YSSA 3GMRB 3MV9B 4U1NB 5C0CD 4KGLA 1YEIH 3AUVA 4OCRL 2PTTA 1Q1JH 1BBJA 2HLFD 2DQFB 5H35B 1R3IH 2DQCH 3PJSA 5E2TH 3O6FD 2DLFL 3S35H 4CW1A 1A6TB 3FO1A 2OL3H 2PNDA 3W0WB 4OCSL 5IT2L 1QR1A 2FB4H 1GGIH 3BP4A 2LU4A 2GSIA 3KYOB 3QISA 4X9GA 5FOJA 2A9ML 4L9DA 4TVPH 1D5XA 1G7JA 1Z6JT 3RY6C 4YWGH 5JNYA 5E70A 3UBXG 1I1YB 5DD3L 2VZTA 1KB5B 5DJ0B 3ARYA 1DUYB 2CO7B 4PJDF 2VWEE 3IDNA 4FNLL 4J8RA 4RQQB 2ITDB 4HIHB 1WF5A 5H94A 4U1HA 2ESVD 4BH7A 4Z7WE 1P5UA 2P45B 2A6KB 4PRIA 1Q9OA 5CLWA 4UT7L 3FN0L 3JUYA 1UM4H 1UCBL 3P30L 4ZYKB 2EIDA 1BD2B 1CFTB 2AJZA 3ZHLA 2QQNL 3L7FB 3WXWL 2C7UB 1NGXA 1ZLWH 1FG9C 3WXVH 4HIIB 3QYCA 4NDMB 4APQA 2HTKD 1L0XA 1I7TB 5DVNA 5LJYH 4U6TA 1CXKA 4LOUD 1W0WB 1FRGH 2XRAL 3CD4A 4BUHA 4WU7A 4OGAD 2B39A 4Y4HD 4KMTH 3T3PF 2V2TA 2I07A 3UAJD 4M61B 5I8CB 4NQXA 4LCUA 1XGRB 3DGGA 4KDVA 3ISWA 3IDJA 4L4JA 4XX1E 3T0AA 3WN5B 4AZ8A 4K3DL 4URTB 3GJEA 1JPSL 4QYOB 4P5TC 3QR2A 3OBAA 5DD6A 3C5ZC 3V9FA 1QSFB 1I75A 5F96L 4LCCB 2YD4A 5K9OB 3OMZA 1LEGB 4LDEB 3IJHB 3DOSA 5F3HA 4DWHA 5KSVA 3IS0X 3ARDB 4MDIB 2EIZA 1OCWH 4N0UB 5D1ZB 3QQ9D 4P46B 5D7SL 4UNUA 1S3KL 2C1OB 3QPXL 4LSRH 2HMID 1JPTL 3HI6L 3UTSD 4YDIH 3P4NA 3EAKA 4OLEA 4F15C 4HWZB 1FGVH 3GBNH 3WCYA 3G5ZB 3KYMA 3JV0A 3QA3B 5TDNB 5DO2D 4NQDB 4QXUL 6FABH 3WO4B 5JLZA 1EEYA 2ADGB 2DI7A 4M1DL 4Q7DA 4P4RB 3IF1A 4PG2C 3QIUD 1YNKH 1S5HA 1LDPH 1S7XA 3PL6B 3B8SA 3DX7A 1D5ZA 5ILTL 4QNPE 3TBWA 4Q9RL 3X3GH 3TO4A 3P4MB 4GW5B 4PJ5D 3HNTH 1I3UA 2VLME 2K7QA 2AQ1A 5IJVB 3TBSA 2AXFA 4QRRD 4WFEE 5CJQL 1FZOB 3SKNA 1PYWA 2R69L 1J5OH 3OKLA 4HC1A 4HWEH 1F97A 4HZAA 4IRSB 5IF0B 5IROC 5GJSH 5FGCB 3IDUA 4U6VH 2CDGA 3O8XC 1JI1A 5HVGB 2P7TB 4I2XB 5D7JC 3SKJL 1M7DB 2D4DA 3GDBA 5I1GH 4UIKH 4HKBB 1VA9A 1IZJA 4HJGA 5EU6A 1FZJA 1UADC 4MXWH 5CP3A 2F74B 3PL6A 1JGEB 4LEOA 3ZTNH 1OAXH 5FHBH 3KPMA 3DO7B 3PXHA 3QCVL 1X5GA 4JM2C 5F72S 5DMJB 4LHUA 5KVFL 3QA3A 4N8VA 2XKNB 4F33B 43C9B 4GW1B 3AMLA 5GGSA 2JIXB 8FABA 4HMEA 1ORSB 4PJFE 4KROC 4F2MB 1IGJB 1SJEB 1FNAA 4Y88A 1NGZB 4G7VL 3U0WH 2QSQA 4I13B 3I02A 3PWPB 5D7KE 4F9PA 1NCAH 2CR3A 2YRPA 4FQIL 1ZANH 2A73A 2NZ9D 2EDLA 2GI7A 2BOBA 5IBTL 5GS1C 4KJQC 5HHPA 5ENWB 5ABDE 4XWGL 3T3MF 1IQDB 4U4BA 3QO1A 2CIKB 3MGOB 3ILQD 2PW2B 5JXEC 4DTGH 3CUPB 1WQVT 4C58B 2ATPB 1LO3L 2HKHH 5HDQL 1EO5A 3OSKA 3H2WA 1DBJH 2D0FA 2GT9A 4XNUL 4W6XB 3OQ3B 4UTBH 3HAEB 1E28A 2FBJH 2PO6A 3T2NL 2DDQL 4DZ8A 1O7SA 5D7SH 1RULH 5ADOL 3G5YA 1IGCL 5CJBA 5K9KA 2OCFD 3BKYH 4L3EE 2Z35B 3BDYH 3VXUE 3O11B 2BNRB 4KAQL 1AGFA 5DUMH 3MLVL 4QTHB 3U4EB 1MUJB 4GMSH 1IGJA 3FQTA 5K9JL 1A9EA 4NT6A 4M62L 3FQWA 5DHVH 1A9BB 3UAJC 3EO1B 4Z95L 5FYJU 4JVPA 1FFNB 2AW2A 2IALA 3RAJL 2AGJH 3QXAA 4WWKD 5CKAA 1JV5A 3SQOH 3HS0A 2I24N 5DI8A 3U7AA 5JOFA 4GAJL 3OKNB 3KLSA 1F45A 1MAJA 3BP7B 3Q5YA 4HC1L 1G6RL 4LSSH 3QHFH 3FOLB 2NTSP 1QRNA 5EU6B 4U1MB 1MWAL 5GSVB 5IW6A 1WAAF 5EDXA 2A74B 1OD9A 3CFKA 4IOIB 3VXPB 3VFVB 4JY6B 1OGAE 2X4PB 2Z8VC 3KPLB 2EDEA 3HHRB 1HDMA 3E8UH 3CLFL 4DGIH 2WWMC 4ODTH 3D2UD 1FYTA 4LPUA 3GSNA 4XBPB 4NNYA 1BQLH 4KUCF 4G5ZH 5SV4A 2OTWB 2A1WL 1KTLB 2C3HA 1C08B 4CMMA 3HAEG 1F6FB 4MZ2A 4EOWL 4XNXH 3BO8A 1EFXB 5EBLB 1U8KB 4ZFFB 2BVUA 1A9BA 4ZXBD 3MNVB 3NIGF 4LHJB 3FFCD 1FNSH 3D39B 3BPNC 3DRTA 4NQDA 5EZJB 1RHFA 4G7VH 3U0WL 4LCWB 3RWCA 2MOVA 5CMAB 3TN0B 4OKVB 3BZ4A 4ZTOL 3X12B 3QRGL 3GBML 3GSVB 5I71C 4ELMA 2QTEA 4EDXA 1U8IB 4RIRA 1X9QA 5D9SA 1QUNA 5GGUA 2MFNA 5B3JF 5TF1L 4DZ8B 3W5NA 15C8L 4MQSB 1MHEB 2FD6L 3OGCB 4IIQC 1S7WA 5I1EL 1I3VA 5HYSB 1YNKL 3EYQD 4P0DA 3CU1A 4G9DA 3WIHL 4HFWB 3BGFC 4JHBA 4PJBF 2ATPA 4JFOA 1NGQL 3W11D 4HKJA 4I18B 5IK3A 1GCFA 4WW1A 3TVMB 2MSPA 4U0RB 2F53E 2IQAB 2P5EA 4JN2B 4O2CB 2VR5A 32C2B 4Z7WB 1ZGLP 2A77L 1T1WB 4KY1L 4ISVA 1F3JA 5DJ2B 4JFFB 4U3XA 4P2YA 5GS0H 3QI9C 3E6FA 3O8XA 1BOGA 3VXRB 4NOBA 1UM5H 4K3JH 2QSCH 1TTGA 5EH1A 1NJ9B 4YWGL 3HG1E 2DJUA 3MNVA 3HMXA 1T7XA 4Q9CA 1BP3B 2W0FA 3BN9D 5DJ8B 2WANA 3GI8H 1F3DH 3KYAA 5DJZB 3FFDB 5IEKB 4NN6C 3E6FB 5IJKA 5BZWA 4WV1C 3GO1H 4MQ7A 4KXZI 4X6BB 2HN7B 1EFQA 4FQJL 5T3XE 4ODHH 2X4RA 5EOTB 4J3XA 2AKRB 1MRCH 5I2IB 5DS8B 4WENB 4EN3A 1YMHA 1PDKA 2IANE 4FS0A 4RQQA 4GRMA 4U2YA 2XRAH 2HFTA 3SKJH 5IB2A 1TJIL 3EOAB 3RIAK 1QBAA 3QJFB 1J7VR 1II4E 1XCTB 1LNUB 4NQSA 4NM8H 5DS8A 4EN3B 5JUEL 1MPAL 5D4QA 3MA7B 3FQUB 3KS0J 2ARJQ 3WNMA 4ONOA 2BVQB 3NPSB 1JPST 4MXQC 1BPVA 1W72A 4K3DH 2IANA 3DETC 4EUPB 3I75B 3QHZH 4LLWA 1I9JL 4PJCA 5JOEA 1MHCA 1KPRA 4TTDC 1IAKB 2ED9A 4OIBA 3C6LD 5I76A 3T2OA 3VD3A 2O93L 2VLJB 4L3EA 3D2UA 4NO0A 5I19L 1JN6B 2V2XA 2R1XA 5IUSA 1K8DA 3JTTA 2NY5C 2ITCA 4WWKB 3BT2L 4JKWA 5HYQB 4L9LB 4PRBB 3QI9B 4UUJA 1B0GB 4CJ0A 4XNQB 1RZKL 4UAOC 5IMLA 1HI6B 4I18A 3H0TB 2VLRB 2Z9TA 4TOYL 1FJ1A 3PIQB 4U7MA 2C3GA 1CTNA 1DZBA 3SGJA 1RUPL 5BO1L 4G6JH 2H2SC 4P5KA 2EEDA 5C08E 5D2LE 5L8LB 4NZUL 1KIUA 4FABL 4LF3A 3EFFA 5KSAC 4DGYH 1X5ZA 2IH1B 5F7EH 3PDGA 4EDWL 2ZG3A 1J12A 3HUJB 4X9HA 4BH8B 2FZ3A 3ULUL 1KN2L 3OJDA 5HGGS 1PD6A 3BVNA 4HWBA 1U8JA 4LRIA 3PWVA 4DFIA 4U1KA 2UY6A 2W9EH 1JTOA 2ZUVA 2F5BH 1BOGB 4OZIE 5JHLL 3QDMB 1AQDB 4XAWH 4KK9D 4L8SA 4ZO6A 5DR5L 2XG5A 1X5HA 1DE4A 1K8IA 5CJXC 3HZYB 1QEWB 4LVOC 2WSKA 4AY0A 2XTJC 4FQPA 1I1AA 3LRSA 3U4AA 4F7EA 1U8LA 2NY3B 4XRCB 3B2VH 4L4TB 4UNTA 1MRCL 3QIUB 1T89C 5BS0A 1MCSA 3L3JA 2UV3A 4WW2C 3IS1X 4HV8B 1I9RL 4ZFOB 1DN0A 2F54A 3O6FA 4FN0A 3T0BA 4ONFH 1DVFD 5DMKB 4YDKH 2WWMD 1HYSD 4CNIB 1U2HA 5E08L 3I50L 3MODL 4M5YL 3IU4L 4X99B 5EU3A 4ZS7H 4G80A 1NGWB 2FHFA 1TQCC 5IR1A 1T0NB 4HG4K 2A83A 2ZSVA 5AZ2L 4KKCD 1QLRB 3MXWL 4NKOB 1KLGB 1FVCA 3MLSH 2WUCL 4PJEB 2G60H 3BO8B 1A7QL 3B9KC 4OGYH 4K8RD 4MSWB 4NHUA 4EXKA 1NANI 3HNVL 3U1SL 3KYNA 4Q6IA 3SDCA 1KPRB 1F3RB 2ARWA 4RGOL 3OKEB 1I8MB 5GRWA 4FQ1H 1IEHA 4WO4B 3UBXB 3FQUA 1C16B 3DMMB 1CDHA 4JRYB 2JCCE 1MCHA 1TZGH 1R5IB 1WZ1L 2I9LA 3BE1L 1FP5A 1FPTH 1XF2A 1BVLA 4M7LL 2B5IB 4XAKE 15C8H 3DV4A 3GJFA 3DVNB 3LN5B 1U95A 2H8PB 1UXWB 1QBMH 3HAEA 3CDGA 2V17H 2VQUA 1YEEH 1Q38A 3MLWH 3T0ED 4XMLH 4PJHE 5CGMA 5AAMA 1QP1A 5D72L 1T21A 2CDFA 1E4WL 4ZFOA 3D3VD 1KG0A 3O2WL 2AABL 4MD4A 4XCFH 3H9SE 4POZC 5JXEA 3SY0B 1Y6KR 1PVHA 2H45A 5BZDA 4JCLA 1SJVA 2NY2C 4L4VE 3T4YB 3GSXA 1NPUA 3P4OA 1RK1B 2FH6A 4O4YH 4HC1H 1GYAA 1FV1A 3A6BH 1JGDA 3SGDI 3H9SD 5FDYA 5K9KB 4P4KB 5CSGA 1KIQB 2OBGA 3H7BA 4PJCE 1JWMA 1KTDB 2EO1A 3L1OL 4BSVB 3LZFL 5FUZL 3E8UL 1CL7H 3LN4B 4K9EC 4P9MH 4V2BA 3MC0A 3OF6A 2DD8L 3IU3A 3ZO0A 1ZT7B 3VXUB 1GGYA 1FC2D 3VFMA 4Y2DC 5HPMA 2IFFL 1IKNA 5H8DA 2P8LB 5D1XB 4N90D 4LDLB 3EGSA 4UV7H 1LEGA 1RZFH 3QIBB 4LPXA 4ZFGH 3CDCA 4GW4B 1AD9B 3O41A 3L9RB 3LN5A 2YOCA 1HH9A 5ALBH 3LV3B 1I7UA 4Y5VA 3O2VL 3BQUB 2OR9H 3DMMC 1RPQA 4M6ML 4OCMC 3PHOB 4GG6E 4QHUB 3VFRA 3RIAF 1JBJA 1IAIM 5BV7C 3IDXH 2DOCA 3T65B 3TZVB 5IMOA 2PTTB 4Z0BH 3JVGC 1CQYA 2F8OA 3G04A 2F54D 1MFAH 4BSWA 5IQ9A 2IPKA 3NN8B 1E4KC 2NY0C 3MRDB 4K71B 3R1GL 4PRID 4FABH 1XGUA 4OJFH 2R8SL 1FG2A 3MBED 4HEPG 2Y4SA 4UINL 4U7KA 2A83B 2ZSVB 5JXAH 2MKLC 4I0PD 5D6CA 5I73C 4HQQH 1MJ8L 4NBXB 4OT1H 1ED3A 5D7LE 1Q9KB 1QG3A 2C1OA 4O51A 3D18B 4MQXC 3OHXA 4J8RB 4PJ7F 1MCNA 1WZLA 5IVNA 1YN7A 5GGQL 4PJBB 4OGXH 3WFCL 1MVUA 2ZSWA 4N9GA 1KB5A 5DHYB 4NKDB 5DQ9A 3T2PA 1F3DJ 4ZTPL 2QADC 3V7AG 4LCCA 5D72H 4MS8C 4ZDHA 4F8QA 4MJIE 3WL9B 2D7PA 3MV8E 4PREB 5L2KD 4JY5L 2WLZA 3ARPA 5K93A 2K1MA 3MLYL 3F7YB 5F1IB 4GAJH 4OBSA 1N64H 3HZYA 2I60L 5BQ7A 1FFPA 5T1KD 2XN9B 5DXWA 3GKWL 3SGEH 1BBJB 1MJJA 4MX7A 3MUGA 1AE6L 1TCMA 1U93B 5MHSE 4DN3H 4N0CC 5IGXL 1PSKH 1CDCA 3QRFM 4U2ZA 2F53D 3OB8A 2EXWD 1QA9B 4KRLB 3TFKC 3BQUC 2O61A 3MRRA 1MF2L 1RZJL 3B2UD 1RHHA 5DD0L 1JZ4A 4E41B 4PJEE 1EJOL 4LSDA 2W60A 5FOBA 5JMOC 4X7EC 2NX5D 4D9RD 2GEEA 2QHRH 4JZNB 1RUAL 4MMZC 4QF1B 1OT1A 2ZOKA 2XZAH 4QXGH 2ZCHL 2ICES 5F1KC 3ARGB 5I1HH 4ONFL 4WO4D 2VZVA 4LKXA 1DQQA 2FECI 2X44D 4WDIB 4HBCL 3BKCH 4PRHE 2P8MA 3MROA 4D3CL 3O3BB 1XF1A 1ZT4B 4OFVA 2W9LA 4MNQE 3KPRA 4Y4KD 5E2UH 5J3HC 1V3KA 4AG4L 2ZJSL 3WS3B 4R4ND 2AXGB 3QT2A 3U9UB 1SJEA 3RWGB 5BV7B 5I1EH 1CD1B 1I8KB 4JHWH 2JCCF 4NFDA 1CR9H 4OD2B 2NX5E 4CBPA 4U1JB 1YNLL 4GW1A 3UP1A 4IIQB 2OK0L 4QRPE 1ZHBA 1I7RB 5J6HB 4OTXL 4F2MA 4X5LA 1WFNA 1Q9OB 4G8GB 4HH9A 3STLA 5SX4I 1FSKB 5J1SC 5E0QA 4HMCA 2JCCA 3QDJD 4LASH 4Y5YC 3O0RH 3QBTB 5JO5B 3NCJL 2A6JA 1ZGLB 5ANMB 3P77A 4OCLC 5DHXB 1J0JA 1KTLA 5CILH 4AH2B 3DO3A 2KL6A 4YDLC 4HWBL 3L3GA 3WKML 4JFFD 4LGPB 1T7VA 4WI9A 3CDGB 1B4RA 1IAOB 2KH2B 1PJ9A 3TH2T 1XZ0A 4WCYL 5A16B 4U05A 2F5AH 1N6QL 3V4VH 4PJBA 4FQCH 4G8FA 4XPFH 5MEOB 2OQJA 3C60B 3T8XB 3VXPA 2AKRA 3N0PB 3CFBB 2YN3A 3ZHDA 4DK6A 4J3TA 1GIGH 2FNBA 4ZQKB 1F6LL 5D1QD 1T03L 4WUUB 4JFFE 5DVLA 4YHLH 3K8LA 3E1F1 3MLPA 5LQBH 2VC2L 4GKZB 2ZKHH 3P77B 4YHYC 2E8ZA 1P84J 1O7VA 1J9CT 2C9AA 2VDMH 4UU9A 5INCA 1H3XA 2Z8RA 1ZK9A 3FQWB 2PR4L 1ETZB 1XF5A 5SWSA 2VLJE 2Q76A 5IQ9B 2DI8A 3RVTC 3C2SA 5JUEH 3G5VB 3VDAA 1I8LC 4FXLA 4K9EH 1M71A 1VPOL 4JHAH 1QOKA 3N50A 2HJLB 1QQDA 1VFUA 5T1KA 4KKAD 5DRNB 1JPSH 4L1DA 2V5YA 4D0CA 1IFHL 4CADB 1XGPB 2E9JA 2NY1C 4YXKL 2Z92A 1IKFL 1SQ2N 2B5IC 3MR9B 3FT3B 5CHNA 3H9YA 1KJ2L 5K9OA 3FKUS 3RIFK 3BH8A 5GRUH 2YA1A 3CSYA 5FYLE 4M6AA 3OKNA 1EEUA 5ETUB 1EHAA 5ESAA 4P59H 5A3ID 3EZJB 1S9YA 5FHAH 2CIKA 3I84A 2NW3A 3ULUH 4JFHE 1CYGA 1MFCL 4Y4HA 4PY8I 1RURH 4V2CB 4CU6A 1A22B 4I9WD 4ZNEE 5ETUA 2W0FB 5DJ8A 3W9EA 1FZMA 5C0RH 2WP3O 4HHAA 3B5HA 4M43H 1IGIH 4P9HH 3IFOB 3WLBB 1BD2A 2AJZB 2Z35A 1QPPA 1XAUA 2R8SH 4UT9L 1RK0A 4BH8A 1T5XB 2MWCA 3HCVB 4IRJD 4Z77A 3KS0H 1LMKA 3ARVA 1EGJH 1ZWIA 4N5UA 4OLWH 4R2GC 5FYLD 4MNGB 5L2KA 2Q86A 5DO2C 2WW8A 2FSEA 4NQTA 4WW1B 2LAAA 4LVHC 3TVMA 5L9DH 4E41D 3RJQB 4HWEL 3QQ4A 2OTUA 5CWSB 1A14H 1M71B 1R6VA 4XNZC 4XNZB 4XNMA 3VG9B 4N0UE 1OP5K 4BA8A 4NNPL 1F4XL 3PHQB 1HQRA 4OCXH 2BVPB 4MS8D 3G6AA 5TFSH 3U7YL 3TA3C 3RTQC 1F90H 5DGRA 1MIML 2Z92B 4JPWH 5E00A 4PS4H 6CGTA 4RRPA 3QG6A 3ORJA 4I3RH 2EDJA 3UPCA 2X09A 3KXFB 3C60C 3VGAB 3R0MA 4NM4H 4WUKH 1EGJA 3OV6A 2Q7YB 1T03H 1X6NA 3PGCB 4J1UB 3VA2C 1JK8B 2L7UA 5KN5B 2WUCH 3VMNA 1EAJA 2DQHL 1A7NH 2ZCKH 1TETL 5GGSB 3DBXA 4HWNA 4XI5C 5E94A 3Q6GL 4YHNA 2V7HB 1AGFB 4AIOA 1D5BB 1N0LA 3HFML 4K7FB 3O6KH 5IFHL 5DQJA 5JLZB 3W2DL 1RJZA 3OAYK 3QIWD 5DFVC 4M1CD 1VPOH 3BN9C 2NY4B 2QHRL 1DBMH 4V1DD 3UDWA 3WHXB 4NN7B 1JWSA 2IADB 3HE6C 2H2PC 4F7PA 3P0VL 1EEQA 1X44A 2IEPA 1QO3B 2H3NB 3OKMA 5I1HL 2GT9B 3J7HA 4BFGA 1ZEAL 3KPLA 2Y36L 4HXAH 1LP9F 4P48A 4TRPH 3UTTE 2CGRL 2DLGA 2JK5A 4NC1C 1K5NA 3QFDB 4JDTH 5DVMA 5FO9A 3DWTA 1FBIH 3BIAX 5KSUB 4P3CL 4OLXL 3MGOA 5KS9E 4IMLA 2Z4QB 3MBXL 5TF0A 1PQZA 3BISA 5DJYB 3NCBB 2FJFB 3MLZL 2P24B 1F02I 2WIIA 1KCVH 5FCUL 3OJVC 4LKCB 1KN4L 4KTDL 2IALB 2VABB 4ZUSA 4G6FB 1T0MA 3IDJB 4X9FA 5EFIA 35C8L 3AB0C 2ADJA 1SVCP 4N1HB 3PWJB 2JELH 4NRZA 1DUZB 4M62H 4JFDB 3DSFL 4LVNB 1ZT1B 5ESQA 4BSJA 4ERSL 1OSPH 2XZCL 3HMWH 3ARTA 3BWAA 5C0BB 1ZLSL 2DTSA 3JXAA 3WEXB 2Q3ZA 1LEIB 5I74C 3SPVB 4HUXB 3T04D 1IGYA 4L3AA 5I15H 4LQFH 4N0UA 2DQIH 1QPXA 4JFEA 2JJTC 4RX4A 4H8WL 4I5BA 1G6RA 1YEFH 2P8MB 1S7WB 4KQ4H 5ITFB 1U3HB 5B8CC 1DQML 2FX7H 1L7IL 5D70L 4POZD 3DURB 2HFFB 1BGXL 2JK5B 3ARGC 1UA6L 3OKLB 5F71A 1FRGL 3CVHB 4OFKA 2N7BA 2CDFB 1HSAB 4EXPX 1NKOA 3FFCE 4PP1D 3EYUL 2HTLC 2P5WE 1MAKA 2VZOA 3GSNL 5JW5A 1G7IA 1H3VA 3RWIB 3SE3C 5HHPB 1WAAE 4TUOB 3GSWB 3O6ML 3P4MA 4GW5A 3ECBB 2H2PD 4J7RA 5CZKA 1IILE 1K4CA 1P4LA 1HHHA 1CFBA 1QNZL 2VISA 4HUWB 2YD7A 4EI5A 2CIIA 4X6CF 1E27A 3PHSA 1MFAL 2X10A 3BSZH 2D7NA 2FATH 3ROOB 2KUTA 4Z7UE 2OTWA 4GSDH 4MZ3A 4OCYH 3DBXB 1BEYL 3K3QA 4JO4L 1LP9B 5J11B 3KYNB 1DEEA 3NACL 3BD5A 2DLEA 3ILPA 1YPZF 4HQQL 3MX0A 4LPVA 3DPBA 3X13B 4LLMB 5JTWA 3RL1B 3JBG7 4RA3A 4RFNB 1UYWL 5CJOL 1XGUB 1X7QB 2Z93A 3R1GH 4KK6D 2FECL 3FOLA 1EFXD 1F4HA 3ARBC 1A6WL 2DBJA 1JNHA 3KPRE 3RI5F 3ZKMC 5E8PB 1NBZA 5MENB 5J89A 1UJTA 4J6RH 1VFAA 1P4LB 3S98A 1JHLL 5MEND 5B21A 2VDKL 3U2SB 2A38A 2CXGA 4OCWL 4ELKA 1NC4D 4HX1A 2CRYA 2QSCL 4PBWD 3H3PL 3GMPA 3IDIB 2EDDA 3ZTJG 3BW9B 4XHJC 2B7DT 4U6VL 2Q8BL 1HIML 1A1NB 4HK0A 5HVHC 3VRJB 5DC9B 3TNNA 2RBLA 3U30B 2VUOA 2X4NB 3INUL 1JYWA 4PRPB 3THML 4ZO8A 4Y89A 3MUJA 4GMTH 4FQCL 4XPFL 1T2QH 5I75B 2QQNH 2WBJD 1I4FB 3D0VB 3WFEL 2RCSH 1FL5A 2DQJH 3VXSB 12E8H 4JRYD 1MNUH 4AL8H 4YHKH 1N8ZB 5A3IC 2AJYL 4FXKA 3L3JB 4R26L 3EOYG 1EPFA 5GZOC 2ADFL 4NUGH 1N6VA 4L4TA 1BIHA 3MBEA 3EDJA 5C0CE 4WJ5A 1AJ7H 4NKIH 5KSAB 4FG6C 3VXSA 5IWLA 4XPHH 1Q94B 2BSRA 3GMPB 4JFED 2AJ3A 2BY1A 3MO1B 1L0QA 5DEGA 1U8IA 2RIKA 2CMRH 4JPKL 2P24A 3S3SA 1DBAH 2D7QA 4X6FB 2FL5A 2ITCB 5F7WC 3VFGH 3HUJF 1VFAB 2QADD 4WHYG 5C9JB 4QNPF 4LRNL 5JR1L 1EIBA 2DTMH 4LQ1A 4PB0H 4HAGA 3I6LE 1OB1B 3GBMH 5JORA 3BXNB 2Y7QB 4OLXH 4P2RE 2ORBL 3IDIA 1ZXQA 5EOQL 5CEYB 1HEZB 3KVQA 4OF6A 2AV1A 4HS3B 3HLAB 4HF5L 1CN4A 3WHXA 3EDFA 4JEGB 1YUHB 3S3JA 1FYHB 4PJDB 3V4UH 3F5WA 4Z7VB 4UDTB 4ZUUB 5E1HB 1RIUL 5C0JA 4WI5A 2SEBB 2NY6C 2HRPL 2MJWA 2NCMA 3OAYH 3MFFB 3DMMA 2X4UB 2X9WA 2O5XH 3AXLA 4UT9H 4DW2H 2YUZA 1WISA 1J0HA 4HXBH 4RA0C 3QXTA 4Q74A 2B1HH 5ITBL 4AQ1B 4XX1G 5KAQF 2X4PA 1I1YA 4RMVA 1S5IH 1ZVSA 4U33A 3SDDA 5M95B 3O9WC 1OM3H 4FQQB 5BV7L 5J3HD 3S6CA 2EECA 3MOAL 2ZP0T 3O6LH 3EW3B 4NKOA 2YKLL 2VDKH 4RFEB 2ZOLA 2HA1A 1O0VA 3RNKB 5KSBE 4KQ4L 4W4NA 4I3SH 3T1WA 3MCKA 1FIGL 4OCXL 1FFNA 3HI5H 4JO3H 5JHLH 1B3JA 4MD5B 2NY7H 4CNIA 4PJCB 5JIPA 3R06B 4XXDA 3QZWA 4OV6F 2BSED 5BZWB 4RWYL 1F2QA 1ZHBB 2R23A 2KQNA 5E6IB 1KLGA 4X9IA 4F37F 1KCLA 1P1ZA 1H5BB 4L4VB 2YHGA 3LRSB 4M7ZC 1ACZA 1B0RA 1U3YA 2YEZB 43CAB 3G6AB 3UJJL 1EMTL 2YMXL 2R4SH 3CH1B 1LWRA 3QDJE 4FZEH 4XAWL 5C08A 3S5LB 3S36H 2HJKA 4OZFH 1MREL 3WLWC 2J6EL 1ERNA 3QG7L 5TE7H 2V9RA 3D69B 2NX5A 3IFPA 4G9DB 4JO4H 4OLYH 3EYOA 4PJ5A 1Y18A 2O5ZH 4U1KB 2I07B 3RGVA 2A6DB 2VLLA 1K6QL 1ORQA 3FONB 4GXVH 4MAYB 4Y4KB 4PJFA 5T3XL 1ZEAH 4X98B 1UKTA 3BZEA 1YY8B 3SDYL 5DRWA 4OM0L 3UJTL 4KRPB 5AYUH 4P99A 1F5WA 1UB6B 5C6TH 4C56A 1JHTA 2FBJL 2BNQD 5EIIB 1PKQB 4XGZB 3U7WH 3MJ8B 4P5KB 4UV4L 1KB9K 3SDCC 1QFWH 1UXSA 4AEIH 3V4PL 4UOW0 3B9KA 5A2FA 5I1CH 1PBYA 1GHFH 3QXVA 4ENEC 2NW2A 5CZVH 3EO9L 4GRLB 2P46B 3DHJA 5T1DL 1MCKA 1B90A 1B88A 4R7NA 5TE6L 5GGVY 4KTDH 1K8DB 1T04B 4AIZA 2E6PA 4M7JH 1KNOB 4PREA 3KLHC 4HPOH 2CK0L 4K7PH 3BIKB 5GHWL 4RMTA 2BZDA 3GI8L 1LE9A 5ITBH 4G9FB 1FO0L 3MRIB 5EUKB 4OZHA 4WW2A 2D7OA 1WCBA 1C12B 4W6WB 4W4OC 4OSUH 3NIDF 2BHZA 2EDWA 2OM5A 4ETYA 3VFOA 3CSPA 3JWOC 3U2SA 1KEML 5EZLB 1UZ8B 1CICC 2WBJA 3MV9A 1KGCD 4YX2H 1T1YA 3MLTB 3HG1B 2DQHH 4JPVL 1X5KA 5ICXA 1YECL 3PGFL 4EUPG 4X5WA 2VXSH 1G0DA 3FB7A 1BFTA 1P5VA 2GAZA 1LHZA 5C09B 5BW7C 4RGMC 1OAKL 4ZODA 4CMMB 3TM6A 4XT1C 4MCYB 4BSWB 4GAYB 4DVBA 5B38B 1BAFH 4LRIC 4F7TB 1TXKA 1A7PH 2X40A 5C07D 3RRQA 1OF2A 5JZ7C 4O4YL 3CFBA 1DLFL 5I8OL 2ZPKH 4KVCH 4OUUA 3MRPA 4Y4FA 1TJHL 1I1RA 3B9KB 5EUKA 5SWQB 4GKOA 4GSDL 3GHBH 4P2QB 3SO5A 3L9RA 5D71L 4M9PA 3IJHA 3MNZB 4XCYA 4P2RB 3PP3H 4QHMA 3SGJC 3LSOA 3CC5A 1J87A 2YUXA 1R3LA 5EA0H 5C09E 3TC9A 4Z7QF 5JOFB 1K4CB 3WS3A 4XCNB 4XP4L 2P8LA 5D1XA 5L6YL 2ESVE 3QDGE 2YD6A 3BKMH 3PL6C 1VGKB 4FXGB 4YC2C 2VITB 1MHPH 1H0DB 5EBMA 5HGHB 3QWQB 2NQCA 3EO0B 1I85C 4MAYC 3S8WA 4U49A 1WJ3A 3C09C 3STLB 1P9MC 4JM2B 4D8PA 5GRXG 3K7UA 4GH7B 4L4VD 5IEKA 4MMXC 1PKQA 1HOCB 5HHNA 3HNSH 4OF0A 3N1GC 5DDHB 3I3DA 3NTCH 3K2UH 5J9PA 2IPUG 3BMVA 2KPNA 1KB5L 4APQB 3DX8A 5LWYL 5C0BE 2JLLA 4P2RA 1ZA6A 3S4SA 4AT6A 2XOTA 4JG1L 3C87A 3VRIA 4FZ8L 3KPRD 4Y4KA 3NZ8B 3WS6C 5I9QC 5EU6D 4AT6B 2G5BB 3KPSB 2IAND 4HS6A 1S9YB 4Y5XB 1HIMH 2QKIA 2APTA 4OFYA 5I1DB 1J8HD 4ODWA 3UTSB 5B8CB 3U4BH 5AD0A 4LEOB 4ODUB 4PG2A 4KU1A 5SWZE 1IARB 1AHWA 4FG6D 3OX8B 4KJWD 3TBVA 2PXYA 5FK9A 2I9TB 3GZKA 3KJ6L 2YPKB 3L7EB 4YDJA 3U0TA 5HYEA 1CLZL 1NKRA 1S7UB 4FFVC 4QOKE 1ZHLA 1AP2B 1P7HL 3QDHA 5DFTA 5H37H 1D5MA 4G6FD 4FMKA 2I27N 2R0LL 2Z91A 3L6FB 4PJXF 4QHNB 25C8H 3BRFA 2BK8A 1TZHA 2V7NA 1F4YH 1RSFA 5IB4B 1QR1B 5DHVA 4NBYB 3MRQA 2YPVH 2MQ0A 1JJUA 5T1MA 4HUNB 3DX6B 1W72H 5LXGL 1IEAA 1P84K 5MENE 2XKNA 4WI2A 4YXHH 4K94C 3MLXL 4JY5H 1CFVL 5J11C 3C08H 5HVWA 4ESKA 1VHPA 1OQXA 1XF3A 1FSKC 5BJTA 1CBVH 3NACH 1LO4L 3IDGB 3WJJC 3FMGL 4DVBB 1OGAB 4G6ML 2EEBA 3ESVF 3K8KA 3CZFB 1PSKL 4Z5RA 4QY8A 2DQDL 1YJDL 4JLRB 5F7LB 5D1XC 3FO2A 4XBEL 4P46A 1MVUB 3G9VA 4P3WA 3P4LA 4ELME 3FB5B 2AK1H 4IEFB 3BH9A 3DX6A 3WDJA 3QCUH 2A1WH 2J8OA 4JM4L 2QHLA 4IIQA 4B0MM 1QKZH 2F58H 4XWGH 2R2HA 2XNAA 4KDTA 5MEQA 4OCNC 2EH8L 4PGZA 4MJID 3U6RA 4HIXL 3WNOA 1QHOA 2QV2A 1S5HB 2GIYA 1NEUA 3BN3B 1CR9L 3ARFB 3FZUC 4G9FD 1YDPB 5E1AB 1EEYB 2ADGA 2BDNH 4PJ8B 1DBJL 4G8GA 4HH9B 2PYEE 2Q8AL 1OM3L 3VD5A 1XIWD 2PUQT 2ENYA 1F6AB 4FA8A 5GGSY 4RMQA 1ZHNB 2FL5B 3MACL 4FMFA 3RVVD 4KQ3H 1LO5B 1QFHA 2D03H 1VGEH 2EKSA 4MAYD 3QXUA 1RQ5A 5HYIA 2ICWI 3GKZA 1VACA 3VW3H 2W9DH 1ACYL 3KNBB 3H3PH 3TJEL 4OZIB 5FDWA 3JWDH 1X4YA 5GXBB 3C6LA 3A6BL 2BNQB 5DR5H 3RL2B 3IFOA 1BWMA 4W4OA 1VDGA 3LRGA 1TFHA 3P9LB 1KSRA 4EI5C 5ADPH 2X70A 3TT1L 2YN5A 4Y2OA 5ACMA 2YC1B 5I1AA 1RUKH 4R90H 4KHXL 5AZEL 5EU5B 5I1JL 1MJJB 4MX7B 4E41A 1IM9B 4PFEA 3OXRB 3MCG1 4F3FB 3ULVF 2FCBA 1R3HB 1DBAL 3J8F7 5LGJA 4NO3B 2W65A 1TENA 4HAFA 4PTUB 3DYOA 1OARH 4E42A 4UV7L 2Q6WA 4PJ9A 4X0KA 2B1AL 4HKBA 2E6JA 3MGAA 2VDOH 2GQHA 2FJHA 5FKPB 1JNHB 2DQFA 4Q2ZB 1MFNA 3BOVA 1MHCB 4N8VB 4F33A 4XC3H 3OR7B 5MEPA 3BZDA 4JQVA 3GSOA 3O4LB 3MLSL 2ZJSH 3OGOE 3MA9H 2VKWA 4WUUD 3RZWA 1TJHH 2HJLA 3HPJA 1T6WA 3TEUA 3UYRL 2ICEA 1U8QA 5DJ0A 3RWEB 3BKCL 3BPCA 5F1SA 4QWWC 4CRPA 4RAUA 1IC4H 2OZ4L 1HINH 5HXMA 4YLQT 3VDBA 1P2CB 2VIRB 1XF3B 4LBEB 3SEPA 3MLTA 5A2IH 4HJJH 4GRMB 3ESUF 3BFOA 3LMJH 4QRUA 2WBJC 4PRAA 3O6LL 3LY6A 2KDGA 1OW0A 4HD9A 1MCWM 1GHFL 4X4XB 4NIKB 5F44A 3D0LB 5CSZB 2HKHL 3IKKA 3SDXA 5GRYA 5KZCB 3MLWL 3ZDZE 1MLBA 2YD9A 1MCEA 1TNMA 4EIGB 3DX7B 3ZYOA 4ELMF 1HYSC 2BVOB 1WT5C 2IBZY 3MV7B 1YQVL 4GRLD 4LAJH 4Y7MA 2P8PA 2VYRE 4TUJA 4XAKD 1CDBA 3FFDA 2FDBP 3PP4H 5KVGL 1Q0XH 2UYLB 1KEMH 3UTPE 3V6OA 3OB0K 1UCBH 4Z76B 4NN5C 1WGOA 1WZMA 5I8EB 5GS0L 1HEZA 2I60H 2ZWLT 5DEFA 1S9VA 3UZEA 4LCIH 3A6OA 5I8CA 2EIBA 2JJWA 2BFVH 2NY7L 3G6DH 1S9VB 4PD4K 1OQOA 4DGYL 4OZ4B 1AD9A 5HD8C 2H6PA 3NIFF 3VWJA 5ISZB 1JNNH 5F9AC 1Z9OA 4ODTL 1ZT1A 3WFDL 2J2ZA 4XHQA 2DQGH 4DQOH 5FGSA 3O3DA 2GKIA 4MA8H 1NEZG 2Q6WB 1LO0L 2APVA 3MO1A 5K59E 3CPLB 2Y07H 4YDVA 4JFEB 2Y25A 5DD0H 4ZUSB 4PLNC 4OD1L 1M05A 2GTWA 1EMTH 1CZ8L 1UACH 1KPUB 2XFXA 2QQKL 3TA3A 3LKRA 1IGMH 1ZHKA 5IESH 4JFDA 2A0LD 5IBTH 4ZMAT 2VJXA 4OFYD 1U8PA 3UTQB 4P9HC 5D7LB 1CVRA 3BVNB 1QKZL 1U8KA 3UBXI 1R5VB 3IDXL 3VFPB 1MAMH 4G6MH 2LV4A 5FDWB 2LQRA 3Q48A 1K4DB 3MJ9H 3RDTA 4M3JA 4R2GD 4YQXL 1PQZB 4XP1L 4DFHA 4PP1C 2YPLE 2CKBL 4IBLT 1XGYH 3ILPB 1K5NB 3QHTC 2Q8AH 4Q0XH 3HC3H 1UKQA 5F7UA 1NBVH 5I1LB 3IFNL 5J1AB 4Q9QL 3BEVA 2B0SL 2FX9H 2R9HC 2RFXA 4MAUL 5L2KE 4ZOCA 4X83A 1L4IA 2R0WL 4U3HA 5ISZD 2CRZA 5HHVL 4V1DA 1A1OB 3VXSE 2D0HA 3LPFA 3MV9E 2E7CA 3KPOB 2WBKA 2I9LB 5TE6H 1HHHB 2Q7YA 1J5OL 4U6HB 3TV3L 4XPGL 3W9DA 1FYTE 3O9WA 1CGTA 3H3KA 4MXVF 4X99A 5HD8D 3FAWA 4OGAC 3ARRA 4GKSB 3WNNA 1FBIL 4YGVB 1F58H 4LLDB 3UROR 2WQ8A 3OKKB 4BFIB 5DD5L 2VDRL 1EHLH 1YJDC 1UM5L 3QP3A 4K3JL 4OB5H 1UH3A 4RMWA 4W6YB 1GPOH 3M1BB 3A67L 3GSOB 4S11A 4XRCA 4QXWA 1AC0A 1JZ3A 1KYOK 2NZ9C 3BJLA 4LAQL 1I8LA 4I5BB 2XACC 1I1AB 4MQ7B 4X6BA 2FEDC 5CLTA 4M5ZH 3H42L 3JWDC 2AP2A 5CS7A 5HHQB 3JV4B 4BQ6A 3WNPA 3UJIH 1OSPL 1LEIA 5IG7A 1INDL 1OL0A 4X0KB 4KI5F 2AEQL 3X3FH 4OKDA 2N7AA 3WJLC 4ZXBB 2B4CC 2YD8A 4JRXE 4Z0XA 3LKPB 2XFXB 3TA3B 4X6FA 3GSWA 5C08D 2ESVB 4O9HL 3LKOB 4QRTB 4MA1C 1Q72H 1M05B 3NIDE 4LGSB 2A9NL 3BP5A 4JN2A 2FLBT 3V95A 2XTJB 2VABA 1YEDB 4KDWA 4HH8A 4XC1H 2XXCB 2VOTA 3MQIA 3S34L 2ADIB 4JO2H 5A2JH 4AM0A 4P5TB 4X80H 4XBGA 1G7QA 1DN2A 1R3LB 1KT2B 3IETA 5EC1A 3NFNB 1FZMB 1RUQH 4RBPH 1NJ9A 5KVEL 4X7DC 4LDOB 1UJ3A 2ZUTA 5FO9B 3EYSL 3I9GL 2E5EA 2NXYB 5CP7B 1NC2D 4UBDC 1N5AB 4OQTH 2IFFH 3ZTJH 4TPRL 4BQCA 1E4XL 3MRGB 1BX2B 1U8OB 1BJMA 4X5XA 3IXTB 2FX8H 4NCC2 2LTQC 4KJQD 1TZIB 4BSVA 4JVWA 4RSVA 4HFWA 4Z6AT 4EQ2A 1N5AA 3DSFH 1U2CA 4XWOD 1XGYL 1RIHH 3MACH 4MD0A 3PV7A 1P4BL 4HLJA 5DSCA 3KR3L 2DAVA 4KROD 4MJ2A 1A7BA 4Z7VF 3SQOL 1ZS8B 1ZA3A 3QNZA 3SE8H 3CFJB 2E3VA 3TO4D 3FTGB 4X6DA 5CSZA 4MVBC 2QQLL 4U1LA 1PG7H 1S7SA 1XF4A 1NAML 3DMMD 2VITA 2JJUA 5IKCB 1XR8A 4XPGH 4NZUH 2AJXH 3CX5J 2UZXB 3KPPB 1KENL 4JFQB 3RNQA 4C59B 5C2BH 5CEZH 4U6HA 1E4WH 4IRSC 1QR4A 4H1LH 1D5MB 3T0EB 4P4KC 3VDCA 4JRYE 4NQCD 3SKMA 3VH8B 1EBAA 2QLVB 2GFBB 3SO3C 3VXQA 1U8QB 1NBYB 3K74B 3BAEH 3GSQA 1J10A 4M00A 2BSSA 1NMCC 3PABA 5GGQH 1MSPA 3C5JB 2GYSA 5FYJE 4OUUB 2X4SB 4I1NB 4GRLA 5E03A 1Y0LA 1I8MA 3WFBH 4Z7NF 1XCTA 3STZA 2IQ9H 4ZUWA 2VUYA 3C8DA 5IMMB 3VI4F 3QEUB 3CFKB 3V6ZB 3TO2B 5C0AA 2VDOL 2EXYD 3RIFF 5KSBF 2H9GA 3T0EA 1HQ4B 3ETBF 5F9JB 3ARBB 1G7QB 2W65B 1IFHH 4OBRA 4BZ2L 2VZUA 5E9DB 2NY6D 4H0HB 3EYVB 5LCVL 4QRQA 1OGAD 1NLDL 4M1GL 3WIFA 1F4WH 2CLRB 5FO7B 4XPAL 2IQAA 4RAVA 1S9WA 2Y36H 3O6FB 4U1IA 1VGKA 1GC1L 1YEGH 1ZV5A 5EU5A 1C12A 2YPKA 4YDJB 5JR1H 3RJDA 5DJZA 3WO4C 1CDIA 2BSRB 3D69A 3RVUD 5E2WL 1B6UA 3IRPX 1ITBB 3NGBB 5L8JB 3GGWB 2NXYC 3GNMH 4LLVA 3F7VA 1I8IA 3CIQA 4JRXB 4DOHB 1M6OA 3WIIH 1ZA6B 1KBGH 2QSVA 1RK0B 2WM0A 2XWJA 3JV5A 35C8H 2DQEL 1HE7A 5EZIH 1GOFA 5CIPB 3TZVD 3CVHL 4AK1A 1Z5LA 4YNYB 5F6IC 3RTQA 1IGCH 4NC0B 3MJGX 4PUBH 4BJLA 3WYRA 3LKRB 3CDYA 5C07A 2DRUA 1J0YA 5GJTH 2R0ZL 4X4YA 4O02H 1EFXA 2ATKA 4H8WC 3O2DH 5DRWB 1SMOA 2O61B 1D9KA 4PLKD 3WSQL 1WWWX 3Q3GA 3O4OC 5FF6B 2UWEF 3RWJA 4PGCB 5I1IL 5DD5H 2I5YH 1ZOXA 5L88L 3ULVC 1G7PB 4JR9H 1I3RA 1WIUA 5AZEH 1A5FL 1FFPB 3OHXB 4UDUA 3QQNA 2OP4L 5C0ND 2J88H 3UDWC 5H37G 1X3DA 5HHOB 2G2RA 1QRNB 2OL3A 2DWEB 1TETH 4M93B 1UVQB 4S1SL 4GAYA 2V2XB 3U79A 2R9HD 4XNYH 2XICA 2CXKA 2AV1B 4CKVX 3HRZB 5F88A 4RMSA 4QWWD 1I3RB 2JCCB 3SCMB 1FQ9C 4MQTB 4TYUA 4S2SB 3O6KL 5IFHH 5AUMB 3KLAB 2X7LA 4N8CH 5E5UB 3EYSH 3MXWH 3G9AB 3RWJB 2VC2H 1TTFA 3R4DA 2DLHA 4UB0H 1S8DB 4IDJH 3M8OL 3HNVH 1IM3B 2CKBH 3IRZA 1XGQA 4C4KT 2E7MA 2JF1A 3CFJA 1M1SA 3LS5L 3MXVH 3P3YA 3T4AA 4A6YL 2XI9A 2XQBH 2BXZA 3DRQB 4M1GH 4NO3A 5JA8B 2EDQA 5FXCH 2QSTA 4V1DE 2CD0A 2PW1B 5FGRA 4MJIA 2A6DA 2VLLB 1A6WH 4KTEH 2CK2A 5T1LD 1EK3A 2CUIA 4FP8H 1CGUA 4G43B 1L7TH 2GSGB 4Z0BL 4ONGH 2HJKB 2ZG1A 2PXYB 5E4EC 1BX2A 2PF6A 1M6OB 3TLRA 1NAMH 3LDBB 3QEQD 1KIRA 5EUOE 3E2HC 4Y5XA 3QUMB 3V52L 4Z7UF 4F57H 2FIRT 5CUSL 1UFUA 3MRHB 5HHMB 1IGYB 3KR3H 1BHGA 1ZSDB 4TVPL 4XCEB 3N9GL 1CGVA 2R23B 5DUML 3D25A 3TH4T 1T1ZA 5JW4M 1ULVA 2LU3A 2FR4A 1B0WA 4H25A 3EO0A 4JY4B 2ICWB 2YMXH 2WV3A 1RVFH 4MGXA 3DGCR 5E1AA 5CEZL 2R0KH 5L2JB 1IEBA 5BS0E 5JXED 1AR2A 2DIJA 4UBDD 5C70A 2AJYH 2DIBA 5JHDE 3ZYIA 4UT7H 2R1YA 2CLVB 1XGQB 1TNNA 3SOBL 5JPNA 4PRPE 1GOGA 2YWYA 1PLGL 1HHJA 1QYGL 2E7BA 3FT3A 5BRZE 5DRZA 1J8HE 2RGSA 3WKNA 4XMKH 1EJOH 2ZSWB 4N9GB 4MDJA 4GS7B 5E7FA 3MRPB 4Y4FB 1S7VA 5DRNA 5MERB 3WHE0 2ZNWA 3NFPA 4OIAA 5CJXA 3ZKMD 3DNKA 4HEME 1TDQA 2CRIA 1QD0A 4S1SH 4XPAH 5DVOA 1C16A 3C8KB 5IJVA 2LABA 5TQ2H 5F3BB 4PGDB 3RY4A 4PRHB 1OAKH 3E0GA 3GMQB 5TGBA 1SJHB 1D5ZB 2W0PA 5IW1A 5IFJA 4UAOB 3DARA 3ZE1F 2NYYC 4IRSA 5CINH 2FJHB 1FLTX 4PYHA 3FT4B 5D7JD 1KUMA 3V8OA 1G9EA 3G04B 3KYMB 1S7RA 5K33A 5FECB 2CSPA 4OD3L 5D5ME 5KS9F 2R15A 2BRRL 4FQ2H 4R2GB 2FH8A 3CFDB 3HFMH 1GGCH 4HGWA 3O2DA 1NSNL 4G8GE 4CU7A 4TVPE 3SGKC 1IGTB 3QZWG 4KJYB 4R8WH 3N1FC 4RGND 1JUFA 3QDJB 3BH9B 4XCFL 1KB5H 4JY6A 1QSEB 5IOPA 1E4JA 4WW2B 5C8JA 3OR6B 2SEBA 1Q9KA 3B9DA 1N4XH 4R4BB 2B8OT 2VLJD 3I3EA 4WHTA 4AQOA 3C6LB 4NN5B 2OR7A 5FYKL 1JIBA 3RUGE 3U48A 4B7LA 4UOW1 4MXQD 2BP3A 3RU8H 1QHPA 4JQIL 1YNLH 1CICB 3TYFA 1NAMA 4Y8AA 3TBVB 1RUML 4E0RB 4WCYH 3FRUA 3NTCL 1FFRA 4M61A 4F57L 3SDAB 1IMHC 5A1AA 5MEPB 2E7HA 2OXGA 5F7EL 3IB4A 4YHIA 3NZ8A 4UMGA 4LNRA 4PGCA 4TUKH 4X7SL 1UEYA 4L3CB 4NSKA 5DD1H 4LPCA 3SE4C 4GUPA 3ZE2E 4KRMB 1TZHB 3IDMB 4O5LL 4WIQA 5DDHA 3FN9A 2OSLB 4AL8L 5C09D 1MJUL 5DWUH 4N90E 1HH9B 5L2JA 3L5HA 3BZEB 4UQ2B 2R2EA 2VNCA 5MEQB 3VXMD 2J8UE 3UJIL 5IFAL 4WDIA 4MCZA 4YHYB 1J8HB 5EBMB 1HCFX 4HIJA 4I48A 4U1HB 3WUWG 5E8NA 4HSQA 5HDBE 4GXUN 4N0YH 4JR9L 4XP4H 3IJYB 2GUOB 4JB9L 1BIIA 5CZXC 5IMKB 1FL6A 2WAHA 2ZPKL 1NUGA 5IBLD 4JZNA 5B4MD 4WFGD 4XMKL 5HSFA 3IJSA 5C0EA 4NBZB 4XP9H 2CO6B 4WWKC 4C56D 3M1BA 1RZ8A 1OGAA 3C09B 4WV1A 3O3EB 1OTTC 1MFEL 3RL1A 1AFVL 2UYLA 3BDBA 1OLLA 2Q87A 1D6EA 4AENB 2MHAA 5BJTB 3CMGA 4K9EL 5JDSB 1NEZB 4K7FA 1LO5A 3ZKQD 5I76B 1DDHB 5GGTH 1U91A 3FAXA 4XPTH 1YC8A 1R5WA 2E9WA 1NDMA 3VXTA 4KK5D 4Y0GA 4Y19B 4M7KL 3BKYL 4HGWB 1Q0YH 4Y19D 3S37L 4F9LA 1R3KA 2PYEA 1CK0H 5FB8B 4PGEB 4GXUM 3QIWB 3G6JE 3RPKA 2VXVH 1AGDB 1UENA 4LEXL 4ZUTB 1HK6A 4ZPVB 5DUBA 5IM7A 5CGYD 2C4FU 4OGXL 3WFCH 1KC5L 4NNXB 5HYJA 3KGRA 5FYLL 2WIMA 4ZFZA 1NSNH 5J12B 5GHWH 3OAZH 5GGRA 5EUOA 5D2NA 5CD3B 2BVPA 4G8IB 5GRZA 1LEKA 5EU4A 1EXUB 3GMLB 3C6SA 3ILQC 1MLCB 3GJFH 3PQYB 5IHZA 4Y8DC 3D87B 4S2SA 5DMIH 4BK4A 1DQJA 4RNRB 3MA7A 5EOTA 3TO4B 5MHSD 5MP6L 4HDIA 1CU4L 4JPVH 4RFNC 4CJ1A 3MRNB 2GFBA 3VXQB 3BXNA 4LLYA 1T5XA 3IJSB 1D5IL 3CXDL 4G5ZL 2YWZA 4S1DC 2DQTH 3C5ZD 2UUDK 4JPIB 3AU1A 3B3IA 2NY0B 3LEVL 1JRHH 3JVGA 2M8XA 1HNFA 4G3YH 3BPNB 1UQSB 3ZDYE 1OLZA 4NQVB 1G9ML 4WY7L 3RA7H 1VADB 1JF5A 1JK8A 1BVKA 1DLHB 1B9ZA 1NMAL 1TVHA 4X6DB 4UQ2A 3QFJD 3QXWA 3EJZC 3UTPD 4MDIA 4AM0B 1EX0A 2C26A 1G7LB 1C5DA 4GMTL 5I16A 1MCDA 1Z9LA 1ADQH 2XY1A 4JM4H 4LL9A 4MA3A 3ROLB 1KFAH 3IKCB 4JQVC 1KELL 2WINA 5IVOA 3MBEB 4OQ1A 1NQBA 1J88A 1E6JH 1RU9L 4NJAH 4JB9H 4LKXB 4ZXBA 1F8TL 2W59A 2DM2A 4GKNA 5I75C 3M8OH 1FGNH 4PRBA 4Q97A 1FZKA 4OZHF 4NRXA 3PWUA 1T7ZA 4ETQA 4P2QE 3LEYH 4PLOB 2PYFA 5J6GA 1L7TL 1P6FA 2AAVA 4NWUH 1KJMA 1KT2A 4KTEL 1SYSA 1MCQA 5HYJE 3TPUA 4OUOA 4EI6B 2XY2A 1JZ2A 3T4AB 1CXFA 4AEHL 2HT3D 1H3WM 2UWEB 4YFDB 3RU8L 1YEDA 3TJEH 4HXAL 3X12A 1H8OA 5CUSH 2EC9T 2WBWB 4YGVA 4LRNH 4X4MA 3UO1H 2WMPA 5F7NC 4ODVL 5E2TL 2FRGP 3RGVC 4PP2A 2GJJA 1FYTB 5DURB 2X6MA 1G84A 4XH2B 1NBZB 5LVEA 1FPTL 5C0CB 4PRAB 1ZLSH 4M7LH 1G9NH 3QG6B 4PJIE 1ZLWK 5FCUH 1HI6A 3U30C 3PUCA 4R90L 1JHKL 2IG2H 3NOIA 3O4LE 1ACYH 1T5WA 3QFJE 4EQ3A 4PJEF 1D5XB 1G7JB 3V5DA 2ICEB 4M48H 5HI4C 3LEXA 5JIKA 3EDDA 5C0CA 1OOAA 4P49A 3TIEA 3B9EA 4TSCL 2R56H 3MFGB 1ZGLA 4NQEE 1Z3GL 4QGTA 1NGPH 3MFFA 2X4RB 5DJ6B 1WICA 3C5JA 1HWHB 3VXMA 2C1PB 4KDTC 1A4KB 2VDNL 3ROOA 5EU4B 2OS7A 1U3JA 3RX5A 3U83A 1BFVL 4XP5L 1KN2H 1NGYA 3Q6FA 3L5WB 4LSUL 1JRHL 1NCCL 4HUWA 3RWGA 4PRDA 4G42A 3MPCA 2XXMB 3F65A 4TQEL 4RFEA 4I18C 2YD3A 2DYPB 1C7SA 3QNYB 5D2LA 1FIEA 2GK0A 3TZVC 2XPGA 4YPJA 1T1XA 2IMMA 3BGAA 4XBEH 4AEFA 3O6FC 4P23C 2FWOB 1UB5A 2UWEA 3O3UN 4ODBD 4Z7OF 5J13B 1UCTA 1WSST 4B7IA 1VSCA 3CFEA 3BT2H 1Q94A 4PJXB 5FM8A 4XVJL 1SM3L 1V3MA 2VSDA 4F8TA 3H9HB 1MHHA 4G6AC 4TULL 5FHAL 1NCNA 2FYYA 5F96H 1OP3H 5JW4R 3SN6N 1GGCL 3F5WB 4Z7VA 4JFDE 1IQDA 3RDTB 3MTRA 1DQDL 1FZKB 2X89A 1G7LA 1ZE3C 1ROWA 3VJ6A 4OCYL 4JFPA 3EZ8A 1PW3A 2O5ZL 4L8SC 4MB3A 2J8UA 4L8SB 1LO2H 3QULB 4YDIL 1A6ZB 3G6JF 3ARFD 3LMJL 2K9UA 1T2XA 4HPYH 5CP7A 3T09A 3WUWA 3CUPA 1FNGA 2CDEB 3R06A 4XXDB 4P46D 2HJFA 3GMNB 1HZHL 1IAMA 4HG4J 4EKXA 4GG6F 4X7FC 3NFSH 3W5MA 4IHOB 4UU9B 2ADJB 4IRSD 1C5DB 3TPKA 5I16B 4XTRC 5DT1H 5E9DA 4W68A 4X7TA 1HKLH 1CU4H 2BVOA 3MV7A 3DECA 3O8XD 5F7KC 1NDGA 5IB1A 3P4OB 5KSAA 1CLZH 3EFFB 3OL2A 2P5WB 1AGBA 2CJUL 2H9GB 3VFTB 2WIIB 2M1KA 3SE4A 3FFCB 4MAUH 3C2AL 3WS6A 2AXJA 4FQQA 4ZS6C 5GSRA 4P5MB 1P6AB 1ORSA 4LASL 2R0LH 1MCRA 4PJXA 3LN9A 3S97C 2GJZA 4NO5B 1U0QA 2VXUH 5E95B 3EYFA 1B0GA 5HDBF 1PYWB 3OKDA 4LBEA 1QBML 5KZCD 2CUHA 2X4UA 3C9NB 4GJTB 1AI1H 3A6CL 5DUPH 3LKQA 2OI9B 4S0SD 1UA6H 5DA4A 2J8UF 3WJJA 1YUHA 4N0RA 4PJCF 4L4VA 2VAJA 4Z7UB 2BCKA 2DM4A 4PRDB 2R29L 3I50H 3L5XL 3L1OH 3MODH 1XF2B 4PRPA 2NR6D 3SOBH 5FUZH 3DI3B 1GIGL 2CLZA 1QA9A 3L95B 4KRPC 3ZE2F 4NP4L 4WO4A 3UBXA 4PJ5E 3QH3A 2P8PB 4XVUC 3QUZB 4LIQL 1A4KA 1K2DA 4PJHA 1MUJA 4OGYL 1KPVB 1S7SB 1XF4B 2YS4A 4YHPB 5EOCJ 4ELKB 3BSZL 3MGTB 4HWZA 2OTPA 1T22B 3OKOA 4L8DA 4A2LA 1QFUH 5KW9L 3D0LA 3PXJA 2HFGH 3S34H 1OAZL 4UILL 2VLRD 1BZQK 3V5HB 3ZTNL 1QLRA 4ZS7L 3BPLB 3ARDA 1NCUA 1WC7B 1ZHLB 3PDOB 4WJ5B 2ORBH 2MQCA 1BJ8A 3QWRD 1DR9A 1AD0B 4KVCL 5T5FL 3MLZH 3VA6A 1B2WL 4NQUA 1KCVL 3RY6A 3T0XA 3CFIC 4F58L 2Q1EA 1E4XI 4GG8B 4J3SA 4XZUA 4U0QB 4IJ3B 1NC4A 3F6LA 2A6IB 3TV3H 1SY6L 5D71H 4DKDC 1XEDA 3NCEB 3OJ2C 1RUMH 3SBWA 1OAYL 3V0VA 4LSRL 2XWTA 2W91A 3G5XA 2AK4A 2FO1A 5CBEA 4ORGA 3B9AA 1L6XA 2J3SA 4YXLL 1KIRB 2P43B 1MHPL 1G1CA 1N7MH 4O2EA 5TQ0H 1XGTB 3QJHB 4DKFH 4X7SH 2NNAB 2PTVA 4M48L 5FYKH 3ZE1E 4ONHA 4EEEA 2DJSA 4B50A 1H3GA 3ARQA 4WW2F 2VTFA 3QDMA 4I3SL 1IC5H 3R8BB 5EO9B 3CGTA 3AROA 2FJGA 3SE3A 5KS9B 2GTWB 4MLIA 2PW1A 3KWWB 1LK2B 5GS2H 2FR4B 4XCNA 5ILTH 4KWUA 3I6LD 4MJ6A 3DRQA 1MEXL 1D6VL 1NCBH 1JHKH 2IG2L 3W0WD 5HGBA 1AO7B 4XZUB 1MJ8H 5JHDD 1G6RH 5SWSE 5DFWH 2IAMC 5JQ6H 3NABH 5E5RB 2C3XA 3W82A 3Q0HA 1EH9A 3Q6FB 4QKXB 1KJ3H 3ZLQC 5FEBA 4CDHA 2H6PB 5D7IB 4TQEH 1WC7A 1MY7A 5E8DL 4GLRH 3VGAC 4JO2L 3MOBL 4JFDD 3STZB 2N4IA 1H5BC 1AXTH 1ZT7A 5KTEH 4OV5B 1YECH 1JYXA 3SGDH 4XPHL 2V9QA 4KJWC 4QGYA 1X5AA 4BYHA 3MLYH 4PD4J 1ZAGA 1JFQL 3T1FA 2O5YH 1S7XB 2ZG2A 1HKFA 2EE3A 2DICA 2GCYA 2HVJA 3BWUC 2VDML 1EDQA 2OJZL 5T3XH 4MSWA 2YD1A 1EEZB 3H6JA 3WXVL 1UZ6E 4WNQB 3B5TA 3P0GB 3MJ9L 1EHNA 1MCPH 3ZKSD 3LPWA 3ET9F 3GSXB 1RY7B 4HUVA 4JKPH 4U1GC 5C6WH 5IR1B 5EUOF 5TE7L 4ZAKC 3MGTA 4UILH 4DCQA 2EZ0C 3HZMB 3VFRB 1HINL 4LLAA 4JG0H 4M8VA 3NCYP 3N1PC 4PGBB 3LEYL 1FCCA 3BPLC 3DSNA 1IRAY 5JMRA 2J5LB 4WHYH 3IGAB 4Y2DD 3ZMRA 4P57B 4QRRE 1G7HB 5DJAB 1HZHH 4PJAE 1B2WH 3UO1L 3HZMA 1DANU 4WFHD 4NZJA 2H1PH 5GRUL 3EGSB 3KHOA 1F4WL 4MB4A 4JREC 1KENH 1KC5H 4NRYA 1T04A 5C3TA 4AIZB 4UV4H 1AHWB 5EZIL 3IDYC 5E5MB 2E7LA 4UDUB 1EZVY 1NANH 3F12B 2HVJB 3OKEA 1IE5A 5TDNA 3SE8L 1RURL 4QOKA 4JRXA 5DD3H 2D7TL 2CDEA 2VXUL 2LE9A 3MRKB 4LCIL 5AWNL 1NGXB 4ODSH 4XGZA 1GC1C 4FFYL 4PLJD 1F13A 2ZUUA 2DBLH 3PHOA 4M7LT 4XCEA 3DHMA 1YY8A 3AAZB 4JRXD 1T0MB 3M45A 4HLZH 1HOCA 2Z31C 5HHNB 1RK1A 4RMRA 4RX4D 1AO7D 5EZOH 3OXRA 5JW3H 3LH2L 3I2CL 2Z4QA 1T4KA 1QACA 4HKXB 3RAJH 4AMKL 5GISL 1YEHL 1BIIB 2HT3C 2M26A 3L3DA 3ES6A 4QYOA 4HV8A 4JDZA 3HB3C 4QRRB 4HWBH 3WKMH 4HIJB 4RGNB 4RGNC 4FTVE 4QLRA 2UWEE 5IG7B 2VN4A 3S5LA 5EU7C 1UXWA 3TVMC 1UM6H 1IGML 1H3TA 5J7CC 3HE6B 5FAAA 4ZUWB 3ARBD 3ZL4H 1KULA 4ZOEA 2PETA 2IGFH 3WEXA 1MCCA 1CFVH 3BZ4B 4HHAB 5F9DC 2E6QA 3FHQA 5LQBL 3PQYA 5IHZB 2J88L 3VXSD 1Z9SA 4JM2A 1CCZA 3FRUB 2XYCA 1PKOA 1CLOH 3MCKB 2MCG1 4PJBE 1A7RH 3HPLA 1MCFA 3FHAA 4XI5D 1NGWA 2X9XA 3SDDC 3F7YA 5F1IA 4YDLB 3LSOB 2HWZH 2GW5A 4POUB 3ZYJA 2BJML 2HT4C 2XZZA 5ECJE 5T5FH 3MA9L 3BX7C 3HZKB 4Q9BA 5CILL 5B3JE 1P7QB 3PHQA 3QIBC 3NZHL 1MRDH 4APQC 5D96B 1WFUA 3NA9H 3MLVH 4Q6YA 3H0TA 4TRPL 5LGKA 5I74B 1F11B 4A6YH 1ED3B 5GGRY 5T1KB 4TTDD 3EJZD 5I19H 5EPMA 1HXMB 1Z3GH 3MBXH 1NGPL 1CIDA 4OFIA 4ZUUA 2D4FA 2G2RB 1YMMD 4MYWB 3NIGE 4K8RL 4R3SB 5BRZD 5BS0D 1H9VA 2ICWJ 1QSEE 2FO4A 1N2RB 1OTSD 2WK2A 4O02L 3VFWA 1D3CA 1RJLA 4GG6B 4OIIL 3NABL 4PJ9B 3ARDD 3L3IB 1FN4B 1MQKH 3RVWD 3UTTA 2DL9A 5K9QI 3OWEA 4Z7OE 5T1MB 4J12A 4UIMA 4F3FA 3H42H 3OZ9L 1RVFL 2HP4A 3V4VL 2H26B 2V7NB 5EZLA 1YYML 2DF3A 4ZQKA 2KKQA 4NRXB 5I73B 4K23L 4LHUD 5I71B 5MEOA 3W0WE 2P48B 4C54A 5D7LD 5DYOA 1A7PL 4HKZA 1A5FH 4KI5C 3FQXB 3V0AC 4DN4H 2YUVA 3HMXH 5A16A 5SWZD 4AMKH 4H88L 2D9QB 3WFEH 3QXDB 4FQHB 1GH7A 3TBTB 1WLHA 3IVKB 4J4PC 4YNYA 3S37X 2HFGL 4BZ2H 3LIZL 3ROLA 1IGFL 3SHSA 3IFPB 3W11C 4YHIB 4HKZB 2P1YA 3TIDB 5IMLB 1W0YT 4YUEL 4QF1A 2XQYG 3IU4H 4WU7B 1B0RB 5FOBB 1REIA 2IGFL 3EYVA 5CEZE 4XVTL 3GMMA 4MNQA 3BEWA 1ITCA 1BQHA 2NXZD 1X5LA 4HK3N 4XP6H 4AYFA 3QUKA 1UJ3C 3FO0H 1ETZA 4HS8H 3PV6B 1JNLH 1JI2A 3VE0A 1MWAB 5HTSA 1MRFH 3KPRB 4I77H 1UWXK 3P9WB 1DJSA 2WLYA 1KF9B 5I18L 2W0LA 2VKXA 5EIQA 1S9KC 2YA2A 1RULL 4LIQE 4LCYA 3JV6B 3GUTA 4JFXB 5F7HA 4HUUB 3JWOL 3W9DB 4G6AD 4Z0XB 1DQJB 4G43A 4YAQA 4C83B 3RPIB 3E6HB 3OPZL 2BSSB 4PUBL 5HYSA 2ZUQC 4JLRA 3VWJD 3WBDA 3HZVB 1FO0B 4FFWC 5HHXL 4BZ1H 3T3ME 5F7FA 3SDCD 1A14L 4OLVL 5D7KD 5EUOB 4LPTA 5CFHA 5DT1L 4OCRH 2AJXL 1SJHA 4KK5C 4O2FA 2WNGA 5E7BA 2EXYC 3IFLH 4D0CB 2AABH 4OZHE 5EZOL 4FTVA 2IMNA 2YA0A 4R8WL 4A2MA 5H35A 2OX5A 4RNRA 1Q9WB 3QWOB 3D1MC 4LSSL 1IBGH 3VH8G 2E27L 4PJFF 4OZGE 1DL7L 2IJ0C 25C8L 2X9YA 4P2QD 2FEEI 1KJ3L 1EZVX 1EAPA 2M2DA 4N68A 5AWNH 1R3KB 3WFZA 1A47A 1JZ8A 3OR7A 1RMFH 5C0DA 3LQAH 2EZ0D 4KI5E 5INCB 1YEFL 3QEQB 4J1UA 4ALAL 3R0NA 2EYTA 3WFBL 3U9UA 1OARL 4UI2A 3X14B 1JF1B 4Z8FH 4XNYL 4NQSB 1ZGLM 2F15A 2ENSA 4KPHL 3GIZL 1GZQA 1BGXH 4PS4L 4JFFA 1XH3B 1QYGH 2XWBA 3HE6A 5DQDH 3AY4C 4LP4A 3MROB 1EHXA 3UMTA 1IM9A 5EOCH 1G7IB 1QSZA 3DX9B 3RWIA 3ZDYF 1HDMB 3E6HA 1IL1A 1SBBA 3LD8B 5LBSH 5L7XL 3FQNB 4H8WH 5D93C 1NFDE 3QPQD 1RD6A 4HJ0C 1YC7A 4QXTA 1CDGA 2VDLH 4RDQF 3IYLW 2X4TB 4JGUA 1JPGB 3D9AL 5CD5D 1TCRB 2B1AH 4N0FA 3QO0B 5IVZA 3LZFH 3B4NA 5DD6B 2NR6C 3QEHB 4HCRH 5E2JA 2J6EH 3VRIB 1K4DA 5ANMA 4XPBH 1JV5B 4JKPL 5AZ2H 3IXTA 5EO1A 3RBGA 1H15B 5DMGC 4L8BB 3IDMA 2W0KA 5C07B 5TF1H 3VXME 3I02B 1GSMA 1WBYA 4YPGA 1E4KA 3RWCB 1BWWA 5DJDA 1VEMA 4UIMB 5J6HA 4IS6B 2NTFB 1ZLUK 3CDFA 2EYRA 3ARGD 1U92A 4TNVF 2CRMA 4TOYH 1WBYB 4YPGB 3HN3A 5IMOB 3QAZC 4MCZB 4RGOH 2JELL 5C7XH 5HHME 1OTUD 1RUQL 2W38A 5EFIB 3U82B 2BY2A 1JF6A 4KQ3L 4Y5VC 1Z0NA 1JZ6A 3REVB 3O3BA 3BH8B 4FQ1L 4RDQG 1D6VH 1AC6A 1M7DA 3N85H 2FGWL 3EDEA 1DBKL 1MI5A 2UY7A 3CFEB 3GRWL 2DS4A 3SDAD 3GMLA 1QSEA 1A6VH 1IC5L 5CBAA 1RIHL 5D6DC 5KJRL 2YR3A 4HPOL 1NLBL 2CLRA 4IOFD 1FVDA 4K7PL 1S5IL 5FKAB 1KCRL 1JPFA 2ED7A 4NZDA 1FO0H 3RWEA 3G5VA 2C4FT 4NN7C 4TUKL 4TSAH 4PRIE 5GQBA 5JW3L 4LMQE 2NXZC 2VLKE 3PWPA 5HHOA 1V3JA 2DQTL 1A1OA 3B9VA 5F89A 4YHML 1S7QB 2QEJA 4K71C 1C5BL 4F9LC 5D70H 3CXHJ 4PJ7A 1PGRB 2EDOA 3I85A 3NIFE 1UACL 3PGCA 2W07A 1JNNL 3LB6C 4MHHI 1U6AH 4YR6B 4Z8FL 5JQHC 2OQJB 5E24E 5JHDB 4PJDE 5DK0B 1IQWH 4GRLC 1LO0H 5MERA 1I7UB 1KFAL 2X41A 1ZVHA 1T21B 3RQ3A 4X6EB 3BUTA 4TUOA 3NVQA 5C0AD 5CINL 3C9NA 1NL0H 2APBA 3UCRA 3CMOH 3DXAE 5F3BA 4NKQB 2YZ1A 3WIHA 1NMAH 3IJYA 2ZCLH 5HY9A 4M9OA 1KCUL 3QB7C 3ES6B 5I1KH 5IM7B 3D18A 3HPJB 4MA7L 1T80A 4LCUB 4YFLF 5D2NE 1ES0B 1MF2H 3FT2B 3FTGA 4JG0L 4Y16D 5GGTA 1LP9A 3WLWD 4LCYB 3VXRE 1JTTA 3RUGF 3O2VH 2P4AB 4UNVA 5KAQG 1RZKH 5L2KB 1G6VK 4ONGL 1UWEL 1R0AL 3GIVA 3SPVA 2J5LC 5JDSA 3PV6A 2WWKO 3O81A 3I6GA 2YPLB 3ARED 3O8XB 1CFTA 4IOFC 1YEEL 1URLA 5BCAA 5LGJB 3AY4A 4HULB 3ZT5A 4LOUC 5KVGH 2A9MH 1FORL 4M6NL 3SDXF 3DV6A 4FTVD 3ALXA 3NPZB 4JFOB 3EO9H 5CJQH 1OD7A 5DEZA 1MQKL 4B5EA 2X4QA 1H8SA 4G3YL 3QEGL 4NQDE 1YEKH 1CGSH 2FJFA 5F7MC 2DQJL 4PV9A 4R4NC 5ICZA 2YXMA 3DETD 1A2YA 4XBGB 1XCQA 2BOBB 1N6QH 1QLEL 1P1ZB 4EDXB 4FQLL 5KSAD 3RUGA 5CD5C 1FJ1B 5GGUB 4HUXA 4OKVA 4MVBD 3MUHL 4F7PB 5I8EA 4F15B 2VE6A 1T66D 2GK0B 1N3NB 2EDBA 1QSFE 2CMRL 4JPKH 1ZTXL 3BAEL 4LHUB 1J0KA 4P4KA 4RZCB 2X2YA 1JGUH 1TMCB 2VZ1A 5DTFA 5TDOB 2UVFA 4NHUB 5TPWH 3VD9A 2XTJE 4XP9L 3VD4A 4GBXC 1YY9D 3BHBA 4MB5A 1RJLB 5IW1B 3UXFA 4Y5YB 3LPGA 4CVXA 1WWCA 4HX1B 1OP9A 4Z7UA 4P9ML 1JGLL 3DVGB 4G80B 3QDGB 4I0PB 5IHUL 5IKCA 2HFEA 4OV5A 3GSNB 2EC8A 2PYED 4OZFB 2XZAL 1MCJA 4QXGL 2ZKHL 1U3HC 2B20A 2FEEL 3SQBA 5CBAB 1F2XK 4TULH 5C2UB 3IXAA 1X5FA 1ZA3B 3QNZB 4DGVH 1RZFL 1KXTB 2D0GA 2ZUQB 3LB6D 1G0XA 2EDHA 3VMOA 4FHBD 5EORL 4AH2A 2DQCL 3FFCA 3RX7A 1UVQA 1T83C 4DUXA 1BVLB 5FYJD 1FG2B 5F7YC 5HDOA 5FYLH 4X9BA 4LARL 3X13A 3IDYB 4X7TB 2EDXA 3QIWA 1OAQL 3QXAB 1SEQL 4KZEL 5TDOA 4JQXA 1ZVYA 2EH8H 4J4PA 3BEVB 4LLUB 5JPMB 1QLFA 1LDSA 1S7QA 5D96C 3U4EA 2B1HL 3NCMA 1FFQA 3KDMA 3FB6B 3HI1B 2F53B 1GRWA 1U8JB 1E27B 2ILLA 2ZUXA 4X8XA 1NMBL 2GTZB 1RIVL 2EYSB 5ADOH 4PYGA 2AK4D 2VDQL 4OTXH 1PX4A 4KV5F 4ORGB 3O41B 5ANME 1HYRC 4QRPD 4KMQA 3VGDA 3ARWA 3BP6A 5IIEA 4DQOL 2D03L 4EJ1C 3DUHA 4BUGA 5A43C 1OP5H 1K3ZA 4ZD3L 1NFDB 3WJLA 1INEL 1XR9A 3LEVH 1UH4A 1J1OH 2ITDA 1CFNB 3H9HA 3AS0A 2X1XR 3PWNB 2HLAB 4OD1H 3LQAL 3LIZH 4HKXA 4FZEL 3T0WA 3CLFH 4DGIL 1INDH 1I4FA 3D0VA 4XB7A 3BP6B 1CZ8H 3RP1A 5KS9A 3N06B 2ICWA 3CH1A 2Y23A 5C08B 1G6RB 1FVEA 5ID1B 3O3AA 2VDNH 1MIMH 3WIFB 2AQ2A 1BQLL 3TN0C 3C2AH 1RZ7L 4DKAA 1IAIH 5BXFA 3JTTB 4Y4KC 3GM8A 2O26U 3V0WL 2RHEA 5JHDA 1K6QH 4JDVA 3GSVA 2J4WL 2VLJA 2Z31A 5L88H 2EYTB 1BQHG 1TVHB 4KXZH 5IV2B 5TJWK 4YHPA 3KLDA 4PJ8C 1RI8A 2OJEB 4KK6C 4ZUVA 4XMPH 1CDUA 3MRKA 1PG7X 3T4YA 1AKJD 1DEDA 4FQXC 3DUUA 5AEAA 4G6KH 1XT5A 3CCHA 2WUBL 4NFBA 1INQA 1H0DA 5HGHA 2NY4D 5H94B 5A40E 2XKUA 5BRZA 3TBYB 3HUJA 3HG1A 3IFNH 2BNUA 4PV8B 5E8EB 4L8CA 4P2CG 1VB9A 1T7YA 4HZLB 4P4KD 4ZO9A 4YIQB 2AJVH 4OM1H 4LGRB 2Z93B 3SDYH 5HHVH 5I8OH 2N1KA 3P0VH 3ZKXC 1BOYA 1KJ2H 4P2QA 1ND0A 5IMMA 1FL3B 3CH8A 1NLDH 1F11A 2DDQH 3UYRH 3LVEA 2C3VA 4D9LL 2YD5A 4Y4FC 4UTBL 1C1EL 4KMLB 1LEKB 4I8DA 3DVGA 1L9MA 3QPXH 3V4PH 3D5OF 2R4RH 3RDTC 2RB8A 3P40A 3VFTA 5IB4A 4YBHA 4WI8A 4ZAKA 3PG2A 1J0ZA 1NAKH 3QSKB 4HJ0D 3L3HB 1OW0C 1XF5B 3IF1B 3NFSL 3HE6D 3NH7L 3BGMA 1R24A 4M1DH 3BHBB 3WIIL 1YYLH 4JJ5B 4K3EH 3KPPA 4OFPA 3T65A 4QRPB 3L7EA 4Q9RH 5DMYA 2DWEA 5DJDB 5HJ3A 2HH0H 1CD8A 5EC2B 4FQJH 3O11A 4DAGH 32C2A 4Z7WA 1A3QA 1YN6B 5GRJH 1XMWA 1V7ML 4XVSL 4YK4B 3OTTA 1VCAA 4Y19E 2Z91B 2AJ3B 4ENED 2GJZB 1I9IL 3RVVC 1RMFL 3BZFB 4O9HH 3Q1SH 1XZ0B 4NQEB 3QUXA 5T5NF 1HH6B 5JPNB 4CGTA 1GGBH 2YK1L 4F7EB 3VI4E 1MVFA 5FYJH 2YPVL 4MA3B 3EOBA 2PCPB 5SWZA 1RV6X 1TZIA 3PWNA 4Z7NE 1ZANL 5HI5D 1K8IB 4H26B 5HI3C 3QUYD 5E99L 3JV6A 4DVRL 4YHOL 3LKSA 1ZKAA 2V5RA 5I1JH 3F7RA 2EE6A 3WFHA 1BLNB 5IVXA 5KVFH 1LK3H 1CBVL 3H7BB 2OP4H 1TITA 1J86A 2JB5L 3QJHA 4QRSA 5E8DH 3IETB 2D3VA 5EC1B 5HHOD 1HQ4A 4GAGL 3MRHA 3VRJA 4IRJB 1B4JH 2X05A 5EO1B 5T3XD 5C0AB 2VAAA 5C7XL 4LCWE 1ZT4A 3MRNA 4CMHB 2WUBH 5BXFB 5IHUH 3S96B 4LF3B 3P0YH 1WBZA 5A2LH 2AK4B 1Q9WA 3QWOA 3GNML 3ZDXE 2BXYA 2O5YL 5TQ0L 1I1AC 1KIPA 1FNHA 3EYOB 1DQQB 2MCPH 2FGWH 4YBLB 2ZOLB 2APXA 4JHWL 4F7TA 1IKFH 1PEZA 5C9KA 3QXDA 5CJOH 2DQDH 4MJIB 5K9JH 5HHQA 3QAZB 4P3CH 2UZYB 3DV4B 5EIVA 5F21B 4JRWA 4LARH 3EJJX 4XPTL 3UX9B 2GJ6B 2AS5M 1H5BA 3HG1D 2BNUB 5E8EA 3ARDC 5GJTL 2J8HA 4PY7B 3PNWA 1TZGL 1QBLH 1G9MC 1WTGT 5ICYA 1U8NA 4JRYA 3ZDXF 4U6XB 1MIEL 4KJPD 2IAMA 4GQ9L 3DTXA 1K2DB 4PJHB 3G08B 1IGIL 4JQIH 4WNQA 5CP3H 3FT4A 3QWRA 2Q20A 1DDHA 5DUPL 3HRZA 5F88B 3RTQD 4WO4C 2VDQH 3CZFA 1RFDL 2GCYB 4NHCH 4PR5B 4G7YH 2CIIB 5J6GB 5B4MC 3LS4L 4L4TE 4TNVK 2BNRE 2J4WH 3F58H 3ELAT 3MYJB 3WN5C 4KHXH 4H0GA 2F5BL 2LU7A 2YPLD 4G8FB 4XNMB 4RFOH 1EV2E 3NFPB 1AXIB 3F62A 2EIZB 1XIWC 5D1ZA 1KJVB 2HLAA 4PTTB 1A6AB 3HC0A 1C8PA 1IM9D 1CQKA 1JE6A 4IRJC 3GUTB 1JCKA 4LSQH 3PWPD 3K80A 2ADFH 4NUGL 1KNOA 2J12B 4NC2B 1D9KD 1CXEA 5JOPE 1D9KB 5ISZE 3T0EE 2AEQH 4WFHE 5ENWA 3TO4C 3X3FL 4CVUA 1N5YH 3ULUC 4Y1AD 2Y07L 5JO5A 1GL4B 2F8XC 3HB3D 4NM4L 1A02N 3KNBA 1KCKA 4IRZL 4DGVL 3GSNH 3AAZA 1IEBB 3GMNA 5DK2A 4OZGA 2X4OA 2P47B 1YEJH 4S1RL 1U92B 1O5DT 3QDGD 5T1LB 2HAZA 1Z2KA 2F9BT 3CJJA 4LPWA 2X42A 3DIFA 1KACB 2JIXA 8FABB 3QULA 1T1ZB 4R9HA 4MXVE 5F93C 5I1DA 1NFKA 1T6VN 1DQLH 3JWNC 3T77B 4G8EA 2GITB 4OZGB 1N2RA 2FATL 3KPMB 3DO7A 5EB9A 5ESAB 3G5YB 4MHHG 4D0BB 4LHQB 4NWTL 2JB6A 3P0YL 5D1QA 5B3NA 4YQXH 1FCGA 1E6OL 1VFMA 3V4UL 4PJAB 3U6RB 3GHEH 3ZT6A 5JDJA 4PRIB 1CTOA 3V0VB 4ZSOE 5E6YA 3S5LG 5C07E 2FX8L 3MRMB 3GBLA 3N1MC 1HHIA 4QRRA 3FQNA 3HC3L 4NKMA 3QFDA 3PP3K 4EDWH 2GSGA 1AQKH 4PB0L 2HT2D 1NGQH 5ELIA 1OWRM 5HYQA 1FZOA 3SKNB 4R96B 5H2BA 5CIPH 1BM3H 3GEWB 5DA0B 1UB5B 1V3LA 5HJ3B 4ZD3H 4Z5RB 3RZCB 1Y6NR 4Z76A 2EEAA 3H9ZA 5CSBA 2R1XB 1OSZB 1QVOB 4PR5A 3CK0L 3FB8A 5ID0B 4OCWH 1WEJH 3BIBX 5HYSG 3V79C 1DEEB 4H1LB 3S88H 5HGAB 4RAUB 9CGTA 5GZNC 1BF8A 4WFFE 2XZCH 3HMWL 3VXTB 5HGAA 1PLGH 2VE6B 4XVSH 5BZDB 4K94H 5ID0A 1SYVA 4EVNB 4KGJA 2XIDA 4TNWF 5ICYB 3WNLA 5M7QA 4B41A 3PWLA 4OIIH 2NLJA 3DI2B 4BKLB 4MA8L 3PQYE 4NUJA 3ZSTA 3O6MH 2G75B 4K7PY 3HZKA 5T3ZL 5E00B 4XTRD 3AREA 1G7HA 5DJAA 2AI0H 1FVDB 4ZFZB 3MJ7A 3ZL4L 3GJFB 1MNUL 4IOSD 4JDZB 2A6JB 4HUUA 1BBDH 3BYTA 2VB5A 3PGDB 3P11L 4YHOH 3RX8A 4XP5H 4O51B 1J8KA 3UC0H 2DKMA 5E4IA 1FNEA 3SKOA 4ZPTA 2QKIB 2NY2B 1DVFB 1FFOB 4KUZH 4KZDL 4FP8L 1DBBL 4MQXD 2NY2D 4GOSA 5CEYA 3FCTB 1E6JL 1HWGB 1AGCA 5DJCB 5E56A 4NQED 4D9LH 1N0XL