3QNXB

Orthorhombic form of human iga1 fab fragment, sharing same fv as igg
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
219
structure length
219
Chain Sequence
QLVESGGGLVQPGGSLKLSCAASGFTLSGSNVHWVRQASGKGLEWVGRIKRNAESDATAYAASMRGRLTISRDDSKNTAFLQMNSLKSDDTAMYYCVIRGDVYNRQWGQGTLVTVSSASPTSPKVFPLSLCSTQPDGNVVIACLVQGFFPQEPLSVTWSESGQGVTARNFPPSQDASGDLYTTSSQLTLPATQCLAGKSVTCHVKHYTNPSQDVTVPCP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a human IgA1 Fab fragment at 1.55 angstrom resolution: potential effect of the constant domains on antigen-affinity modulation
pubmed doi rcsb
molecule tags Immune system
molecule keywords Fab fragment of IMMUNOGLOBULIN A1 LIGHT CHAIN
total genus 43
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2011-02-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qnxB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qnxB02
3BJ91 5EOCH 4AH2A 4XP5H 3LPGA 1K2DB 4U6VH 4YDVA 2WIIA 2OMBA 2AXGA 2CJUL 4ZFOB 5IHZB 2CUIA 4U1JA 4D0CA 1QLEH 2GJ6A 2E9WA 1BF8A 5E08H 3FQNB 5TE7L 3SJVD 3QULB 3QXAA 3IDXL 4ZPTB 3WLBB 2VXUL 1A1NA 1QBLL 3QEGL 5I6XB 4YDLB 1A1MA 4AEEA 5C0RL 2YK1L 1HHHA 3B5HA 2QQNH 3DYPA 1MVUB 4UOJA 5IWLA 4LLUB 1BHGA 1JPGB 5FK9B 1P84J 1JGDB 3U1SL 5EB9A 1MFEH 4NQEB 3WIIH 1J86A 4R96B 1RAMA 3REWB 1JK8B 1CD9B 1FBIL 4HS3A 4C58B 4Y2DC 2CLZA 4HZLB 4RFOH 3L5IA 1NFDA 3ZKSD 3N1MC 4LAQL 4L9LA 1S9VA 1JPSH 2NX5B 1ZANH 1ZGLA 3G5YA 1GIGL 1Q38A 3FB7A 4O5LL 1N6UA 4L9LC 5IVXF 1VSCA 1WTLA 1A21A 1QLEL 3G08B 1TZGH 5EC2A 4X6FB 5LQBL 5I73C 2BFVH 3FT3B 1L6ZA 4OCWH 4YHMH 4FQLL 4EDWL 2DLTA 4F7MA 4P99A 1GZPB 3VXPB 3D85D 1EGJL 5ISZB 1EHAA 3D0LA 2GFBB 1KTKE 5I2IB 5CJOL 4PGCA 4M5YH 1U3HB 1CQKA 3W81A 2VXVL 4F8QA 3OJMB 4I0PD 4GMSL 3HZMB 3HI1A 4LAQH 1FVDB 3U4BL 3IDGB 1H3PL 5IJVB 3ARVA 3WUWA 1ETZA 4YFDB 1FZKA 3DHMA 2N1KA 4MXWL 1UJTA 3OKLA 1A0QL 4ZO7A 4NKMB 3W9EB 3TIDA 1T7YA 3CSBA 3X14B 3LVEA 4OQTA 3ULVD 1DVFC 4KDTC 3IRPX 4LSRL 1FFNB 1U36A 2HLAA 3DYMA 5E2UH 4YK4C 3VXSA 4NM4L 5DO2D 3T77A 3CDGA 3GKWH 2VJXA 4WI8A 3UTZA 5CEZE 1S9KC 5F3HA 5KTEL 2HJFB 4XWOD 4FQLH 3PP4L 4M4PA 3VI4E 4IMLB 1UH3A 3GMMB 3X12A 3GMNB 2CJUH 3S4SB 3V6ZA 1UJ3B 2FDBP 3WUWG 3VFVB 4EUPB 1P2CA 2NY2C 1TVDA 1MCPH 3GJEA 4HS8H 5CJBA 1AQKL 1YDPA 4Z7VF 1J0KA 1YY8B 5ICZB 2L7JA 2JKXA 1TVHA 2BRRH 4HWNA 4JFDE 5ERWB 5BV7L 2OL3H 4L5FH 3X11A 2OTUA 2IPUK 2DYPD 5DVNA 1L7IL 5ESAA 1MCWW 1BAFL 1SJHB 2PW1B 3DURA 4X80H 3S5LA 3JWOL 4HJJL 1T4KB 3V5DA 2JELH 4M7JH 2YZ8A 1RPQA 1UWXH 2EE6A 3RX7A 3HE7C 3SDAD 3LPFA 4DTGL 1T0PB 3UBXB 4NZUL 1CFVL 1WZKA 4ZUSA 1KUMA 5F44A 3B9EA 4G3YH 1JI1A 2HFTA 3RA7H 2H32A 2RBLA 4XNZC 1I3GL 4K71C 3I75B 5FUOL 3WJLA 3ARTA 5ID1A 4ETQA 3OZ9H 3S37H 3GJFA 1UYWL 5CIPB 4IIQC 4BUHA 2P5ED 4ODXB 3TT3L 4OCSL 4Y5XA 1SEBA 1KB5A 3GSVB 1HINH 3QUXA 4JHAL 4XPTL 1F4AA 5GISH 3JWDC 3PWNB 2ZG3A 4NRXA 1PSKL 1W8OA 3IVKA 1CQYA 2VDQH 1RVFL 4NQUA 5IEKA 2V9TA 4WHTB 4KK9C 1KCKA 4QTHB 3P9MA 4NCDA 3WKNA 5K9OA 1E6JL 4HJGA 3O6KL 1I1AA 2PN5A 3C60D 3WXVH 4XTRC 4KK9D 1NCUA 4P9HC 4XPBL 3FB5B 1J05B 1BIHA 4XRCA 1LWRA 5IKCA 2HTLD 1LEKA 2E9JA 2P43B 4UT7L 4Y16D 5FYJH 3QFJA 1ITBB 1MH5A 5FHBH 2NYYC 2D03L 2JCCF 3KLHD 2Z0BA 2I25N 3LS4L 4JKLA 1NGPH 4XPTH 2BY3A 4OTXH 1QR1B 3PE9A 1UZ8B 3QZWB 5DEFB 5C7XL 4KQ4L 5DQJB 3KPLA 2X1WL 1YEHH 1FFPB 3MV7E 5IF0A 3KPRA 1ZA6A 1JWUA 2BOBA 2P24B 4Y5YC 4HS6B 3RUGF 2RFXB 2FZ3B 4HHAB 2DQTH 1ADQL 3RTQA 1X5ZA 5FO8A 3QPXL 4JFZL 1IKFH 3QNXA 2P24A 2FIKA 2OP4L 2CRMA 4YDIH 3VDCA 4PV8B 5D6DC 1TVBB 3VU2A 5CS7A 4UOW1 1MJUL 1YQ2A 1MCOL 2JJTA 2DBLH 1H3WM 2AJYL 1WZ1H 3BT2L 1HYRC 1N64L 5IB1B 5D96B 3OHXA 3NZHH 2ZCHH 4UV7L 1ZWIA 4K8RD 1EUTA 3VGHA 1IEBA 1QLFA 2Z8SA 1QEWB 1PY4A 3DROA 1FVDA 5D5ME 1CICA 4Y4HD 1LEKB 3MR9B 5GSRA 5J6HA 5DJZB 1U6AL 3LKNA 1BVLB 2XV6B 1U3HA 3TCLA 3ULVL 5CGYD 5EOTB 3NFNA 4UAOC 5KVDH 3DMMD 1PFCA 5ISZA 3VXPA 3HTLX 4N8VB 1CD0A 2KBGA 3BP4B 4MQXC 1JZ6A 1YEJL 1QFWM 3NPSB 1LNUA 1IFHH 4MNHA 1CIUA 4GRWB 2GSGB 4QRRD 2E6PA 2N7AA 3EYVA 1C16B 1DQML 4F3FA 2CRIA 1CDHA 4YO0B 3TN0B 1MAKA 2AJXL 3D87B 3OKEB 3SE9H 1A9BA 1XCQB 1KIPA 3GHBH 1A7NL 2NX5A 2X4NB 3MQIA 4QTIL 4R90L 4EKXA 4ZODA 5T1LA 2ZSVA 5TQ0L 1PW3A 2FHFA 3E6FA 2CDEA 4KROD 5JOPD 3QUMB 3SDAA 3O8XA 4LLDB 1JGDA 1TJIL 3QUKA 4RISL 1CI5A 1W72L 2NY2D 3L3DA 4RGOH 3FO2A 4AT6B 1OTUC 3ARXA 4OZFA 3PGDA 3RU8H 2G5RA 3RAJH 2ENYA 1I3GH 5CZVH 3MLXH 1A1MB 3AGVA 4X4ZA 4RFEA 5D6DA 4DEPC 4ORGA 1MCDA 3S36H 1FZMA 2PTTA 4PR5B 2FR4B 4NOBA 2KPNA 3U46A 3NCMA 4YHLH 3EZJB 4OZHA 3MV11 1IKNA 1ES0B 2E3VA 5FXCH 1XH3A 2AAVA 4LNVA 2BK8A 1ZS8B 2BNQA 3BKCL 3JV6A 4Y2DD 3EUUA 2BRQA 4OJFL 5E5UB 1AE6L 3W2DL 5ADOL 1PSKH 3VXUB 5ACZB 5I1KL 1ACZA 4XMPL 5D6CA 4L4TA 2HAZA 4P57A 3QDGE 1AQKH 2ESVB 2CMRH 3ARFB 5F1SA 2EIBA 1ZLVH 4FQXA 1AD9A 2OP4H 1GC1C 5DDHA 1N5YL 1FYTD 1S7TA 4ZQKB 5C9KA 5IVZB 1CFQA 4R6UA 4BQ8A 4OD1L 1RK1B 5CP3H 3JTSB 5CZKA 4JPWH 5DWUL 4C4KO 1FSKB 3Q3GB 3OPZH 4PTTA 1KLGB 3IXTA 3EOTL 2OJZL 3MMEA 4NYLB 1G6RL 5JMRA 1OAXL 3O4OC 3MBED 4XVTL 3TIDB 4U1HB 3QQ9C 2EDRA 4DOHB 1GSMA 3BDXA 4OGYH 1TCRA 4NGHL 5F7KC 2V6HA 3FB8B 2D3VA 2OXGA 2CXKA 2X9WA 5GS2D 4X6DB 3H7LA 1S7UB 5D2LB 5I15H 1XGTB 4JDZB 3U4BH 2ADIA 1WK0A 4F7CB 3HZMA 3H3PL 3QBTB 4JFDB 2K7QA 5SWZB 4YE4H 4PJGA 3CZFB 1NCDH 4I5BB 2WQRA 3RWJB 1C5DB 3EJJX 5CUSL 4ZXBC 4PY7A 4I3RH 2BDNL 5I1IL 2VQ1A 2EE9A 3MV8E 3MRMA 3QEQD 2H3NA 4F7PB 2Y07L 1EJ6A 1Z2KA 4JAMA 3SKNB 1NBVL 1YJDH 4BKLB 3F12A 2VWEC 4Z18A 1CDBA 5CINH 2HRLA 1JHTB 3P9WB 5HHPB 1RQ5A 4P3WA 3MV9A 1DBAL 1MIEH 4QRTB 5A2IH 3VXNA 1SJVA 2GEEA 3X3FH 2PTVA 2YUVA 4JFFD 3UTTD 4YFLF 5HYQA 4DQOH 1S9VB 4QHLA 2UWEA 4DZ8B 4OZ4A 3RFZC 1IBGH 4ZDHA 3L3IB 3IDNB 1UM5H 3CAFA 5DQ9B 2FLBT 4BELD 5IHUL 1JPGA 4Q6IA 1U8NA 1OGAE 1T83A 2X2YA 3Q1SL 5LGJA 3P2TA 4JQXC 2YA2A 5D72H 5F1NA 2E7LA 1NKOA 1Z9MA 3RUGB 2CGRH 3DTXB 3MRHB 1L9NA 5DLMH 1KEMH 2DI7A 2XNAB 4YXKH 2QADD 1XGYL 2EDXA 1VESA 4RMWA 1T1XA 3BPCB 2ICEA 4JO3L 4BUGA 2J4WL 4L4VB 5IQ7L 1DBAH 1IKNC 1XMWA 4NDMA 4N9OB 3PP3K 1T1XB 3W9DB 1H8SA 3IDIB 3HI6H 3MC0A 1S8DB 1VEMA 1YN7A 3WE6B 5IHBA 5IK3A 3C8HA 3QIUC 4LCYA 2I9TA 1M7IA 1A5FH 2ADJA 1I1YB 1KLUA 3FFCE 3ZO0A 4HCRL 2QQLH 1S3KL 3IJHB 5LWYL 4UDUA 1WBYA 3D85A 3DXAA 1FVEA 3FZUD 4LPVA 3VGAC 5ADOH 5LG1A 2YEZB 4Y4FD 3VGDA 2J5LB 1G7LB 2X4SB 3R06A 7FABH 1FL6B 3CXDL 1XGYH 2GTWA 4PV9B 3TESA 1FO0L 3AROA 4DKDC 4L3EB 3RVWD 4Y1AB 4TSCH 1EAJA 2X4NA 1QHOA 2P42B 1CDGA 3TNNA 4ZUWA 3ARGC 4NQCE 4PJ5D 5MEPA 1S7XB 5CSGA 5CKGA 4YO0A 2IQAB 1OAQL 3PHQB 1NCAL 2F74A 3LQAH 1HI6A 3L95B 1CDYA 1RJZA 4OKVA 4R4BB 4EXKA 4OIIH 1S3KH 2IAMB 2JLLA 3QWRA 5D7LB 1GOHA 3MRRB 3CLEL 3BWAA 1ACYL 5F7EH 3TCLB 2X4UB 3ZYJA 5L6YH 4JPKL 4PJGB 1L0XA 4JM2A 3UJJL 3CPLB 1E0OB 4EOWH 1KJ2B 3LAFA 4U6TA 4JZJA 5GQBA 1JWMB 3RDTA 1CLZL 3LKOA 4LSSL 2D7QA 4P9HH 5TJWK 3SDCA 4UMGA 4ONGH 4XPGH 2JJTC 1YEKH 4OCRH 3WHXB 1FNHA 2H2PC 3PV6A 4YNYB 5EPMB 2Y23A 3MOBL 1CGVA 5DJ8B 2AS5M 5E2TL 4J4PC 1U91A 5DI8A 3MROA 3TZVA 2AV1A 4P49A 1WBZB 4QXTB 3MJ8B 3GSNL 4RMRA 4OFYA 3VFTA 3LKSA 2A0LC 5HYJE 2NY4D 4P2RD 5GGTH 2ARJA 2BSSB 5FM8A 3IDMA 4JPIB 1BJ1J 4NJAL 3BPOB 1XGPA 1HKFA 2EO1A 5E7FA 3QCVH 4JFQB 3DRQA 4U6XB 1KIQA 4Y5VC 3BIBX 5HHVL 1MAML 1RZFL 1ZOXA 5GJSL 1BZQK 3EDFA 4WCYL 1ERNA 2R8SL 1OCWL 2F53E 3BGAA 2BSRA 2C26A 4DUVA 3VA6A 3QCTH 5D5MF 1T1WA 4KAQH 2Y06L 1WZMA 3O45B 1P69B 1Q0YH 5DZNA 2ARJQ 2CK0H 2D4DA 4WO4D 4DFHA 3I3EA 2BP3A 4WHYG 4PJ9C 3GJFK 4ENEC 3FT2B 5GXBB 4KV5F 3PWNA 1NCDL 3MTRA 1ZLWK 35C8L 3HZKB 4TVPE 1C7SA 1IILE 2L0DA 1HNGA 1NMAH 2AABL 2Q76B 3L9RA 1JYWA 3T09A 3RNQA 4Y5XC 1KN4H 4M7KH 4GG6F 1EEYA 2VOTA 2YD5A 2ZUXA 4K3DL 2J5LC 1RUML 3R1GH 3MRDB 4ODWA 4OLUH 3EFFA 2EKJA 5DK2A 1Q9WA 4HUNB 2HT3D 5JPNB 2EH8H 1DE4A 2K1MA 3PWPB 1VERA 1ZKAA 4TN9A 4X6EB 3UO1H 1OP5H 5HXMA 2IMNA 3ZE2F 5TQ0H 4N9GA 3BGMB 4M6NH 1PYWB 5DRWB 5E8EB 1JNLL 3BW9B 3QPQC 4R97C 1MY5A 4GW1A 4IRSA 3H42H 3MODH 1QA9A 5F1KC 2NNAA 1V3JA 5F9DC 3EYOA 1WCBA 5C7XH 1EEZB 5KG9B 3P77B 5L0QB 5ICXB 3SCMB 3UZVB 2IANB 3LQMA 3SJVB 1XF3B 4JG1H 5IFAH 2IPTH 3QP3A 1VFMA 1IQWH 5IR1B 12E8H 2XZQL 1RUKL 4BZ2L 4OGAC 2X1QA 1AGBB 1KN4L 4M7KL 2WBJA 3AXLA 4JGJA 4I18B 3S6CA 5AUMA 5KSAA 1OHQA 4QXWA 1IEHA 4QEGA 1B0GB 4HJJH 2VLJB 3KPNA 2VRAA 4IIQA 3I2CL 2VLRA 3BVNB 1VFBB 5IESL 1HZHH 1MCQA 1JL8A 1A6ZB 2HMIC 4HWZA 4PRIA 2E6JA 4YX2H 2P48B 1FO0B 4QHKI 1I7TA 2EDYA 4IOFC 5H94A 1ZHKA 3GB7B 5I8KL 3HUJE 5CD3A 5FYLE 5TE4H 1RJLB 3JV0A 4U1KA 4YIQA 5I66A 4FFWC 2HWZH 4CJ0A 2Z93B 1IQDA 3D9AL 2G5BB 1O0VA 1NCWH 5DJ6B 5ESQB 1PG7W 3BEVB 5INCB 4WY7L 1NUFA 3IXAB 1T7WA 4QF1B 1J8KA 5CEZH 3K0WA 3UZQA 5IB2B 5DMYA 1MWAH 2C3HA 4EBQL 1LILA 4CUCA 2X4UA 4JZJC 3TVMA 1CXLA 1KCVL 3RWFA 1J1XL 4OF5A 2YWZA 3I85A 1MFBL 3MO1B 4IHOB 4YHZL 3B5TA 5JO5B 5T5NF 3MGOA 3G6JF 2IGFH 5T5FH 5KJRH 5JW4Q 5K9OB 4FABL 3RPIB 2ARJB 2BSSA 1EEQA 3MXWH 3G08A 4A2MA 3RVXC 3LKSB 4FQJL 3U6RB 3VFTB 3WHE0 3IVKB 1N59A 1U8JB 1L4IA 4YHML 1MCRA 1IM9A 1JPST 2P5EE 5CSZB 2AV1B 4FXLA 4N68A 4DN3L 5IT2H 1CCZA 4WHYH 4QY8A 4OZGB 3WFHB 4OCLC 1KCRL 4XB7A 1Q9KA 2KZWA 4F7TA 5IB5B 1R3LB 3NIDE 2VDRL 1RZ7L 4F33A 1IGMH 2R1WB 4NZRL 4LVOC 5IMKA 4JFOA 5EBMB 4EUPG 1CLOL 2OQJA 4XZUB 4YDJA 1IGIL 4QRUA 5J12C 1S5IL 1A7OL 2ZJSH 2EEDA 5JHDA 5CMAB 3MLYH 1XIWC 1T04A 1U95B 3BKYH 4U1GC 5DJXA 1YN7B 3WE6A 5DURB 3TT3H 1Q8MA 1K4CA 3DUUA 1CD1A 4QCIA 2W38A 3G6JE 2IAMA 1FAKT 3TH2T 5HPMA 1KLFA 1DL7H 1RJCA 4ODSH 5K59F 4M62H 3V4VL 1DBJH 4X6DF 3F5WA 5E4EB 1BOGA 5IQ9B 2CRYA 4MNQD 3S34H 3RKPA 7FABL 2VLKE 5KOMC 3U48A 3OV6A 4K23H 2ZUSA 1OF2A 3CGTA 4EUPA 1KJ2H 2VE6B 4M03A 4Q0XH 3B3IB 3T0WA 3D0VA 4D3CL 1ADQA 3M17A 4IMLA 3KS0H 3QFJD 1JPFB 4LKXB 3KPSA 5E08L 3R06B 1T0MB 1CG9A 4ZUVA 2F5BL 5LGHL 1OY3B 1MCJA 4KK6D 3TBWA 4HWUA 4IOFD 5FKPA 1N6VA 3TCXA 5KSVB 4NO5A 4HS8L 1MPAH 5A40E 4AG4L 2Q20A 1I1YA 1KLUB 4U0RB 1MHEA 2QL1A 4ZOCA 1CFBA 1I1FA 4NN5C 4JN1H 3BZ4A 4PYHA 2B0SH 1WZLA 3RQ3A 2BNUB 2ZPKL 1A6WL 2YPLD 5CJQH 4PRHB 3OF6D 1CS6A 5CBAA 3RDTD 1U8PA 3CUPA 4X9GA 4M8VA 3HLAB 1ORQB 4XC1H 3EKCA 2VIRB 3D48R 4XVJH 4DZBA 1UADC 3DUUB 4JY5L 5HI5D 5E70A 3ZTNH 1MCNA 3ZYZA 5F97E 5CEXB 3ARSA 3KXFE 2XWTA 1AGCB 3MRQB 4BJLA 3L3JA 3BZDA 1N6QH 1GZPA 5LJYH 3VFRB 5D7LE 3VXSD 5LGJB 4S1RH 4MAYD 3LSOB 3PXHA 1W0VA 5AAWA 4EDWH 3EO0B 3QHZL 4Y5VA 1S7VB 3PG2A 1JYNA 2FL5B 1HHKB 2VH5H 2WBJC 3DSFH 5ITFB 2YC1B 1R3LA 3GRWL 4XBPB 4F7TB 1E6JH 5MEPB 2NY1C 2HJLB 2YPVH 4WTXA 4E42A 3ECBA 4FQ1L 4QRPE 2QHRL 3FN9A 2HH0L 1NCCH 5KJRL 3RZCC 4N0UE 4Z7UB 5IG7B 4X7SH 1NJ9B 1RVFH 2CLZB 3UJTL 4NQVB 5DD5H 1DFBL 3V6OA 1II4E 1I8KB 3VA2C 3U9PH 1E4KA 5E8DH 3RGVB 3H0TB 1WAAF 5EO9A 4NQEE 1HDMA 2EDKA 2W0PA 2AK4E 3BJLA 1KIRA 5E03A 1AHWC 4Q9QH 3VXUD 5C0GB 4CMMB 1OW0A 1TITA 3U1SH 3WIIL 1JUFB 1D9KA 2JIXD 4L4TB 2B20A 1HXMA 3RWHA 2IC2A 1I3VA 3SDCC 2VO5A 3G5XB 1S7QA 1DBBH 3P9LB 5CWSA 3ZT5A 2PXYC 4TSCL 1UCBH 3WIHL 1U92A 4TVPH 2GCYB 4Z95L 4MDIB 1C08A 3Q6GL 3JV6B 4F7CA 1CE6B 2AVGA 2R4SL 2BY0A 5CILH 2XZAH 4Y4FB 3ESUF 4C56D 5EORH 4YC2B 5D1QC 1PEZA 4N1HB 1EMTL 2EDFA 3VD5A 2Z8WC 3QNZA 5I66B 4KK5C 5BS0A 4L3CA 4ZXBA 4JM2F 4EJ1C 4PGEB 1RY7B 5A2FA 5C6TL 3CVHA 3V4UH 5BV7H 4PTTB 4U0QB 3QDMA 3MLZL 4WGWB 3STZA 4F7EA 1ACYH 1XZ0A 4PJHB 3MCG1 5IFHH 3QXVA 4M8QA 1K8IA 4JFEB 4XXCC 1V5JA 1WBXA 3THMH 1WT5C 2A6IB 2EXWD 3KPNB 4PJFE 4NOFA 1MFNA 4FQXB 2VDLH 3CFBA 4KTDL 3OF6A 1F42A 4WUUA 2GY5A 2J88H 4PFEA 1KEML 5B38B 3NIFE 4XAKE 3Q6GH 3QDMD 2DM2A 2V5TA 1AIFB 1T1ZA 3MV9B 3VXMB 2IANE 5BVPL 1YNLL 3KYMB 2DWDA 1BECA 3P77A 1NBYB 4MJ5A 4I77L 5IVXE 4FP8L 4X0KB 4BKLA 3QQ4A 3RWGB 3HC0A 4LLVA 3U46B 2AQ3A 1FFQA 5D96C 2OL3A 2X4TA 4KUZH 3RWFB 4E0RA 3VMOA 3MFFB 5E56A 3FQUA 3NACH 4OLYL 1P6FA 3CZFA 3O3DA 4S0SD 2EEBA 3WFCH 1GGCL 3QIWD 4QRPD 3VWJD 1OARH 4YDJB 1G7MB 2FGWL 5E6ZA 5JIPA 3OXRA 1SM3H 5GZOC 4LFHG 1NMBH 1YEFH 1JGUL 5KOVC 3QIUD 3LQAC 5IB1A 3L1OL 5TFSL 1NBVH 3MLTA 1FLRH 4L29A 3BESR 1WWBX 4YHOL 1G0XA 3CFDB 2Q76A 3UBXI 4KKAC 1N3NA 1F4WL 3P30L 4K3JH 3VXQA 5IF0B 5C0JB 5HHQA 4PJGF 1MFEL 3GHEL 4ZTPL 5GS2H 5C2UB 5IVZA 2BVPA 4BFIB 3SDXE 3BKCH 3C2AH 1PKQE 4G6FD 4PP1D 1MCLA 1YEIL 2Z31C 3ZE1F 2AJ3B 3ZZ1A 4DQOL 3RBGA 1Z0NA 3TO4D 5D7IF 1LO3H 2ZCKH 2H2SD 3C5SB 3K1DA 3N85L 1D5BB 1OB1B 2Y1VA 3QFDA 5K9KB 5EOTA 1BFVL 1G9MC 2VZOA 5HHMD 4OLVH 3OPZL 4P2CG 3MR9A 5DQDL 2WUBH 2CKNA 1Q94B 1WC7A 3GIZH 3MOBH 4LFHD 4AENA 4J12A 3T0XA 1EA9C 2HFEB 3DO7B 4JCMA 1OGTA 5ESQA 5INCA 3UTQB 2UV3A 3GSUA 5FYKE 5BRZE 2I9LB 1D5MB 2P8LB 3HI5H 5MERB 4GW1B 4IRSB 1T7XA 5C08B 3K81A 1A22B 1A7RL 5FB8B 1MQ8A 3D5OF 3T0AA 1MCIA 1A1OA 1FNLA 4UBDD 4P46D 1D6VL 2XXMB 1XGUB 1EO8H 3VFGL 4UAOB 5GRUH 3RIAK 4I4WB 1P4LB 3QUKB 1AXSA 4HBCH 3D39D 2DB8A 3GMQA 4FZ8L 5JW3H 2NZIA 5IUSA 3K4DA 4YHLL 4D2NA 3I75A 4JVWA 2IFGA 4WV1A 2XN9E 2P8MB 4JN2B 3V9FA 3JUZA 1U8OB 2Z8VC 3O3UN 3HHRB 1UH4A 5A2KH 3DLQR 4PP2A 4JO1H 4Y5YA 5E1HB 1IEAA 4YPJA 3UTTB 2DS4A 5FGCB 1T22A 4OV5B 1U3ZA 1T21B 2HG5B 1UM5L 5KS9A 5ESVB 1EHLL 4M7LL 2RR3A 1RJZB 4OKVB 2GK0A 4R4BA 1ZLSH 5EOQH 2QHRH 2Z92B 4TSAL 4H1LG 2GW5A 5GS3A 3GMLA 1G9ML 3ILPB 5IGXH 1WIPA 5KSAC 3CH1B 4M1GH 4J3VA 5DJYA 5CJ5A 2W1NA 4F2MA 4JFQA 3I6KB 3CXHK 4U7KA 2XN9B 1UJ3A 1I7UB 1XF1A 4WUUB 3TN0D 5I1JL 2UVEA 4JPIA 2A6JA 5HHOB 1UG9A 2VITB 5K59E 5FDYA 5KAQF 1J1OH 4ZD3L 3OHXB 4NUJB 3MBEC 43C9B 4OZHF 5IBLC 2D0HA 1Z3GL 2LE9A 4ETQB 1NQBA 4TRPH 4Q0XL 5TQ2H 4XC3H 1NDGB 2GITB 5K9JL 3KPRD 1SYSA 4RWYH 4LCWA 2IGFL 5IK3B 4NN7C 2EYSB 1FDLH 4QHUA 1T4KA 3V5DB 1V3KA 3DECA 4P46B 1BX2B 3MXWL 1XFPA 4LLQA 4ZAKC 1JWMA 1YQVL 4LARH 1C08B 3ME0A 1L7TH 5ID0A 4KZEL 1QKZH 1YPZA 5H35B 3O9WC 1XR8A 3KXFB 2Y7QA 2HTKC 4Z7NF 4Q6IC 4CADB 3FQXA 4G80A 4XX1E 2ICWI 4XWGH 4LSQL 4NWUH 3O2VL 4P2OC 3S4SA 3V6ZB 3VG0L 3T0EB 3X12B 1A6VH 3KAAA 4Y2DB 2AJ3A 4ZOEA 4XHQA 4JHWH 4RNRB 1H9VA 3FQTB 1D6EA 4PJ7B 3DVIA 3RVVD 2BVPB 2HKFH 4BFIA 2JCCA 2LU4A 3T65B 2YR3A 5EC1A 3FB7B 4LLYB 3RVUC 3R0NA 4X80L 5C70A 4OJFH 1GH7A 1DCLA 4P5KA 4UT6H 4Z7UE 4Z7VB 3F6LA 4JFPB 2COQA 5EPMA 3ARUA 4TUJA 2V5SA 1I85C 4Y5XB 3X14A 5JHLL 4P4RB 4XNQA 4NKMA 3W9EA 3REWA 4BQBA 3QUYD 5I9QB 1DQLH 4V1DD 1IVLA 4D9LL 5HHPA 5CIPA 1OWRM 5HBBA 3KYNA 2AEPH 3EO0A 4HWBL 1ADQH 3NMEA 2YPKB 3ZT6A 4BSWA 1MFBH 4RX4A 4XVUC 3MOQA 1DVFA 4KDTA 5JR1L 1QO3A 1NGYB 3O4LB 3WLBA 2W0FB 3FN0H 3BUYB 1LO0H 4G6JL 4PG9A 4JANA 3JUYA 2GJ6B 3VWKB 1FRGL 4HUMB 4WY7H 3H9ZA 5ENWB 4PIRF 3CVHL 2YUWA 1CGXA 1NBYA 4MJ5B 4AL8H 1ORQA 3FTGB 1GHFH 3K2MC 5ALBL 2ICWB 1D5XB 4I2XB 1IE5A 2BNRB 3GKWL 2OZ4H 3HPLB 1OPGH 3MV8D 4XNYL 1KN2H 5HYIA 1PX4A 3O6KH 4Y4HC 4FQCH 4JM2C 1JF1B 2CLRB 3JSSA 3DX9B 4Z9KB 4Y16C 5KSVA 1QSEA 5HGDB 3OWEA 5C0RH 1TQBB 2VXTL 4BSJA 4UT7H 5FYJL 1MJJA 4WI9A 5JOFB 1E4WL 3PQYD 1A4KB 5B39G 3DXAB 3VFPA 2CXGA 2HLAB 5E99H 4OLZH 4DVRH 2VDNL 4GXUN 1FQ9C 1D7FA 1RIVH 3JVGA 4WDIB 1TTGA 1FRGH 1W72A 3VFSB 5JA9A 1H5BB 4HAFA 3SBWC 1JFQL 3UJIL 5FYLH 1HSAB 1JZ2A 1Q9LB 3VG0H 4O58H 5EA0L 3EBAA 3ARED 1NAMH 3QHTC 3MREA 5HVHB 3MLVH 5SWSB 4NQXA 4ZSOE 1JTPA 2FBJL 3EGSB 5MI0C 1TCMA 2J7LA 1CR9H 1ZTXL 4GRWH 1FC1A 2NW3A 1GVIA 4FFYH 1VEPA 4P5TB 1LDSA 4TVPL 3OKKA 3O41A 3CVIL 3L3DB 1KIRB 1SY6H 2L7UA 4OAWA 5EU7E 1VADA 4JRWA 4EI5D 3QR2A 4UIMB 1TJGH 3T4YB 2W65A 3NCBB 2DKSA 1JBJA 4JO1L 5IVOA 2CDFA 3L7FB 1E28B 1BQLL 2ZSWB 3QA3A 4YPGB 5JXED 4Z7VA 1A6VL 25C8H 4HKJA 4P3CL 1B0RA 3GFUA 5HTSA 4GAYB 4HSQA 1URLA 5ITFA 5ACLA 3BRGC 2AI0H 3EJYD 2XXCB 3KDMA 5HVWA 2VDMH 3G5ZA 3CFKB 3HI6L 1I9JH 3ARFA 5GGUB 4P2QA 4UT9H 2BCKA 1WEJH 4AY0A 1FIGL 5DK3A 5F7UA 3K2UH 1NH6A 1JWSB 2AQ1A 5ID0B 3D18B 4NQCD 1HQ4B 2DBJA 4KTYA 5I8OL 1FL5B 1NFIA 2EYTA 3RVUD 4KJQC 4PRNB 3IFPA 5E5MB 2ZNWA 1JGVL 3CUPB 2F58H 5GRJL 1RUQH 4HKZB 4QHUB 3NA4A 4NN7B 4F57H 1RU9H 1NGXB 2V7NB 3EYSL 1S5HB 3UJTH 1MHHB 4ZUUB 4OZFG 1F45A 3PQYE 1MUJA 3RZCA 3U0PB 2B2XH 4WV1C 2EIEA 3ISWA 4GMTL 2DIAA 2Q7YA 4LMQI 2NY1B 3TBWB 4EQ3A 5F72S 3K2UL 1PZ5B 1BBDL 4LLDA 4MAUL 3P0VH 4NUJA 5DDHB 3KPSB 3WFBH 4E41E 1LE9A 1JGEA 4R97B 4H0GA 1J18A 1RK0A 4O2FB 3ARQA 4PJXA 1D9KD 3S8WA 1T5XA 3AS3A 1MFCL 4S10A 4UB0H 5EU6A 4JQIH 2LTQC 1BM3H 2H8PA 5KSAD 4G8GA 3Q6FB 1XF5A 5GGTA 2R2BA 4GKZA 4ODBD 4D9RD 2RIKA 3IFNH 5EU3A 3K1KC 3IU3A 1DQJB 4M6ML 3V5KB 1QFHA 5GRJH 1NSNL 1X3DA 15C8H 1K9TA 1DVFD 3N50A 3OAUL 4P2RE 1AI1H 4XPFH 2GJ6E 3H9SE 1UVQB 1TLKA 3UMTA 2PTTB 5TF0A 1R0AH 4LVHB 1JF6A 4NJAH 4NSKB 1IEAB 1FJ1B 1QO3B 4OQ1A 1GRWA 1F4YL 5J6HB 4G9FD 3TPUA 4PJ5E 5CMAA 2MWCA 1FFOA 5JHDB 2PYFA 5T1KA 3MJ9L 3WEXB 3EFDH 3TWCH 4BSWB 1QEWA 3QXDA 4BK5A 5EBMA 3L3GA 1R5WA 1JMXA 4S1SH 1IC4H 1MRCL 4RAVB 5C6PB 1JP5A 2VABB 4MNGE 1S7WA 1DSFL 3GJFB 1DR9A 2C5DC 5CSBA 3F7YB 1BBJB 2ZOKB 4X9HA 1R3HA 4HG4J 4HZAA 4DW2L 1NFDE 2EE2A 4YJZL 2I24N 5B4MD 3GMPB 5BVJB 4K3EL 1CDCA 3PDOB 3MNVA 1OTSC 4P59H 4UTAH 1IM9B 4QOKA 4CMHB 1W0WA 1NGPL 2XZZA 1A02N 1KPRA 1S9WB 3R8QA 5AWNL 1X4YA 3T1FA 1HCVA 3MCLH 4G43A 1KT2B 5C2BH 3KGRA 1ZA3A 4Q97A 2ADGA 5D8JL 3W2DH 2LU7A 4CBPA 1HHJA 4K3HA 2FX9H 1LO4L 3QUYB 2E27L 4CVXA 4MCYA 1RHHB 4G6FB 1P4BL 3S4SG 2Y7QB 1RUQL 3KYKL 4KK8C 3VXOA 1K6QH 1KPUB 1P2CB 4I0KA 4GKSB 3IETA 5FYJE 3TV3H 4MJIE 5LCVL 5D7KE 1A14H 5I1EL 3KNBB 5I19H 3BEVA 5HVFB 2XI9A 3T2NH 1JCKA 2X89D 2O61B 4JZNB 5IW1B 3VW3H 4H8WL 3HCVB 2FJGB 2H32H 1ZEAH 1YEDA 2WMPA 4X7TA 1CTNA 5GISL 4YGAB 2DLFL 5HHQB 2CO6B 4L1DA 4M7ZC 3GB7A 5I1LB 1U91B 4Z7WE 4S1QH 5DJ8A 1A6WH 1QUNA 1WF5A 5FUCC 4C59B 4XP5L 4R90H 4RCAA 3Q5YA 3BP5A 2QQLL 1B90A 4X7FC 3RI5F 3EYUH 3KNBA 2HT4C 3QDGB 4LL9A 4M6AA 1U3JA 4OB5L 5HDBF 4KZDH 4X4XA 5F9JA 1AGBA 4QKXB 4F2MB 5L8LB 4JG0H 1FGNL 1SEQL 3C6LC 5EH1A 1IAII 1WICA 1KN2L 4JGMA 5GGRA 3GMLB 4K23L 5HDQH 3S5LB 1R3KB 2AKRA 2EZ0C 5LKNA 3DVFA 1EEZA 5KG9A 4HQQL 4HLZH 1ULVA 3KYMA 4K2UL 3H3BC 4ORZC 5EZOL 2IQAA 5DD0H 5HHOD 5GRVL 3QUMH 3NFPA 1NAKH 4MYWB 2HN7B 2QR0B 4QWWC 1ZAGA 5EO1A 4UQ2B 1FGVL 1PYWA 5E8EA 3S35H 2X10A 2E5EA 1U8OA 1FPTL 3MLPA 4OLZL 4DVRL 3PWPA 4FFVD 4NHCH 2AI0L 5KSUB 2GK2A 1O5DT 1VKXA 1P6AB 3EDDA 2H6PA 3BQUD 4TULL 3UPRB 3K8LA 3RY6A 1CXFA 4RZCA 3WNPA 1R5WB 4HF5L 5B3NA 2AEQL 5TH2A 5SWZD 3P40A 1XZ0B 2A9MH 1IAIH 1EAPB 2ICWJ 3OQ3B 4CNIB 3BD5A 1S78C 4K3DH 3FQNA 1S8DA 4NN6B 4YAQA 1S78D 3D25B 1HEZA 4JVUA 2PW1A 2IQ9H 2O61A 5ESAB 3TF7C 5DJAB 4OT1H 5JZ7C 3PWUB 5JW4R 2OX5A 2RQ8A 3VXRB 2R4RH 4LSPL 1CFTB 4JY4B 1MI5E 3MLWH 5DYOA 1C12B 3VXOB 3MRFA 4FFZH 2A73B 3H42L 4LP5A 1LEIA 2X4RA 3C2SA 4HWEH 3RUGE 1T83C 3RWHB 4LQ1A 1T7VA 3CXHJ 4GAGL 4OCNC 1PEWA 3WS3B 1IGML 3C6LB 3QPXH 4JFZH 1JJUA 2YWYA 4RISH 4DVBB 1INDL 4EI6A 1ZSDB 5DHXB 5HYJB 1JGEB 3NCYP 4LASL 5GGQH 5D2NC 4JHZA 2D0FA 2WBWB 1JPSL 4QXTA 4YDKL 4I0PA 3DIFA 4HEME 3KPRE 4XNMA 3VXQB 1DBML 4HXBL 3GMOA 1IJ9A 5GRXG 5FECB 1CZ8L 2QSQA 1MUJB 3WNMA 2C7UA 3WFDL 1LK3L 4HS3B 4YNYA 3V8CA 3NPSC 5F71A 4QHKJ 1AJ7H 4QRTA 4M9OA 4Q2ZA 3FZUC 2YD6A 3HS0A 2QTEA 1VADB 2XZCL 1FZKB 2HVJB 3OXSB 3JWOH 1MY7A 3QO0A 4MDJB 3G04B 4LCIH 5EO0B 5D5MA 3UCRA 3MBEB 3C5JB 1FLRL 1RZJL 4BFGA 5B8CB 2IPKA 1IC5H 1IAOA 3LEYH 1VGEH 3NH7L 2X40A 1BREA 1AC6A 4NUGH 3O3EB 5E8PB 1JV5B 2IBZX 4HUXB 5BJTA 4WI4A 1SHMA 3HB3D 4PJIB 5C0BD 5EU7C 3NCFB 1XGTA 3OG4B 1CK0L 3VFOA 1IM3A 4KHXH 3ZDXF 1F90L 2X7LB 4G8EA 3HS0B 4DAGH 2QKIA 3TN0C 3ULVF 1ONQA 1CF8H 5L2KB 4XX1G 2EDBA 2JF1A 3GSNB 2NX5E 5L2JB 2P5WE 4IDLA 1OSZB 1MREH 3SQOL 3EOAB 4XTRD 3AREA 5MHSE 5FO7B 4HMDA 2I26N 5JW5B 2VMFA 5D7JD 2I07B 3G6AA 1MHPH 1JHKL 2WNGA 3RL2A 4RMQA 1AD9B 4PLKD 2VAJA 4XXDB 1RUAL 2FECL 3FMGH 5DD1H 5HYEA 3TO4B 2Y72A 3TP4A 5DMKB 3IJHA 4MNQE 4W68A 4LLAA 4U6HA 3VFNA 1Z3GH 4YFEA 5MEND 1DN0B 2R8SH 4JJHA 2XWBA 2YD9A 1KB9K 5ALCH 1BF2A 5CP3A 4EVNA 4NFBA 4YHNA 1CXHA 1J0YA 1PLGH 4G8EB 3PP4H 2E7HA 5EU5A 3LEXA 1A6PA 2VISB 4E41D 1S5IH 3QJFA 3T0BA 2BNQE 4KPHL 1HQ4A 1IM9D 2ATPB 2VN7A 1W72B 4HIIA 4LVHC 3ORJA 2ADFH 1F4XL 2PNDA 2UZYB 3D3VE 4KRPB 2D2OA 1MHCB 4RGNB 3V4PL 1ND0B 3D69B 3BEWB 4CU6A 3VH8G 4L4TE 3HMXH 2CO7B 3MGTB 4QRUB 2DBLL 3B2UD 2YPKA 1JYVA 1SYVA 4OBSA 3RRQA 5IMKB 4G5ZL 1YYLH 4LRNH 1R0AL 2B1AH 1H3PH 3MRCA 5MEQB 4TVSa 1QRND 5JW5A 4YGVB 2W9EH 1CGSH 1SMAA 4TUJB 4DKFH 4G9DB 2EE3A 4AEFA 1FGNH 4EOWL 4KK8D 3QI9A 4PBVC 4M93B 1NEUA 3DIFB 4JCLA 5E8NA 3F7RA 4ZAKA 1J1PL 4HGWB 3T65A 2JJWA 3LKQB 1S7VA 2IBGA 1Q0XL 4N90E 2IG2L 3EYQD 4LOUD 2VR5A 1FLTX 5MENB 1MCHA 5T3ZL 2XOTA 3E8UL 3WS3A 5FF6A 1NL0L 3AUVA 3C08H 1F3JA 4HF5H 3UPAA 4C4KT 4HT1H 4OQTL 4PY7B 3L3JB 4CGTA 1JV5A 3W0WD 1WVZA 2NR6D 3B6SB 1U2HA 4MQSB 2HVKB 5DYOB 2WUCL 3MV8A 5IB2A 2ITCA 3WIFB 3LH2H 1FZOA 3SE8L 4AEHH 5IVXB 3ZYIA 1ZWIB 3UTPE 2HJKB 5JIIA 1B2WH 4MJ6B 2B4CC 3MJ7A 4PRDA 1T1YB 5L2KD 3MCKA 3D25A 1UEMA 4PRHA 1NFKA 3KPOA 1KJVB 2LQRA 3U2SA 5E00A 4GG8B 4RIRB 5DQDH 1KULA 5T1MB 1U8KA 2UWEE 1MF2L 5D2NA 2EC9T 1NDGA 4XMLL 4YHPA 4G9FE 2EDQA 5JLZB 3AMLA 4TTGA 1UWGH 3H7BA 2XQYG 2R9HC 4HMCA 5TDPB 4IEFB 3HG1A 4OD3L 1A4KA 3GBNL 2BJML 2H9GA 1CFQB 1P84K 3EOBB 3AMKA 1NC4B 4U6YB 4LK4A 3VE0A 4LKCA 1DQDH 4J6RH 5IROA 1CFVH 4XXCA 3RVXD 2DAVA 2OXHA 4LPXA 4HT1L 4FFWD 4HIXH 4OQTH 3SDXF 4LSVH 5ETUA 35C8H 2FO4A 3CFEB 3O2DA 5I1GL 1D9KC 1J8HA 2K3TA 5TDNB 1I1AC 4CVZB 3PABA 1OF2B 4QRSB 2W0KA 2X4RB 1FYTB 3DV6A 2JJSC 5IR1A 2MTPA 3CH1A 3NIFF 1MCBA 1SJEB 4IRZL 5HYJD 2C3VB 4Y16A 3PHSA 4PJHF 1RIHL 3B9DA 3VRLF 3HG1D 1IGTB 2ICWA 4LVNB 4KJQD 1CU4L 3IKCB 2NPLX 2ADGB 3OAZH 3SDYL 4Z76B 2YHGA 3FOMA 5HVHC 3BH9B 5CGMA 3LQZB 3UTSA 3HMWH 5IB3B 2J8UF 1ZHLA 3H6JA 2Q8AL 2IALA 5D7IE 4MCZA 3RNKA 4N9GB 1N8ZA 2FX8H 4UNVA 2P8MA 3BP6A 2BOCA 2J88L 3D1MC 3GSVA 3GSXA 2R1XA 3QUXB 3ES6A 2B5IB 4NQED 4EEEA 5F6HJ 1HE7A 5IHLB 4Z7OF 3TBVA 1OAQH 3SY0A 5HGAA 1BIIB 3QDJE 5B38G 2YK1H 3WFHA 3MRKA 5DURD 4Z7QE 4BQCA 3TA3D 4MJID 1RFDL 5I8CB 2DQUL 2BDNH 5HD8D 2NY2B 5I1IH 4UQ2A 2V2TA 2MHAA 2UWEF 5JW4M 2OK0L 4JM4L 3CXDH 1CU4H 1CL7L 4KWUA 2FHCA 4WHDA 2VDLL 3QPQD 4MNHB 3PIQA 4DUXA 4M1DL 4UILH 4M61A 4L8SB 1FZJA 4R7DB 4HG4K 4JY6B 5F7FA 5AZ2H 3S34L 4L4VE 5B22A 4Z77B 4NJ9H 3N1QC 5KS9B 3BP4A 1WIOA 2P1YA 1TVHB 4MAYB 2MKWA 5EFIB 4IRJC 2BSED 1X4ZA 1BJMA 3GSRA 4YHIB 2NW2A 5T1LD 2FIRT 3F65A 5DTFB 3CFJA 3PWJB 1OAKL 4FNLL 5C0FA 4YHZH 1HWGB 1D5IL 3RZWA 1HH6B 1ZE3C 1QR4A 2G5BA 5DVOA 3REVB 3SDAC 5BXFA 3BWUC 2H9GB 1R5IA 3ROOA 5C86A 2NY6D 4RAUB 3EJZC 2NZ9C 5HDOA 3V7MA 1FFRA 3S96B 5DI8B 1JGLL 1KGCE 3HNVH 3TGXA 5ISZD 3N1GC 4MD4A 3RI5K 2V7NA 2YN5A 4GG8A 5GS1A 3CFDA 3RIAF 5C09B 1JRHI 3ARRA 1YEDB 4LEOB 2VLRB 3BVNA 4K07A 3P4NA 2A83A 2WBJD 4DW2H 3CSGA 3DV4B 5I1CL 2A77L 3FO9A 3QFJB 3ARWA 1F6AB 4Q6YA 4RQQA 2B2XL 4YFLI 2PYFB 4DGYL 5IESH 4FOMA 1I8IA 5B8CC 1N6QL 3MA9L 3JV4B 5C0CD 3DSFL 4PJ7F 1RZ7H 4APQD 4RRPA 1X5IA 5D1XC 4FZEL 4MQ7B 5EFIA 1W2KT 5J6GB 3CFCH 1MFDL 1A4JB 3RU8L 3TBSB 4ELME 2AJSL 3C60C 1JHLL 1B6UA 5L9DL 2NXYB 3LV3B 4S2SB 3ARPA 4HGWA 2Z8RA 1KPRB 1S9WA 2X70A 1LDPL 4TPRL 4Y5YB 2IBZY 4YDIL 2MJWA 4BQ6A 4Y88A 2FD6H 1N3NB 3Q1SH 2V17H 1NFDB 1OL0A 5HJ3A 3MRKB 4R96A 2BHYA 4YXLL 3MRCB 5IBUB 6FABH 4NM8H 3BPNB 5T5NG 4HD9A 2CSPA 1TFHA 1CLCA 3FJTA 3MACH 4YHYC 3C08L 4OUUB 3RWIA 3E2HB 2MCG1 1CT8A 5T1DL 4KGLA 2ATKA 1HHGA 3DRTA 5DD6A 4P23A 3FO1B 4LLMA 2FHBA 5DHVB 1NGXA 3A6BL 5F70A 4M02A 2ATPA 3W82A 5L8KB 2DQEH 1T3FB 1A2YA 3VGGA 5MERA 1F02I 1E4WH 4D9QE 2FD6L 1H0DA 4UDTB 2FSEB 1OGTB 4X0KA 3X11B 3FONA 4HK3J 4WW1B 1DJSA 3A0OA 4RMVA 3VI3E 5FYLD 1H5BA 2Z4QA 3EHBD 1JWSA 1F2QA 3I2CH 3LB6C 3RVVC 3P11H 2VLJD 4JY5H 1FYTA 1F11B 1T89C 4U2ZA 5K9KA 3ARDC 2BCKB 1T66D 4OD3H 4ZAKD 3CLFL 4AIZA 3BGFB 2DQTL 4OZIF 1QNZH 2Y4SA 4LDEB 1A7BA 3T8XB 1V7MH 1UGNA 1LE5B 3S98A 4WCYH 2XA3A 2F8XC 5TF1L 4KVNL 1AO7D 3ARDB 1JMZA 3AS1A 4LKCB 1DEEA 1TZHB 4XCEA 3O9WD 5BV7B 3OGOE 5IVNA 3PL6D 2EDOA 5DVLA 1B88A 2PR4H 1OTTD 2QSCH 1GPOH 1AKJA 1M71A 5FCUH 1MJ7H 5E9DB 3MROB 4PRIE 1XF4B 5H2BB 3U4EA 4MWFB 1KTRL 1Z5LB 1U8KB 2Y07H 1RULL 3V0WH 1TETH 2DF3A 3U4AA 1N2RB 1HOCA 1QFOA 2J8HA 5BZDB 1FSKC 4FFZL 3ZDXE 3CK0L 5IFJA 2R0ZL 3SPVB 5IMLB 3SDCB 3P73A 3FTGA 3QXTA 2P5WD 4U3HA 5ICYA 3WUWB 2OI9C 4P23C 3MRMB 2V5MA 2R4SH 2OR9H 3GNMH 2GCYA 3M8OH 3QWOB 3L6FB 3LDBC 1NAMB 4NQDE 5INDA 3BKMH 3I02B 3IS0X 2W0FA 2P7TB 3L3OA 2VLLA 5I2IA 2AJXH 3G5XA 5C92A 1PG7L 1NAMA 2VLMD 3SOBL 2W92A 3IS1X 2C1PA 1U42A 4XMKH 5EO0A 3MUJA 1YYML 1UCTA 4MA7L 3FT3A 1YJDC 2RHEA 3CFKA 5MENA 1EZVX 1TETL 4RFNB 2NY7H 5CBAB 2EKSB 3CK0H 5FUZH 5GS0D 3L5XL 1LD9B 5B4MC 1NAML 3AAZB 4U3XA 1ZGLB 3V0WL 1RZKC 5GSVA 4JFPA 3HA0A 2VN4A 1DDHB 3RAJL 4GW5B 4D8PB 5C08D 1E28A 2Z31B 4G6ML 2G60L 2NLJB 4LASH 4NBYB 5EZOH 2GTZA 1EUUA 1AFVH 2IAMD 5A2JH 3D3VD 2M1KA 4KKBD 4X5XA 4U33A 5IT2L 4OF8A 4XP4L 3RWCA 3DARA 1FO0H 5JHDE 5M7QA 3VFRA 2Z31D 1P9MC 2ZOLA 3BHBA 1NC4D 1I8LC 2A73A 3O9WA 5J11B 4LF3A 5CEXA 1FAIH 3DSNA 1Q72L 5SWSA 4NZUH 3VXRA 4KRLB 4DCQA 4D0CB 1PY9A 2CK0L 3G6JA 1QBMH 2YKLL 1UACL 4IS6A 1RV6X 1L0YA 4QCIB 3QG7L 1U8PB 3T3MF 3PF2A 5LQBH 4GUPA 1QFWH 3X17A 5I1CH 3ULUE 1GYAA 3BMWA 1TXKA 1NGYA 1DQQA 1GAFH 1QPXA 1BEYH 1KENH 1HIML 4YC2C 4WDIA 5D1QB 5EUOE 2N7BA 3TJHD 1HXMB 4F58L 2LTQB 4U6HB 3VFNB 1F8TH 5F7LB 3UO1L 1A3LL 4K3EH 4HFUL 3PGDB 2QSVA 5F89B 3QDJB 4KHTH 5FKPB 2W60A 4JFOB 3GDBA 2UY6A 4MLIA 4Q6IB 2KKQA 2APBA 43C9A 3O8XB 5BV7C 5EO9B 5DMIL 5FYKD 5D7LD 4ONHB 1GC1L 3IDNA 4G3YL 4P23D 2KQMA 3QNYB 2D9CA 3DETC 3S3SA 4PS4H 4W4NA 2FB4H 1WWWX 2CLRA 4J3XA 4D3CH 3I6KA 1NBQA 1M6OA 5L2KA 2QEJA 1OD9A 4WO4A 2X70B 4RA0C 3V5HA 5C0BE 4LLYA 4PLJD 2FH6A 2ZG2A 1F4WH 5F93C 4ENED 1U41A 4JDVB 2EYRA 3LB6D 5J1SC 4PJCE 3W0WB 2BVQA 3N06B 3MNWA 2X4PA 5HDLA 1MCCA 1T6VN 3LSOA 4BA8A 4M6OL 4DN4L 2OI9B 1G9NH 2EDTA 3ARDD 2EDLA 4ZUTA 1D5IH 2XZQH 2VQ1B 2P49B 3TA3A 3F7VB 4NCC2 5AWNH 3KXFA 1T0NA 4W6WB 3GRWH 4EQ2A 3WD5L 3LKNB 3ZKXC 1DUYB 4QNPE 1PQZB 3LD8B 5HPOA 3UBXG 4GOSA 2VZTA 2FJFA 4D0BA 3GSQA 2GUOB 3FB8A 3K7UA 4PJXF 1LVEA 4L8SC 3U0WH 2DQIL 4F15B 4H1LB 4WHCA 1MHEB 2O5ZL 1CXIA 4APQC 4H5SA 4P5KB 2DYPA 5FKAA 2D03H 3T3PE 4GAFB 1AXIB 3WS6A 4QXUH 3GBML 4WFED 1OOAA 4PBWD 5KVGH 4OT1L 4O9HL 4X5LA 4JFDD 2DRUA 2ILLA 3CU1A 5EZLB 3ZE1E 4WEBL 1L6XA 2AJVH 5CGYC 4IIQB 1I4FB 5SX4I 3WUZA 2AABH 4JZNA 5IW1A 3FQTA 2AK4A 1MIML 1HH9A 4LHUD 2RAMA 5KANG 2B4CL 2DIBA 5KSBA 4M5YL 1CFSA 5ANMA 3RX8A 1LO5B 1B3JA 4JFXA 2EDEA 2VE6A 2VXSL 3ARGD 5I16A 5I8EB 1F11A 2VQUA 3F8UB 4EZMA 1AGEA 4P4KC 5JXEC 3DMMC 2I60L 1AGDB 2R2EA 1KCSH 3T0ED 3JXAA 3P9MB 2X4OA 1F58L 4JM4H 4QTHA 4XPGL 2FSEA 3PNWB 3RZCD 1J0IA 3BISA 3GSOA 2Q8BH 3QQ3A 2AK1L 3OAYK 6FABL 5I75C 2W9DH 4ORGB 3UTTE 1F2XK 4K7PL 5I30H 5DHVA 4P5MB 4UQ3B 4LRIC 3PDOA 2HT4D 3BGMA 5E94B 1CGWA 3QDME 4M7LH 2BJMH 3V7AG 1X5XA 2ATKB 3LIZH 4HQQH 3UC0L 5IOPB 3GIVB 1FL3B 4JRYA 2Y6SC 3MRBB 1LO2L 4OLXL 3TV3L 2QQNL 4PJFA 1RZGB 2X5PA 3SDAB 1IC7L 4I4WA 1I1RA 3GIVA 5BVPH 3N85H 4KI5D 2BVOA 3MJ6A 3VXMD 3GSXB 5FYJU 1UXWA 5C09D 4PJHE 2NY0C 5CJXC 5KVFH 5BW7A 3TPUB 3MRNA 1P1ZA 5D7IB 1BZ9B 1VACB 4RDQF 4GXUM 4MA8H 2ZUQC 2IANA 4BQ9A 2Q8BL 1D6VH 3AY4A 4MAYC 1UH2A 4DK6A 3QRFM 3UJJH 2OJEA 4ODUA 4ZS6D 2YZ1A 2HFEA 5ESVA 4LHUA 4FQQB 2VDML 4NRYB 2IADA 1OW0C 1SJEA 2F5BH 5LGHH 5ITBH 4JR9H 3TIEB 5C0CE 1X6NA 4U6XA 3QUZB 4XH2A 1D5BA 5E2JA 3V6OC 2PETA 4MSWB 4FQPA 1G9NL 1QLFB 2BVOB 1EJOH 3WS6C 4D9RE 5E6ID 1FNFA 3A67L 4TOYL 5J12B 2OTWB 5IQ7H 3O6FB 32C2B 3LN4B 3MRBA 1KCVH 5BO1L 1D3CA 4U1KB 4YIQB 1BWMA 3B9AA 1C8PA 3VXTA 1YC8A 3KHQA 1Y6NR 2YD3A 3MGAA 4XPHL 2XACC 5DLML 1MHHA 2D7PA 1W8NA 3S3JA 4RIRA 4H1LA 2EIZB 1XIWA 3MZGB 3HR5A 2FBJH 4GKNB 32C2A 3O6FA 4WW2C 3GI9L 5J0BA 4YXHH 1NMCB 1U8HA 2G75B 4UINL 1PKQA 3THML 5BRZD 1DANU 3TA3C 5FO9A 3RGVD 4Y19D 4ODTH 2AV7B 4I18A 1BJ1H 4ZFGL 1NFIB 2EYTB 4JN1L 5IKCB 4WIQA 1S9XB 4U7MA 4LPUA 1KPUA 3BIAX 3SGJA 4C54A 3LCYA 3MCLL 3QFDB 2DJSA 4HV8B 3KVQA 5CGTA 1CBVH 3L7EA 1ZHBA 5F9OL 1NLDL 5AZEL 4JKMA 1G7JA 5D7JA 1RIHH 1TJGL 4X6FA 3C09B 1CDIA 3SO3C 3QUZC 2YMXL 4Y19E 4RA3A 1NUDA 5I75B 3TH3T 4LDLB 1OAUH 4LPYA 2NXZD 2HLFC 2WW8A 3QUZD 4UV7H 4XPAH 3SCMC 1RHFA 3JZ7A 5FKAB 2UZIL 3G9VA 2BVTA 3BZFA 4JLRA 1YNLH 1UXSA 3ECBB 2D31B 3LZFH 5HGAB 1DBJL 3WHXA 3MA7B 4XGZA 5GPRA 5MEQA 3U0TB 4WW2B 3OMZA 1ORSA 2ZKHL 1EO7A 1QHPA 4IJ3B 3O41B 1SYVB 1X5KA 1LP9A 3QDGD 1YY9D 4D0BB 1NGWB 3EOYG 4NNYB 1U9KA 3MLUH 1IGCH 4WFGD 1RJYA 1F4XH 5HGBB 1UVQA 4MX7A 3P3YA 5E8OB 2ZUUA 4Y4FA 2R0WH 1R3JB 3MLZH 1KBGH 3PNWA 4PG2C 1JNNL 1RZ8A 3NIDF 4Z5RA 4PJ9A 3FL7A 3C87A 2AEPL 4PJIE 5J56B 2E7CA 4DGVL 1SEQH 4LMQE 2Y9RT 4NKIH 3C9NA 1S7XA 3CJJA 3I6GA 4K3JL 2R2CA 5C8JB 3NABL 1XF5B 1UWXK 1KIQB 1G7IA 5T3XE 4M00A 2CPCA 1OVZA 3NH7H 2Z91A 3HMXA 2FATL 3GMNA 3BKJL 4OGYL 3O8XD 4PUBL 2HMID 3RL2B 1HWHB 3ZKXB 4YHKH 4AZ8A 4O51B 1YN6B 4M1GL 2XKSA 1N64H 4AL8L 2C3XA 4N0CD 1CR9L 5C71A 2NLJA 2R0WL 1EERB 5D1ZD 4DKEH 2PXYB 3HMXL 1A8JH 1OSZA 2VZUA 3RTQC 3VGBA 4ESKA 2WWKT 5D1QA 1MWAL 4LQFH 2XRAH 3ULUF 1N7MH 1V3MA 1WAAE 1YYLL 2FX8L 4NM8L 1CK0H 2XWJA 2JJVA 3ET9F 1QRNB 4LCUB 3GM8A 4LGSB 2CKBH 4NN5B 5HHNA 3V52L 5HPMB 1ETZB 1P7QD 3P4OA 5D7JC 1YEJH 4PBXA 2FJFB 4PLNC 1E27A 2C1PB 4PJEA 1S9YA 1YPZE 4JFFA 4QRRE 5KN5B 3U7YL 1PG7X 1IARB 5IM7B 4Q9BA 3C5JA 4M93C 4DZBB 3RWCB 4Z0BL 4QRQB 5JHDD 4EI5C 5JNYA 1SVZA 1HSBB 4LLWA 5D2LA 4U1NB 3MNWB 4LIQL 3UROR 4TUKL 3AS2A 2R1WA 4R4NC 3SPVA 2AJUH 4Y0GA 3K46A 4NKDB 1HNFA 3V5HB 4L4TD 4ODHH 5FIEA 1TNMA 3S5LG 1HILA 5F9AC 2X4QA 4Z7UA 4LEXH 2E9BA 3IAGC 5J4MA 4G9DA 4L3EA 2OR9L 3GNML 3BXNA 3M8OL 3MLUL 3TO2A 1JK8A 3ARGA 1EMTH 5FM4A 3TC9A 5C0DA 5L88L 3C5ZC 4N8CL 1M05B 5FK9A 4QXGL 2GIYA 5EOQL 3ILQC 5EU4B 1BD2D 4ODVH 1A7NH 3KPPA 5DR5L 1OP5K 4D9QD 3KJ6H 2J8OA 2NW3B 3BEWA 1YEHL 4CDHA 3LZFL 3O2DL 4BH8B 1INQB 2CIIB 2EXYD 1A1NB 3S7GA 5I76A 1LEIB 2VLME 1J9CT 5MI0B 4G6KL 4JRXB 4MA7H 4YLQT 4P0DA 3ZKMC 4PJEB 1UWEH 3AC0A 2B1HH 3MRGB 4Z5RB 2WANA 1FN4B 1X44A 5BO1H 1H0DB 3TO4C 4KMQA 6CGTA 3BPCA 4MX7B 1IGJB 1IQDB 3BKML 2IMMA 4YHKL 4ZFZB 2WZPD 2OTPA 1DTUA 3IJYA 3SDDD 3I50H 3D2UD 3TFKD 2X1PA 1HHGB 3CX2A 3DRTB 1FO0A 4JO4H 1GGBH 1NGWA 3JTSA 2IAND 2OQJB 3PL6B 4X5XB 5JQ6H 4DWHA 2NY0D 4P59L 4UTAL 4V2BA 1CBVL 1OGAB 3WFCL 2R29L 4P4KD 1B0WA 3C5ZB 2OK0H 5JPMA 1T0MA 1QVOB 2HRPH 4EIGB 4QYOB 1QSEB 5FO7A 5HGDA 3B8SA 5KSUA 4G8IA 4OZGE 1RZKL 1OP9A 4AMKH 1CGTA 2DMCA 1PX3A 1LDPH 4TPRH 3MUGA 2BHZA 4LGPB 4XVUD 3D39A 4TVPD 1FVCA 3QUML 1DBKH 4FTVA 3V6FA 1WFUA 2V17L 4D0DA 5E2TH 3MSPA 5GRVK 3H9SB 3LV3A 3BOVA 3QISA 5CCKL 1JHTA 3QUXC 1IM3B 5E2WL 1ZT1B 4H0HB 4AK1A 3H2WA 3DETD 3GO1H 5D1XD 5MHSD 3L3HB 1CXKA 4B50A 1YUHB 3OJDA 4X4ME 1BD2B 3PWVB 4IHOA 4ZSOA 5E4IA 3QXWA 4LCCC 4O2EA 1Q72H 4GKOA 4ZTPH 4F37K 3FFCD 3MYZA 2FNBA 4JKWA 1AH1A 3W11C 3BRDA 5CKAA 3GJFH 5EOCL 4HC1L 4LLMB 4NFCA 2CLVB 2LV4A 4WV1B 4HKXB 4WVRA 1YNTA 5AAMA 1Q9WB 1PKQB 1ORSB 3IDXH 4F33B 3HAEA 2P47B 1EEYB 1YMME 3FAXA 3WJJC 2WLYA 3E6FB 3MA7A 1R5VB 2Q3AA 3BQUC 4JKPH 3FQRB 4M1CD 1F8TL 4OKDA 2VXQL 4Z7VE 4U1LB 4XB8A 5C9JA 5E1AB 2J1KA 2XTLA 1JI2A 1XEDA 4ZFGH 4CU8A 4F15C 4LDOB 3G5VA 5HDBE 1J5OH 4ISVB 5C0EB 4AIOA 3K3QA 3QIBD 2DIJA 1WWAX 2R1YB 3I6LD 1MRFH 4B41A 1PKOA 1D6EB 2EECA 2WWMD 4YQXH 1BQLH 1WFNA 5DS8A 1RURL 1MELA 4PJFF 5ADPL 1A4JA 3S36X 4HUUA 4MD5B 4P2QE 4U4BA 2VL4A 5DA4A 5I17A 5C0CB 2X1XR 1NCTA 2KQNA 4Z7QF 3TBTA 5CJ8A 2HT2C 4I48A 1NEZA 5I17B 4KVNH 1MAJA 1N26A 3C5SA 1K5NA 2LAAA 2DM4A 5CBEA 1CICB 5J9PA 5D93C 1FORL 4KRMB 4EN3A 3DI2B 2YD2A 4LCWD 1ROWA 1VA9A 1Q1JL 5D1ZB 4JKPL 1QA9B 2FEDD 4U6VL 5CJOH 3ZHDA 3LKPB 4LOUC 5FGBA 4MGXA 1G9NC 3FQWB 3B43A 4HUWA 3HR5B 4YBHA 2MHAB 3BW9A 1A7PL 4KJPC 3PQYA 5FO8B 3LH2L 5DD6B 5F1IB 3NTCH 1KEGH 2VAAA 3S96A 1BM3L 4YZFE 3G6DL 5DK2B 4X7CC 1TQCB 5KAQG 5BXFB 1MAMH 1RZFH 1ZXQA 5KSBF 1MJ8H 2A9NL 2APXA 4JJ5B 2W0LA 4FQ2L 4PJXE 2R1XB 1FORH 1G7MA 1NANH 5T1LB 5F8RC 4XMLH 3WEXA 5K9QI 5DTFA 2GT9B 1AO7E 2W9EL 4MCZB 1KIPB 2LAGB 4Y1AD 3Q5TA 3E3QE 1KGCD 4PRAB 2OS7A 3P11L 1BD2A 4NRYA 3IFOA 4LIQE 3O45A 4OCXL 5HYFA 4OSUL 3V0VB 3K80A 4J7RA 3IKCA 5D70L 2X4OB 2H45A 4P2RA 2OCFD 2BSRB 5D1ZC 1IGTA 3EYUL 3H9SA 3N9GH 4OV5A 4LNRB 3PDDA 3VXME 1YY8A 1YEEH 2EC8A 2KZ1B 3HE7A 4ZFFB 3DV6B 2V2TB 3ZKND 1B4JH 1M7DA 4YHOH 5EN2B 4PJ5A 1EO8L 3L5WA 5FCUL 4HUUB 3V95A 4X6EA 4GRLC 2ZZUT 3M07A 2BVYA 5ETUB 2RCSL 4XCFL 4UZGA 2V7HB 4QYOA 3JWNC 1NLDH 3GMQB 5DEGA 3BD4A 5JPMB 2DQCL 2PCPA 1NC4A 1I4FA 2J4WH 1JN6A 2EDDA 4U6YA 4L4VD 3VE0B 4MNGA 2V9QA 3BP5B 1PJ9A 5C09A 3ES6B 3RNQB 4UDUB 1U8QA 1WTGT 2FIKB 3U7WL 3EFDL 1A1OB 4W70A 1LO3L 2ZCKL 4M7LT 3VWKC 1PLGL 4HS6A 4P5MA 4UQ3A 3EYSH 4QOKE 5LBSL 1EGJA 4UU9A 3ULUC 1MI5D 2YSSA 3KYKH 2P8LA 5CUSH 4OLVL 1UZ8A 1WJ3A 4Z76A 2HJKA 2ORBH 2JB6A 3UTQA 1HQRB 4KFZC 4W4OC 5E5MA 3IDGA 4JZJB 5IJVA 5J9PB 4CN1A 3P30H 2VXUH 4RGOL 4NZJA 2R2EB 3CSYB 1U92B 3PL6C 3TBTB 1A3LH 5M94B 3DTXA 4U1GB 5I76B 3FB5A 3HPJB 4NQDB 1U8LA 1XIWD 2KL6A 5SWZE 4HPOL 3EDKA 4MXVF 2H1PL 3WXWL 4MJIA 4HUVA 4B53A 4V1DA 1I8MA 4M61B 4N8VG 5EU4A 4X6DE 4WWID 1I1CA 1E6OL 1BQHB 1HN1A 4WTZA 4JDVA 1T03H 1J1PH 2VZ1A 4GS7B 1MCEA 4RSVA 4D0DB 1RIUL 4WW2F 3OR6B 4I3RL 4WO4B 1KPVB 4QOKB 5GS0H 3MNVB 2X1OA 3LRGA 4PJAF 4B7LA 4Z7WA 1Y0LA 2NR6C 4WNQA 1R3HB 4PTUA 3MZTA 1BIIA 1KYOJ 3ZKQD 1X5JA 3I6LE 4JDTH 4HCRA 1N5AB 1S7WB 2DD8L 4HMEA 2FL5A 3C5ZA 1AKJD 1FNEA 3JV5A 2GJZA 4IMKA 4XBEL 1WQVT 3VRIA 1AHWB 4UNTA 3O3AA 5T3XD 3L3GB 4K94H 5C07E 3L5JA 1MVUA 2OM5A 3E3QC 3PL6A 5D9SB 4JFYA 2VDOL 3QZWG 4MA3B 3ROLB 2ITCB 5EZJB 4XAWL 2MQCA 2DQIH 3IT8D 3P4MA 2Q86A 2MCPL 3F7VA 2GFBA 3OKYA 1AFVL 5J13B 3Q5OA 4NQXB 1I7ZA 3MV7D 2APFA 1GCFA 1E27B 4GQPH 1N7ML 4J3OC 4NRZA 3HC0B 4LLVB 1WWCA 2YMXH 2VIRA 5DR5H 3X3GH 1UT9A 2HP4A 5EU5B 4HFUH 3CMOL 4R0LC 3OAZK 1SBBA 3PHQA 4MB3A 4Z0XA 4HIJA 1UFUA 5JOPE 4RDQG 1CD8A 1IZJA 1YNKH 5JXAH 2C3GA 4H1LH 3O4LE 3HRZB 3LEVH 3D39B 4QRSA 4K7FB 3MUGB 1KCRH 3SE3C 4ZNEA 5IEHA 2XTJB 1E4XI 4X4YB 3DJ9A 5HY9A 4NN6C 3VFVA 1ZLWH 4GRLB 3PWPE 5C0AE 1I3RB 1T2QL 2Y6SD 2XQBH 4GBXD 1LE9B 2YUZA 3M45A 4PD4K 3UTZB 4O02H 1RUKH 1IGYB 4BZ2H 5IMOB 1KCUL 4FQXC 3HC4L 2ESVE 2YBRA 3U30C 4H25B 1MVFA 5HI4D 2DQGL 4RGND 3STZB 3RZCB 1DUZB 5HYQB 5H8DA 1G7PA 1BZ7B 3SOBH 1PDKA 2I9TB 3L5HA 3I6GB 3C60B 3KHOA 3QULA 3QXAB 1T80A 3BIKB 3L3KB 1CWVA 1YECL 2NYYD 1FC2D 1HKLL 4EN3D 5T1DH 3F12B 2VISA 4ALAH 4OZHB 1HYSC 1SY6A 3HI1B 4NRZB 2CH8A 2A9NH 1NCWL 1K4CB 2F53B 5C0AD 1MI5A 1FZMB 4KMTL 2A1WL 2EH8L 2P7TA 1T04B 1U95A 2DL9A 4G8FB 5DJXB 2AJYH 4U3CA 2G60H 3ZTJH 2V5YA 4LPWA 1IAOB 4GBXC 4I5BA 3RUGA 3KLSA 5B8CA 3WKML 1DFBH 1YPZF 2OBGA 1I9IL 1CGUA 1WIUA 3ALWA 2APVA 5F96L 2ADIB 1IGFH 5E4EC 5SWSD 5ILTH 2DLGA 4FMKA 3BZEA 4DUWA 3CH8A 2WUCH 2XG5A 1AHWA 3QCUH 2BHUA 3HC4H 1QRNA 2I07A 4OFPA 1DQLL 3BGFC 2CKBA 3TO2B 2E8ZA 2D31A 4KZDL 3MMEB 4NYLA 1JTTA 5GJTH 1EDQA 5I15L 1FP5A 4NO0A 2FX9L 4JB9H 4EN3C 4C56E 4DFIA 4J3TA 3QIWB 4QRPB 4Y8DC 2IH3B 3VWJB 4PJBF 4Y4HB 5GGVY 1KELL 2YKLH 4WFFD 4J3SA 4Y19B 1QPPA 1DEEB 1TZHA 2RCSH 5I74C 3FCTA 3HRPA 3VH8A 3O3BA 5F96H 4JPWL 1L9MA 5DWUH 3C6LA 3VFOB 1IGFL 5ILTL 4JO2H 1RULH 3W39A 4JGUA 2NY3C 4WWKB 4EDXB 3I9GL 3L3OB 1XR8B 1N0XL 3VXUE 2DI9A 1R3IL 2AP2A 5DJZA 3V52H 3QWOA 3T2NL 4IOSD 4GFTB 4U31A 1KTLB 2AEIT 3F58L 4FXKB 4KK6C 1XH3B 1DLFH 1FDLL 5IHZA 5HGHA 4JFHE 1HZHL 5DJ6A 4PREA 5E6IB 2DLFH 3CZJA 3WIHA 4P46A 2IG2H 4PR5A 2FR4A 2YSSB 4CJ1A 5K9JH 4WUUD 4JB9L 1I1FB 1I7TB 5H94B 5LAXA 2DMKA 2P5WA 5I9QC 4X7EC 2WK2A 2GITA 4JFED 5DC4B 15C8L 2ICES 1CT8B 3QEQB 1ZA6B 1A6ZA 2F53D 3MLSH 2F8VA 3RX5A 3WJLC 4URTB 1KJ2L 2P45B 3BH8B 1E4XL 3FO2B 4RZCB 1AY1H 3BKJH 2PCPB 1MJJB 2FH8A 2CDEB 1ZSDA 3MA9H 1J0JA 1UB6A 3T8XA 3U36B 4MNQA 3OR7B 4NQDD 4NWTL 4XCYA 3BAEL 3SKJL 4LPTA 5D6CB 2DMBA 3FT4B 5EN2A 2XTJE 1CLYL 2PR4L 4TSAH 1UWEL 3LRSA 1VFAB 2R0KL 3TEUA 1A9BB 4KMTH 1J88A 3MRFB 4LSUH 5ACZA 4HIJB 4N8CH 2DQUH 3SJVE 4OD2B 4CKVX 1JYXA 2Z4QB 2IFFL 4OCSH 3V0AC 3C8KB 2DI8A 2Z92A 3S35L 5AD0A 1ZS8A 1T2JA 5D71H 2LFGA 1G7JB 1AD0A 3EYOB 1A0QH 5D7JB 4F37F 5FHBL 5FEBA 1S7RA 1EIBA 2J6EL 4KY1H 5I1HH 1T3FA 1EH9A 4DN3H 5CEZD 5J89A 5BJTB 1FPTH 2JIXA 3O3EA 5E8PA 3D3VA 5T3XL 5IB4A 1TQBC 1I8IB 3ABZA 1GGUA 5EZJA 3GHEH 4XC3L 4PGDA 1F6FB 4YR6A 4LSDA 4MD0A 1XGRA 2J3SA 1PG7H 5I73B 5HVGB 3QO1B 1AR1C 3MRDA 5K93A 5FA4A 3WNNA 3SGDH 4JVPA 2FWOB 4OZIA 3U0TA 2AW2A 4GKNA 1FL3A 3WCYA 4U49A 2B5IC 4CN6A 3PP3H 4ZS7H 2C7UB 4WNQB 4Z0BH 3DX6A 1NDMA 5HHMB 4HBQA 4IRJB 4C83B 3QCUL 3KPRB 4NO0D 3GMRB 1ZT4B 3WO4B 3NFPB 3MNZB 3VGEA 4YEFA 5F7EL 1LEGB 3QCTL 1J1XH 1A7QL 1ZV5A 4OLYH 3HNTH 4OLWL 2HH0H 2YA0A 3IYLW 1UB5B 2H1PH 3WXWH 5JXAL 1K5NB 3O0RH 1E6OH 5EORL 3KPQA 4K9EC 3QUZA 1H15B 4L3AA 3HAEH 1MEXH 3VRLE 3NFNB 1AGEB 4WU5A 4MS8C 4LU5H 3RVTC 2DJUA 4QOKD 3DRQB 3KPQB 1LK2A 1KC5H 4UINH 5JUEL 1CFSB 5ANMB 3BFOA 3EW3B 4AEIH 2PO6B 4OLUL 3IDMB 1HQRA 5JW3L 3BYYA 1EO5A 3IU4L 2DQDH 3GUTA 4JHBA 3VFMB 4TNVK 4PRHE 3OBAA 4PJAB 3O4OB 1UA6H 2ZP0T 3MLVL 3MRNB 4X7DC 4ZXBD 5FGBC 1F5WA 5ADPH 5D2NE 4KTEH 4UB0L 3VXTB 4G9FA 2P8PA 5E2VH 1JWUB 2BOBB 5SV3A 5EBLA 1SEBB 4HKBB 3HG1E 1MEXL 4M1DH 4UILL 3NCCB 3X13A 3CU7A 4IRZH 2VLJA 5E95B 2DQEL 3BDBA 1B0GA 3BRFA 1TNNA 1CICD 3HZVA 3WYRA 4AM0A 3DI3B 2A1WH 1WITA 1U3HC 3UTSD 1G7QA 2CR3A 1YJDL 1JZ7A 4HKXA 3B9KD 3BP6B 1J8HE 2F19L 3CMOH 5EUOB 1FJ1A 1NFDF 1T0NB 1OP3K 2IALB 2YOCA 4KUZL 2X4TB 3RVTD 3QYCA 3BUTA 1CFNA 2IH1A 2WP3O 1BWWA 4U2YA 4LNRA 1YUHA 3FOMB 3IRZA 4KI5C 3SCMA 3NCJL 3T2OA 5EUKA 3V7AE 1WGOA 4GLRI 2I5YL 2VXSH 3PIQB 2NNAB 2HG5A 5BOZG 3QIBB 3MOAH 3TJEH 1YA5A 4F9LA 3UTSE 3QDJD 4PP1C 3BKYL 4JRXE 4FTVB 4M7ZB 3G9AB 2H2SC 5D7IA 3DGCR 1TJHH 3Q6FA 5DFTA 2ZUYA 4Y1AE 4HGKC 4FXGB 5KSBB 3SDYH 5IJKA 4FZEH 1AI1L 4AM0B 5DRZA 2FEDC 2A6KB 3OKMB 3WLWD 4ODXA 1RZGA 2G2RB 5DGRA 2PO6C 3H3KA 4RAVA 1INDH 4KU1A 2R0ZH 3QDJA 5C0AB 4M8QB 4I8DA 1EFXB 1X4XA 1GGCH 5D7SH 3C6SB 2CMRL 1JIBA 5LAXB 2BZDA 4H5SB 4XT1C 1RU9L 1U8IA 2P5EB 3TPKA 1X5LA 1Z9OA 2AXHA 2NTSP 3QEUA 3PGFL 5B3JF 5BS0B 1BFVH 4APQB 3LDBB 3ZSSA 1T1YA 4WFHD 4MHHI 4ZPVA 5JQ6L 4PREB 5E6IA 3VJ6B 2EXWC 3O11A 4KKAD 2VSCA 4G42A 4L4VA 3B8YA 1UKQA 3JVGC 3K4ZA 4GKSA 4WRLA 3K4AA 1MLCB 2F54D 3B6SA 2EO9A 3HB3C 3FB6B 2ZOLB 3HC3H 4PJ8D 4G8GB 3ARBD 1EEUA 3W39B 3V2AR 4OM1L 4XPHH 2PW2A 3KLDA 5CZXD 1T66C 5C0GA 5DZLA 2E7LC 1ZA3B 2AK4B 1KT2A 4PJCB 2ZCLL 4GW4B 2NY0B 2QQKH 4PJDE 4X8JA 1P4BH 2VB5A 4JR9L 4JQIL 4LAJH 2ED8A 4U1SA 2OSLA 2VC2L 2VL5A 5FGRA 1Z6JT 1F4HA 1BFOA 2VZSA 5GGSA 3R0MA 4ZDHB 2DYPB 3HMWL 4KQ3L 4DTGH 2XFXA 5D4QA 3FQRA 4GRWF 4PRBB 1IAKA 3EAKA 5KVDL 4MJ6A 4PRDB 5TPWL 2M26A 4FRWA 5FHAH 3RDTB 4Y4KC 1F00I 3MRIB 1QACA 4LEXL 4MD0B 3WIFA 2FYYB 3WDHA 4P3CH 3WO3B 1KJ3L 3MFFA 2QBWA 3E6HB 4JEGB 4G8FA 3HNSH 4L8DA 4PGJA 3WNLA 3HE6D 3MLRL 4N0FB 4ZUTB 3RKDD 3GSWA 4ELMA 1S7UA 3W0WA 1EX0A 1WEJL 1GPOL 4CVUA 4WU7A 2AJZB 1DBBL 1YEIH 1ZT7A 4FFVC 4H26A 3MJGX 5EBWA 3OTTA 3OKDA 1RIVL 4AQ1B 1B0RB 5EWIH 3TFKC 1BPVA 3O0RL 4Q74A 2B0SL 4KDVA 1KLGA 3IDUA 1UQSB 3U4EB 3DMMA 4G8IB 3TO4A 3B2VH 2CKBL 4ONHA 1RK0B 1G6RA 3IGAA 2EDNA 5H37G 4O58L 4NO2B 1DQMH 1HYSD 3ZT7A 2GTZB 1CG9B 4ZUVB 2A6IA 3QDHA 5I19L 5I1GH 2DTML 1JPFA 4LKXA 2B7DT 1IC5L 1IC1A 4Y4FC 2A6DA 1HHHB 1UQSA 4D8PA 4LGRB 3U0PA 2P5WB 5DVKA 2LABA 4GBXA 1CGSL 1YMHA 4R7NA 4Q7DA 2Q6WB 3AAZA 5J7CC 4XMKL 4ACPA 3EGSA 2ZWLT 4XP6H 4MHHG 5C0IA 3IU4H 1GHFL 5I71C 1SY6L 1A6AB 3RPKA 4P3DA 1QD0A 1KTDA 1RZ8B 5TQ2L 2NX5D 2OZ4L 3RTQD 1O7SA 4DCQB 2DKUA 4AH2B 1GGTA 4N0FA 2ZCHL 1GZQB 1LO2H 4OLXH 3EYFB 5J06A 3O9WB 4K55A 1FYTE 3P9LA 5CWSB 2D7NA 1JF5A 3D9AH 5C3LD 3MBEA 4M4RA 3HN3A 3FO0L 4H20L 4OZFB 5CEZL 5FM5M 5I8OH 3G5ZB 1JNLH 4KDWA 4OUUA 3RWIB 1U8NB 3F58H 3GSNH 5IFJB 1C5BL 3VRJB 4NO2A 1CICC 3ZHLA 1I9RH 3MX0A 3RWDA 4UT9L 1ZK9A 3T0DA 4PTUB 1XCTA 2Z31A 1E4JA 5EULV 4QY8B 1V7NH 3OSKA 4E9LA 3O8XC 4JPVL 4OZ4B 3SE9L 3GMOB 5FECA 5J3HD 4Z7WB 2WSKA 1GAFL 2CDFB 2QQQA 1LHZA 4X6CF 1Y6KR 3MRJB 3VXNB 3V4UL 5F6IC 3VRJA 4PJ7A 4GW4A 2JJUA 3QG7H 4HDIB 1D5XA 2F58L 1E4XH 3KLAA 3GM0A 4ZS7L 4RGMB 4PB0H 5BOPA 4OGZA 2IPTL 2Y5TA 4J3UA 4TULH 4PB9H 1YY9C 3L7EB 4N0CC 2C4FT 1MRDH 4TUKH 1DP0A 3QH3B 5JO5A 4NQDA 4MQ7A 3BSZL 4JDTL 4L8DB 3A6CH 4O9HH 4DAGL 4OM0H 2DQHL 5I1JH 3EYFA 1MRFL 3CSYA 4HAGA 5BS0D 1MCPL 4KI5E 1IGCL 5J57B 1ZLUK 2E7BA 4H8WC 3DROB 1LO0L 5HSFA 5MENE 3VJ6A 2IFFH 3OKNA 5DJAA 5TE4L 3QCVL 4WI6A 4APQA 5C0IB 2ERJC 1V05A 5F88A 2YPLE 3H9HA 5CEYB 4P5TC 4CL7A 4XNQB 5KZCD 1RJLA 2BNRD 4UU9B 3DBXA 2XYCA 1DUZA 1QKZL 4N0UB 2A6DB 3NFSL 4HC1A 5E9DA 5GGSB 5DSCB 3WD5H 4X98B 3KPLB 2XA8L 3SCMD 2OR7A 4M7JL 1FAIL 5TDOB 1XF2B 3O81A 3KR3L 2V7HA 5DFVC 1AE6H 4N0YH 5HHOA 4WI7A 1YMMD 4U1MA 3T0EA 2CUHA 1MCFA 4P57B 1QBML 2J12B 4GRLA 1K3ZA 4ONGL 1VPOH 1DLHA 1EHNA 4X6CE 5L9DH 1KSRA 2NW2B 3SKUD 4LVEA 4ZO6A 3HUJF 5F9OH 5FM5O 2VLKB 4H26B 3O6LL 1XF3A 1JHKH 5SWSE 5GRWA 1I1AB 4K9EL 3VXRE 3WV0A 1CN4A 1GGYA 4JHAH 4DK3A 1MLBA 4KI5F 2BC4A 3B83A 3NFSH 4TNVF 4Z78A 4YDKH 5TPWH 1FE8L 3O2DH 4M6NL 3UJIH 5DT1H 1XR9B 3P4LA 1CZ8H 3UEZA 4LPCA 2HRPL 5DK0A 1DVFB 5DMJB 1U8IB 4PP2B 5E2UL 5EUOA 2NY3B 4WWKC 1SYSB 3J7HA 3NAAH 4IM8A 1NANI 1RZKH 2PUQT 2DWEA 3ALXA 3QG6A 1ZLSL 4OV6F 2GQHA 4HFWB 2A83B 3H8NA 2J8UB 3PJSA 4MMZC 3WN5A 2G2RA 4ZMAT 3FAWA 4XPBH 4NNPH 5KS9F 2D7MA 1OLZA 2J8UE 3FRUB 4MQXD 2R69H 5J3HC 5IIEB 5EBLB 2PYEA 4J8RA 4AJ0A 3OAUH 3DUSA 4WJ5B 4BM7A 5L2KE 1J1OL 4ZD3H 4U1SB 5C0BA 4PJAA 4CU7A 1FNSH 3D6GA 2MSPA 3EYVB 4F3FB 2GSGA 5DUPH 4JPKH 5D1ZA 4PJCA 5DUBA 3H9YA 5DD5L 1WFOA 1I8LA 1EBAA 3ARBA 5AZEH 1MLBB 4KGJA 4KUCF 4UNUA 1T22B 1QSED 4S1QL 1GIGH 3TWCL 3ZLQC 1YPZB 5H35A 5EIIB 3VGAB 1RHHA 5LXGH 4X6CB 4KXZI 3Q0HA 2FO4B 3CFEA 1F6AA 4RQQB 5DD3L 5T3ZH 4POYA 3DPBA 3VD9A 2XN9D 1NUGA 2AGJH 5HDQL 4W6YB 4N8PA 3P4NB 2BXYA 1P7QA 4PLKC 5F3HB 2Z93A 4PJ9D 3T77B 4MB4A 5JORB 4LHQB 4HKBA 2L4OA 3GMRA 5DJ0B 3U7AA 4S1DD 3QDAA 5ALCL 4X6BA 4TNWK 3BPNC 2VDOH 4XVJL 5T1MA 1QQDB 4AEHL 1OAUL 2RFXA 4HHAA 3B4NA 4RBPK 5DJ0A 1VCAA 4P9HL 1TPXB 1KCLA 4RAUA 3AB0C 5D8JH 3MLTB 5DEFA 2OTWA 4M5ZL 3BN3B 1D5MA 2FJGA 4K8RH 4TUOA 2VABA 4XNXH 3U7YH 4JZOB 4KJWC 1EXUA 1EJOL 1QFPA 3UYOD 5L7XH 2BRRL 1KACB 1ZVSA 4Z7OE 4POZD 3QXDB 3QG6B 4BFEA 2DQCH 5KSBE 1BBDH 4MAUH 3VXRD 3PWJA 2BOCB 5ANME 3CPLA 3V4PH 4BK4A 1FH5H 5DJYB 3DOSA 3O2WH 4LCCA 1A7QH 4KROB 2W9DL 4NIKB 4HWBA 3QH3A 3BX7C 3VI4F