3QNXB

Orthorhombic form of human iga1 fab fragment, sharing same fv as igg
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
219
structure length
219
Chain Sequence
b'QLVESGGGLVQPGGSLKLSCAASGFTLSGSNVHWVRQASGKGLEWVGRIKRNAESDATAYAASMRGRLTISRDDSKNTAFLQMNSLKSDDTAMYYCVIRGDVYNRQWGQGTLVTVSSASPTSPKVFPLSLCSTQPDGNVVIACLVQGFFPQEPLSVTWSESGQGVTARNFPPSQDASGDLYTTSSQLTLPATQCLAGKSVTCHVKHYTNPSQDVTVPCP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab fragment of IMMUNOGLOBULIN A1 LIGHT CHAIN
publication title Structure of a human IgA1 Fab fragment at 1.55 angstrom resolution: potential effect of the constant domains on antigen-affinity modulation
pubmed doi rcsb
molecule tags Immune system
total genus 43
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2011-02-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qnxB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qnxB02
3DUSB 2IADA 2ARJQ 1NCBL 1F00I 4ODTL 2P5EE 3J8F7 1N6QL 4OJFH 5EO1A 5L88L 1JI2A 1TZGH 3S3PA 2E7BA 1IGTA 3VFTA 5IBLD 2F74B 5CJQH 4HK0B 2A6JA 4LDEB 1FNSH 1NCTA 3V5KA 1BBDL 2VO5A 3IU3A 3B9DA 1JTOA 1XGYH 3JTSA 2P42B 2X40A 2NY0D 2R0KL 2YD8A 1F4YH 1TJHL 5DJ2A 5FO7B 1G7MB 3GMLB 1U8MA 5DD5H 3LIZL 4PGBA 4J2XA 1OSZA 1KCUH 1I7RA 2OTWA 4AZ8A 2OXGA 4ZNCD 3TESA 3BHBB 1ZHBB 3RJDA 4I0KA 2DQDH 5DJDA 3QULB 5MEND 4ZSOE 2ICWJ 1CGXA 4XB7A 1NGYB 1YEIH 5HPMB 4UU9A 5DGRA 4AIZB 4GW5B 1QQDB 3NFSH 2P48B 3V7AG 3ULUL 2KUTA 2DQCL 3TT1H 3HUJB 2CMRL 3QCVL 3DETC 1QLFB 3G5VA 4HBCL 5GGSY 1OARH 3AVEA 5IV2B 4ALAH 3VFUB 5C0RH 1W72L 1C12A 3IDJA 1AHWA 4UTAH 1JHTB 4PJ7A 4ZDHB 4K3JL 3H42L 4Z8FL 4JM4L 1F3DJ 5SWZB 3FCTA 4MQXD 5TJWK 3IAPA 4R4BA 4I3GA 3OKEA 1KOAA 1MAJA 4PRHB 1E4XL 1HYSD 2AJXL 2YK1L 1AIFB 2V5TA 4CU6A 2XOTA 5AYUL 5C3LD 4R4ND 3M17B 1I1FA 1JPST 3HA0A 3TBYB 1A6TA 2Q8AL 1MFDL 3GMRA 4MB4A 5CMAB 3VWJC 1KXVC 3TEUA 5CZXC 1H3UA 2N1KA 3GMOB 2C3WA 1JZ3A 3QQ9D 2A74B 4KU1A 5EH1A 2F19L 4J4PC 1INQB 2J6EH 4JAMA 4PLNC 1UXSA 4XCYA 4P0DA 1FYTE 3MLSH 2J5LB 3TLRA 3V52L 4ZFGH 4NQXB 1DQDH 4F7PB 4JDZB 4M5ZL 2IPTH 5L2KD 3F8UB 1U8KB 4D9LH 1TJIL 3RVVD 4OSUH 3QCUL 1K6QH 4LSVL 3CFEA 1JGLH 3D85B 1WCBA 4UQ3A 2ZJSH 5JLZB 1KT2A 3TVMC 5SWZD 5F1SA 2NX5D 5J56B 3PL6D 3QDMB 5D96C 5HHQB 4I77L 4QY8B 1KF9B 4WVRA 4Y4FC 5F9WB 1TNNA 4MXQC 2EE2A 5DI8B 3ZT7A 4E41E 3KXFA 4HFWB 2GAZB 3DX7A 3MBXH 5FYLH 3H7BA 3EYFB 4OIBA 5I1CL 4X8JB 4YPGB 1FC2D 4NWUL 3O3AA 1QKZL 3TBWA 3KYMA 4HMDA 4PJIB 4JR9L 2X70B 3EUUA 1D6VH 1K4CB 3CDGA 2HLAB 4HXAL 4L3CA 3LPGA 4KMQA 1RZGA 4FFYL 1IAKA 4X6FA 3GO1H 5T3XH 3TO4B 2IFFH 35C8H 3MLWL 4OFDA 4QGTA 3JWDL 3P30L 5C08B 4M6NH 4GQPH 1FPTL 3LH2L 1KEMH 2QKIB 3B9KC 3EW3B 2VLRB 2M8XA 2A9NH 4NQCA 4ZAKB 3NCCB 2W9LA 5EOQH 3D85D 5H2BB 1Q0YH 2DL2A 4I0PB 3HI1B 1FO0L 1BVLB 4OLUL 2LAAA 4WI2A 4ONGH 4Z95H 1A3RL 4GFTB 5D5MA 1SEQL 2Y9RT 4K2UH 4Q6IA 5KVMC 2ZUSA 1LEIA 2DI8A 4TN9A 1X4ZA 4GKOA 3WUZA 4DZBB 1MCEA 2WANA 5I1HL 3CNKA 3OF6A 5DHXB 1HINH 1KJVB 4XBGB 1CGSH 3QRGH 4Z77A 2D4DA 5AD0B 1R5VB 3O3UN 3CFBB 5CHNB 2ESVE 2AV7B 3C6LC 4JPWH 3LHPL 1MIML 5IHUH 5BXFA 3BDBA 3OTTA 3INUL 1TJGH 3O6ML 2VZVA 4HS3B 5JA8B 2VITB 2NY5L 5C08D 1ADQA 2IALB 5C0JB 5F88A 4ZAKD 3BZ4A 1JGDB 1OTUD 1E6JL 3SDCB 3ILQC 1OVZA 3QI9D 5GS0H 3T4YA 2AI0H 5IB1A 2Z31B 4I0PD 4PPTA 2OJZL 3QUMH 1MPAL 2Q6WB 3OJDB 4PJ9A 5HVGB 1F3RB 2CKBL 4BFIA 1XIWB 5C0BB 2XWBB 1LP9E 3B5TA 5BZDB 5DJZB 1DQJB 1JRHH 4YE4H 4HUXA 4OV5A 3QHTC 4L8BB 4U1HB 4OQTL 3M07A 1ZA6B 4FQHB 1P4LB 5J13C 4P2RB 3PV6A 2VDQH 2CLVA 1A47A 4NHUB 2AEQL 4XPTH 3IGAB 1ZHKB 4PJ5B 4WU7A 3M8OL 3WNPA 3FB8B 4WTWA 4YFLF 3Q3GB 3SDAC 4LMQE 4MA8L 2QEJA 1UA6H 5E8NA 2X1XR 3DSFL 4O02H 3V4PH 1EGJH 1OTSD 4UILH 4PRIE 2A73B 4LF3B 1K85A 1CFSA 4HS6B 3B3IA 1AFVL 4LKCB 1I9EA 4APQA 4POYA 3T1FB 3HHRB 2ATKB 3IDXL 4LSRL 4Q2ZB 3RIAK 3EDDA 3T2NH 1DJSA 2XFXA 1IC4L 3H3PL 3BZDA 3TNNA 4PTUB 4F9PC 3H9YA 4WFEE 1RZKH 3NFNB 5IB4A 3C5ZD 1BX2A 4KRPD 3DBXA 1MRCH 4ZUUB 1XIWD 5C0BD 2OTUA 1A1OB 1LP9F 3DURB 3WKML 1S9WA 4GQ9L 4KJYA 4L8SA 5GJTL 5AG8A 2OK0L 1HIMH 4KKAD 3OKLA 1E4WL 3VE0B 4P2RD 4JHWH 4GXUM 4EI5A 4K94C 4L9LC 2CLRB 4HIEA 5SWSB 1IEBB 4JZNA 5KW9L 4PJ5D 3O81A 3QO0A 2BJML 5EC2A 1FLTX 5CD3B 1RUAL 5CGYC 5DDHA 1I3RB 1FFRA 2YUVA 2H45A 3GI9H 1EFXA 1C7SA 3GUTB 2GTZA 5EOTA 2Q8BH 3MJ8B 4Z7QE 2ADFL 4KMTH 5T1MA 2H1PH 1G7IB 2AQ1A 2J12B 3QP3A 3ZKMD 1RUKH 3CLEL 1IQDB 1GZQB 4XCNB 3RHWF 2BNQB 2DM2A 2FGWL 4WFHE 2FHCA 3L5WB 3OJVC 4S1SH 3L3JB 5JIPA 3MOBL 2EE6A 3D25B 3AB0C 2Y6SC 3GSUA 2DQEL 43C9B 3S97C 1N59A 1MCFA 5GGRB 3TZVA 2NY1D 3VXUE 1K3ZA 1Q1JH 1MFEL 4MAYC 3W11D 3TH4T 4ENED 2FB4L 5DVKA 5AEAA 1NC4B 1FNEB 4QRPB 3KS0H 3QJHB 5M94B 5EU7C 5SWSD 5GZOD 2NY6D 4PGDB 1C1EL 5EO0A 4TUJA 2Y06H 1J05A 3ARBC 4PP1D 5F1NB 3IDMB 3VWKA 2EC8A 3NZHH 4Y7MA 5FGRA 3RWJB 4J7RA 3BIBX 2X05A 3HI5L 2BVUA 4WI9A 4LCWE 1EHLH 3RIFK 3CK0L 4Z7QF 5ISZA 1RIVH 4BELD 2NTSP 4Y19B 1A7BA 3EFFA 3GHEH 4G5ZH 4GOSA 3MLTB 5TQ0H 1YQVL 5C0CB 3T0DA 3P11L 1PX4A 4PG2C 1L9NA 1RFDL 4M1DH 4R96A 4XHJC 5KJRH 1FH5L 4R2GC 2EEBA 3N9GH 5GSVA 5JOEA 5E9DA 5GGTA 2ADIB 4Z7VE 3FN0H 4Y2DD 5ENWA 1ED3B 1RZJH 5FA3B 4QLRA 4Q6YA 1CDIA 5E03A 4KUCF 4O2CB 3HE7B 4H20H 4WFFD 2AK4E 1G7JB 1BQHA 4Y0GA 4JM2C 1BP3B 4GAJH 5BOZG 2H9GB 4JB9H 5D2LB 5C7XH 4HEME 3IF1A 3O4OB 5D7JA 4YXLH 5E00B 3UTSB 4DN3L 5E8DH 1V05A 2AEPH 3JWOL 2FR4A 3VW3L 3OSKA 5FYJD 2ZOKA 3SE8H 3KLAB 1BZQK 3SO5A 1DVFA 2DQHH 3UAJC 2I9LA 5C0CD 3GSWA 3QQ4A 3MRDA 2D0FA 2D7MA 3QXDB 1U3HA 3RPIA 4Z7NF 4K3EH 4LK4A 1KJ2H 3HI6L 7FABH 2FEEI 3LEYL 5TDPA 4DQOH 3S6CA 4P9HC 5JIHA 1AGCA 4KTEH 1UQSA 5IW1A 2JCCE 4BK5A 5KTEH 1ZS8A 1G1YA 4IRSB 1OAYH 2F53B 3BYTA 4GG8A 3GSNL 4G8GA 1ZANL 4M6AA 3OG6B 4LHUG 4X8XA 4KK8C 4WNQB 3HE7D 2A6IA 3FOMB 3CVHH 1VESA 1F4WL 2XZZA 2D7QA 4JN1H 2BDNL 3GRWL 4PJDE 3GMPA 2KDGA 1S3KL 3BAEL 2Y4SA 1TCRB 3UTSD 2JB5L 1CFQB 5E2TL 5TPWH 2FD6H 3MA7A 3FT2A 1BLNA 1EDQA 4HKBB 5IUSA 3RY6C 4WWKC 5CLWA 5D7LB 3RWDA 4NPYA 1WGOA 2Y72A 2VXUH 1SJHB 3K8KA 5HDQL 5F9AC 5EUOA 4R7DA 4YBQD 2IBGA 3DTXB 4BH8B 4WW1B 2HJFB 1XF5B 3BP7B 2FJFA 4LNVA 4EQ2A 1S5IL 3UTTA 4J1UA 2JCCF 4Y4HD 4PTTA 1G6RH 4G3YH 2F53D 4XC3L 3UCRA 1W72B 3SY0B 2H2PD 4LSDA 1Q0XL 1CCZA 3SCMB 3FOLB 5AZEH 1MNUL 4H0IA 4K55A 5BVPL 1BJMA 3VDCA 4ODSH 3REVA 1PKQA 2PF6A 3MLVL 4RFOL 1E27A 1JWMB 4OQ1A 1F13A 3MRNA 1U93A 4PJDF 1L7IL 4Y1AA 1I75A 3Q5OA 4AY0A 3ARGC 5EIIA 5EFIB 5MERB 3QDGB 2ZUUA 4NJAH 2R15A 1A4JA 2NXYC 3LV3A 4L4VE 1MUJA 1DANU 1DBJH 4U7KA 5D7LD 2X1PA 4OM0L 3LRSB 3EOAB 2VQUA 2X4OB 4PJBB 5A2IH 4RNRA 4PJHA 1WK0A 5KS9B 1MAMH 2NLJA 4NZTL 4TULH 3F7QA 5C0IB 4EUPB 4OKVA 5DUPH 3D9AL 3SDDD 1KTLB 4I18B 3EOTH 4IS6B 4TRPL 3ULUD 1L0YA 4P3DA 3ARQA 5E2JA 1UJ3B 5K9KA 1HZHL 3NACH 4J4PA 4M6OL 4NM8L 3E3QC 2FJGA 4P4RA 1EV2E 2BRRL 4XMPL 3B9VA 1FE8L 1UXWA 3SCMD 3FN3A 3O11B 3QH3A 5DK0B 1V3MA 1U6AH 4NOBA 5IMMB 3VRJB 4KDVA 3EYQC 2GJ6A 3FRPG 3QDGD 3MNVA 3SBWC 2P5EB 4YDIL 1FVDA 2HH0H 4GW4A 1BIIB 4ZTOH 5AZ2L 1I7UB 4HJGA 2A1WL 2LFGA 2PUQT 5AUMA 4Y4FA 4DGVL 5I73B 3ARSA 1EMTH 1DDHB 4NKOA 3TN0C 3OQ3B 1QRNB 3M1BB 4GMTL 4GO6B 3WL9B 3IDGA 4LSPH 2G9HB 4OT1L 4XPAL 3HR6A 3I2CH 3U0WL 5DS8B 5E4EB 4MA1C 4XP1H 2NW2B 5DEGA 4R97B 4IJ3B 3BJLA 4R26L 4G9FA 3BP6B 1X6LA 4EEEA 5IW6B 2DB8A 3O6FB 4HGKC 5HYFA 3C2AL 3UC0H 2PYEE 2O26U 1KB5L 3KYOA 5CWSA 3UJIH 5IF0A 4M03A 4JFFB 5BS0A 5DC4B 3O41A 5IHBA 1F3JB 5KANI 4OGAC 2J3SA 4U1KB 1T7YA 4OD2A 1YEDB 3C8DA 1FO0B 4I2XA 1LD9B 3UO1H 1CD9B 1T2QL 1OWWA 5E4IA 3R8QA 2P5ED 4OUUB 5IB2A 5ESAA 1WSST 5GZNC 4PJ8B 1N7ML 3G5XA 5DUBB 3FT3A 4L5FL 4JO1L 3SQOL 4PB0H 1KPVA 1QBBA 3PWLB 4G9DA 4KKLD 1JGEA 1UM4H 1JFQL 1JF1B 2VOTA 1QSEB 4M4PA 2ITCB 3EYSH 1WQVT 1KLGA 5CKGA 3BPLB 4FXKB 3C6LA 2AP2A 4HX1A 2F58H 3LB6C 4EI6A 5DRZA 4WV1C 1IAIL 3ZTNL 4QRUA 1I85A 2IBZX 3WIFA 5IMLA 2CUIA 1Z0NA 5DEFA 3LS5L 3DRTB 3MLXL 4JFDB 2AERT 2HG5B 4WHTA 5CEZH 2EXYD 1LK2B 2YUZA 2Y7QA 1IGIL 1EHAA 3GMQA 4HUVA 1FYTB 4FQLH 4Q9QH 3RJQB 1M05A 3PGCA 3QXUA 1A9EA 2CKBB 5DJXB 2DQFB 4NGHH 1M6OB 1ZT4A 2BC4A 1ZVHA 3QDJA 4JN2B 3MREA 5D1QB 3OX8B 4P4KD 1DTUA 1G7HB 4PJ8D 5H37G 5BVJA 4ONFL 1DUZA 1V8HA 4X80L 1F42A 2CRIA 1AD9A 2V2WA 3CH1B 3QUMA 2D3VA 3BUYB 1FZJB 1FFNA 4CN4A 3G9AB 3R06B 3U46B 1QSED 5ABDE 4XNUH 5ADOL 1EUUA 1BM3L 2B39A 1M7DA 1NFDA 3O6KL 4HC1A 1NCDH 4WI6A 3ARDD 4TSCH 4Z7UB 3MLYL 4P9ML 2VWEC 4PGEB 3H9SB 3LKRB 4PLJD 2V5SA 4P57B 5EU6A 3TO2B 5EC1A 4JFDD 5ADPL 3QNXB 4TSAL 3HCVA 4MVBC 3O2WH 1FYTD 2A6DB 5J1AA 3ARED 1EGJA 3G6JB 1W8NA 4GXUN 4FTVA 5L7XL 5F6HI 1DUYA 5K9OB 4P2QE 5DA4A 4LPXA 2ARWA 5D1QD 5FYKE 2BSSA 5F7WC 5D7SH 1CFNA 3VRLE 5KSUB 4NQDE 3L7FB 1ZV5A 1C5BH 4PJCE 4V1DA 3WE6B 3Q48A 5J6HA 1S5HB 1RULL 5F6IB 1JNNL 4HWEH 5GS1C 3ZL4H 3MBEB 3WXWH 2O5YL 2V7NB 4WUUB 5HY9A 2R1XB 3IXTB 3W82A 4XTRD 4E41D 4LCIH 3VMPA 3OR7B 5TDNB 1G7PB 4HQQH 2GIYA 4IBLT 5FECA 5E08L 1D5XA 2NCMA 4YR6B 3H9SD 2HVKA 2DL9A 2VKXA 2APVA 1F6AB 5C07A 5FB8B 3BE1H 1AE6L 2E27H 2WWMD 3MPCA 4QXWA 2ESVB 2HT3C 4KJQD 3P0VH 1VA9A 25C8L 3GBLA 5IOPA 2EYRB 2Q7YB 1CLOL 1NDGB 1QBLH 4KUZH 5TGBA 4NKIL 2CDEB 1VHPA 1CVRA 4U6HB 1VDGA 4R8WL 1UWXK 3OPZL 3N1FC 4YHNB 3VRLF 1NCCL 1NL0H 5JPNA 4OB5H 4PD4K 4MAYA 1X5HA 5E2UH 3PWUA 1QFWI 4YHZH 3MBED 1GC1C 1NDMB 1QSFA 3GIZH 5B38B 4WUUD 1WCQA 3LZFH 3ARBA 4D8PB 1JF6A 1P5UA 1CTNA 4XZUA 5D1ZB 5ACLA 3VG9B 2LTQB 3O45B 1CWVA 2B1AH 5J12B 2VZ3A 4HIHB 4PJ7E 5ICXB 5F96L 3C5JB 3FN9A 4CMMB 2MQ0A 2H26A 4OV6F 4QNPE 2YD1A 3RVUD 5EORH 3VGGA 4LCCA 4D9RE 1WJ3A 4JPVL 4OF5A 2ESVD 1NMAL 1YNKH 3WFEL 4AH2B 5IJVB 2NY3B 5B3JF 5F3HB 1YYLL 5BZWB 1JHKH 4M7LT 4PRIB 4RX4D 2ARJB 4WENB 3D0VA 2WUCL 3RWCB 4ETQB 4HWUA 3DX8A 1HHJA 2DYPB 1B2WL 3WLWD 4NZRL 2FX7L 4X6DF 5CJXA 2H32B 3T77A 2WINA 5ESVB 5FK9A 3X17A 4JZJC 5DQDL 4LLUA 3KG5A 2VL4A 1ZHNA 3GFUA 3VG0H 1I9JL 4JM2A 4XPHL 4G6ML 5IMOA 1J1OL 1A2YB 1YY8B 4MNHA 3MRIB 4G7YH 1EEQA 2G75B 2CGRH 1QVOB 4IDJL 1ND0A 3MFFB 2IG2H 1I3GH 2DJSA 1WTLA 3OKKB 1UVQB 1T04A 1LO3L 4QNPF 1SEBB 5BJTB 3BKJL 3HPJA 5D4QA 1VKXB 1ZXQA 1NBYA 1CDUA 3DV4B 4JKLA 4M1GL 1WIUA 5DD3L 4BSWB 3REWB 3WIIH 4GRWF 1IGFL 1D5ZA 1KFAL 2VR5A 1NLBL 2NY3D 4F2MB 3KXFE 2PXYB 4RFNC 4PRID 2CDFA 3E6HA 1JWSB 1CK0H 2XA3A 1Q94A 3LKNA 1OGAB 5FF6A 1X5JA 3PABB 4NNXB 3LKQA 1DN0A 5DHVA 1IBGL 2PTUA 4NRYA 4DFHA 3LKSB 4ZFZB 1MCCA 3KDMB 4BQ8A 3LQAC 4MS8C 4LHUA 3STLB 3UZQA 1T1WA 4NQCE 4WY7L 4I9WE 2ORBL 2IQ9H 1F8TH 4M02A 2C1OB 5DUML 3QUXA 1BJ8A 4KFZC 4HF5L 5DR5L 1AQDA 2CUHA 2IANB 3BGFC 3T0EB 3ARVA 2FYYB 1H8OA 1P84J 2NXZD 3MV7A 1WEJL 1WICA 1R3HB 5I19L 3P4LA 1A5FH 4GSDH 3EYVA 5FUZH 4OCRH 4HWNA 4ZS7H 5D5ME 3UJJL 4C59B 5JIKA 1JZ5A 2FH8A 5HYSB 5IHZB 1MRDH 2WMPA 2N56A 4YDVB 4JLRB 2A77L 3FQXB 5BRZB 1GCFA 1NANI 4YXHL 3NH7H 4RGOL 2FEDD 3GMNB 1R5WB 2OYPA 4FNLH 3PWJA 5SX4I 4DGIH 5GRZA 5JW5B 3MTRA 3SGEH 1JGUH 3QFJA 2OZ4H 3BH8A 1D5MB 3VCLB 4R0LA 1TZIA 1XF4A 2P49B 3TIDA 5MEOA 4X4XA 2EO1A 3MA9H 5B21A 3U7WH 1FGVH 3BZEB 5JORA 4LCYA 3U0PB 2DWEB 1SHMA 3IU4H 1OSPL 3MMEB 3MRMB 1FNAA 2BERA 1OAQH 4HJJL 4NO3A 4G43A 2AK4B 2FATL 4U1MB 2CK0H 1BAFL 1OL0A 4RMSA 1HNFA 4U1NA 4MA3A 1FZMA 1CL7L 3LMJL 1V3LA 2ZSVB 4AQ1B 4ODXA 4LCWD 1DQMH 3LN5A 2J4WL 2XWTB 3RGVC 3MX0A 5D5MF 4LLMB 5CINL 5EBLB 3QA3A 3ZHLA 3W0WB 3WLBA 3MR9A 4YPJA 1KPRB 2O5XH 4TVPE 1HXYA 1ZEAL 4N90E 3JTTA 4NNPH 4J3SA 4BSVB 2BSRA 4J8RB 2VXSL 1HHGB 3CDYA 2EDYA 3NFPA 1FVCB 4NFBA 5IVXA 3TIEB 1EFQA 3ARFB 2QQKH 4HXBH 4OLEA 5JNYA 4IRZL 1CFBA 1JPTH 1L4IA 4HAGA 2G60H 5F7UA 5GS2H 5C0FA 3ECBB 1B0RA 4MJ6B 2VR9A 1QO3A 4NJ9H 4KROB 1GGBL 3SBWA 3BGAA 4J23A 2AK4D 1A6ZA 4QT5A 3OHXB 4GRLB 3D2UA 1YMHB 2MNUA 4XC1H 1H9VA 3C8KB 2IF7A 4RZCB 3FRPA 3HPLB 4NC0B 3ARRA 4ZXBA 2FX9L 4X7SH 1CYGA 1F2XK 1KTRL 3I50L 4Y4KB 4TOYH 1HI6B 2WIIB 4CKVX 3CSYA 4BQCA 5HHNB 4JY5H 2DQGH 3C9NA 4AEIL 2IAMA 2V2XA 3GKWL 4KQ4H 3W0WD 3WN5C 2FL5B 2OR9H 3C60B 3KR3H 3V0WL 3KPPA 3MLZL 2E8YA 5D7KD 3RNKA 3V5DA 4OFKA 1WT5C 1KB5B 5KSAB 4TTDC 1KELL 5IK3A 1F4XH 3UYRL 2IQAB 3S96B 2DM4A 3IFOA 4JO3H 2R29L 3O9WB 1YJDH 5I8KL 2R2HA 1P2CB 3O2DH 5FYJH 1G9NH 3ARFD 4ORZC 1S7WB 2DIBA 1ETZB 2HFFB 3V6ZA 1K5NA 2RIKA 4N1CA 2BVQA 4Y5YB 1WF5A 3AC0A 3RWGA 4XVJH 4KROD 4ZOBA 4LPWA 2R4RH 4YAQB 5E5MA 4ZUVA 4GRLD 3K81A 4Y5XC 1OWRM 4YC2C 4E0RB 5CAYB 1NFIA 2LV4A 2P7TB 4MD0B 4RGNC 5C0NC 4ACPA 2PO6A 1S9YB 5F1OB 3LSOA 1A7RL 1MEXL 2I25N 1A1NA 2EH8H 1S78C 3DARA 2QV2A 1T21A 4Y4KD 4YHOH 1ADQL 2Y23A 5HGHA 4O58L 1CT8A 3HZKB 1XAUA 1XF2A 3C60D 1LDPL 4LOUC 2ATPA 3L3KB 4OCYL 4Y5VC 1AP2A 3NCFB 4OZIE 3D3VA 3ULVH 4WV1A 1CN4A 3FJTA 3RDTC 4F7EA 1CTOA 3L6FB 4AL8H 1NGPL 1AGDA 4OFYA 4WTZG 5KANG 2GY5A 4EIGB 2XWJB 4MXWH 1WWAX 1S7TB 4CNIB 1QTYT 5IM7A 2YPKA 1E28A 1JZ7A 1J86A 2HJLA 4HJ0D 4M8QA 4V2CB 4GRMB 3VJ6A 2FSEA 3CJJA 4WGWB 4PLKD 4HEPG 5C1MB 5LGJB 1QBML 5DTFB 1OM3L 3RTQB 2Q87A 2X09A 1RURH 3BIKA 5E7BA 1WAAE 3HNSL 5E9DE 2FJHA 4QRQA 5D70H 4LASL 4UIMA 5DD1H 2MHAB 5IVZB 4GT7A 1DQQA 1I4FA 5EIQA 4ODTH 1E4KC 3P4NA 5C9JB 4Y16C 1XR8B 4Z76A 1N6QH 2WNGA 3UJTL 3ARPA 4PJAB 3HC0B 4OZIF 5JDSA 4AEEA 4YGAB 2VIRA 5KSBF 1BBDH 1L7TL 1P53A 15C8L 1MIEL 1RK1B 1VFMA 3DROA 1MHHB 2R0KH 1TJHH 5F3BB 2R4SH 4QWWD 3LIZH 5TH2B 4XPGL 3GSOB 1G9EA 3VGBA 2FH6A 5IIEB 1BD2E 2Y1VA 4QOKB 5DLML 4HK0A 3EHBC 2DAVA 1PSKL 1TVHB 5HGGS 4AEHL 3QXAA 3PJSB 1GYAA 3QFDB 1OP5H 3K3QA 3WNMA 1WAAF 3TJHC 4B41A 3ZKXB 4OFPA 2IMNA 4RMUA 2DQCH 1BWMA 2ADGB 4QTIL 2CMRH 3QCVH 4LRIC 1OAKH 3D0LA 3E6FB 1CVSC 4LLVB 1HILB 4HBCH 3BHBA 1ZHBA 5GS1A 1MJ7H 1FNHA 1G9ML 3QULA 1W72H 3G6DL 4CU7A 4RFEA 4XH2A 3QIUC 3JWNC 2I07B 1JHLL 1V3KA 3H0TA 5HPMA 4HLZG 3ESUF 4AIZA 3B83A 3U6RB 3H42H 4Z8FH 4JM4H 5GGQL 3RVWD 2YUWA 4DCQB 4XNQA 4M48L 1QLFA 4JQIL 1JPSL 2IEPA 3S98A 4NBXB 4HKZA 3MSPA 4EN3D 2YK1H 4HUUB 4YHPA 1V7NL 5AYUH 4XXCC 2AJYL 1UM6H 1AD0B 5J6GA 3VGAC 4QOKD 4WW2B 2PYED 2Q8AH 1PGRB 1MFDH 1TVDA 5B22A 1F6FB 1FL5B 2VUOA 1BPVA 1M71B 3RGHA 3MV9A 4PRHA 2AAVA 4EUPG 5IVNA 1DLFL 4LEXL 5A2KH 3B8YA 3I3DA 4MJ4A 4MMXC 3M17A 2OS7A 3V52H 3RA7L 3TBYA 3L3OA 3MGOA 3ZE2F 3OR6A 1WWWX 4KRNA 4M5ZH 4B7IA 3WS3B 5FO9B 4ZO7A 4TUOA 5JIIA 2JB6B 3QCUH 3GMOA 4G8FA 1WZLA 4K7PX 4LSVH 2A74A 1RK0B 3QUYB 2YS4A 5GGTL 1CQYA 4IRJC 5I1JL 4YDKH 4UAOC 4EXPX 4JZOB 2F8VA 4OBRA 4Y1AE 5DURB 4I77H 4JDZA 5EZIL 4DTGH 5FYKU 1N5YL 3WFZA 1KCLA 2P8LA 4X7FC 3HNTL 2VAAB 5I1CH 1X5ZA 2FBJL 4F7TB 1NGXB 1PG7X 1QKZH 3VH8G 4PJHE 2DQTL 4JR9H 4S2SA 1SBSL 3QDMA 4Z18A 3RWIA 4LSUL 3ZKND 1HXMB 5HHQA 4MJIB 1AR2A 2VN7A 4HXAH 4IOFC 4HFWA 2HA1A 4XBPB 4Q9RL 3IVKB 1S7RB 3MLWH 3EYFA 3JWDH 1T1XB 3P30H 4YPGA 4F37K 4ZG1A 3LH2H 2PYFA 4ZPVB 3QYCA 4M6ML 4NN5B 1T5WB 4J3VA 1HWHB 1JZ4A 1YEHL 3DO3A 2HLAA 4FFWD 4F8TA 2UWEB 2VLME 5C71A 5JW4M 1C5DA 2OQJB 4OF8A 3UXFA 3VXPA 4ZUSB 1J8HA 3TO4A 1BEYL 1FO0H 5EU5B 4OF6A 4OLUH 1MCHA 1X5IA 3MLUH 5DURD 2IADB 2OX5A 2VLRA 4J3WA 5IGXL 4KGJA 1CICC 4HIIB 1MCKA 5FGSA 5EO1B 5E6YA 5H2BA 4OI7A 1IGTB 3DHMA 1A6VH 3W2DL 3BEWA 4NWTL 4I0PA 2A6JB 2W38A 3V5KB 3JTSB 5BV7B 4MJID 1I1AD 3CIQA 2RQ8A 5A16A 1YUHA 2JJUA 1BZ7B 3LHPH 1MIMH 2WW8A 2XA8L 4G9FE 2NY4B 1GOHA 1OF2B 5FDWA 3S9DB 3EYUH 3INUH 3O6MH 1U8MB 4JQVC 4PJFF 5D7IE 5FYLE 4DZBA 1U8OA 3HE6D 4PGBB 1EJOL 4P2QD 2OTWB 3RI5F 3BW9A 1T66D 4M1CD 4XBGA 1KJVA 5E2WL 5AD0A 4NQDD 1LEKA 1S9VA 5HGAB 5BS0E 3SDYL 4XRCB 3MRBB 4UU9B 1WC7B 4MNGB 3VXNA 3FO2B 4G8EB 1MPAH 1RMFH 3S7GA 4MXVF 2D4FA 2CKBH 3G5VB 5CIPA 5C0JA 3MYJA 3VI4F 2DQDL 5F7FA 3HMXA 1C12B 3SDCA 3VGEA 2HT2C 4OQTH 4PJ7B 2VL5B 3GSXB 3NFSL 3S36H 5IW3A 5L9DL 2Z31A 2AEQH 4YO0B 3QIBB 2VZSA 3FCTB 2HKHH 3D69B 1G0XA 3OJDA 5IWLC 4RCAA 4OLZH 1GAFL 3M8OH 2ERJC 5BZDA 3OKEB 1SBBA 1SQ2N 4ALAL 2XT1B 2NYYD 1TZHA 5KOVC 1R6VA 4MA8H 1FN4B 5BCAA 5D7IF 3DSFH 1FSKB 2P5WA 5MHSE 1P4LA 3ZYIA 1DEEA 4JRYA 3ULSB 2I24N 3IGAA 1NKOA 2ED7A 3GMRB 4MNQB 4PRAA 3IDXH 4LSRH 2OZ4A 3HC3L 3GJFK 2BCKA 3H3PH 4ORGA 4JAMB 2J8HA 1UXSB 4OZHA 5TE7L 4LQ1A 2Y5EA 4LF3A 1R5IA 5E6ZA 3WKMH 4YBLC 4LSTH 4LBEB 3R1GH 3QDJE 3TNMA 4GQ9H 4RAHA 1BJ1J 2HLFC 4P23C 2OK0H 1E4WH 4ODVH 3RGVA 3BDXA 3MV01 3ZDXE 1WCBB 4UQ3B 4RDQG 3HRPA 4RIRA 3E1F1 5KW9H 3MFGB 2BJMH 1KLFA 4D9RD 3MLSL 4B50A 4EDWH 1RUAH 1PD6A 1RU9H 3LD8B 2DLIA 1DQDL 1CFVL 3EJYD 3PDGA 1NPUA 2IPTL 3BQUB 4DEPC 1NFDE 1TQBB 2ADFH 3DX7B 3VE0A 4KK9D 4NFCA 1MCWW 1MJUL 4LAQL 3TBVB 3H7BB 1JGLL 2CLRA 32C2A 4ELMF 4LHQB 1IEBA 3HZVB 3CLEH 3O3AB 3TBWB 1H3GA 5CD3A 5EU6E 3SHSA 4NQEB 1I3RA 3OAZK 2FGWH 4NHCL 1BOYA 3CDGB 5GPRA 5B4MC 1JYNA 3MOBH 3MJ8A 4L3CB 2DQEH 4B7LA 1RZGB 1IAKB 3WBDA 4X6FB 4FTVE 1WUNT 2VISA 2VLJA 4M93C 3RIAF 5HYJB 5ACZB 2F5AH 2OLDA 3FONA 3QXVA 4XCNA 2GW5A 1KB9J 2BNQA 3CMOL 1NGQL 3L5WA 5I15L 3AS3A 3OMZA 2FX8L 1ZKAA 3D25A 4V1DE 43C9A 1H3XA 1RUML 4P5MA 3WN5A 4UT9H 43CAB 1C1EH 1V7ML 2YPLA 5GGRA 5HDLA 3RWEA 4M6NL 3HI5H 1KEML 2A9NL 1SMOA 2JJTC 3MGTB 1FFPA 4TQEL 1NFDF 3KXFD 5EOQL 1IKFL 3T2OA 1NC4A 4Q6IB 4QRPA 4JFYA 1LEIB 2EDJA 1YQVH 2C1PB 3FQWA 1PZ5A 1RFDH 2DLGA 4L29A 2F54B 5F1NA 5C07E 5CBEA 3ZHKA 5HD8C 4Z77B 1FH5H 5L0QB 2XTJB 1KIRB 5TF1H 3CPLA 3OJ2C 5BXFB 4Y19A 1E4JA 1CGUA 2KPNA 4U0RB 4WHYG 5IQ9B 3PF2A 4LLQA 5EBMB 2A0LD 3IFLL 3RZWA 1J10A 4NQCD 4XWOC 5F88B 3BZ4B 4MB5A 1HINL 1CGSL 3QRGL 5EZJB 4EBQL 5E8PA 2YA0A 3V0AC 3OL2A 5E6IC 1T7ZA 4FHBD 4JPWL 2ADIA 5HVWA 3K8MA 4FG6D 5D2NC 1ZHLA 4HT1L 2X9YA 3BRDA 5IB1B 1ED3A 4Y5VA 1QSFE 3H9ZA 2FDBP 4PJ9B 4FQJH 3B9AA 4BFIB 2BSTB 2E3VA 2BZDA 3VW3H 4JJ5B 4X4YB 8FABA 1HQ4B 3B5GA 3DHJA 4KPHL 2AK1L 3HE7A 9CGTA 2W9DL 2VERN 4LU5L 2H2SC 3PV6B 1YEJH 2G2RA 5GS0L 5D2LA 3L3DA 5EWIL 3RIFF 3OF6D 3QUML 4MDJA 3OXRB 2XTJD 3BKYH 2I60H 4WTZA 2WWKT 1QHPA 3HI6H 1SVCP 4WCYL 3BD5A 2HTKD 3LEYH 2GYSA 5E8NB 4O4YL 1OQOA 3FHAA 3H7LA 4HC1L 1J0IA 3WV0A 1CFSB 1IZKA 1XF1A 1FIGH 3B3IB 1ULVA 2CR3A 1E4KA 4N9GB 5JPMA 4Y16A 3K1DA 1F4WH 1TQCB 2XFXB 2V9RA 3TNNB 3WO4B 1UA6L 4R6UA 2BDNH 3GRWH 1F5WA 5C0DB 1S3KH 5IB4B 2CKNA 3DBXB 4PJ9D 2JB5H 4J12A 4IRSA 5E2TH 3IFNL 4QHNA 4TNVK 1S9WB 3Q6FA 5GXBB 4WNQA 3FOMA 4L8SB 3VXRB 3WEXB 3EJJX 3OKLB 3T2NL 1U8IA 1PVHA 2VDOL 1S8DA 4JZNB 1T3FA 4JANA 5B39G 5HDQH 3I85A 4M7JH 1OAZL 1MRCL 1TCRA 4LVOB 1CFQA 1PLGL 5DDHB 4F7MA 1UG9A 1EFXB 4LVHB 1I1YA 2GTZB 2VAJA 5EOTB 1S7XA 1HIML 1H5BC 1QFUH 5T1MB 1ORSB 2PKDA 3THML 5F7DB 2DJ4A 2XZAH 1Q0XH 2IPUG 4K8RH 5IROA 1MNUH 5IBLC 1GRWA 2R1WA 3DTXA 3KPTA 4JDVA 3VD3A 3QIUA 4WW1A 2HJFA 3BP7A 5CEXB 4L3EB 5I66B 1L7IH 1N59B 3QUKA 5EZLA 2NY0C 2OJEA 3SY0A 2XPGA 3VXSB 3SCMA 3GIVA 5LG1A 5HI4D 3NA4A 4EI5D 4OM0H 4Y2OA 2QJDA 5LAXA 1JWMA 1L6XA 4XXCA 4NZTH 5CSBA 5EO0B 4TUJB 1T89A 1LILA 4LFHD 1CI5A 5EFIA 5MERA 3C6SA 3D9AH 4OAWB 3MV7E 5F44A 2RR3A 2A38A 2BXZA 1EFXD 1Q1JL 4TRPH 1EZVY 1RZFL 4EZMA 5DZOA 1HWGB 3HR5B 5ISZB 5L8JB 1HZHH 4M6OH 5LGHL 2V9QA 4NM8H 3LRSA 3EFFB 1CE1H 4PJBA 5DJ8B 3L5XH 5KS9A 1BMGA 4X4MA 4X99A 3U79A 3FB5B 3T3ME 3P0GB 1FE8H 2Y06L 2I9TA 4R96B 2XXCB 4EUPA 3FB6A 1E4XI 1MOEA 5FUCC 4KXZH 4P99A 5E9DB 1EHLL 1HHKB 3BPNB 1RIVL 4Z7WF 4X6EB 5ENWB 5GISL 4MDIA 3TZVD 1NUDA 2DMBA 3GHEL 5JW3H 3ZTJH 4P5TB 4YDIH 1TENA 5JHDA 5AZ2H 1F97A 1WZKA 2A1WH 2IH1A 3S35X 3V8OA 4DGVH 3BXNA 3C09C 5I71C 5IMMA 1BQHB 4GMTH 4E42A 3FN0L 3MXVL 4Q7DA 1JWUA 3IXAB 4OT1H 4XPAH 5DK3A 4FA8A 3U0WH 4JFEA 3IF1B 3VWKD 1OW0C 5E8OA 3P40A 1D3CA 3QQ9C 4S10A 3EO0A 3NCBB 2FR4B 2OI9C 5ISZD 2I5YL 5ESQA 2ZOKB 5JW4N 1B0GB 1DDHA 5KN5B 2C3GA 1QRNA 2I9LB 4FQ1H 3DLQR 3GSWB 3QQ4B 3MRDB 2G9HA 2EDEA 1KB5H 5C7XL 5DS8A 2NW2A 1MQKL 3NA9H 4YXLL 3RPIB 1N64H 5E9DD 5E8DL 2AEPL 1CD1B 1A21A 5IW6A 1U58A 3O6FA 5TDPB 2P45B 1Y18A 5HGBA 3PL6C 2A6KA 5IVXE 1AGCB 4F9LC 1ZS8B 4KK5D 1HKLH 3SE4A 5GQBA 4GG8B 3G04B 1IARB 3AM8C 4G8GB 4JFFA 2QR0A 1Q8MA 4JGJA 4K3EL 4L5FH 4JO1H 3SQOH 2BOBB 1A1MA 5E7FA 2GJJA 1YEDA 1OGTA 2YRPA 5ITFA 4F58L 5JQ6L 3PWNB 2KKQA 5D7JD 3GMPB 1JFQH 2JJVA 2XV6B 4OUUA 4ZS6D 1FBIL 3MA7B 4XI5D 3FT2B 4JVPA 4PJXE 5B8CC 1BQLL 3WJLC 3T0VA 2H3NA 1IAIH 4EJ1C 3U9UA 3IDIA 3UDWC 3S3SA 3ZTNH 5DRXB 3PWLA 4FOMA 3TFKD 4JN1L 4NIKB 1PZUB 1HEZB 3LS5H 1OAXL 1MH5B 3MLXH 3QT2A 1JF1A 5CZKA 2YZ1A 3SDXB 5HI5C 1JUFA 4PV9B 5EUOB 2ITCA 5TPWL 2GSIB 3TBSB 1IGIH 1FLRL 4FXKA 2VDML 4AT6A 3KJ6L 1X5GA 2FJFB 5FM4A 3UTTB 2NR6C 4HZLA 3FQNA 3GJFA 5CZVL 2D7PA 2XKSA 2ZOLB 4G8GD 1HN1A 3DRTA 3EDFA 2HG5A 4JFDA 1IKNC 4ONFH 1UENA 3T08A 4X80H 2DM7A 1GZPB 1PKQB 3RX8A 4NNYA 1ES0A 3MRNB 3Q0HA 2APBA 5DJXA 2DQFA 3DGGA 4JFOB 4BA8A 3T2QA 4JN2A 5ADOH 1A4JB 1G7HA 4PJXF 2E7HA 1MUJB 1RD6A 1YN7A 4M7ZC 3O6KH 3HFML 2HFEA 4P9MH 1XZ0A 4MYWB 3CH1A 4JQXC 4RNRB 1ZE3C 4G6FB 2NLJB 3BUYA 5ADPH 3GI8L 3R06A 4TSAH 3QI9C 1XCTA 2DLHA 4WEBH 5TE4L 3VWJB 2WSKA 3QEQB 5J3HD 4P3DB 2KH2B 5LXGL 3UTTD 3BX7C 4NO0B 5K9KB 5IFHL 2BVOA 2FJGB 4P4RB 2R56L 4AG4H 1TTFA 1MAML 3DETD 3TA3C 4S11A 5CEZE 3QPQD 4S1DD 4J6RL 1JYWA 1U41A 3QH3B 4U1JB 1RVFL 1ZLSL 2B4CC 1RULH 1JNNH 1UM5H 2HN7B 4UT6H 4OIIL 5K9OA 1SM3L 3NACL 4Y1AD 3TVMB 2GJ6B 4BQBA 3MNVB 1XH3A 4OGXL 4GW4B 1CE6A 5D96B 5KSUA 4YH6A 5AUMB 4Y4FB 2BRQA 5DJAB 1I8IA 2YRZA 1LK3L 2XQYG 4NKOB 1RHHB 3R0NA 4UUJB 3IDGB 1QBAA 1AE6H 1YEEL 2VWEE 2R1XA 3IXTA 4RSVA 3OR7A 4D94A 1UKTA 5TDNA 1G7PA 5MP6L 3C5ZC 4A2MA 4KRPC 1A3QA 5DQJB 4J4PD 1K3IA 1EMTL 4NKIH 3STBA 2YA1A 4R8WH 1NCCH 3KYOB 4PUBL 5IF0B 3B9KB 3X11A 3J7HA 4TNWK 1RIUL 5CD5D 1MJ8L 4KTDL 1IM3A 3NABH 1Y6NR 3TH2T 1YPZA 3GSVB 2HAZA 4I2XB 2GJ6D 2IBZY 2AJZA 4U6HA 3I3BA 3F7VB 4UQ2A 4YHNA 1DBAL 5IB2B 5ESAB 3VU2A 3N1MC 3UJIL 4NO5B 4D0CB 1YEFL 2JJTA 4Y4FD 4YFLI 4MXQD 4H25B 4U4BA 4H88H 4LSSH 5B38A 3IAGC 3HUJE 4M7LL 4G9DB 4JPVH 3UO1L 1JGEB 4UB0H 4W4NA 2QHLA 3WNOA 4D8PA 2EO9A 4WI8A 5D1ZA 4XMLL 4G9FD 1KLGB 1NBQA 1P7KA 1YYLH 1UB5A 3C6LB 5MI0C 4HX1B 4HIHA 4DKAA 5ILTL 4EI6B 2NY1C 5JA9A 3C5JA 4WRLA 3DSNA 3W11C 2PR4L 2CJUH 1B2WH 4NZRH 2FX7H 5DEFB 3O6LL 1A4KB 1AXTL 3MV9E 5GZOC 1UCBL 4PRHE 3EYSL 1YN6A 4AH2A 2NY6C 2Y7QB 5IJVA 3GMQB 1CXLA 1ERNA 5DQDH 5F3HA 5BZWA 1I9JH 1M05B 4XPHH 3PGCB 1A9EB 1J1OH 2ARJA 4ZO8A 4GKNA 4NYLB 4ELKB 1ZT4B 2DYPA 3QDJB 3LRGA 1A6PA 3MREB 4X7DC 1MVFA 4R3SA 4IDJH 5I16A 2V7HB 4HG4J 2H32A 5CEZL 1DUZB 3VD4A 1LO3H 3DUHA 4JKPH 1AD9B 2V2WB 3HUJF 3JZ7A 1XT5A 4FQLL 4JG0H 1EEYA 3FFCA 4M1GH 4PRDB 3RRQA 1YECH 1YY8A 1IGFH 2DKSA 1KFAH 3ZYOA 4Y2DC 1NLBH 2G75A 3WJJA 1QVOA 3DXAB 3C6LD 3MFFA 2J88L 4WI4A 3SDAB 5L2JA 3OKKA 1UFUA 1ZT1A 2UV3A 1SEBA 3FO1B 1KCSL 1I8LA 5BJTA 2COQA 1VKXA 1CGYA 3QDME 2CIKA 5BV7H 4BSWA 3MRRB 3HCVB 1IBGH 3AXLB 4OLYL 1JBJA 4NSKA 4N0FB 5J1AB 2PXYA 5KBNC 3ILQD 1YNTA 2F8XC 1JWSA 4TSCL 4YHML 3CUPB 1OGAA 3T65B 2DI7A 5EIVA 3QDJD 3ZE0E 4PJIE 2VDPH 1G9NC 2ORBH 2BSSB 3CZFB 1CFNB 2DQIL 4NDMA 5DUMH 1REIA 1PG7L 5GS0D 2BVEA 3CX5J 3O2WL 4V1DB 3LKSA 4HF5H 4ISVB 5DR5H 2ZWLT 1J8HE 3WIHA 4L9LB 5AWNL 5C08E 1WEJH 5I19H 3MZTA 3STLA 5HY9B 2VLRE 1FQ9C 4K9EH 3UJJH 4WJ5B 3VDAA 2C1OA 5FECB 3WHE1 1C5BL 1D5XB 1LWRA 3CCHA 3V6OC 5B39A 2A77H 1H5BA 2IANA 2HVKB 3BWAB 4YXHH 2FIKA 4HWEL 3T0EA 4RGOH 2FYYA 3ZL4L 3WXWL 5C07B 5EU6D 1R3HA 1VEOA 5GRWA 2JLLA 2YHGA 1QSZA 5INDB 4FQCL 4IDLA 3PIQB 4FTVD 1U0QA 4HQQL 5HYSA 1FCCA 2ZPKH 3VRIB 3AB0B 3QJFB 3FQXA 5BRZA 5TGBB 2M26A 4ODBD 4PJIF 4WHDA 1MF2H 3ROOB 4ETYA 1EO5A 3FQTA 5JW5A 5JPNB 4HJJH 4F3FA 1FORL 2FATH 3QZWG 4MAYB 1F58H 2Z8SA 4V1DD 3P0VL 4NQUA 5K9JL 3VCLA 1ZLVH 3PWUB 1FVEB 1NQBA 1MWAB 3QAZC 4FZEH 1CL7H 3FAWA 3B5HA 3LMJH 4GG6A 4GAFB 2ZNXA 3BZEA 3I6KB 4OM1L 3BZFA 5I1LB 2J4WH 5HYEA 3ARBB 3F62A 5CUSL 2IFGA 4XZUB 2V2TB 1W8OA 3U0TB 1NL0L 3Q5TA 4Y4HC 2EDKA 4OB5L 3DVNB 2EZ0C 1WZMA 1S7UA 3JVGC 1MRFH 3JSSA 4XCFL 4YHZL 4KJPD 5C07D 4MHHI 1ZEAH 1HQRB 4HK3J 3LZFL 5C0BE 3RVXC 3DNKA 2VXSH 5C70A 2XWTA 5EBLA 3DV6A 4R2GB 5E5UB 3VXMA 2OL3A 3AFLA 2B1AL 2P5WE 4L8DB 4C54A 4P2RE 3O3EA 4IRZH 4JRYE 3D0VB 1C16B 3GK8L 5F9DC 3T2PA 5EORL 1GGBH 4XNXL 4DAGL 4J3UA 3VFMA 4MAYD 3V7MA 2R0LL 1JNJA 5DFVC 1HDMB 4C4KO 3T1WA 2DTML 1A6WL 3HLAA 4JREC 1FVCA 3C5SA 4LLUB 2VC2L 1CDBA 4OZHE 1QSFD 3ARFA 1ZHNB 2FX9H 4KV5F 5ICYA 3B2VH 1U95A 4JM2B 3SDDC 4HDIA 3I50H 3ULUC 5DMKA 3ARBD 2O5ZL 4DVRH 4AEIH 4CADA 3GKWH 1H3TA 3OHXA 4HCRA 1QG3A 1CR9L 3V0WH 3MLZH 1A14L 2FNBA 1OLLA 1BOGB 2VJXA 3BESR 4X83A 4YZFE 1KELH 1C5CL 3UX9B 3UYRH 3RFZC 3OG4B 1JN6B 1VB9A 1QPXA 1AH1A 3DWTA 3VFGL 2WIIA 5HI3C 4XHJD 5I8KH 4G7YL 1D5ZB 1I3GL 3UBXI 1JZ8A 2CDFB 3PP4L 4K7FB 2JKXA 5SWSE 4Z7OF 1Q94B 3G5YB 3LKNB 4YIQB 5KSAA 4U6YA 2J8UA 2IQAA 3S96A 2R39A 3LKQB 1DN0B 3O9WA 3WIIL 3PWPB 5DHVB 2CUMA 5F21B 4PV8A 2IWGA 4N1HB 2NZ9D 1MCRA 1TLKA 4NRYB 2FZ3A 1A7RH 4JM2D 2JJWA 4Y8AA 4N0UA 5M95B 3HAEG 1A7NL 2ITDB 5L6YH 1ADQH 4LHUB 5I8EA 4PIRF 4O58H 3L9RA 1T1WB 4YAQA 2JJSC 2BNQE 3KPSA 3PUCA 1S7SA 1LDPH 4E0RA 4OCYH 1RZIA 2BVPA 3WJLA 2X7LA 4WWKB 3UDWA 5DEZA 3SJVA 3MV7B 3IETA 1MCNA 4OZGA 3HZKA 3B2UC 4HAFA 3HMXL 4BSJA 4X0KB 4QRPE 5A2JH 5DVNA 1J87A 3DI2B 2ED9A 3SOBL 1QBMH 3KYKH 3PWJB 1BREA 3P77B 4CN6A 2FEEL 3QFJB 4AIXA 1J8KA 3BP4B 2XWJA 1UEYA 1IKNA 4ZS7L 1S7TA 4KKLC 4CNIA 3MNWA 4Y19E 5FYJE 2D7TH 4L4TB 3HMWH 5GRXG 2XN9B 5MEOB 4IJ3C 1MRDL 3OAYH 4XB8A 4GRMA 4LHUD 5HHMB 5C0CE 5JORB 4YNYB 4LCYB 3V4VL 1I8KB 3ARGB 3F12B 3RTQA 5FIEA 2X4UA 3JWDC 3UJTH 2NXYB 4G43B 2OZ4L 1AQKL 2IC2A 1H3PH 3QUXD 5A3IC 3KYAA 2A9ML 2GY7B 4WWKD 2MHAA 1L7TH 3JV4A 4U1NB 15C8H 4MA3B 2DICA 1MIEH 2W65A 4JQXA 1FZMB 3MV7D 4FFVD 1IFHH 1FGVL 4H5SB 4ODXB 3LN5B 3IU4L 2BHZA 3UTQA 4XPGH 2AABH 1VFUA 1OAQL 1VFOA 4PJAA 4FZ8L 1MLCB 1X5YA 2DI9A 3ULVE 3MR9B 2QSVA 5DHYA 4P4KC 5GJSH 5D2LE 1D6EB 1PSKH 3VI3F 4CDGC 5JR1L 1RK1A 2H6PB 4AEHH 3T3PF 4GKZB 3JTTB 3UTSE 3QFJD 3RQ3A 3TA3A 2BSRB 1IVLA 4HULB 4W6XB 5TH2A 3NFPB 3GSOA 3KPQA 1T0PB 4QTIH 5I30L 2IGFH 3L5JA 1MCOL 3IDNA 3LDBB 4X6DB 1VFBA 3G6DH 2ZZUT 3ARGD 2EDWA 4ZNEA 1QO3B 3ZE1E 2NY5C 3QWOB 4XNYL 2NXYD 4NNPL 1JHLH 3ARDC 5GIRB 4XP9H 2IBBA 1A6ZB 4QT5B 4OD1H 3D2UB 4PLJC 5GGQH 5HHXH 3F5WB 4N9OB 2ADGA 3PV7A 5ICZA 4M48H 3E6FA 3TN0B 1KTKE 1JPSH 4QHKI 1X44A 1NMCC 2G60L 2F53E 5I1EL 3AREC 3CSYB 1G7QB 1V7NH 3C9NB 5E94A 2IAMB 2AJYH 2V2XB 4JY6A 3U6RA 4XC1L 3KPPB 3ULVF 4NRZB 5D2LF 3V5DB 3CXDL 3MV11 4DCQA 4OZFG 1DBKH 4NT6B 4X5WB 3ZHDA 4TOYL 4HUUA 3M45A 2R2HB 4PS4H 3U4EB 3FAXA 4RBPH 1F4HA 4S0TD 4KZEL 1S7VA 2HMID 1MVUA 2VLLA 2XIDA 4XTRC 3RA7H 3V6ZB 4ZD3H 5GRUL 2BVQB 1D5BA 3RWGB 1R3KB 4YUEL 5DRWB 5E5MB 3D39A 2QBWA 4ZQKB 1X4YA 4ZUVB 3D2UD 3NCMA 4H8WC 4UT7L 2XACC 2P4AB 1MCIA 4RISL 5GGTH 1OHQA 4K3GA 5I1JH 2WWMC 3LSOB 1SJEA 4ZXBD 2AJ3B 3BOVA 4KJQC 5FM8A 1T21B 2JK5A 5EZIH 2UZIL 2C4XA 2B5IC 1N5YH 3WS3A 1CXIA 4AK1A 1HH6B 5HGHB 3HN3A 1DEDA 2IAMD 3HNTH 4ZUTA 5JXEC 2BY2A 3U48A 5CILL 1MJJA 1RK0A 2ATPB 3QUYA 4PJGA 2FBJH 4UZGA 2GCYB 1F4AA 4B0MM 1AP2B 4A6YB 3D3VB 3AY4A 4WV1B 3SKMA 1SBSH 2GFBB 4JZOA 4LSUH 3DRQA 4L1DA 1YC7A 5K93A 3WNKA 4IM8A 1ZTXL 1AGDB 2PW2A 5E2VL 5HHVH 4I3RL 4Q9RH 2FHBA 3VMNA 4PY8I 5IM7B 2VAAA 2VDNL 2H41A 1E28B 2HJLB 3QUZC 1TITA 4JPIB 4PJBE 2VZOA 4M8QB 5KS9E 3ULVL 3VJ6B 2BP3A 4M6MH 2NW3A 4GJTB 4TSBH 3VFPA 1LE9A 5JZ7D 1DANT 1T20A 3BIKB 3QXWA 5GZND 4UDTA 3ULUF 4UOJA 4QRQB 3RX7A 4AJ0A 3GSQA 3IVKA 1RI8A 4UIMB 2XY1A 1FAIL 5TE6H 1FZOB 3D48R 3NN8B 1IGCH 1DQQB 1WITA 3IKCB 3P4NB 5JHDE 3NCEB 4Z76B 1NMBL 4C56B 3UTPE 3QHFL 3X3GL 3BH9B 2OQJA 4Z0BL 3VFVB 3W2DH 3D3VD 4NWTH 5D70L 5JDSB 1GGCH 2VIRB 4HD9A 3BN9C 1IC7L 4JFEE 3DROB 4NCDA 1UACH 3FL7A 4OFYD 2XA8H 4HIIA 3VXOA 1NCWH 1NBZA 4OCMC 1EJOH 3C2SA 5KS9F 1QRNE 2KBGA 3ZYZA 1GGYA 3MACL 3A6BL 5E2WH 3S35L 3MRPA 5CEZD 3QXAB 4FXGB 4KHXL 1BZ7A 3SDYH 3DUUA 1OF2A 2R4SL 2SEBA 3D0LB 3U4BL 3F6IA 1AKJB 5BQ7A 3RL2A 4X4ZA 5GS1B 1UADC 3BJ91 1CDYA 1PYWB 4U3XA 4MZ2A 4PBWD 1IEAB 4RFEB 4JFFE 4XH2B 5HGAA 2DQUL 4XRCA 3H0TB 3BI9X 3MRBA 3SE3A 1WC7A 2G5BB 2Y36H 5L9DH 4UBDD 2VDLH 4W6YB 1JZ6A 4MNGA 3FO2A 4G8EA 4KDWA 2R0ZH 2YC1A 4XNQB 3V6OA 1OAKL 3TPUB 1GAFH 5GHWL 1MHEA 2OP4L 4HKZB 1MJ7L 4YHPB 1EIBA 1NEUA 3A6OA 2JIXB 1OTTD 2VL5A 3GSXA 3JWOC 5J6GB 2Z91B 2UY7A 4MA7H 3V6FA 4YO0A 3QIBA 3O2VL 2DRUA 1JYXA 3D69A 4CJ0A 4LEOA 3STZB 4HH9B 3S4SB 5J9PB 3PQYB 2P24A 5EUKA 3MV9B 1QSEE 3HC3H 5C6PB 2VYRE 3HG1A 3I6LE 1FN4A 1J7VR 3CFDA 5TE7H 2NXZC 1KGCD 1B0WA 1UM6L 3L95A 5D1XC 4YDJA 4TUKL 3ULSA 3L3OB 3MGOB 3OR6B 1BQUA 3MUGA 4MNQA 4TUOB 4JFDE 4QRSA 4G8FB 3RHWK 3MC0A 1JNLH 2DWDA 1CDJA 3N1QC 4Q74A 5T1LB 3VFRB 1U8QA 3CDFA 3JVGA 1B4JL 4MD5B 4OIAA 1CFVH 4LBEA 3HTLX 2QQQA 4HHAB 5DC9B 4PJEA 2P8LB 2HT3D 3UPRB 1MJUH 4LAQH 4O5LH 4YDKL 4OF7A 4S2SB 3RWIB 4NHCH 3PQYD 3MV9D 4F7CA 4PRHD 4DTGL 4XWGH 3P73B 2X6MA 1HK6A 3BQUA 1NBVL 1GSMA 1H3VA 2OSLA 5EBGA 2X1QA 3TBVA 3BD4A 1T5XA 4E9LA 1NEZG 4Z7UE 1QEWA 3HZVA 2PYFB 3H9SE 2F5BH 2LU4A 4NQEA 5C0AA 3CMOH 3LKPB 4CAGA 1NGQH 4PP2B 4HUNB 4YHIA 5I15H 2FX8H 4E5XB 4FQ2H 4PRPB 1QFWL 1DR9A 2VMFA 1C5DB 1RUMH 4PRNA 3VXPB 3G6JE 4S1RL 1V7MH 1J8HB 3EJZC 4MHHG 2R0WL 5HYJA 5ACZA 3MRHA 5F93C 3CD4A 1EXUB 4TQEH 2YN5A 4GBXC 4D3CL 1IKFH 1P1ZB 5T5NF 4H26A 5HDOA 43CAA 3ARXA 1MFCH 3BEWB 1QR1B 3VGFA 3QNYB 3N85L 1WWCA 3QDMD 2RBLA 4WUUE 4U0QB 5F7HA 3MLUL 4P59L 2EDXA 5A16B 1YUHB 3MGTA 3PHQB 3EOYG 5FDWB 4OF0A 4XX1E 1PAMA 4Z7UF 1U8OB 1GOFA 1H8NA 5ETUB 5K59E 2C1PA 3IFLH 2HFGL 1A6VL 3BW9B 4J3TA 3S37X 2F54A 3PHOB 4F33A 2ZUYA 1QPPA 1KIRA 4EBQH 1LEKB 1S9VB 5KZCB 2JJSA 1IAOA 4HT1H 3VFOA 3G6JF 5CEYA 5TFSL 3EYUL 5FV2A 1J8HD 4NKDA 2EECA 3TO4D 3U4AA 5IQ9A 3U82B 3VXNB 5EBMA 3BGFB 1VADB 2VLRD 5CIPB 2L7JA 3MYJB 3MOAL 4U33A 4AIOA 5C0EA 5EZJA 4KKCC 4KPHH 2AK1H 2W9DH 1KV3A 2N7AA 4NN6C 3UBXG 4LU5H 2EKSB 3KS0J 4HS8H 1S7QB 3I02B 5EWIH 2ZCHH 2DKMA 1ZMYA 2C4FU 1RMFL 3UZEA 4GKSB 3G08A 2BSTA 5C8JA 1RHFA 4WCYH 4W4OC 1P5VA 4JEGB 4JJ5A 4X4YA 1T2XA 1TZHB 1HQ4A 3GBNL 1CGTA 5DJCB 4O4YH 5DK2A 2P5WB 5E1AA 3V4UL 2DBLL 4HC1H 1DEEB 4WFGE 2GEEA 4JRYB 2BNUB 3LEXB 3S36L 4MS8D 4I3SL 2HKHL 3OXRA 4PRAB 1KPUA 4OLZL 3X3FL 5KZCD 2MQCA 2BCKB 1MFNA 1XGPB 2VDKH 4ORGB 4HWBA 1PG7W 3AS2A 2BNRB 1RJLA 2OMNA 3BN3B 4PLOB 4OZHB 1LO4H 3GGWB 4G42A 4YK4B 4D0DA 1R5IB 3IFNH 1FNFA 2L4OA 1K8DB 3TNMB 3ZSSA 4N9GA 3SDCD 3UYPA 2BSED 4KVNL 3RGVB 3MJGX 1BWWA 2P8PB 2VDOH 2Z4QA 4NRXB 2Z31D 4WGVB 4RIRB 5C0DA 1P9MC 1OAZH 4G7VL 3FFCE 3WHE0 2KL6A 1PLGH 2W07A 5EPMA 4CVXB 4LSTL 4QEGA 3R1GL 4G6AD 4UDUA 3RKDC 5JO5B 5CBAA 3VXRA 3WEXA 2P5WD 4ODVL 3DVFA 2YBRB 2YMXH 1ZSDA 4JRYD 32C2B 3THMH 4GS7C 4IMKA 5EZOH 4XNMB 5DMJB 1CXEA 1JIBA 1CFTB 4EDWL 5ALCL 3NBNA 1RU9L 5F1KC 4ZO9A 5J1SC 1WZ1H 1JCKA 1DLHA 1XGTB 2EC9U 1ORSA 2VISB 2VLJB 5F7DA 3SKNA 3VA2C 1OGAE 1RJCA 1JNHA 1WV7T 4QWWC 2A83A 3FONB 5I74C 3T09A 3LPWA 2YWZA 2P8MA 4O51A 3VFSA 4NQVA 3RGVD 5TQ2L 1INDL 4OCSH 5CEXA 4L3EA 5FYJU 4TNVF 4P5MB 3WN5B 5I66A 1AI1L 2YPLB 1QA9A 2QLVB 1MWAH 1HKFA 1B6UA 1ACYL 1O5DT 3MRFA 1PDKA 3RWEB 1N4XL 1F11B 2F5AL 3B6SB 1KNOA 1RZFH 3VXSA 4HGWA 1FFPB 5LGHH 4JFYB 2AQ3A 3MODL 4UT9L 4OZFA 2IANE 3FQWB 3T0EE 1PZ5B 4L29B 3WFBL 5CBEB 2BY0A 4OAWA 5EA0L 4P46A 3RVWC 4PJFB 3CPLB 4Q97A 3HR5A 4PGZA 5GISH 4P48A 4Y5XB 4QHLB 4YC2B 2VLJD 5DJ8A 5I18L 4RGNB 5BOPA 5GS2D 4LLQB 3OXSA 2NY2C 3FB5A 4EN3C 5BRZE 1Z9OA 3V8CA 2BNQD 1DCLA 3BISA 1Z9MA 2AQ2A 1SJXA 5E8PB 5TF1L 1HHKA 4ZO6A 3MXVH 5JXEA 1ZHLB 4RAVB 4X6EA 1CXHA 2YPLD 4W81A 4HUKB 4WDIA 2YZ8A 5FKPA 2L7UA 4Y5VB 3RBSA 5MEQB 1VACA 4GUPB 1K4DA 3QRFM 4GG6E 4P5TA 3GMMA 4TTDD 3O0RH 4RAUB 5GGRY 2I5YH 3SGDI 4JY4A 8FABB 1NC4D 3KPOA 4QRPD 2AXGB 4MLSA 1PJ9A 4H1LG 2G2RB 4NBYB 2BMKB 3IXAA 3NCJL 3L3DB 4BJLA 5FKAB 3S8WA 3QUZA 5EU3A 1TPXC 1MQKH 4MDJB 2LAGB 4FQJL 3RWHB 2Q3AA 2QSQA 3SKJL 3IDYC 5DVLA 1JTPA 4Y19D 1B0GA 3W0WE 2VXVL 5D6DC 5C0ND 5KN5A 3AS1A 4PY7A 1JMZA 2CR6A 1YEJL 5D7KE 1KXQE 2EDDA 5E24E 1S78D 1MI5A 3K4ZA 1LMKA 3BKYL 2AEIT 2I60L 1T83C 5JPMB 5LGKA 4Y16B 4AENB 2WP3O 5DHVH 1CD1A 4XGZB 1PY9A 4Z7VF 3TJEH 2VKWA 3SKUD 4F15B 4LOUD 2DDQH 4ERSL 4F58H 4KC3B 5JQ6H 3ZKNC 4EVNB 5DMGC 3BVNA 1FBIH 1KXTB 1FIGL 2VQTA 4QHNB 3G04A 2Q76A 1LO0H 2ADJA 5MEPB 1D5IH 3H2WA 3Q6FB 5CP3H 1BQLH 3CU7A 4U2ZA 4OLWL 2BOBA 2JF1A 1N2RA 1U8IB 3ULVD 1LP9A 1S8DB 4QRRB 3PWNA 1T3FB 4JANB 1OAXH 5HHOA 3WIHL 2WBWB 4QXTB 2R23B 1XMWA 4F7MB 4D2NA 4M3JA 4G6JH 4LKXA 5IKCB 1FLRH 1I1YB 2VDMH 4XCCL 3KJ6H 4IHOA 1S7XB 5M7QA 1P7QA 3V79C 5DRXA 5I75C 2YXMA 1Q9KB 5CZVH 3P9LB 3CXHJ 3OGCA 4AQOA 1HEZA 1MH5A 3SDXA 2J8UE 4M7JL 5D71L 4JO4L 4PV9A 1INEH 4Y16D 4S1QH 2GSIA 3TBSA 4LPTA 2R1WB 2AW2A 1RUQH 1PW3A 4JDVB 3QIUB 1A7OL 4O2EB 1TVBA 1QFUL 3QUKB 5EZLB 1I1AC 2X5PA 3B43A 4N0UE 2GK0A 5C09B 4IRSD 1KEGL 2OJEB 2XZAL 2EXWD 2ZOLA 1L9MA 3KPNA 1N3NB 2XPGB 3AROA 4K8RL 4X5XB 3HE6C 2AGJL 3GIVB 3KPSE 5FXCH 3GZKA 3HFMH 1WFNA 3RUGB 1GZPA 1T66C 4UNTA 8CGTA 4LHJB 5LAXB 4QRRD 3VGAB 2PETA 3SJVE 4JFOA 3GI8H 5FV1L 4ZUWB 3C6SB 3TYGL 2GT9A 5TE4H 3PGDA 3U2SA 1M4KA 4OZGE 3FTGA 4HKJA 4DFIA 5LXGH 1AGEA 4NM4L 1QNZH 5IFHH 5KSVB 2EIZA 2R56H 1KSRA 4X99B 5KAQF 5D1XA 4LLAA 2I9TB 3EYOB 3FB6B 1B88A 4J6RH 3P4OA 5HYQB 3VWJA 1W2KT 3OGOE 3QEQA 2VXQL 1CQKA 1RVFH 3QIUD 1ZLSH 4YHKH 4NO0A 4OIIH 2OL3L 1KTDA 1A22B 1SM3H 1KYOK 3QIWC 4MDIB 4M43L 3LKOB 1IT9L 3MYZA 1CE1L 4K23L 1QRKA 3L5XL 4IRJB 2HVJA 2NYYC 4OGXH 4UAOB 5JHDB 3MXWL 1NCAL 2IH1B 3JUYA 1F90H 4U1JA 3BXNB 1LK3H 3FQUB 5LCVL 2HN7A 4E42B 3VXUA 1JWUB 3TBTA 3SKOA 4MLIA 2GHWB 1YEEH 4JFEB 3TVMA 5E8OB 5JW3L 4JFXA 2E7MA 2E9IA 1Q9WB 4TVSa 4I13B 4V2BA 3EO0B 4WO4C 5MP6H 3RZCC 1AR1D 5ESQB 2Z92B 5DJAA 1JPFB 3VH8B 4HCRL 4PJAE 1RHHA 1EH9A 4UUJA 2HJKA 4YLQT 3CC5A 1AHWC 1QHOA 4PUBH 3BDYH 1RIUH 3PXHA 5ELIA 1E6OL 1LO2L 1MJ8H 4KTDH 4NZUL 1U58B 3FZUD 3QNZB 3QG7L 1NEZA 1Y18B 3DGCR 5HGBB 5DQJA 2A6KB 4FABL 3EJYC 4QOKE 4PD4J 1H15B 5DZLA 4FQ1L 4HPYL 5JHDD 3LS4L 1DBAH 4WWID 3N1GC 4ZNEE 3QHZL 3B9KA 1YEFH 3NA9L 3UTPD 2QR0B 1N5AB 4HFUL 4UINL 1N64L 4GBXA 2D31A 1CICB 1X7QB 1JK8A 1A1MB 5I9QC 1OGTB 4M7LH 1G1CA 3GSVA 4JO2H 5ITFB 4JFED 1HKLL 1HCVA 5EN2B 3F7VA 4MSWB 4XMLH 3CFIC 4NO5A 4D0CA 1T80A 1YDPB 4H25A 4U1SA 1N6VA 5ILTH 1U8NB 3C08H 2H3NB 1BFOB 2GITA 3U9UB 3IDIB 1QRND 2PR4H 2YA2A 4UNUA 2DF3A 3E2HC 1EO7A 1LEGB 3O6LH 4JHAL 5FM5M 3MLRL 5D8JL 1JUFB 1AXTH 1UCBH 3NPSC 5DMIL 2ICWI 2M2DA 3O6FD 5LKNA 5EG6C 4AT6B 4YXKL 1Z3GL 2ICES 4TNWF 4HZLB 4XMKL 3FQNB 2ILLA 2B0SL 3GJFB 4WI3A 1Z9SA 1KG0A 4JFFD 3CXHK 1A4KA 3H3BC 3Q5YA 3D39E 2YD5A 4NNYB 4ZOEA 3HC4L 2X41A 1ES0B 2AXHA 5F7MC 3DGGB 4NYLA 3LEVL 4ELKA 5H37H 3VXQB 1ONQB 3UEZA 1C8PA 3BIAX 2V7HA 2ERJB 3UBXA 2J88H 1VPOH 2X4NA 1YN7B 1A3LL 1PKOA 1I9RL 3DMMC 4YHYC 2MQ3A 4BFGA 2HFEB 1FJ1A 4PJDA 5DFTA 1XZ0B 1I7TB 1KCSH 4S0SD 5JHLH 5DT1L 3ZDZE 2BFVL 5F89A 4Z0XA 4K7PH 2QSTA 4PRDA 4XP6L 4ZMAT 1XCTB 3I6LD 4FG6C 4OLYH 2UVEA 3DXAA 2Q7NA 2EIDA 5FO8B 4JPKL 3SDAA 4ODUA 5AG9A 4YHMH 2BVOB 1A7QL 2D03H 2Y5TA 1YA5A 3FO1A 4WW2F 3EFDH 5EDXA 4OUOA 2HRLA 1B4RA 5IB3A 4X5LA 3MRRA 2GI7A 4KI5E 3QEHA 1I1CA 4YBLB 2DQIH 1JRHI 4MJIE 3RNQA 2DN7A 3V2AR 4WEBL 3AXLA 4C58B 1MHCA 5KOMC 1PG7H 2ZUQC 4N0FA 2P43B 2HT2D 4P23B 1UWXH 3GEWB 1HSAB 4XNZC 3S34L 5AWNH 4F9PA 3CUPA 3T65A 1NC2A 3KJ4C 1P9MA 2HTKC 4AG4L 2VSCA 1KBGL 1XH3B 1KACB 4JJHA 3CZFA 1CE6B 2UWEE 2E9BA 1I8IB 2FIRT 4DEPB 4ISVA 4G80B 3ZYJA 5FOJA 2FLBT 4X9HA 1UM5L 3ZDZF 1TTUA 4UT6L 1JP5A 4L9LA 4NC2B 4L4VA 1CLYL 1NAMB 2CXGA 4FQCH 3HS0B 1R3LA 4KHTL 4WJ5A 5JUEL 4GMSH 1J0YA 3LCYA 4U3HA 4I0CC 3BWAA 4ODWB 1KC5L 4M93B 3W9EA 1MFBL 4TTGA 1FORH 3X11B 3X14A 3S4SG 2HLFD 5INDA 5K9JH 1G6RB 2V5YA 5I2IA 3PIQA 1IM3B 1FV1A 5C92A 4YX2H 1JGVH 1YPZB 3VRIA 3QJFA 2AJZB 4OM1H 4OF3A 5KVFL 1CDCA 1IZJA 5CUSH 3ROOA 4UQ2B 5T5FL 3OAUL 5ID0A 5EBWA 4NO2A 1OAUL 2ZUTA 2UWEF 4PJCF 4U1IB 5BMFL 2WLYA 4AM0A 5IESL 3NABL 1FVEA 4XCFH 4APQC 1MWAA 2R9HD 4OBSA 1EBAA 4MNGE 3L1OL 3WUWG 1GHFL 3V6OE 3I6KA 4XBEH 1KIUA 2CD0A 5I1LA 3OB0H 2VH5H 3WSQL 2V2TA 4NUGH 3U0TA 1P7KB 1K8IA 3DVNA 1UB5B 1Z2KA 2LU7A 3N06B 1B3JA 1U8LB 2X4TA 2EYTB 5IBTH 3ILPA 5HJ3B 3UYOD 1CZ8L 1JL8A 3GK8H 4H88L 4LSSL 4OLXL 1CGWA 1I9IL 1HQRA 4XNXH 4DAGH 5HI4C 5TF0A 4UB0L 4PG2A 3V6BR 4EI5C 4YJZL 2R0LH 3MROB 1YN6B 1FHGA 3DVGB 2DTMH 1A6WH 1RIHH 2GUOA 2VC2H 5E6IB 4L8DA 2P47B 2PTVA 5D2NB 4PREB 2RFXA 4XXDB 4U7MA 1LDSA 4GKNB 1C16A 4HMEA 2O5ZH 2CJUL 4MNQE 4OI9A 5SX5K 4R3SB 5I16B 1CR9H 1EJ6A 3E0GA 3T4AA 1A14H 1G9MC 1HDMA 4JDTL 2VDRL 4JFQA 1OB1B 1XGUB 5K9QI 1U8HA 1C5CH 4CUCA 1EEYB 3FFCB 3I6GA 1L6ZA 3HZYA 1RV6X 3VFGH 5HD8D 5D1ZD 5IQ7L 4FQIL 1QACA 4PJEE 3TZVC 4JE4B 2P46B 3IJSA 4PJ7F 5HDBE 5L2JB 3OB0K 1AY1L 1JVKA 3PP4H 4WFGD 5H94A 4WUKH 4JKPL 1BOGA 2FRGP 1ZT1B 3GDBA 3MOQA 5D6DA 1SY6A 1GXEA 4JG0L 3GHBL 1JN6A 4FQXC 2RCSH 2CIKB 4XWOD 1UWGL 1YECL 2XKUA 1YC8A 4NSKB 4OFIA 4ZFOA 4N5UA 1YNTB 3VWKC 1P7HL 4K7FA 1A7NH 3G5YA 4NQSB 4YIQA 2DYPD 5IEKA 3A0OA 3LQAH 3TYFB 1ZA3A 4NQEE 1M7IB 5BV7L 1AO7B 3PWPA 4NDMB 1CG9B 3KPRB 5CP7B 12E8L 3FFCD 5HYJE 2ITDA 3EZ8A 2FECI 2W92A 5CIPH 4ODHL 1VFAB 2VDPL 5CP3A 4UV7L 5I0ZA 3HMXH 4NCC2 5LBSL 4KK5C 3RY6A 4WTXA 4WWKA 3CCHB 5B39B 5BO1H 1H5BB 2FIKB 3SOBH 3V9FA 1J0ZA 1T1ZB 2Q3ZA 4JFPB 3ZKQD 4PR5A 5GRJH 4K9EL 4CRPA 4NBZB 2PXYD 4X0KA 2WUBL 2E9JA 5D7JC 1A64A 3UPAA 4NC1E 4DOHB 4KDTC 1CDHA 4ZS6C 1OGAD 1X5LA 1X3DA 3V4VH 3HB3C 2F54E 2NY0B 4LP5A 2WBJC 3P77A 3QO1B 2BVYA 2XTJE 3FQTB 4F3FB 1DVFC 4ESKA 1NFKA 1AQKH 3BP4A 4GAYA 2A9MH 2XY2A 3WD5L 4L4TA 1U3HC 4CVZB 1QLRA 1VEMA 2XN9A 2ZPKL 4GG6B 4RA0C 1MCPH 4YNYA 3BZFB 5I1DB 1I8KA 3ARGA 3F12A 1MF2L 4LPUA 2MSPA 1QZ1A 3RVTC 4FZ8H 3U30B 2DOCA 1F58L 3K2MC 1NKRA 1S7UB 3FT4A 3S37L 1T03H 1LO5A 2IAND 1SYSA 3T0ED 5JR1H 4BZYA 3KLDA 1NUFA 2B1HL 4FZEL 3MRLB 1FL6B 3KHOA 2ZCLL 4DKDC 5E56A 4H5SA 2VN4A 2XQBL 4HIXL 1X9QA 5SWQB 5T1KA 3DV6B 1DFBL 3VXMB 4XHQA 2OL3B 1YMMA 5I30H 1MLCA 4WI7A 1ZLWH 3O3EB 5BRZD 5FA4B 1MCOH 3TM6A 4N5ED 1MRFL 1D6EA 3QIWA 4PFEA 4K8RD 2H6PA 4JFHE 2X44D 4GKZA 1QR4A 4XNYH 4KZDH 3VFMB 3QWRA 2I27N 5CJBA 5H35A 4NUJB 3HLAB 3EGSA 3SO3C 3C5SB 3C09B 5I71B 2EDNA 4R90L 5ICYB 1U95B 4HDIB 5DA0B 1F02I 4X6DA 5F70A 1R0AH 5I1EH 1IAIM 2VABB 4M7KL 3PDOA 5DMKB 5J3HC 3QWOA 1ZGLA 5GIRA 4CADB 3PWVB 4RMWA 4OLVL 5C0GA 4WO4A 2OI9B 3BFOA 3RZCA 3F5WA 3U9PH 1YY9C 4K71B 3CXDH 4N68A 2QADC 4POUB 4TYUA 3TN0A 6FABH 3QPQC 4S1DC 4MCZA 3B2VL 2MCPH 5L2KB 2W9EL 5I1KL 2V9TA 4MJ5B 1G7QA 3VXMD 4DVRL 1MCBA 4KZEH 3VXRE 3LN9A 4ZTPL 1U8JB 2NX5B 1FZKA 5GRUH 3BPCB 4NRZA 3PL6B 1EEZA 4YUEH 3TT3L 4M5YH 4U6YB 2F8OA 2J8UB 4R9HA 4NT6A 4X5WA 4Z9KB 1ZLWK 2LE9A 4YDLC 4UT7H 2CPCA 3NMEA 4RISH 4PV8B 3U4EA 1H3WM 1CLZL 4X6BB 2QQLL 2C9AA 2FZ3B 3L3IA 4N0UB 1XF3A 4PG9A 4X7TA 4NOFA 4QHUA 2UZIH 1DBML 4HUWB 1R3KA 3RAJL 5I8EB 1PBYA 3UMTA 3L9RB 4LAJH 5I6XC 5DRWA 1KN4L 3KPMB 1J9CT 2XNAA 3KPSB 4ZQKA 1S7SB 5CILH 5EOCL 5B8CB 1RZIB 3KPLA 2BVPB 4L3EE 2X7LB 4YGVB 3SJVB 2AJ3A 4JFZH 3H6JA 1RJYA 5CD5C 3IETB 5L6YL 5AYQA 5IMKB 1HH6A 4OZGB 1ZTXH 3JV0A 5E2VH 3VXSE 3KLHD 4I3RH 5HGDB 4MQ7A 5F6HJ 2X1WL 3OKDA 2VDNH 2GCYA 4UIKL 2ENYA 3WS6C 4A6YA 3VD7A 3E8UL 5I8OH 3DOSA 2PN5A 3U1SH 4U6VL 5KSAD 2GFBA 2VQ1A 3ES6A 3LAFA 3EO9L 5J06A 3IJHA 3O9WD 1KIQB 4AMKL 2UVFA 5HSFA 5ISZE 3MNWB 2MTPA 3T0AA 1FAIH 2EDLA 3BGMA 4JPIA 5IT2H 5I17B 3U36A 3QG6A 3RI5K 4CMHC 1YNLL 4MQSB 3KYKL 3KPSD 2X4UB 1NMBH 3QHFH 2X4RA 2YPVL 3X3GH 4Z0BH 2QHRH 4M7ZB 3DMMA 1X5KA 3JV6A 4HWBL 2EKJA 2D7TL 3SJVD 1X6NA 4ONHA 3JV4B 3HMWL 1IC7H 2AEWA 1D7FA 1FZOA 2W65B 3NN8A 2WBKA 4KJWD 1MCWM 2AXJA 3IKCA 5IR1A 5HI5D 4IOSD 3QI9B 5EO9A 3UTQB 1VGKA 4C56A 4JGMA 3BH9A 6CGTA 1QP1A 5HVHC 1H3PL 3VFVA 5DZNA 2NR6D 2HYMA 5DHYB 3MACH 4BYHA 3A6BH 3S35H 3H9HA 1DE4A 1SMAA 3EO1B 3K46A 4KHXH 1IFHL 2R2BA 3JBG7 5F7EH 3TA3B 2YEZA 4X6CB 2AABL 4YEFA 1F3DH 3KPQB 3LQZA 4U3CA 3U4BH 4QF1B 3K80A 3QBTB 3F65A 3R8BB 4LGRB 3QQNA 3Q6GH 4XPFH 3I75A 3IDNB 5GJSL 1VFBB 2KQMA 1ORQB 1MI5E 3RTQD 2RB8A 4CVUA 2E7LC 4FXGA 4BKLB 1RPQA 4HZAA 2DQUH 3MV8A 4X98A 4HWZB 1I85C 2K7QA 2IH3A 2Z0BA 2JTDA 1NUNB 1OD9A 4U49A 5IFAH 1R24B 1V3JA 5ICZB 1R3IL 5LJYH 1AKJA 5GHWH 2OP4H 3R4DA 2IGFL 3FFDB 4KKBC 1PYWA 1WFTA 1IEAA 4G8GE 2GK2A 4G6KL 4HLZH 5E94B 4XP9L 3BKML 4JY6B 2AJUH 4OD1L 2G5BA 4WU5A 3N50A 3GB7A 2AS5M 3DJ9A 3C5ZB 1BFTA 4KRPB 3G6AB 5HHXL 3O2VH 3HKFA 2V5MA 5ANMA 3TPUA 5HHOE 2E6PA 2AVGA 5GS0C 4OTXL 2HRPL 3TA3D 1O7VA 1T6WA 3MJ9A 1OT2A 2JIXA 1S7VB 5C2BH 5DJYB 3RWFB 1MVUB 2VLLB 2Z91A 4TUKH 3BPOC 1UGNA 1D5BB 1FDLL 4JCLA 3STZA 4HH9A 3UP1A 3S4SA 3SDXE 5J9PA 3PQYA 1DBKL 4EUPH 1JV5A 5EUOE 3D39B 4BQ9A 1CBVH 3MO1A 4PS4L 1PEWA 3CFCL 2MWCA 3UTTE 4H8WL 1B4JH 1SJEB 3VGHA 1S9XA 2CLZA 5GSRA 4ZD3L 4K07A 4QKXB 2JK5B 1ZLUH 4CGTA 3SEPA 1EAJA 2V17L 4HV8B 4ZUTB 5K33A 3V7AE 1MJJB 2FO4A 1PKQE 3WUWA 4PJGB 5T1LA 3VFRA 4LLDA 5MI0B 2Q86A 4BFBD 2NY1B 3SKMB 1ITBB 4MD5A 3DRQB 2P44B 1IEHA 1D9KC 4LLYA 1U8PA 4HHAA 4OKDA 1MY7A 1NBVH 1G7LB 1RZKC 2AJVH 2PW2B 3UPRA 2NY6B 4PYGA 2UUDH 4NCC1 3CFJB 3UZVB 4CU8A 2NW3B 3SDXF 3VFPB 4L8CA 3PE9A 1LE9B 2YD3A 5EUOF 1HSBB 2QQNL 3D39D 3F7RA 3P73A 3WFCL 1T20B 4MAUL 3NPZB 5F7KC 1QFWH 4UV4L 3QEQE 4UDTB 4KJPC 5HHVL 3WMSA 3D18B 4S1RH 4RWYL 2XRAL 3GSQB 5E99H 1UB6A 1A7PL 2R0WH 3IJYA 4JZJA 5KG9A 2YRLA 5BW7C 3AGVA 1IGJA 1J88A 4D3CH 4ZOCA 3LKPA 4TSBL 5CFHA 4PP2A 2GQHA 4Y2DB 4E5XA 4LCUB 1C08A 4PRPA 1ZLUK 3QUYD 2EDOA 2ZNWA 4XP5L 5DO2C 3QWQB 3N85H 1QFOA 4TPRL 5J11C 1RZ7L 3K4AA 5TE6L 4P59H 2GJ6E 1IGCL 1EXUA 4FQXA 1P1ZA 3VXOB 4OZIA 1NBZB 4POZC 2ZG2A 5KSBA 1ZVSA 2HP4A 1FNGA 1QD0A 3MRKA 3OZ9H 2HFGH 4PJHF 1QR1A 3QNYA 4X7CC 1GGCL 3EDJA 4EDXA 2AXFA 4KI5D 3MRPB 4I5BB 4XAKE 3PNWA 1UACL 2UUDK 3PHQA 5L8KB 1IE5A 3DUUB 5TFSH 1BECA 5K9QG 1NCWL 2SEBB 2D0HA 4LCCC 3O3BA 4HKXB 5ETUA 3TWCH 4YFDB 1KJMB 3RL2B 5BQ7B 3F6LA 3GJFH 1RZ8B 3PHOA 3MOAH 4CDHA 1BHGA 1WAAA 4Z7NE 3MRQA 3RU8H 1JI1A 4M4RA 4MZ3A 5FCUL 4YBHA 1BQSA 2FCBA 4FQQA 3MNZB 3KAAA 3WDIA 2XKNB 4GXVL 4I2XE 4C57C 2ZP0T 5CJXC 2YC1B 2GSGA 2BHUA 5E70A 1VADA 1MHEB 1EZVX 2NZ9C 2R8SL 3GBNH 1RZJC 4NN7C 3V4UH 2DBLH 2NPLX 5F97E 2EKSA 1VERA 3ARYA 4DK6A 1S7QA 2Y36L 3NGBC 3I02A 4BH7B 2EIBA 3OBAA 4FN0A 4K3DH 2VDLL 3V6FB 2X4PA 4KDTA 4I3SH 2R0ZL 4GKSA 4LEOB 4L4JA 5F8RC 3EKCA 5IBUG 3X3FH 2P24B 5EUKB 3OKNA 3HG1B 2LVCA 2NY4D 2WBJA 4QXGL 5JOPE 1BD2A 2HTLD 4KRMB 5DJCA 1WISA 4KK6C 4BZ1L 3CFDB 3L7EA 4U1LA 5KVEL 3OAZH 3L95B 1HHHB 1EAPA 4YDJB 2BNUA 3FHQA 3LEXA 4MA7L 3QAZB 4W70A 3PXJA 4AYFA 3MUGB 1EX0A 3QZWB 3RL1B 4KVNH 4QRSB 2ZCKH 1WBZA 3CAFA