3QO1B

Monoclinic form of igg1 fab fragment (apo form) sharing same fv as iga
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
219
structure length
219
Chain Sequence
VQLVESGGGLVQPGGSLKLSCAASGFTLSGSNVHWVRQASGKGLEWVGRIKRNAESDATAYAASMRGRLTISRDDSKNTAFLQMNSLKSDDTAMYYCVIRGDVYNRQWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab fragment of IMMUNOGLOBULIN G1 LIGHT CHAIN
publication title Structure of a human IgA1 Fab fragment at 1.55 angstrom resolution: potential effect of the constant domains on antigen-affinity modulation
pubmed doi rcsb
molecule tags Immune system
total genus 46
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2011-02-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qo1B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qo1B01
4ETYA 3RWGA 1QLFA 4U2ZA 3FMGH 2NXZC 4GRMA 1MCRA 4FZEH 4DVRL 3SGKC 3B8YA 1PKOA 4ODXA 4BFIA 1R3JA 3O3EA 3JTSA 5H2BB 5B4MC 3UTTE 1ETZB 1OW0C 1DL7L 3C60D 4LVHB 3RVXD 3MBXH 9CGTA 4WW2A 3GNML 1NANH 2I5YH 5TH2A 2NY2C 3FQNB 5C0CB 4XZUB 5DF0A 4KTDL 3MRGA 3WJJC 1CT8B 2YRPA 4C59B 4G6ML 1YPZA 4I2XB 3CDGB 1T66D 5F71A 4KROD 3VXUD 2GEEA 4WFGE 5GHWH 1V3KA 5I1CL 3O2DL 1KCRL 3M1BA 1F4YL 4IS6B 1BD2D 3V0AC 5DI8A 3AS3A 3N1PC 2DIAA 2AXFB 1S7TA 3B6SA 5FA4B 3T65A 4PJAB 3V4PH 3UZEA 1RIUH 3KJ6L 3UZQA 3OJVC 4JR9H 5EG6C 3VRLE 3NIGF 4F80A 1B4JL 2NY1B 2IF7A 4P9HL 3ARFD 4XNXL 1GC1L 2EYSB 4PLOB 3CVHA 4XX1E 2UUDK 1HHKB 4YX2H 1F02I 2YPKA 3Q3GA 1UACL 1AC0A 4KK6D 5C07D 3HMXL 2NTFA 3LRHA 2R23A 2N1KA 1RY7B 4PJHB 3HAEA 5FK9B 5HI5C 3MGOA 4DVRH 3BESR 5EO0A 2RB8A 4S1DD 1FFPB 3ZE1E 4BFGA 3BHBA 1ZAGA 3MV7E 4LCCA 3LS5L 1DL7H 4Q9CA 3WFHB 3GNMH 3DI3B 3X17A 1GIGL 43C9B 2BMKB 3WEXB 1X5AA 2ARJA 3SGJA 1NBZA 3KLAA 4KTDH 1FVCA 2FZ3B 1EHNA 5D1XB 1I3UA 3ARTA 3HE7A 4Y2DD 5IOPA 4Y16B 5I1CH 4DUVA 3O2DH 5EU5A 1KCRH 1K9TA 1F4YH 3QDGD 1Q1JL 1I3GL 3OGCB 4DQOL 3C09C 4MJ2A 4UOW1 5A2FA 2DTML 4FQ1L 5IW3A 1UZ6F 1Z0MA 2WMPA 3KJ6H 2YRZA 4BSVB 2FH6A 3RA7L 5ANMA 1B4JH 2JLLA 4NNYA 4P9HH 5KSAA 4XNXH 1GC1H 1UVQA 2OTUA 5IW1A 2FX7L 2OTWA 4KGJA 4JFOA 1OL0A 3MROB 1Q9KA 1UACH 3HMXH 3TA3A 3I6KA 3T08A 2AJZB 5KN5A 2I27N 2CDGA 5HVHB 3WNPA 4ZFZA 1NMBL 2C3GA 4LPCA 1UKTA 4JFEE 5D5MF 2C7UA 3QFDA 3G08A 1I8IA 1II4E 3O8XC 3LS5H 1MCPL 5CD3A 5KZCD 5GXBB 2F58L 1GIGH 2Z8RA 3VWKC 2Q76B 3KHOA 1FGNL 1U8QB 4MNGE 3QI9D 5JO5A 5EWIL 1CDUA 2PYEA 1RZKC 4KMTL 4GSDL 3C8HA 5A40E 4CUCA 2XQYK 3JV0A 3UAJC 3BKML 3DGGB 4GAYB 5DK0A 1LK3L 5HGHA 5BS0D 1Q1JH 1I3GH 4DQOH 2RCSL 4WHTA 1P84J 1R0AL 4JFDB 2HP4A 4GBXC 3EO1B 2DTMH 2H32H 4FQ1H 4XCFL 3SKMA 4Y19A 1AGFA 3V6ZB 2OM5A 3RL1A 1NCUA 5IEHB 3T0EC 1NLBL 5E94B 3QNYA 5HJ3A 3IDYC 1EO8L 4RAVA 3RA7H 4TTDD 3LPFA 5KSBE 4KDTC 2ITDA 3RBGA 3EDFA 3TO2B 1B0RA 1RFDL 2FX7H 3G5ZA 1E4KA 2O26U 1GJIA 3GMMA 5EOTA 4XGZA 4JFPB 4YDVB 4OD2B 1NKRA 2ESVB 2Z4QA 3LQZB 3OXSB 1HKLL 1YEGL 3VFOB 2E7LA 3T09A 1CFQB 3MREB 1T6VN 1HH6B 2VNCA 3WN5B 1NMBH 5MHSE 3M17B 4TVPL 4G6AD 2X44D 2EIDA 3U48A 4YAQB 1NFIA 4X6DF 1G7JA 4BK4A 4FFYL 1MCPH 4EUPA 2GJ6E 1UT9A 3SOBL 2F58H 3U9UB 2R0WL 1WGOA 1FGNH 4LSRL 5ID0B 3D9AL 5DRWB 3F62A 5EWIH 4Z7QF 4KMTH 4GSDH 1XIWD 2EDEA 2GTWA 2Q8BL 1RURL 3D25B 4DK6A 3CCHA 2Z0BA 3OAYH 4WUUA 1UH3A 2DQDL 3BKMH 3UMTA 5DHXB 2NW3B 4ONHB 2QR0A 1LK3H 2NNAA 4Y4FA 4YEEA 1IM9A 2RCSH 1WWAX 4M7KL 1R0AH 2FL5A 1DDHB 4XCFH 3HLAB 1NLBH 4KJYA 3S96B 4LSUL 4L3CB 4JPIB 1EO8H 4Y4KA 2A73B 4JQVA 1G7QB 2MNUA 1MQ8A 1RFDH 3L5IA 2FJFB 4Z95L 3SJVD 3QH3A 1I1AB 4PJIF 3UEZA 4EI5C 4Y88A 4MXVE 3HG1A 1BFOA 3ECBB 1HKLH 4APQC 3TN0D 3ZKMD 1YEGH 3BISA 3KYKL 4HS6B 5DMJB 4TVPH 3BH9A 2IAMA 2WWKT 4LNRB 5I73B 2BP3A 5ESAB 3DHMA 4F9LC 5T1LD 4TVSa 4FFYH 3OWEA 3K46A 4J6RL 3OAUL 3SOBH 2A6KA 1S7WA 2R0WH 2V7NA 1A2YB 1JWUB 4LSRH 3D9AH 2HA1A 4CVXA 4PJXF 3QIWA 4CADA 5I71B 3TBYB 2Q8BH 1RURH 1D3CA 4XBGA 5IEKB 5GRYA 3C5ZC 2APWA 4DOHB 5JW3L 2DQDH 3EGSB 1A9BA 1VACB 3HPLB 4M7KH 5D96C 5A2JH 4F8QA 3FTGB 2Y7QA 4N90D 5FO7B 4OZGE 3QDMB 4LSUH 4J3XA 5SWSD 3Q0HA 1O7VA 5H2BA 5JOPE 1ETZA 3HZMB 4WGVB 5EUKB 3S98A 4MA1C 4Z95H 2UV3A 4EIZC 4YHNB 4TUJA 5F3BB 4Y5XA 3GHEL 3FQNA 4JE4B 2F53D 4XZUA 3NPSC 1AO7D 1QFPA 3DYOA 4W6YB 1KG0B 4XPGL 1CT8A 1DVFB 1KLFA 3HI5L 4I2XA 3KYKH 3ROOB 3VFTA 3TV3L 4F3FB 4NQVB 2FO4B 2BC4A 3HAEG 2RFXB 4TNWK 1KB5B 3QHZL 4ZOBA 4ZNEE 1I7RB 3FFCD 4Y5VC 5E5MB 2AXFA 1BHGA 3MBEC 5CP7B 4PJAA 3VXRE 4J6RH 3OAUH 4NNPL 2JJUA 2A74A 4FXKA 2C4FU 4QYOB 4GLRI 4R7DB 2YUWA 1FL5B 4JZOA 1ES0B 4P3CL 2Y5TB 2JE8A 2A77L 5JW3H 3L7FB 4TSBL 1HHKA 4PRBB 4QHUA 3KLHD 5DJZB 5CJ8A 3JVGC 1QYGL 1TDQA 1JHKL 2F5AL 4PJHA 5C9JB 3PQYD 3FQXB 3FB6A 2R1XB 3QAZB 1ITBB 4PGBB 2X4RA 1BD2E 1B9ZA 4POZD 3MJ7B 5EO1B 1GCFA 4M8VA 4CJ1A 3WFHA 1XH3B 3DVGB 4Y8AA 3NN8A 4PS4L 1FNHA 3QO1B 4R96A 43C9A 2BMKA 3GHEH 4KRPD 1RZ8B 2Y07L 3QXDA 4JO4L 2KQMA 1C7SA 2DQGL 4XPGH 3HI5H 2FZ3A 1RZIA 3QDJE 3GBNL 5D1XA 2D3VA 2I07B 3TV3H 4JJHA 4MJIA 1HOCA 3WHE1 4Y16A 3QHZH 3C6LD 2HVJB 3A6CL 1ZA6B 4WEMB 5FYKE 1KLGB 3CZFB 4NNPH 2Q20A 5HPMB 3U4BL 4BSVA 4JHAL 3KPSB 5JHDB 2FEEL 1L0QA 2FGZA 1MCDA 4P3CH 3GZKA 3FO2B 4P48A 1G9NL 1WJ3A 2A77H 4P2OD 1ZTXL 2W0LA 4WNQB 3MROA 4TSBH 4KQ3L 4PJ7A 1MCJA 1J8HB 2CKBB 5HPOA 2FIKA 3AM8A 4PP1C 3GJFK 1QYGH 5I8CA 4ISVB 1JHKH 2F5AH 4QT5A 3O3BA 4UINL 2AJZA 4NKOB 3KPSE 5IFAL 1AR2A 1V5JA 1S9XB 3LY6A 5EU6A 3BGFC 1R3KB 5D5MB 1NBQA 4AEFA 3I50L 4WO4A 4OBRA 5MEOB 1C5DB 4UT9L 3K81A 1BJ8A 3AXLB 4PS4H 2R29L 3QIUD 1U8QA 2Y07H 4JO4H 3V6BR 2DQGH 4NGHL 1T89A 3CFDB 4J1UA 2DBJA 3TO4C 3GBNH 3LZFL 4G80B 1MWAB 3DGGA 1FZMB 2DTSA 5HYJD 4GAYA 1ZT7B 3A6CH 5I17B 2WWKO 1P4IL 4MS8D 4Y7MA 2R8SL 1R5WB 4CU8A 4JFDA 3EO1A 5F1IA 3GSVB 3VXMD 1RPQA 1TJGL 4PJCF 4K07A 5IEHA 5E94A 1EH9A 3ZDXF 4Z7VE 3U4BH 1TTUA 4JHAH 1JPFB 1DLFL 2EZ0C 4XWGL 2DLGA 3TO2A 3W11C 1SM3L 2MQ0A 3T2OA 1FG2B 3JSSA 1G9NH 4Z5RB 5JR1L 1ZTXH 1WZKA 4PFEA 5I9QB 3N06B 1AD9B 3O4LE 1LP9B 4KQ3H 1ZA3B 4KKLD 4YDVA 4OD2A 5DFWH 3IDIB 3OXSA 3D39E 4UINH 2MOVA 5IFAH 3V4VL 1ED3A 4KK5C 2XTJC 2AABL 2HTLD 1HH6A 3MREA 5IQ9A 3WN5A 1X5GA 3WIIL 5I6XB 3MLVL 3W9DA 4X6DB 3I50H 3D3VD 2B4CC 3ARRA 4F2MA 4UT9H 2P5EA 4WTXA 3V5HA 4I4WB 2PTUA 2R29H 2W1NA 5ID0A 1CXKA 2PO6A 5DRWA 3OXRB 3OKDB 2G2RA 3OPZL 4U31A 4NGHH 1T03L 2E9JA 5FYJD 3D25A 4X0KB 2X9XA 1N3NB 3LZFH 5JXEA 2WBJB 5IFJB 1Q9LA 2FO1A 1X5ZA 5CGMA 4LRIA 4LPVA 4CVZB 5T1KD 4ONHA 1C1EL 1P4IH 4M4RA 2B1HL 3FN0L 2R8SH 2P8MB 3BIKB 4Z7QE 1A1OB 1DDHA 2J8UA 2JJTA 4ELMB 1TJGH 3SDAC 4UAOB 2EDHA 3S96A 4L3CA 3G6DL 1RJYB 4HZLA 1I1CA 4CW1B 1DLFH 1WVZA 4XWGH 2A73A 1G7QA 2W91A 3KPQA 1SM3H 1VESA 5HI4C 2FJFA 1F6LL 5B8CC 5JR1H 2IG2L 1MCWM 1I1AA 1X44A 3CGTA 5J57B 1BREA 2ZUXA 3ECBA 4WJ5A 1C5BL 4XVTL 2YPLD 1LDPL 3RVUD 4PBWD 3V4VH 2AABH 4NN7B 4HS6A 2ZUQC 4DW2L 4HSQA 4LNRA 5EO9B 2GUOA 3WIIH 4WHCA 4PJIE 3MLVH 1HXYB 3UTSD 1T1YB 4OLYL 3ZHKA 3E8UL 4DJMA 4RDQG 4IHOA 3DUUB 2HRPL 3DX7B 4DGVL 1XGUB 1JWUA 2AK4E 3GDBA 4IRJD 3I9GL 4V1DD 3ETBF 3MRLB 3PP3K 5DRZB 3OPZH 3PIQA 1T03H 3TBYA 1XGTB 3SGKA 1IM3B 3KXFA 3OG4B 1KACB 3EFFA 4RGMC 5IEKA 2CLVB 4C83B 1MY5A 3EGSA 1FDLL 1JK8B 1C1EH 3G6JB 2B1HH 3EO9L 3FN0H 3HPLA 1IC4L 1O7SA 4MQXD 4PJXE 3S34L 1Q72L 5D93C 5FO7A 4JM2D 3QDMA 4XI5D 5FECB 3WJJA 3G6DH 3L5WA 3DRQA 4LLYA 5IGXL 1JTOA 1XF5B 4X5WB 4WTZA 4PJGA 5F88A 1NCNA 5EUKA 1EHXA 3UTPD 7CGTA 4JREC 4QRPE 1XF4B 3O45A 3TZVA 5IQ7L 2O61B 2A9NL 2IG2H 1BZ7A 4YHNA 3F6LA 1A4KB 4LHUB 3QQ9C 3V95A 3P9LB 3RNQB 1XMWA 3HZYA 4C57C 1ADQA 3RDTC 1EFXB 1DVFA 2Z8VC 4XVTH 1LDPH 1V8HA 3ROOA 4F3FA 4NQVA 2VLKB 4OCNC 2FO4A 4NQEE 32C2B 1CDCA 2YEZB 4RRPA 2RFXA 2KPNA 1CXHA 3DARA 2FECI 1JYXA 4AY0A 1I7RA 4OLYH 1J87A 3E8UH 3LQAL 2HRPH 5BRZE 2H32B 5CP7A 3PJSB 3VD7A 4EEEA 4JG0L 3SE3A 1MVFA 2NX5B 4DGVH 3L5HA 2IEPA 3I9GH 3CLFL 4R7DA 1OTTD 1OSPL 3P30L 3NCMA 1ES0A 5I1IL 3PL6D 5IB1A 4BK5A 2HTKD 3L7FA 2F53E 1HE7A 1J7VR 1FDLH 2VSCA 3EO9H 1IC4H 4G8GB 1M7IA 4WI4A 4EBQL 2H2PC 3S34H 4R9HA 4WU7A 1Q72H 3CJJA 3PV6A 2R1XA 1F4XL 4H0HB 2W0FA 4L8DB 4U0RB 2APTA 5IGXH 3EZ8A 5EO1A 1NCBL 4PJ9B 1LO5B 3PWVB 1K2DB 4JFYB 4FNLL 5IQ7H 5K9KB 2A9NH 3DVGA 5E6YA 2A38A 3BP7B 1TVDA 3QO1A 2ZUSA 3ARBC 1AIFB 5EC1B 1RZ8A 1QSFD 2YD4A 4HT1L 1WZMA 4PRDB 4N0YL 3AC0A 2I07A 4L29B 3X11A 4RQQB 4OLVL 2DQCL 5DJ8A 1Q9WB 5GZNC 2HVJA 3MV11 1INEL 1NUNB 4JN1L 3TESA 3LQAH 4ZAKC 3E6FB 1BBJA 3MTRA 1PG7W 4JG0H 3T04D 3VCLB 3WIFA 5HPMA 3KAAA 2DL2A 3CLFH 1KPUB 1OSPH 1DUZB 2Q8AL 2A6JB 2XPGB 3P30H 5FA3B 4DEPB 5I1IH 1XF2B 2GHWB 2XOTA 1U3HB 4I8DA 3FO2A 1TZIA 2D7QA 5DHVH 4WNQA 3U30C 3GSNA 5I76B 3O8XA 2FHCA 3CIQA 4OI8A 4EBQH 1CFNA 1QKZL 3VWKA 5CJ5A 4NKOA 1S9XA 1INQB 3GGWA 1EFQA 1QLRB 2MKLC 2DKUA 4KGLA 1F4XH 1J11A 1OAQL 4WV1B 5GSVB 1NCBH 5EULV 5MEOA 3C6SB 4FNLH 1UM6L 1OD7A 3AXLA 4WHDA 1KIPB 1FZJB 1FLRL 4HT1H 4GBXA 3GBLA 3DO7A 4N0YH 3VGBA 3VXOB 4TUOB 3CFDA 1D9KB 3DRTB 1MWAA 3H9SA 1FZMA 4OLVH 2DQCH 4KDTA 3RP1A 4G42B 5I17A 5F72S 1EJOL 2G5RA 1L9MA 4UNVA 1INEH 1R5WA 3HUJF 4JN1H 2VITB 2EDWA 4PPTA 1SQ2N 2Q8AH 3LKNA 3WUWB 2E9IA 1ZGLA 5HHOB 3I6GB 3V9FA 1FG2A 4Z5RA 3RWDB 1F90L 1MAKA 3SDCB 3IJHB 3UYOD 5ISZB 1ZA3A 2DAVA 4PJCE 3ZL4L 4PBVC 3IDIA 1QKZH 1BZQK 1JZ5A 4P5MB 1OPGL 2HFFB 1OAQH 3JWDL 4JVWA 4LIQL 4ODTL 1MFNA 1NBYB 2A6DB 3L3OB 4FQXD 4GXUN 3S35L 4L4TB 1UM6H 2RJMA 5JA8B 4NO5A 1UC6A 5HHPB 4H25B 1FLRH 3OXRA 3OKDA 3KPPB 3BWUC 4CMHC 5C6WH 4PGJA 3DXAB 5FYLE 5KSUB 3PWJB 4X0KA 5IFJA 2BNRB 4NRXB 1RJZB 1H8NA 4NC0B 3L3IB 1EJOH 1C08A 1KN4L 1IAOB 1WFTA 2FLBT 2P8MA 4ZUSA 3CFIC 2HFEB 1ULVA 4PG9B 4ELMA 5A3ID 1P4LB 1WAAA 5I15L 4PV8B 4NN5B 5E9DD 1RJYA 3ZTJH 4JQXC 4IMLB 4QHMA 3MLRL 3GMLB 1F90H 3MZTA 4F9LA 4MD0B 3VXSD 3ZL4H 3QEQD 3OJMB 3VGGA 4TQEL 1L7TL 2SEBA 2ZOLA 1I7ZA 1XF1A 1N6UA 1OPGH 2DYPA 5EO9A 1IEAA 5JW5A 3FB7A 4G9FE 3JWDH 5F21B 1HXYA 2AXGB 3W0WB 4LIQH 1YN7A 3E2HB 4ODTH 4G9DB 5HGDB 3ARDD 3UBXA 4NZJA 2B0SL 1ZGLP 1JTPA 4HH9B 2D4FA 4RAHA 3PDOA 3S35H 2Y06L 1WT5C 4JDVB 1XGUA 2HJLA 2K7PA 5C08A 1OLZA 5DRZA 4D94A 1XGTA 1IM3A 1F8TL 2CLVA 2W59A 2FJHA 2HMIC 1JZ6A 3RZCC 1TJHL 3S7GA 4PJBE 1CXFA 3I84A 4OUUB 4A6YL 1KN4H 4OFPA 5I1HL 4RRPG 3PXHA 3ARGD 3QFJB 5KS9F 5I15H 1SJHB 1XGQA 4G43B 4BQBA 5FECA 4X9FA 2EYTA 4GRLC 3UTSE 1XF5A 4X5WA 2VTFA 1UXWB 3PHSA 5ESVB 1OWWA 3HPJB 3MLRH 1XF4A 4RWHA 4TPRL 2O61A 2XWJA 5GZOC 4HX1A 3P9LA 3RNQA 4FFWD 5DD5L 1RUML 2VDOL 1MI5D 3VRJB 4X6CF 1EFXA 5IT2L 2HLAB 4TQEH 1CXEA 1L7TH 2VLKA 3LN4A 5CBEA 2YEZA 1BWMA 2E9WA 3KDMA 1L9NA 1VFBB 1D5IL 2DQJL 4F57L 5JPMB 1JF6A 1KTDB 2OTPA 3O9WC 4M7ZC 2B0SH 4G5ZL 3PJSA 3REWB 2Y06H 1TZHB 2GITB 4YZFF 5E0QA 5DEFB 5FUCE 4NKDB 1F8TH 4HLZG 1DBML 5T3XD 1TJHH 4XNUL 5J13B 3MV01 5IBLC 4JZNB 5D7KE 1J86A 4FMFA 4A6YH 4JVPA 5I1HH 5GRWA 2M26A 4LHQB 5EUOE 4G8GA 2OZ4L 5DEZA 3THML 3PP4L 3FQTB 1EUTA 3MLZL 3LV3A 3MSPA 1IKNC 1QUNA 1JP5A 3F7RA 4HKZB 4Q6IB 3BQUB 3MUGB 4CBPA 3SO3C 2Z92A 3ESUF 4X6BB 1LO5A 2AVGA 3PWVA 1K2DA 4JFYA 4TPRH 3X13A 1CFSB 4QRTB 2JCCB 1IJ9A 1AIFA 5EC1A 3ZE0F 3TVMB 2X10A 5DD5H 4XVUD 1RUMH 2OMBA 2VDOH 5IG7B 1ORSB 5IT2H 1T20A 4OIAA 4GRWF 5IHZA 1Q9WA 3H42L 3QQ4B 2AERT 3SO5A 5C0DB 5J11C 4IIQB 1D5IH 2DQJH 4F57H 4WWKD 4R8WL 4PRIB 1QVOB 3B2UC 2R4SL 1YMMD 4LVEA 4G5ZH 3PHOB 3E6FA 2WBKA 3NFPB 3QDAA 1RK1A 2AEIT 3VCLA 4B7LA 1G7MB 4X5LA 1UKQA 5ICXB 3RVTD 1OARL 3TCLB 3GMOB 3K4ZA 1QA9B 2EICA 1AGEB 2XPGA 5FA3A 1YY8B 4L4VE 2P1YA 1XF2A 1U3HA 3F8UB 1DBMH 4FFVD 4XNUH 3HC4L 1ZHNB 5I76A 2Z31B 3SN6N 4CVWA 1TQCB 2BY3A 1OAYL 3OR7B 2OZ4H 5GPRA 3THMH 3PP4H 1U8NB 3MLZH 4BM7A 1QLRA 5FCSH 3BMWA 2FSEB 4QRRB 1DZBA 1ZHBB 4XHJD 4WV1A 3LKQB 5FKAA 5GSVA 5KANI 5TJWK 5F3HB 3C6SA 5DZOA 3U0WL 2CKNA 4L1HA 1X6LA 2ID5A 1KIPA 1YZZA 1KJMA 2D31A 2GJJA 1ZK9A 4QRRE 5IMLB 3DVNA 4FQJL 1D9KA 3DRTA 4D8PA 3ABZA 3RWCB 5F96L 3H42H 4G42A 2PYED 4YNYB 4RGNE 1OB1B 4R8WH 3H9HB 1F4WL 2F15A 2R4SH 2CDFB 2D0FA 5EA0L 4RIRA 5ILTL 3MLSL 3TBWB 1RAMA 1FNSL 5KANG 1OARH 1BVKB 3WLBB 2PW2B 5DEGB 5F6IC 3TIEB 3TYFB 3WUWA 4HHAA 5HHOA 3I6GA 4XNZB 1EEUA 1IAKB 2BXZA 3HUJE 3RWDA 5D1ZB 3SDCA 2GI7A 2AJVL 3HC4H 1OAYH 4JFHE 3BVNB 3OGOE 1P7KA 4JHBA 4P5MA 2ADIA 3CPLB 4XT1C 4UZGA 1IKFL 3QUYC 1WCQA 2HFFA 4OFYD 3BJLA 2VLME 1NBYA 1NPUA 4L1DA 2A6DA 4DUXA 3U0WH 2A9ML 3AY4C 4L4TA 1WC7B 4XPTL 3SCMC 4GG6B 4HPYL 5HHPA 4P2QD 4H25A 2CR6A 5DO2D 2NXYC 1XAUA 2Y25A 4KKBD 5MEPB 1ZGLM 2BY1A 4ZS6D 5FKPA 4M61B 4AK1A 3A0OA 5KSUA 2J5LC 3PWJA 4FQJH 2UWEF 1S7SA 5IB5A 4Y1AD 4IEFB 1RJZA 3GI8L 2EECA 4MA7L 4XB8A 5IJVA 5F96H 5INCB 1IEBB 3P9WB 4PYGA 3AMKA 5B8CA 3LRGA 1E6OL 1F4WH 4P2RB 4Q9RL 5EA0H 5B39A 4WUUD 1VB9A 3WNOA 5ILTH 4LOUC 3MLSH 2IADB 1FNSH 1P4LA 1UADC 4P4KB 4PV8A 4JEGB 5F7HA 3WNMA 1DANT 2EIZB 1I8LC 4MJ5B 2JJSC 1FJ1A 2QLVB 4DAGL 1OOAA 5ESQA 1DP0A 2XWBA 2DBLL 3FRUA 3UPCA 2AJVH 1I4FB 3RUGF 4Y4KD 3DV6B 2OR8A 4DFIA 5D71L 4WEBL 2IANB 3O2WL 5LAXA 3QUMA 2OR7A 4RFEB 1IKFH 4UBDC 3IT8D 1KF9B 1YC7A 2VXVL 4EN3D 4ZQKB 2AXGA 3W0WA 3WV0A 1T4KB 2DN7A 2XZCL 2A9MH 3RWFB 4HH9A 4PRHA 4XPTH 1F58L 4HPYH 4JDVA 4HXBL 2LTQC 4MVBC 3OAYK 2ICES 4S11A 5GRZA 4M8QB 3DMMD 4QTHB 1AP2B 4L3ED 1MFBL 5GRUL 3QG6A 1RHFA 5DHVB 4PD4K 2VQTA 3GI8H 4MA7H 1G7IB 1HYSD 4QHKI 1FNAA 2A83B 4H8WL 25C8L 1E6OH 2NY6B 5DGQA 3EDKA 3OAZK 4Q9RH 4OGYL 4NO0D 2WZPD 3MV9A 1E4JA 1JGUL 5DUBB 3RL2B 1SJHA 4G43A 4MGXA 1HIML 1VPOL 1PEWA 1WIPA 1UXWA 1NKOA 4DAGH 5ESVA 2Z35B 1W0VB 5I6XC 3HHRB 4OLEA 2DBLH 5JQ6L 3F5WB 2FCBA 2MKWA 3U4AA 1E4XI 5D71H 3VGAB 1HSAB 4WEBH 4F7TB 5KS9E 3IAGC 4OF5A 3E6HB 3C8DA 3PWPD 2QHRL 3OZ9L 1CDJA 2WWMC 2XYCA 1B90A 2HLAA 3O2WH 2DQHL 2XQYG 1Z0NA 1TJIL 5CJXA 4D0CB 3GMRB 1QEWB 2VXVH 2EKSB 1X5XA 5D9SB 3GSXA 4JN2A 4NQDB 5A2LH 5TQ0L 5F7UA 2XZCH 4X6CE 3REWA 1CD0A 1F58H 2GITA 4HXBH 4O2FA 5DEFA 2X7LB 1JVKA 1AR1C 3IDJA 3MCLL 5GRUH 1MFBH 3CSYA 3L5XL 1FVEA 1T21B 1EHAA 4C56D 1NQBA 2DD8L 5EZOL 4YJZL 2NCMA 5DXWA 1VCAA 4OZHA 4H8WH 3HZVA 3H7BB 1KJ2L 5TFSL 25C8H 3RRQA 4YZFE 4Q74A 4WW1B 3W5NA 1TXKA 1T22B 4OGYH 2DM4A 3ARBA 1JGUH 1Y0LA 5F44A 2A6IA 4O4YL 2BNQB 4HKZA 4LVOC 4FXGB 4Q6IA 1PKQB 1HIMH 3MUGA 4NN7C 3VI4F 1VPOH 3MXVL 4PJ5D 4X6BA 4XXCA 2DM2A 1T1WB 3UTTA 4QRTA 5JQ6H 2JCCA 4ZAKA 4IRSC 3HB3D 5IG7A 4IJ3B 1XZ0B 2QHRH 3OZ9H 2H45A 2DQHH 1MCKA 1MHHB 3GRWL 4LGRB 1TJIH 2VR9A 3KG5A 4P46B 5FYJL 4E41E 1GC1C 2ZSVB 3IAQA 3QQ4A 5C0DA 4PJ8C 4MXQC 4PRIA 1QVOA 5TQ0H 3ZE0E 1GZQB 5GJTL 3PHOA 4LMQI 4E0RA 5MEND 1TETH 2YC1B 1G7MA 1K3ZA 5B38G 2NY7L 3S3JA 3K3QA 4GRWE 2HJKA 1A14L 3TCLA 3GMOA 5E4EB 1RVFL 1AGEA 4R3SA 3MCLH 2YZ1A 4XB7A 3L5XH 3ZYJA 4Y5YC 2DD8H 5EZOH 5C0IA 2CMRL 1SEBB 3C60B 2XNAB 2Z31A 3VA2C 4XP5L 5TFSH 1KJ2H 3QA3A 3OR7A 3V7AG 4PG2A 5L8JB 3RBSA 2H8PB 3VA6A 4O4YH 2FSEA 1S78D 4WTWA 4JFQB 4KROB 3VXUB 1CG9B 1ZHBA 2JK5A 1AQDB 3MA7B 4FQIL 3MXVH 2Q6WA 5F3HA 1N5YL 3BXNA 3U6RB 4HCRL 5D72L 4PY8I 5EU6D 4KI5D 2KDGA 1YEEL 1NFDF 3ARQA 4ETQB 1FFRA 2XA8L 3ULUF 3S4SB 3L9RB 5IMLA 3WS6C 1NGYA 2EIEA 4HJJL 4A2MA 3GRWH 2VE6A 5FYJH 3FO9A 5K9QI 4YNYA 4JPVL 4OLXL 5E99L 5ENWB 1WBYA 2CDFA 3ELAT 4J3SA 1YC8A 5GJTH 5C07B 2EDJA 2PYFB 2NY7H 3FQUB 3KPRE 4F7MB 5CKGA 4U1NB 2PW2A 1A14H 5IB4B 1A02N 3T0AA 3ULVF 3TYFA 1RVFH 5A2IH 1GOHA 3I3EA 3LQMA 2PTVA 4KJQC 4U0RC 3LD8C 4JKMA 3OF6A 5D1ZA 1H3UA 2CMRH 1EEZB 4PJ9C 3BPCA 4J4PA 4QO1A 4XP5H 3WBDA 1X3DA 1AKJD 1DN0A 3V6OE 4MSWB 1PZ5A 3QZWB 4L8CA 5K9QG 1RZFL 4UUJB 1GYAA 1QPPA 1L6ZA 2HJFB 5HHVL 5FGRA 4Y2DB 4FQIH 3G5VB 3AREB 5D2LF 3CAFA 3UTZA 1N5YH 4HCRH 4M93B 1QBAA 5D72H 3U36A 3BPNB 1P1ZA 4JFEA 4GG6A 4WI6A 3AU1B 2Y6SC 1QRNE 1YEEH 2RGSA 5MEPA 3TJHD 2VXQL 4KU1A 2XA8H 3QCVL 3GIVB 4M61A 2P5ED 4ZTOL 4MZ2A 4HJJH 5E6IC 2XACC 4D0DB 1IGTA 1KYOK 3DX8A 3HTLX 4OM1L 2PO6D 5CEYB 5EZLA 5INCA 1IEBA 2V7HB 4JPVH 4OLXH 5E99H 3V5KA 4P2RA 3VWJD 5E2VL 4R4NC 1EO5A 1NGPL 1A6ZA 4FXLA 5F7FA 3O6FC 2UWEE 3MODL 1ZHKB 4C4KO 5JPNB 2EIZA 4MJ5A 2J12B 3HR5A 4JAMA 3CX5K 4TNVF 1OT2A 5DA0B 1WWCA 1UQSB 3EJYC 5KSBA 4R4BA 1I4FA 3U7WL 5KZCB 3DV6A 5DJXA 4D9RE 2DQIL 2IANA 3N1GC 4ZOAA 3QI9B 3FRPA 1RZFH 3IFOA 4JFFE 1GPOL 1T1ZB 1Y18A 4RFEA 4GW4B 4RAUB 5IB2A 4OAWB 2XWTB 2P42B 5HHVH 1B88A 4ZQKA 3X14B 3RUGE 4GW1B 3H9ZA 3RZCA 1K4CA 1DEEA 3BT2L 2V9RA 3RWFA 5BS0B 3TBTB 1P9MA 4M9PA 4KHXL 1I3VA 1NGXA 2IH3B 3ZKQD 1ZS8A 1CL7I 4IOFC 3REVB 2VXQH 2GJ6A 3CC5B 1AI1L 3QCVH 1S7RB 1AP2A 4GKNB 4X4YB 5E70A 1WUNT 4ZTOH 5CMAB 5DHVA 2N4IA 1I1YB 4U1IA 2NXZD 4OM1H 2ADJA 3DIFB 2A2QT 3F7VA 2E6PA 4QY8A 4X7CC 1KC5L 5E2VH 2HKHL 4K3GA 1MH5B 3WD5L 3BP6B 1NGPH 5D6DC 5DUBA 3LAFA 5B4MD 2Y23A 3MODH 1AD0B 4PTTA 2ERJC 2Z35A 2FATL 4OI9A 1W0VA 5D6CB 5DHYB 1KGCE 4Z7UF 1EV2E 3IDNB 4YIQB 4ZG1A 3F5WA 3OJDA 1OD9A 3T3MF 1PBYA 1HSAA 4F7TA 2DQIH 3T0WA 4Y2OA 5CZXC 1ZANL 1OTUC 1XIWB 4F15C 1GPOH 2EKJA 1GAFL 1SYSB 3GMRA 3VE0B 2EKSA 5D9SA 4GUPA 4NQDA 2VZTA 4GKSB 3ILPB 1GZPB 3VFWB 4DVBB 3BT2H 3DV4A 4A2LA 1MJJB 4EOWL 4KHXH 2V5YA 1A6AB 3SE4A 1P5VA 2X7LA 3ARVA 2CIIA 1AI1H 5IVXF 1EZVY 3TPUB 3NABL 3SJVB 1MF2L 5HI5D 3PWPE 4ODBD 2JIXD 4HMDA 5C0AD 2QQKL 1HWHB 4WW1A 5IMKA 1KC5H 5DD6B 2HKHH 3FHAA 4YC2B 1OSZB 3WD5H 4HIIA 3OL2A 2P5WD 3BD4A 3BZFA 5FF6B 3T8XB 4PRNB 4K2UL 2FATH 1CD1B 1DQTA 2CRZA 5T1LB 3WLWC 4HFWB 1T1WA 4UV4L 1QFHA 3RGHA 4OM0L 2K7QA 4U1LA 2DMBA 1XZ0A 5ABDE 3L3JA 4FZ8L 4OLWL 3SKUD 1ZANH 2K1MA 5BW7C 1QZ1A 1GAFH 4XX1G 1PZUB 4JZJB 2OCFD 3C5SB 1GZQA 1CFTB 3QWRD 4OF0A 2YC1A 4EOWH 5AZ2L 3N85L 2E8YA 1J0KA 2IQAB 5IWLC 2DM3A 1AHWB 2QTEA 1T83A 1KLUB 1TVBB 4QHNB 4ZUVB 1IGYA 3T4YB 5AUMB 5SWSB 3CK0L 1M6OB 4PGCB 4QKXB 3EDDA 4XPFL 2RR3A 2W9LA 1RU9L 3C60A 1U8KB 3NABH 2HG5B 2XNAA 1MF2H 3RQ3A 2QQKH 1Q9OA 1I1RA 1P84K 1AO7B 1KTLA 2VQUA 4J23A 3WNNA 3O8XD 4I18B 3BWAB 3VXUA 4CU6A 1CG9A 5D7SL 3MRDB 1AQDA 3MA7A 5FUCC 2YRLA 4K2UH 3U6RA 5MENE 1N8ZA 1BD2A 5I74B 3TNMB 3FFCB 1FNEA 2P24A 1JI2A 5LJYH 4UV4H 5TGBA 2OI9C 4OM0H 3PABA 2NZIA 1TLKA 4ETQA 5ALCL 4FZ8H 4OLWH 1O5DT 1XCTB 3C5JB 2ARJQ 3ARFA 1UYWL 4GBXD 4M7LL 3PHQB 5ENWA 3T0ED 1NFDE 2EDRA 1MRDL 3DURA 3ULUE 5AZ2H 1NCAH 2YD2A 3N85H 2PYFA 3FQUA 1N0LA 3PQYB 2MQCA 2FWOB 1G6RL 5DJAB 5IB4A 1BAFL 2X4PB 2XZAL 4XNQA 1G0YR 2ZOKA 2KZWA 3CK0H 3MO1A 3S8WA 4XPFH 3FHQA 4JB9L 4PJEB 3BW9B 3R4DA 2FBJL 1RU9H 1EEZA 5KVMC 3VJ6B 1DUYB 3MJ6A 3CFKB 5K59F 4OCXL 4KRPB 4MSWA 1WBZA 3ULVE 1QFWI 5DJDB 3MX0A 2CXGA 4UUJA 3MRQA 4P4RB 3ZDZF 2DICA 5D7SH 5SWZD 4Y2DA 2B5IC 2UVEA 3C6LB 1S9VB 1FCGA 3VD5A 5IVOA 3RWJB 3QDGA 4IIQC 3K74B 1D5MA 2XN9D 5MI0B 4KQ4L 4KV5E 3VXQB 2VWEE 2R2HA 5L8LB 3EO0B 1IGJB 2XKUA 3V52L 4NQCB 2X1PA 5EB9A 5ALCH 1CLYL 3GMNB 1A7QL 4ONGL 3TYGL 5D2LE 4D0DA 1UYWH 2JJSA 5D7JC 1P6FA 3CLEH 5CEYA 4K9EL 4P2OB 1ZT1B 3IU3B 2F74B 5T3XL 5I75C 4M7LH 1H8OA 1H3GA 1MRDH 4BKLB 1EERB 4Z76B 3N50A 3K80A 3CVHL 1ZHKA 4JRXE 5JPNA 5ACMA 1G6RH 1BAFH 2XZAH 5E5UB 2MWCA 4Z7VA 5L2KD 4EI5D 3VG9B 4JB9H 2FBJH 1G9EA 1R24B 4L8SB 4APQD 2ZUTA 4N8VB 4RGNC 5E5RB 1H8SA 4OCXH 3QIUB 3QI9A 4D9QE 3MNZB 1W8OA 4YBLC 5FOJA 1T1ZA 2OXHA 2F19L 4GW4A 1L7IL 4LSQL 4OAWA 2R15A 3VI3F 1CQYA 1B0WA 1KIUA 2ZUUA 5HYJB 4ZUTA 3HCVB 3HRZB 3B9EA 2ATPB 5E2JA 3TBTA 5J6HA 1UJTA 1QSED 4KQ4H 4JRYE 2DYPD 2B1AL 2IH3A 1KN2L 2VXSL 3REVA 4MCZA 4HK0B 3C5ZD 3V52H 5AG8A 3OTTA 2GQHA 1BIHA 5DJYB 4GKNA 1CLYH 2W60B 1A7QH 1PJ9A 4ONGH 3TYGH 3N1FC 2WV3A 4N0UE 5CMAA 5GGRB 1DBAL 2B20A 1I1YA 2D03L 2DIJA 4K9EH 1NGWA 1KULA 1KJ2B 5T3XH 4OZIF 1A3QA 2EH8L 1J0HA 3HC3L 4JJ5B 4LCWD 5E1AB 5D7LB 1EDQA 3CVHH 1KCVL 4LKCB 3VDAA 3QXAB 1OGAB 1JGEB 1LEGB 1IVLA 3WMSA 1GVIA 3B2VL 3HAEH 5DD1L 3D3VB 3JWOC 3IDNA 2X5PA 4PRPB 4YIQA 5E03A 4F37F 4TTGA 2YUZA 4QXGL 5C8JA 4W70A 4XCNB 3BPOB 2VLRD 5IROC 3RX8A 4ZO8A 1X5YA 2F19H 1L7IH 1OGAE 1T0NB 2DI9A 1ZLWK 4Z7UE 3MBED 1SYSA 3MOBL 4LSQH 3VE0A 2X70B 43CAB 3BAEL 4GKSA 1G0XA 3FOMB 3ILPA 3C8KA 4OKVB 3T3ME 1J0ZA 3B9KC 1DLHB 1UXSB 2XRAL 4JG1L 2B1AH 1R5IA 1A6AA 1KN2H 2BX5A 2VXSH 2CLZA 3MUZ1 5IVXB 4P4KC 5GGQL 4K3JL 3RI5F 1EIBA 2ENYA 4XCYB 3ZLQC 4X7SL 3TC9A 2OS7A 1DBAH 3TPUA 2I9TB 1MHEB 3TBVA 3SJVA 2D03H 4HLJA 1A6TA 1NEZG 2EH8H 4I9WE 2AKRB 5DD6A 3HC3H 1OSZA 1QNZL 5C09D 3TN0A 4ZFFA 1KCVH 4OSUL 5FF6A 1IGFL 1U95B 4M6ML 4XRCA 5E8DL 5T1MA 3LHPL 2BVUA 3CMOL 5T1LA 3B2VH 4ORGA 1MVUA 1LQSR 3LEYL 4PJ8A 5DD1H 2X4TA 3LQAC 4QXGH 5D4QA 4WEUD 2NY4C 3E0GA 5EIIB 4IRJB 3GB7B 2WIIB 4V1DB 2DQEL 5IR1A 1OGTA 3MOBH 5F7DA 1CGXA 3BAEH 4ZSOB 8FABB 3C5SA 3DECA 4OV5A 1YJDL 4Y5YA 5BJTB 5D2NE 4NQEA 3NA4A 3P73B 2HT2C 1FL6A 1CFTA 2F54D 2XRAH 4JG1H 4U1JB 1EHLL 5DVLA 4F7CB 2IQAA 3MRCB 2BDNL 4JM2B 1WIOA 1KLUA 4QHNA 1XR8B 5F9WC 3T4YA 5AUMA 5DUPL 1CIUA 4K3JH 5GGQH 3HMWL 3STLB 4PGCA 2D7TL 2GTZB 3W9EA 1VGEL 4X7SH 4PP1D 1TQBB 1LEIB 5F7LB 3MLWL 3KYMA 1K8IA 4HKXB 4HQQL 4P5TC 4WU5B 1RUPL 4MX7B 2NY3C 4QNPE 2F53A 4AZ8A 2VLJE 1QNZH 2XKSA 3VGAC 1AO7A 1NDGB 3DUSA 3JV6B 4JLRB 1UJ3C 3BPLC 3KPMB 2NY5L 2VMFA 2HFTA 4KY1L 1U91B 4OSUH 3WJLC 4WW2F 5HGBA 3MRDA 5KAQF 1IGFH 3BUTA 4M6MH 2D7OA 1JL8A 4YDIL 4DZ8B 5E8DH 3MRRB 3TT1L 4K7FB 1SMAA 3LHPH 1P53A 3CMOH 3FFCA 3QJHA 3TNMA 3LEYH 1S8DA 1YPZF 3TO4D 3IDXL 4FTVE 1CICC 2VC2L 3HE6C 1FO0L 3MRJB 2DJUA 4Z18A 1UEMA 3C5JA 2DQEH 3PL6B 1IL1B 1S3KL 5EN2A 5I16A 1YJDH 3PHQA 2J3SA 1MCQA 4ZFOL 4BFEA 1KPRA 5I18L 3DNKA 2WP3O 3AFLA 2EZ0D 3K2UL 4S0SD 1EHLH 2OX5A 3W11D 3PQYA 2BK8A 1A9EB 2BDNH 1I85C 5E56A 3DROA 4YE4L 5D8JL 3NIDE 3LKRA 4MAUL 5DUPH 5EPMA 3GSOA 3HMWH 4W4OA 1QPXA 2D7TH 5BO1L 1VGEH 3G04B 1OF2B 4PJEA 3QULB 1OLLA 3MLWH 4HQQH 3VJ6A 3D85D 2NZ9C 5MEQB 1DUYA 4KK5D 2XTJD 2X4NA 5DVNA 3EYFB 1RUPH 5J6GB 1V3JA 1QSFB 1WCBB 1YYML 1JWSA 4NCDA 1OP3H 1UWXH 1KPVA 1NDMB 2NY5H 4L9LA 5GS3A 5E24E 4KY1H 1VADB 2UZXB 1KCSL 4DN4L 4P46C 2KUTA 4YDIH 3V7MA 2WAHA 3C6LA 1S9VA 1YNKL 5J1AB 3RWJA 5DJ0A 3TT1H 1DANU 5K59E 1NANI 4YDJA 3VXQA 5A43C 1DQJA 3EO0A 5I1GL 3IDXH 1LEKA 2WIMA 3DGCR 2VC2H 1FO0H 4CMMB 2ARWA 4PGZA 1H5BC 4YDLB 5HYSG 1FIGL 2CIKB 3ZKNC 5DQJB 4K7PY 4GKOA 1F3DH 4P2OA 1S3KH 1ZT1A 3IU3A 1B6UA 3L3HA 3SDAD 3ARXA 2XA3A 2DL9A 3WKML 1JPGB 5I18H 4Z76A 3K2UH 5FYKU 1I8MB 3FB5B 3VDBA 5HI4D 4XP9L 1PX4A 3Q48A 4LDOB 4YE4H 1EPFA 5D8JH 1S7QB 4MAUH 2XN9E 1JV5B 5BO1H 5D1QC 2V5TA 4UQ3B 1R24A 3FB8B 3UC0L 1M71B 1S9WA 4NJAL 4I0PC 3LN5B 3ZSTA 3QIUA 1YYMH 3MNZA 1ERNA 4OJFL 5EZIL 4YFDB 3MRKA 2E7CA 3BJ91 4K8RC 4UDUB 5C2UB 1KCSH 4DN4H 2JKXA 3MRBB 4LFHG 1YNKH 4UV7L 1AXIB 3HCVA 2ATPA 4OFDA 3P0YL 4UIKL 4KK9C 3VXMA 5I1GH 3QRGL 4HK0A 2YHGA 3RNKA 3UDWA 4DZBA 4ODWB 1FYTE 2MPAL 2IBGA 3VI3E 3V6OC 5DSCB 1N2RB 2W60A 4PRHD 5C86A 2XY1A 2BSED 5GGRA 1FIGH 3SDDC 1F11B 2D9QB 1ND0A 1S5HB 4QOKB 4OZIB 2R2EB 1CVSC 3PGCB 5HI3C 1X5LA 2B2XL 3ARPA 4JJ5A 2JJVA 3WKMH 5T3ZD 2X4SA 5E1AA 4AIXA 3QWQB 1TPXB 1IT9L 4XPHL 1PYWB 3B4NA 5IM7B 3UYPA 4XP9H 2CK0L 4Z0BL 5JA9A 3QQ9D 4HW6A 1KXQE 5SWQB 4QOKE 1LEGA 3MV9D 1QSEE 2ICWI 4M00A 1QFOA 4GFTB 3RDTD 3AREC 3QYCA 4M93C 5JLZB 1ORQB 4FQXB 3UC0H 3DSNA 4LCYB 4NJAH 5FCUL 4NKMB 3VXTB 3B83A 3KPNA 4HWZB 1BF2A 4OJFH 3WFCL 3BZDA 5EZIH 4PIRF 5IUSA 2M8XA 1EO7A 1T0NA 3KPOB 4I1NB 4QGYA 43CAA 4EDXA 3BN9D 4NUJA 4HMCA 1N5AB 3FOMA 5T1KA 1MLCB 4LCWE 4UV7H 3ZT7A 1DLHA 4H5SB 2CPCA 5JW4N 1UXSA 3P0YH 4UIKH 3WS3B 3FONA 1RJCA 5HHMD 5TF1L 1IE5A 4YGVB 1G1YA 3MV8E 3QRGH 3U0PB 5F9JA 2MPAH 4JKWA 3RTQC 3STZB 5ERWA 5E9DB 3WO3B 5HD8C 4EZMA 1YNTA 4XCYA 4YH6A 4ESKA 4MNQD 2BCKB 2AXHA 2NYYC 2I9TA 5CP3A 5FIEA 3ES6B 3OB0H 2H2PD 2A0LC 4NSKB 5IIEB 5C7XL 1FVDB 3VXSB 2AKRA 4HH8A 2B2XH 4PJBA 3QEQB 5TDNB 3RY6C 4W4NA 2HVKB 3P77B 5J7CC 1IT9H 4XPHH 4PBXA 2YPLA 5GGSB 3P40A 3RGVB 1U95A 2CK0H 5BW7A 4LHUG 4Z0BH 4NFDA 5IB3B 1YUHA 3ARBD 4X99B 1K8DB 2QBWA 1QRKA 3UTSA 1VGKA 3ARDB 1AGBB 5FCUH 5C0BB 3NZHL 3J8F7 4IRJA 1MY7A 3GB7A 3QQ3A 5GZND 1H3VA 4V1DA 3WFCH 5C0JB 1Z3GL 3GO1L 3UCRA 2H3NB 3UTTD 5JNYA 3RVWC 1G7PA 4ZAKD 3BRFA 1X7QB 4GH7B 1RV6X 3ME0A 5ECJE 3BP4A 5C09E 3GKWL 5CZVL 2CO6B 3P73A 1YEJL 4S1QL 3LSOB 4QHKJ 5I8OL 3MQIA 3P9MA 3QHTC 3ARGB 4U1JA 5TF1H 1IAII 1S7UA 3RVVC 1T80A 3NCFB 4F7CA 1BJ1J 4TRPL 1G6RB 4JM2A 5IJKA 3SPVB 4WFGD 5EFIB 1XR8A 2I24N 2R2BA 5D7IB 1I3RA 4LSPL 3RWGB 2QQLL 3STLA 4YHZL 1S7XB 4GRMB 2X4OA 3U7YL 1XEDA 5C7XH 4WU5A 4MX7A 2R9HC 1R3JB 1NDGA 3JV6A 1MI5B 1J0YA 3KPMA 4TNVK 5EUOA 5F1SA 5CSBA 5EU4B 3TP4A 2AJXL 4DZ8A 3MRRA 4GMTL 3K1KC 2FHFA 5A16B 2IBZX 3BUYB 2IALB 1H3XA 1FN4B 3NZHH 1AXSB 1NAMA 3M1BB 4NO2A 3MRJA 5AZEL 5DI8B 3BX7C 5JW4M 1JNLL 1Z3GH 3B6SB 1CBVL 3MV7D 3GO1H 4HWNA 3T65B 3PL6A 1CQKA 4X98B 4PJAF 5DDHB 1YPZE 3GKWH 5CZVH 5GGTL 4ENEC 1YEJH 3MYZA 4S1QH 5I8OH 2VLLB 5FAAA 3CVHB 5GS0C 2IPUG 4TRPH 1A9EA 2NY0C 1JMZA 2YPKB 3Q3GB 1TITA 1U36A 2O93L 4LSPH 2NTFB 2QQLH 2R23B 3PWUB 3G04A 2VDQL 1OF2A 3MYJA 4WFEE 3CDCA 1L6XA 3HAEB 5BQ7B 4PJHF 3U7YH 2Z91B 3CSPA 4U1MA 5DJ2A 1VKXB 4JPKL 2Q3ZA 5J6GA 1C16A 4NFBA 1RQ5A 4AIZB 3BHBB 2XZZA 1WCBA 4LCCB 5I8EA 5BZDB 2CH8A 2VUOA 4U7KA 2EC9T 4YHML 2HKFL 4IBLT 1VADA 1YEIL 1T7VA 4HUMB 4GAGL 4NUGL 1UH2A 2AJXH 4GS7B 5J1AA 1ADQL 2CRIA 4WWKB 5D7JA 4GMTH 1FVCB 2YKLL 3WUZA 1YMMB 4HAGA 5IOPB 2IC2A 4I3SL 5DZNA 1T0PB 2N56A 5EU5B 2GK2A 5AZEH 4CMMA 4JFED 1AHWC 1JNLH 1CBVH 5J9PB 2CIKA 4XCEB 1UENA 4QF1A 5DURD 4K94C 3ROLA 5GGTH 1V3LA 2AV1A 3VW3L 5ANMB 4HIJB 1MFAL 2IPTL 4YK4C 2OTUB 2BERA 4OCYL 5IW1B 1I8MA 2OTWB 3SGEI 3BEWB 4HJGA 5SV4A 5TE6L 1Q9KB 5GS1C 1S7QA 4LP4A 4PJ7F 3TA3B 2VDQH 5KN5B 1Q0XL 3IF1A 3FB8A 5ANME 4ZFZB 5I74C 1M71A 4WY7L 4PY8J 1KBGL 4JPKH 3LN5A 1AH1A 3BD5A 1J1XL 3G08B 1A6WL 4X9GA 3ULUC 2VR5A 5CD3B 4YHMH 2HKFH 1YEIH 3IGAB 2OL3L 4GAGH 4NUGH 4KHTL 3ZYOA 1JN6B 3MRBA 5JO5B 1A47A 4WFFE 1ADQH 2PYEB 4R2GB 1SYVA 2YKLH 3T2PA 1P69B 3MRFB 4GQ9L 3NCBB 4GKZA 2FD6L 5HGAA 5ID1B 2LFGA 4NHUB 1WSST 5DMGC 4I3SH 5DMKA 2HMID 1DQQB 1MLBB 3RZCD 5MHSD 5FGBC 4KKAC 5HGHB 1N2RA 3ULVC 4WHTB 4H20L 2AJUL 5CEZL 1NGZA 1F11A 4MDIA 5FDYA 1EK3A 4ALAL 2GJ6D 3QNYB 2DS4A 5HJ3B 4RAVB 3PGCA 4N5EC 5B3NA 3VW3H 1EAPB 1BVLB 4GRLD 1MFAH 2IPTH 2ITDB 1B0RB 4OCYH 3HI1A 2HT3C 2VWEC 1PYWA 4J3UA 2EE2A 3PDDA 3G9VA 4OIBA 1MCBA 3GSNL 5TE6H 5J1SC 5EOTB 1FFNB 5GZOD 2AW2A 4Y19E 5SWQA 3NPZB 4P23C 5HDLA 3QJFB 4E9LA 5BCAA 1Q0XH 5F6HI 5JLZA 1ORQA 4FQXA 1MCFA 4LCYA 1RZKL 1VSCA 3B9KA 4WY7H 1KBGH 3L5JA 3VXTA 4P2QB 1J1XH 2W0KA 1A6WH 2BVEA 5F1KC 1NFIB 1G7JB 1F4HA 3KPOA 2E7MA 3O9WD 4Y1AB 2BVOA 2OL3H 4KHTH 1CN4A 2GTWB 3FAWA 1QP1A 4TOYL 4GQ9H 3TWCL 3WS3A 3W5MA 2FD6H 3CCHB 3PUCA 4WUUB 5L9DL 3IU4L 4XC3L 1KSRA 1JZ4A 2NNAB 5IBLD 5E9DA 1EVUA 3OHXB 3RZWA 1X6NA 1IC7L 2AJUH 4H20H 5CEZH 4Q9QL 3NFNA 2FL5B 3LH2L 3OB8A 3ES6A 4YPGB 1V7NL 4ALAH 3ARSA 2J8UF 3SKOA 3E3QE 3VWJC 2VZOA 2IFFL 1FVDA 2VZVA 3VXSA 4L8SC 4Y4KB 3T3PF 1W72A 1XFPA 3QEQA 2HVKA 2VAAA 3LS4L 3ILQC 5GISL 3QUZC 4HEPG 3I75A 4ONOA 5GGSA 3UTOA 3GSNH 1TVHB 1RIHL 1NGQL 5L0QB 3O4OB 3P3YA 4JKPL 5IB3A 1X5JA 1NC4A 4X99A 4UIMB 4EN3B 1BLNB 1BFOB 4R97B 5F89A 3ARDA 5C71A 4JCMA 1AGBA 2YBRB 1T5WA 5FO9A 4XH2B 1RZKH 5GHWL 1PVHA 2IAMB 5HY9A 1FO0B 3DETC 3T0XA 3B2UD 4ZXBC 3DMMB 5JOPD 4L3EB 3TH4T 4MB3A 1CTOA 2A6KB 3HG1E 1X7QA 4HZAA 4ZFOB 5GS2H 3QIWB 5E8NA 4TOYH 2H41A 3TWCH 3D18B 3ARGA 4P5TA 1JIBA 4NO0B 5L9DH 3IU4H 4XC3H 3JV4A 5KSVA 5E1HB 1G6RA 4X6CA 3S88L 3D87B 5EFIA 1UJ3A 1QBLL 5D7IA 4OCSL 1IC7H 1S7XA 4Q9QH 1WLHA 3WJLA 3E1F1 1YMHB 3LH2H 4N0FB 2IPKA 1RZJC 2Y7QB 2DRUA 1V7NH 4MD4B 3WXVL 3VXRD 1HSBB 4U1GC 2IFFH 1Q94A 1L0YA 4EQ3A 4X6FA 3BPOC 1MI5A 2EO9A 3PG2A 3LS4H 4PJGF 4G6FD 5GISH 1CICA 1LK2B 2DWEA 4TUJB 4U1KB 3EJJX 4Y5XB 3X3FL 3IETB 1RIHH 1NGQH 5EU4A 1G84A 5JZ7C 5HHXL 4JKPH 1R3IL 1MFDL 3O11B 5EOCJ 4POUB 4OF6A 3VFTB 5A16A 1AFVL 1LILA 3IFPB 3BUYA 2BC4B 1SJEA 3WL9A 3X3GL 2IALA 4PLKC 1FN4A 2OP4L 1AXSA 5FOBB 3Q5OA 4F9PC 4N0CC 1H3PL 3IXTB 1Z9OA 5C0CE 4OUOA 4C56B 1G0DA 2IH1B 4X98A 5DDHA 3IXAA 4NRYA 1UWEL 2A74B 4FXKB 4I2XE 4QWWC 2MJWA 1IMHC 2R1YB 3VFRB 4JZOB 2V2XA 4MQ7A 2VLLA 3TNNA 3QDJD 1HEZB 4KRLB 3S88H 4QHUB 4PJAE 1QBLH 2CLRB 4OCSH 3PWUA 2DQFA 1AQKL 1JBJA 4M6OL 4PJ5B 1HYRC 5BQ7A 2Z91A 3FB6B 5CS7A 3WXVH 5FYKD 2X4RB 5HVWA 3U9PL 1VKXA 5D2NC 5EBWB 2J1KA 4JKKA 4X83A 4AIZA 3QUYD 5DMIL 3STBA 3SBWC 5BZDA 4GW5B 2YOCA 3AVEA 3NN8B 4QXTA 3X3FH 4R96B 4F37K 4PJHE 3SCMD 5HHXH 3QXDB 3TEUA 1R3IH 1MFDH 5AWNH 4WWKA 2EDLA 1VHPA 2NXYD 3LKSA 1RZIB 3DI2B 4V2BA 1YMMA 5DTFA 4X4ZA 4IMKA 1AFVH 1FC2D 1LVEA 4MJIB 4NPYB 1GOFA 1HOCB 4LPYA 3KPSD 5JORA 4XHQA 3X3GH 5JHDD 2FDBP 3EYOA 2OP4H 4X7TB 1A5FL 3MJ9A 3V0WL 4ZPVB 3F7QA 1D6VL 1H3PH 3QUXC 1BECA 5J9PA 2R1WA 3I3DA 4XCEA 1ZKAA 1OQXA 5IBTL 5F7KC 4LOUD 1JNHA 4LLUA 4BH8B 1UWEH 5J12C 4PREB 1DJSA 4HWBL 3NMEA 5ETUB 4OZ4A 4HIJA 3RI5K 1IGCL 3BEWA 4PJ7B 2FIKB 5I8CB 1LE5B 1AQKH 2Z9TA 1IGIL 4M6OH 4QT5B 5FGCB 3O3BB 5GGVY 4Q58C 1U42A 3H7LA 1U8JA 5EU6B 3U9PH 2LAAA 4UBDD 1VERA 4NJ9L 1A7PL 2FRGP 4WO4B 5DMIH 4MAYC 4KMQA 3WKNA 4HG4K 2YA0A 4PJ7E 1GSMA 3T77B 1RUAL 1H3WM 3VD4A 3V6OA 5ICZB 2D9CA 3IGAA 3VFPB 3VFNA 1JN6A 3O4LD 2D4DA 1K5NA 2HLFC 3MLTB 1E4XL 4MVBD 4BQ6A 5LGJB 5HHNB 3MRFA 3EAKA 4J1UB 5KVEL 3D39D 5CLWA 3HZKA 3P4OB 5ID1A 4NHUA 3OKEB 2C1PA 1DQQA 1MLBA 1SVZA 3FZUC 1A5FH 1URLA 3V0WH 1D6VH 2ILLA 5L88L 4K3DL 5F1IB 4FG6C 1CLZL 5IBTH 1NMCB 3HI6L 2BHUA 4KXZH 4HWBH 1EAPA 1BVLA 4Z7OF 4QTIL 3VXNB 1AKJB 2EC8A 3S5LA 4R0LC 1JZ2A 1TNNA 1IGCH 3IFNL 4HKBA 4YHYC 4JFDE 2E27L 4MQSB 1FFNA 1XCQB 2F8OA 1LP9F 4M02A 5TDPA 4FQHA 1HILB 4ZO6A 5DUML 1A22B 5CCKL 2VZ3A 1PG7L 4OFYA 4PTUB 3QJFA 1IGIH 4F7EB 1A7NL 3LB6C 4LFHD 15C8L 1ED3B 2WWMD 3B5HA 4JKLA 1FBIL 4UT7L 5IQ9B 4MLSA 4NM8L 1BQHG 4AT6B 1U8MB 3BIBX 3N1QC 4P2QA 4NJ9H 3W9DB 1A7PH 2ATKA 3DPBA 4F2MB 1RUAH 1HI6A 2DB8A 2P5EB 1SBBA 3T4AB 3V5HB 5I66A 2ESVE 2H9GA 3NBNA 4YDLC 2L7JA 4Y1AA 4X8JA 1YY9C 1T3FB 4JFFA 1IGML 2PO6B 1E4XH 2G2RB 4EKXA 1WBXA 5GQBA 3Q6FA 1AR1D 5KVEH 2OJEB 1JTTA 2EDOA 1Q9LB 1FRGL 2ED9A 1ZOXA 3RY6A 4KVNL 3OHXA 4G3YL 1SMOA 5L88H 4K3DH 1P6AB 5JMOC 2J8UB 4YPGA 1CLZH 1NMAH 1KT2A 1KJVA 3KYOB 4ELMF 2UVFA 1CD9B 3EW3B 1WAAF 1JPST 4HZLB 4W68A 2AK4D 3HI6H 5C6TL 1M7DB 4RA0C 2V2TA 3BN3B 4QTIH 2YMXL 4JDZA 3U82B 3KPQB 3MJ8B 4Z8FL 5CHNA 4LVNB 3CMGA 4LLWB 4OGXL 3MCKA 3IFNH 4NZRL 1TVHA 4NN6B 2E27H 3CZJA 4JFXA 1ZVHA 4MLIA 5DUMH 5CCKH 1PG7H 4UIMA 4EN3A 1BLNA 4IRSD 4WJ5B 1A7NH 3T3PE 15C8H 2YBRA 4UT7H 1FBIH 4NM8H 4XH2A 1CVRA 2YSSB 3PWNB 2XV6B 5DQ9A 2GUOB 3DLQR 1FO0A 4TSCL 1OP5H 4PJ8D 4MXQD 5J4MA 4M1GL 4IHOB 3DMMA 4L3EA 1DBJL 4F7PA 2GIYA 4JO3L 4QRPD 4ODUA 2I60L 5AEAA 3WFDL 2PXYC 1IGMH 5DJCB 4LLDA 4ZFOA 4KDVA 5HBBA 3PIQB 3MNWA 2Q87A 2X4QB 4MZ3A 1EGJA 3KXFB 4N0RA 3EFFB 3D18A 4YGAB 4NO0A 5IMMA 1FRGH 2J7LA 4NQED 4KVNH 4RMWA 4N8PA 4G3YH 4CN1A 2WW8A 3M8OL 3G6JF 1YMHA 4LHUD 2NY2B 4JANA 4N0FA 2VL4A 4MD4A 4Y4HC 5BRZD 3V5DB 1HSBA 1F2QA 3KS0J 4RFNC 3GSQA 3L5WB 2W38A 1ROWA 3DRQB 4LLYB 5C6TH 4DOHE 2I9LA 2YMXH 4PJGB 5EZJA 5F88B 3BDXA 5M94B 3QPXL 3PWPA 4Z8FH 3O45B 3TZVB 1FNGA 1LK2A 4OGXH 4PGEA 1BZ7B 1J1OL 4U1KA 4NZRH 1CK0L 3IETA 2AEWA 4MA3B 3HZYB 3B9AA 3O11A 2YUXA 3BOVA 4U3CA 3QDME 1PFCA 2NX5D 3BYTA 4I5BA 1WF5A 3QUML 5AG9A 2ZNWA 4LPTA 1CE6B 2PW1A 3IFPA 3QIBC 3H0TB 2PKDA 3IRPX 5FOBA 3VFUA 4AIOA 4TSCH 1YQVL 5IHUL 1MCHA 3IXTA 2OMNA 4M1GH 1DBJH 2L7UA 5F9AC 3V6FA 4C56A 3BYYA 3DVIA 4JO3H 2IH1A 3SHSA 2I60H 5DFTA 3WFDH 4LHJB 1W8NA 3FO0L 1A1NA 3HNSL 4OZFA 1IARB 3IKCB 2L4OA 2R1YA 3VFRA 2JIXB 5EBLB 5C0AB 1AJ7L 5IB1B 3D0LB 5T3ZL 4LCUB 1TZGL 4KJQD 1HEZA 1MCLA 2P5WB 1CDBA 5J8OA 4MJ6A 4PJ9D 2CLRA 4FQQB 4KRNA 1IC5L 1M7IB 3M8OH 3NIGE 4KVCL 2DM7A 4PJ5A 4NQSA 4WU7B 3PV6B 1RZGB 5EBWA 2W0FB 3MACL 3H3KA 4GJTB 1SEQL 3QPXH 1ZMYA 4GW5A 3ARYA 2EIBA 4G8FB 2N7BA 1J1OH 1CK0H 3LKPB 3C09B 2OL3B 2Y6SD 1JF1B 3S36L 1MIML 1XT5A 5CIPA 3PWLB 4M43L 1LO3L 3SGDI 1OVZA 3PGDB 3QUMH 3NVQA 3S4SG 4NPYA 4ZO7A 5MENA 3X11B 5DVMA 5E6ID 5DJ8B 4X7TA 4J3VA 4C55A 1YQVH 1HH9B 5IHUH 4ZPVA 3FFDA 1P5UA 4MWFB 4Q0XL 4G6KL 1BBJB 3K4DA 3TM6A 4R4ND 3WIFB 4AM0B 4BH8A 3LRSB 2NR6C 3O6FD 4D3CL 3FO0H 3HNSH 4PREA 4LCIL 1CL7L 5ETUA 3UXFA 3IJSB 1AJ7H 3VH8G 1TZIB 1NCTA 3DHJA 5T3ZH 1TZGH 3GSNB 3O8XB 1UZ6E 3EJYD 4WW2C 4E42A 1LE5A 3TH3T 1IC5H 3O3UN 1CFNB 4JGJA 4KVCH 3VWKB 2IFGA 1NJ9A 1B6DA 3D0VB 5JHDE 3GGWB 1OP3K 1UWXK 5I8KL 1W0WB 5ADOL 3MACH 1I7TA 3EOAA 4QXWA 3HC0A 4X80L 1SEQH 3T77A 2G60L 1J8HE 4NDMA 4Z7NF 2YWYA 5ICZA 3VFPA 3S5LG 4GAFB 3WO4C 4OQTA 4GBXB 3S36H 3DO7B 2WINA 3MLTA 1MIMH 4IOFD 4O2EA 4M43H 1LO3H 5LGJA 5HHNA 3T0EB 5D5ME 5ITFB 5HXMA 3IDYB 3P4OA 4DGYL 3OKEA 3GJFH 3H9SB 1MFCL 4M7LT 5EOCL 1T5XB 3O3AA 5B22A 4Q0XH 5C70A 4G6KH 3B8SA 5ISZD 2C4FT 5HSFA 1UH4A 3CXHK 2VJXA 1U0QA 2DJSA 2J4WL 1I8KA 4P23A 1RUQL 2XXMB 4D3CH 1LNUB 3FCTA 4LCIH 1CL7H 3TFKC 3LKNB 1ZGLB 3VXNA 1AKJA 4O51B 3GI9L 1JZ7A 4ZUUB 5FYLD 3BSZL 3F7PC 4PLNC 3D5OF 1XCQA 4J2XA 1HILA 5SWZB 4NQXA 4PTUA 3RKDC 4F7EA 5DD3L 1F00I 3SGJC 5I8KH 1UA6L 5CZXD 2BNUB 1OTUD 2DJ4A 3GBML 4DK3A 5J1TC 5ADOH 4AT6A 1BEYL 1U8MA 4I13B 4P3DA 3HE7C 1LP9E 4X80H 4YWGL 1MAML 2G60H 3T4AA 2VZ1A 2FB4L 4Z77A 1YNLL 4NO5B 3LEXA 1T3FA 1N59A 3MGTA 1RULL 1JNNL 4Z7WB 5T5NF 3VWJA 5DVKA 1BQUA 4HWUA 4LAJH 2OJEA 2HH0L 4X6DE 4DGYH 5KSAC 3IFLL 1C08B 1MFCH 3EOBA 3LDBC 4JRYA 4QLRA 3QUZA 4G9FD 5CLTA 5EOCH 1IILE 4ZUSB 5JMRA 1BFSA 5TQ2L 3TA3C 5L2KB 1S7VA 4JRWA 3KYOA 2J4WH 4HS3B 2E3VA 4LNVA 2H2SC 1RUQH 4APQB 1M7DA 3VFMA 4WFHE 3OKKB 1M7XA 5C0NC 3GI9H 4QHMB 3MJ8A 3OR6B 4LLWA 3BSZH 4LPXA 1QBBA 3WLWD 2IJ0C 4ELME 4FFZL 5BVJB 1WAAE 2B39A 4OQ1A 5DD3H 4BA8A 1WTGT 2CDEB 1DQLL 4XWOC 4HKJB 3DSFL 1UA6H 2SEBB 2ZOLB 1I7ZB 2YSSA 3GBMH 3PWNA 2DYPB 5JW5B 1IEAB 4EDWL 3FB7B 1BEYH 5JIIA 4ONFL 3VFSA 5JOEA 3BZEA 4YR6A 4KWUA 3C5ZB 2QADC 1YN7B 4HGWA 4YWGH 1MAMH 3UBXB 1PGRB 4K71C 3PDOB 2FB4H 3P0GB 1YNLH 2C3WA 4N9GB 2HJLB 1UZ8B 5C08B 5DJCA 5GGTA 3G5YB 1MCIA 4TN9A 1RULH 1JNNH 4ZOEA 2X4QA 4PP2B 2FJHB 4S2SB 2HH0H 4FMKA 3DOSA 4UDTB 3IFLH 1OAXL 3OB0K 1OW0A 4MA1B 3WNLA 4EJ1C 1U6AL 4RZCB 1NC2A 1S9YB 3T1FB 1FQ9C 4UOW0 5TQ2H 3VGHA 3V5DA 2ICWJ 1XGQB 2VSDA 2E7LC 2EYTB 1CDYA 4Q9BA 4HGMA 3A6BL 3B5TA 1BQLL 4OZFG 3G6JE 2P8LA 3T2NL 3IKKA 1ZSDA 2XWJB 4Y5VB 4F9PA 4HX1B 4XMLL 4MA3A 3MBEB 4JY4B 4U6TA 4U6VL 4FFZH 5D7KD 2P4AB 2AI0L 1GH7A 4G8IA 5EU3B 5CWSB 1DQLH 1A1MA 1QFWL 3DSFH 1CE6A 3LN4B 1ZT4B 5I2IB 5CBEB 2J6EA 3E3QC 1JCKA 3H0TA 3KDMB 1Y6NR 4EDWH 4ONFH 3K2MC 1BPVA 3ZSSA 4I0CC 2RAMA 1KIQB 1ODAA 2X41A 4UTAL 4Y4FC 3ARZA 3BN9C 3UPRA 4BQCA 2EC9U 1FSKC 1QR1A 1N26A 2VLKE 4HIHA 2VZSA 3IKCA 2JIXA 5EBLA 5C0AA 3D0LA 5J3HC 4LCUA 4JQVC 2P5WA 3AS0A 4QRSA 5F1NA 2GCYB 5E8PB 1OAXH 4OZHF 2NX5E 4FQQA 1GGTA 1U6AH 2UZYB 1LDSA 3LV3B 1RZGA 2AV7A 1VFUA 3TVMD 3ZDYF 1IQWH 2VDLL 4L9DA 5IF0B 2Z92B 2IAMC 4WIQA 3A6BH 1WWWX 1BQLH 4L4VD 4G8FA 3T2NH 3X13B 5JDSB 4G8GE 2NLJA 3LKPA 4XMLH 4CNIA 2OL3A 1JF1A 3I3BA 4U6VH 2JCCF 2AI0H 2FX9L 3PWLA 4M62L 3I2CL 1T20B 1LGVA 3PGDA 4YEFA 5FV1L 2F54B 3QWRA 1QFWH 3QIWC 4RMVA 3MMEB 5IHZB 4OLUL 5IW6A 1KXTB 4OKDA 2R0ZL 1HH9A 4O02L 5D7JD 4NHCL 4BUHA 5I0DA 4MWFA 4UTAH 4KPHL 5F8QC 3C87A 3AGVA 4U6YA 1RK1B 4XXDA 4AM0A 1MCNA 3LRSA 3P4NA 3BEVB 3QT2A 3IJSA 3BGFB 4I0KA 4PD4J 4U1HA 5DRNA 1A64A 4QRRD 2GFBA 4JCLA 4AEIL 4KUCD 4LVHC 4MAYA 3BMVA 1DCLA 1GHFL 2XZQL 4RGND 4Y5XC 5L6YL 3V8OA 1YDPB 5EORL 3D0VA 4ZOCA 4RSVA 5ELIA 1W0WA 1EBAA 3WNKA 3RPIB 2VDLH 1TIUA 4MHHI 3TO4B 1OY3B 2EXWC 5FKAB 2VUYA 5B38B 5ACLA 5HYFA 4NZTL 4AG4L 3KLSA 1U41A 1C12B 3ZE1F 3BH8B 1KJMB 4J7RA 3I6LE 2D31B 1PG7X 2FX9H 2WSKA 4M62H 3DYPA 4TVPE 4Z78A 3T0EA 3I2CH 4JFHD 4H1LA 1FPTL 3DVNB 3G5XB 4FN0A 5ITFA 2X1WL 2MCPL 2NY1C 4KDWA 4D8PB 4PLJC 4Z7NE 2ZWLT 4OLUH 3VMOA 2W0PA 2R0ZH 1OAKL 4O02H 4OB5L 4NHCH 3IDGA 1T5XA 5ALBL 4R0LA 3I02A 2VLMD 4KPHH 4RIRB 4GQPH 4LAQL 4MHHG 4HUXB 1GRWA 2IBBA 2FR4A 3SDXB 5IKCA 1LNUA 4NZDA 4HHAB 2XTJB 3ZKXB 4S1SL 4O51A 2VISB 2V2WA 4ZUUA 3RHWF 5I1JL 1HCFX 1CU4L 2GKIA 4AEIH 4AL8L 1GHFH 2K3TA 2XZQH 3ZDXE 3UZVB 5SWZA 1AGCB 5L6YH 3CDFA 1P7KB 5EORH 2BHYA 2ADIB 4MQTB 2BNUA 2XN9A 5HHOE 5D1XC 3PV7A 5H94B 4Y16C 3INUL 2BXYA 2J2ZA 5ISZE 4JGUA 1T7YA 4NZTH 4AG4H 5FXCH 3B9KD 1RJLB 4ERSL 1CGVA 3OJ2C 4P57B 4GG6F 4Z7WA 5FKPB 3SDAB 1FPTH 4OBSA 1UWGL 1S7SB 2FYYA 4P4KD 2MCPH 5IB5B 1F13A 2F5BL 4IOIA 5IJVB 1X4XA 5HYEA 4FA8A 4OB5H 1OAKH 4L4TE 2VRAA 5B8CB 5BXFA 5FM8A 3D69B 4YHIB 5ALBH 1R6VA 5B39B 5EU7E 3AM8C 1B0GB 4LAQH 5L2KA 4EI5A 3DYMA 4HS3A 1KB9K 3DXAE 5GRJL 4APQA 1YEFL 5HVHC 5C0GA 3H8NA 5FYKL 3OKKA 2BNRE 2UYLA 1FJ1B 2ZG1A 3EZJB 4S1SH 5LG1A 3KPLA 5ESQB 3OR6A 4RWYL 4JGMA 5I1JH 2AS5M 2OXGA 3FRUB 2XWBB 5E95B 1CU4H 1CGYA 4HPOL 4AL8H 5KSBF 1A7RL 1XF3B 1JPTL 4RCAA 3BDBA 5BVJA 3M07A 2NY4D 2Q1EA 4Z0XA 5LAXB 2CDEA 3QUMB 4HKJA 1BQSA 1UGNA 4XAKD 1T89C 1QSEA 1NC4D 1D6EB 1MIEL 4RGMB 4ACPA 3OKMB 1MHPL 3C5ZA 2QQQA 3INUH 3MUHL 4EI6A 4PRHB 2HT2D 3KHQA 2V9TA 4N9GA 4OCMC 4ERSH 2EO1A 2Z8SA 4LEOB 1UZ8A 3DTXB 4EQ2A 2VH5L 3G5YA 5D93B 3FO1B 1MCWW 1QLEL 3QG6B 4PP2A 1QTYT 4S2SA 1UWGH 1ZLVH 3ZYZA 3W0WE 4LCWA 2F5BH 4UDTA 3H6JA 4ELKB 3OSKA 4JREB 4HD9A 4RZCA 1BX2B 3NCJL 5HVFB 1S9YA 4P5TD 2O5ZL 3R1GL 3T1FA 2NY3D 2YA1A 3MV9B 2AXJA 3RDTB 2WQ8A 1UCBL 5GRJH 1ZWIA 1YEFH 5F6HJ 5FYKH 4X8XA 3WN5C 1HQRA 3L95A 2VLRA 3BI9X 4NCC1 4RWYH 1R3LB 2Z93B 4LP5A 2BVTA 4HUVB 4Y5VA 4HPOH 3MBEA 4JY4A 4L3AA 1A7RH 1JPTH 3GSWA 3EDJA 3QFJE 3NIFF 5EU3A 1Y6KR 3MUJA 5CWSA 1CICD 3HE6D 1PEZA 1ZT4A 2X1XR 5I2IA 3GJFB 2R56L 1MIEH 5FO8B 5JXEC 3GSXB 4JN2B 1MHPH 4LGSB 4LRIC 1KIQA 1U2HA 4NCC2 5IBUB 2BSSA 4FOMA 3QEUB 1HHJB 4U7MA 3JVGA 4MNQB 4PJFB 5I1DA 4I48B 4O2FB 5HDOA 1NSNL 2VH5H 3S36X 2JJTC 4HWBA 3IDJB 1QLEH 2D7PA 3CSYB 1FVEB 5FEBA 4PJDB 4HUWA 5GJSL 5C09A 2BNQD 1KYOJ 2NTSP 4XP6L 2YR3A 3U83A 1NCDL 4E41D 5CD5C 2GCYA 4OZHB 5E8PA 3DX9B 3HZVB 4LVNC 3MOAL 1HHHB 1I1AC 5E2WL 2NZ9D 3NCJH 2ITCB 4NN6C 4S1RL 2O5ZH 1P7QD 3R1GH 3ARBB 4Y89A 5CSZA 1Y0LB 2A6IB 3JUYA 1UCBH 3AB0B 5JW4Q 2P47B 5JHLL 3BD3A 1F3JB 5IF0A 3CX5J 1E6JL 1HXMA 5I73C 2AJ3B 4P46D 2XICA 2BJML 4Z9KB 5JDSA 3UTTB 4ZAKB 1MUJB 4HIEA 3ZDYE 2P48B 5IMOA 3JZ7A 2F54A 2IMMA 3WHXA 5I71C 3ISWA 3MMEA 3DJ9A 1N6VA 1FFOA 2R56H 3ZKND 1YN6B 1KFAL 2BSTB 3SY0B 3L6FB 1NL0L 2JCCE 3U30B 4E0RB 1E4WL 4MA8L 4UNTA 4XVSL 1NSNH 4XPBL 2HJKB 1IQDA 3BEVA 1X5KA 4R3SB 4NBZB 4HEME 1M05B 2C3VA 5GJSH 4PRIE 4XP6H 5C0IB 1N0XL 5D1QD 4H1LG 1NCDH 3TZVC 1HHIA 3QA3B 2E9BA 4L5FL 5TDOB 2E7BA 3MOAH 5E2WH 3OKLA 5AAWA 4S1RH 2BVPA 4I0PD 4CJ0A 1YDPA 1Z5LB 3QDHA 1DVFC 3TCXA 1Q8MA 2DLEA 4K8RD 1RD6A 2VB5A 3KPRD 3RPIA 5JHLH 2JK5B 3L3KB 1RK0A 3TO4A 2VDRL 1U8HB 2Q6WB 3QPQC 1E6JH 3BXNB 1FHGA 1QSVA 3QCTL 5B38A 3L3GB 4LKXA 3SDYL 2BJMH 1E27A 5MP6L 1C12A 3MV7B 3BH8A 4RX4A 1AXTL 3AMLA 4KK9D 1ZVYA 3SE3C 1FP5A 1B4RA 5EBGA 1VEOA 5L7XL 1DBKL 3MLPA 4ZNCD 3QQNA 3G5XA 1NGYB 2HYMA 1VFMA 2VE6B 3L7EA 3FO9B 5A1AA 3SDDD 4WHYG 1KFAH 3WE6A 3CD4A 4ZD3L 4BQ9A 5TF0A 1NL0H 1WBYB 5HI3D 1E4WH 2VAJA 3LVEA 4GOSA 3NCCB 4HUXA 4MA8H 4H0IA 1QRND 1T7WA 4XPBH 4XVSH 3SDXA 5KBNC 2CXKA 3D85A 3QAZC 4YBQC 3O6LL 4UI2A 2YN3A 12E8L 2VISA 1TFHA 4G6MH 4HF5L 4J8RB 1T2JA 1N0XH 3BPCB 2HFGL 3ALPA 3ARED 2OQJA 1EMTL 4L5FH 2PUQT 4K3EL 1DN0B 1AGCA 2HT4C 4DKDC 1EXUB 1CDIA 1PZ5B 4L8CB 5DMYA 4YXLL 4KJPC 4CMHB 2PCPB 2V6HA 4YFEA 4MCYA 5JOFB 2VDRH 5H94A 1IZKA 3UTZB 3S3PA 3QCTH 1TTGA 3U36B 3SDYH 1P1ZB 5KVFL 4JFEB 5MP6H 1G6VK 4O00A 3D48R 1RJLA 4P57A 2LAGB 1PLGL 4J12A 1AXTH 1J9CT 5DURB 3QWOB 1GOGA 1XR9A 2ADGB 4D9RD 5L7XH 3SDAA 1DBKH 5H37H 3RTQD 2AP2A 5IP4A 4WI7A 4MNGB 5HD8D 2ZZUT 1IGTB 4JFFD 3DX8B 2NYYD 5EZLB 5IVZB 1SY6A 2YPVL 4ZD3H 4GG6E 2X89A 2A0LD 3V5KB 2BHZA 3D69A 4YHIA 3WFEL 2JB6B 2Q86A 2D2OA 5F7WC 4MJ4A 1B0GA 2VZUA 1A6ZB 3HRPA 3O2VL 1BVZA 5CJOL 4X4MA 5GSRB 1IAIL 3GIZL 4PUBL 2DLIA 3O6LH 3HR5B 12E8H 4JAMB 5SX4H 4HF5H 5E2TL 4LBEB 5HTSA 2OBGA 1DTUA 4P2RE 4Z7VF 1FZKB 4WDIA 5KSBB 4R4BB 2HFGH 5DJXB 4HDIA 1EMTH 1XF3A 4K3EH 3VDCA 3ALWA 3MA9L 4LLVA 1KENL 1U93B 3IFOB 1Y18B 2XFXA 4YXLH 1HHGA 1U8OA 2LV4A 5LVEA 5DFVC 5IB2B 4NWTL 1XGRB 1D6EA 3RVWD 3OKMA 3MR9A 4QHLB 3RZCB 1K4CB 5JTWA 1DEEB 5KVFH 2YD7A 2IANE 1NUFA 1KGCD 1NGXB 2DQTL 3TPKA 2Y36L 4LEOA 3VFGL 1FNLA 3BKYL 3DTXA 1PLGH 1ZS8B 3RVVD 5LGHL 2GJ6B 1MOEA 3FO1A 2Y5EA 4HBQA 4G7VL 3B3IB 4LDLB 2X2YA 4GRLB 2LU7A 2COQA 4U1IB 4I77L 4P9ML 2ADJB 2YPVH 4ELKA 3IYLW 3F7VB 5I9QC 5IESL 4QY8B 4F8TA 1BX2A 3WFEH 4R90L 4XAKE 3MPCA 3G6AB 3GKZA 2R9HD 3O2VH 5CJOH 3RDTA 4M6NL 2H6PB 3GK8L 4JDTL 3MNVB 1IAIH 3GIZH 4PUBH 2V5RA 4PTTB 3K1DA 3K8LA 1FL3B 4M4PA 4XPAL 1R3LA 2Z93A 5E2TH 4DTGL 4HUVA 4NNXB 3OJDB 3O9WB 4M7ZB 2EDYA 1CF8L 3MA9H 3JWNC 1KENH 1OP5K 1GL4B 4X9HA 1R3HA 3GJFA 4NWTH 4U0QB 3OAZH 1BZ9B 3VMPA 5FO8A 2WBJC 4WENB 4F33B 4GUPB 2BY2A 3DV4B 3IJYB 3NIFE 3QEUA 1TETL 4ENED 1HHJA 2GJZB 4MNQA 4PJFA 2DQTH 2Y36H 4I48A 3VFGH 4C4KT 3BKYH 4KK8D 1OTSC 2EYRA 4ZUWA 2CIIB 4M6AA 5LGHH 5GS0D 1FV1B 2E6QA 1R5VB 4UAOC 3OKNA 2NY0D 4G7VH 3P4MB 4PJDA 4QRUA 3B43A 4NQDE 1LE9A 3MRIA 3SO3B 5C2BL 4I77H 4P9MH 4X6EB 3DX9A 5FYLL 1M4KA 3IRZA 1HHHA 2GSIA 4DCQA 5IESH 5IMKB 2LVEA 5EIVA 2ITCA 4CVUA 5CBAB 3DUHA 4R90H 4HIIB 2H26B 2R69L 4M6NH 3GK8H 4JDTH 3QBTB 2P7TA 1F3JA 3BZFB 4LASL 5KAQG 4NO3B 2G9HA 4OZGB 1YECL 2AJ3A 3QXWA 5J11B 4XPAH 4DTGH 4FP8L 6CGTA 1VFAA 4U1LB 1MUJA 3CFBB 1CF8H 3L3JB 2BNQE 1PKQE 1NEZB 4P9HC 4LEXL 1BFVL 4HWEL 1BIIB 3BFOA 1YN6A 3NCYP 1A6VL 2BSTA 1FYHB 3L6FA 3SY0A 1GXEA 1NUDA 2ORBL 4BJLA 4AQ1B 4BFBD 3DO3A 2YS4A 4LARL 1J18A 4YUEL 5C0CA 3VXRB 1CGSL 1IGYB 1M05A 1SHMA 3CDGA 1QO3B 2CRMA 5C2BH 4G6FB 5FYLH 5LKNA 2P43B 4IS6A 5TDOA 1Q9OB 3BKJL 5FA4A 1Z5LA 1KTLB 2QSVA 1N4XL 2CUIA 1ZXQA 2R69H 1CXLA 3EYVB 4WI9A 3ULUD 1KJ3L 4CU7A 2EH7L 4K23L 3SGEH 4LASH 3L3KA 1U8HA 1PY4A 5CILL 5C0RL 1YECH 1EJ6A 1N8ZB 1BD2B 3L3GA 1KCLA 2EYSA 4NZUL 1P4BL 1FNEB 2P24B 3KYNB 4FP8H 3OBAA 3MV7A 2I26N 5TGBB 2VERN 4XMKL 1JJUA 3FKUS 3PABB 5DMGD 3VXUE 4KKAD 5FK9A 3ZTNL 3ULVD 2F9BT 1YYLL 3ARFB 5F6IB 4LIQE 4L8BB 4LEXH 1BFVH 4HWEH 4ODHL 1FFPA 3WIHA 1A6VH 3QDJB 2ORBH 3DURB 4N5ED 4UILL 1F2XK 4AEHL 1HN1A 4LARH 5T5FL 4YUEH 3WEXA 4RISL 2HT3D 5K9JL 4O9HL 1CGSH 4XNQB 2ZOKB 2EEDA 2BFVL 3MO1B 5D70L 4J8RA 3QUYB 1LO2L 5LWYL 4P23D 5CP3H 4PJEF 2YD8A 5C07E 2Q3AA 5LXGL 3OGCA 4WVRA 3SCMB 1HQ4B 3BKJH 1WBZB 1EXUA 2APXA 4X5XB 1N4XH