3QO1B

Monoclinic form of igg1 fab fragment (apo form) sharing same fv as iga
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
219
structure length
219
Chain Sequence
b'VQLVESGGGLVQPGGSLKLSCAASGFTLSGSNVHWVRQASGKGLEWVGRIKRNAESDATAYAASMRGRLTISRDDSKNTAFLQMNSLKSDDTAMYYCVIRGDVYNRQWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab fragment of IMMUNOGLOBULIN G1 LIGHT CHAIN
publication title Structure of a human IgA1 Fab fragment at 1.55 angstrom resolution: potential effect of the constant domains on antigen-affinity modulation
pubmed doi rcsb
molecule tags Immune system
total genus 46
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2011-02-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qo1B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qo1B01
5C7XH 3L5WB 3Q1SL 2FATH 1LD9A 4OF8A 5E6YA 3MA7A 4PBXA 4DW2L 3U0TB 1YY9C 4NJAH 3UPRB 2B5IB 2DDQH 1UCBL 3MJ9A 1RAMA 5JW3H 1OAQH 1Q72L 3CMOH 3VXPA 5HYSG 5JXEC 3MRCA 3RAJL 1L0YA 2MHAB 1IM3A 3G6AB 4L3CB 2BMKB 1NCCL 4IBLT 2EC8A 4LNVA 3NFNA 1MCPH 3F12B 1U6AL 3BKCH 4TVSa 2X7LB 4MA3B 1LO2H 2C4FT 1X6LA 3DYOA 2F74A 3AXLB 4XXDB 4W68A 1D9KC 3GO1H 4PJFA 1NMAH 5CBAA 2DQDH 3VFMB 4ZG1A 3C60D 1EHNA 4XVSL 1S7UB 2XWJB 2IFGA 4ORGA 4XXCA 3EOTH 3O41A 2VABA 4JR9H 3HC0A 4LASL 1K85A 1DQML 2HJKA 1SYVB 3MTRA 3OJDA 3TA3C 4EBQH 4LSPL 1DQDL 4FFVC 4LOUD 1UM5L 4IOFC 3DYMA 1N3NA 4PTUB 2AEWA 3PHOB 1XIWD 4G8EB 4LLDA 1CWVA 4I48A 2DOCA 5M7QA 2GJJA 4R90L 1AGBB 1U6AH 5J1TC 1PQZB 4LSRL 4NKIL 4BM7A 5GZOD 3BJ91 4OKVA 1HQ4A 3BPLB 1AKJA 4P23B 4WFED 4ZNEE 4WO4C 2CQVA 4WUUB 1G0YR 5C86A 3OAZK 1A6UL 3HLAB 2DQIH 3GSRB 3EYOB 3QEUA 4OLWL 4W4NA 1N59B 2CSPA 5BV7B 1U8MA 2OBGA 1KN4L 1RZKL 4WFGE 3DO7A 1QLEH 2VLRD 3VU2A 3DO3A 5F7LB 2XWBB 3HCVB 3F7VA 2DKMA 3T77B 3VFUA 1QFUH 4KRPC 2C3VA 3FQWB 1VFBA 2J88L 4EOWH 1P2CB 4I3GA 1N2RB 1IEHA 3WFBH 3EYSL 1HCFX 3L7FB 3BZFA 3FOMB 5DEFA 3ARBC 4QY8B 2EXWD 4F9LA 4D9QE 4XPGH 1U2CA 3RUGA 2ZOLA 4WUUE 4YO0A 2O61A 4FQIL 3SDAD 4UT7L 4OZHF 1HXMA 1MJJB 5CCKH 4LAQL 2PETA 4XTRC 3PUCA 4MA8H 1JYNA 4KGLA 4QRRB 3M8OL 5C0EA 5KN5B 4PJGF 2XRAH 2VZSA 3UC0H 5DQJA 1F11B 5CUSL 5F9WC 2CLVA 5D7LA 3UZQA 3FHQA 4QHNB 3RU8L 5IR1A 3VDCA 2R0KH 1TJHL 4JHWL 4C56B 1V3KA 3CAFA 1WCBA 1T03L 3VFSB 1C7TA 4K3EL 4PP2A 5T1LB 4F57H 4TNWK 1RHHB 2YPLB 1S5HB 5JIPA 2J8UE 1MI5D 1N4XL 2RR3A 5BO1H 5CINH 2W9LA 4OD2A 3KAAA 5EU4B 3SKJL 4ELMB 4XRCA 3CFEA 2DAVA 3VI3F 3ZE0F 5CJXC 3I2CL 5FO9B 2QSQA 4PJAA 4WUKH 4R96B 1JF1A 1FL5A 1SY6H 5EPMA 4QRRE 4XNMB 5DQDH 2V2WB 1R5IA 2LE9A 3I75A 5K93A 2G2RB 4LVOB 2YK1H 2OSLB 3A6BL 4NM8L 2VUYA 4X6CA 2NY4C 1GZQB 2AK1L 2GSGA 2RFXA 4QRTB 4GRWF 3AREA 4EZMA 1NUGA 1UGNA 2EYSA 5FYJD 3H7LA 3BKJL 4C56E 5I18H 1T0NB 2EE2A 2YPLE 1MH5B 3SKJH 3LMJL 3IETA 4HS8L 2JB6A 5D5ME 4OI7A 3KPOB 4G80B 1CR9L 1G6RL 3BVNB 4XAWL 1IVLA 3BJLA 5DUBB 2R15A 1CQYA 1N8ZB 1JV5B 3TV3L 3OHXB 4KU1A 2EEBA 1FYTB 3ZKMC 3PNWB 4NJ9L 1CGWA 1P7KA 4WGVB 3RRQA 3QUZB 4BFIB 3S5LG 1CFNA 4X6BB 1B0RB 3SDXA 2GTZB 4OZIB 1SY6A 1Q9OB 4U2ZA 1D7FA 1AH1A 3WJJC 3EDDA 2X1WL 1BQLH 4KUZL 2H3NB 1CICA 4RX4A 3LH2L 1KCSL 4WHTA 3VFGL 5T1KB 3M1BA 1YUHB 4G3YL 3ZDZE 4YAQA 3F65A 3T08A 1VADB 4WHYH 4M8QA 1YPZF 1FAKT 1Q8MA 4MQSB 1NL0H 3FQUB 3PIQB 4WEMB 5E8NA 1HHHB 1RUKL 5F8QC 4PRBB 4R2GB 4MNQB 4RZCB 5F88A 1FYTE 3KJ4B 3D3VA 3O4LA 4LQFH 3QXTA 2PCPA 1ZANL 4KROC 3WEXA 1WZLA 3C2AL 4F9PA 4A2LA 1JGLL 2K1MA 3UAJD 1F5WA 3V0WH 1YEFL 3GJEA 3X11B 5IM7A 3FCTA 3L5XH 1T20A 1IAMA 3VXRB 1EH9A 3RPIB 3OQ3B 1OD9A 4NOFA 4PJBB 1NCAL 1E4XL 2IAMB 5D7IB 4P46C 4ZOEA 1HHGB 1IEBA 3NGBC 4PGJA 1JWSB 2ZUWA 3ULUH 4YHZH 4J3VA 1H8OA 1A2YA 3ECBB 3ZYIA 3SQOL 4YPGA 5IUSA 5I0DA 3FTGA 3DURB 1AGEB 4DZ8A 4GXUM 3TBVA 4MNQE 5ICZB 1TCRA 4UTBH 1RZIA 4KI1A 1IKNC 5IVXF 1X5JA 4E42A 3VMPA 2EE6A 2BDNH 3CJJA 3B9KD 1H15B 2K7QA 5E6ID 3TGXA 1TLKA 2HN7B 2WBWB 3VXRE 3U1SL 5H37G 4I5BA 3MPCA 1QVOA 3OKLA 3MR9B 4PLKD 1UH2A 3QDJA 4GW5A 5DLML 4D2NA 4PJBE 5D7IE 1IAKA 2CRMA 4JHAH 3OKOA 4NQEB 5ADOH 5D2NA 4OLXH 3NZHL 2X6MA 1YZZA 2BVYA 3TCXA 1IGJA 4BSWA 1DBKL 1OAXH 1XFPA 2ITDA 4X6DB 3MLZH 5HDLA 1DDHA 3VJ6A 5CD3A 1KFAL 2X44D 5AZ2H 2CIKB 5D70L 2CDGB 4I2XA 5EUOA 3N9GL 3QHTC 5JO5A 4NQCA 3GDBA 4PV8A 4ODUB 3KYNA 1X5AA 1ZVYA 3BKYH 1TPXB 3KXFA 1KT2A 5DGQA 4UV7H 3ULSB 1ONQA 3GKWH 3V6FA 2DTMH 4G42A 2CLRB 4HIEA 4WHYG 4NZUH 3ARFA 5GJTL 4JY4A 3MLXL 3T2QA 3STZA 4MQ7A 4WI3A 1EUUA 1S3KH 1JK8A 2FIRT 3RWHB 2HRLA 3QIWD 4NOBA 5H35A 5IVZB 4PJ5D 4X6DE 4NNPH 4CU6A 3B2VL 1X3DA 3EFFA 1IM9D 4D9RD 4ALAL 3BE1L 2VUOA 2CKBB 1P4LB 3IDGA 1HCVA 4U1JA 3C60A 1VEMA 4BQBA 2VWEC 5DJZA 5E99L 5LJYH 1L7TL 3RVTD 2OTWB 4JRYA 1U8NA 2KDGA 1IGML 4WVRA 5AUMA 5IW6A 1F4YH 1U8IB 3LEXA 15C8H 4JM2A 5IV2A 4XGZB 4GAFB 4CAGA 1A3RL 2DJ4A 3QG7L 3Q5YA 4C58B 1MIEH 1WFUA 4IMLB 5ESAA 3UBXA 5KVEL 1MCKA 4F33B 1KJMB 4QXWA 5HHPB 4PG2A 1A7RH 1QPXA 4FQ2L 1FJ1A 3LKNB 4K3HA 1CLYH 1F3DJ 1N6VA 2GITB 2XN9D 5LBSH 4AMKL 4PJIA 3TJEL 2A74A 1CYGA 4M61B 3R8QA 5IFJB 2VXQL 3WIIL 5C0BB 5TH2A 2BRQA 2Z92A 5L6YL 4QXTB 2FHCA 2H6PB 2G5BA 5IT2L 5LAXA 2BX5A 2DLFH 2WK2A 4OLUL 2CIIB 2PW1A 1ZWIA 1ACYL 1R0AL 2VLRB 3STLA 1T4KB 5KVEH 3N06B 4JM4H 5FYJL 1YJDL 5IROC 3S4SB 2DI7A 3L7EB 2Q20A 3ET9F 2H2SD 4OCRH 1BEYH 4NFBA 3S36H 3G5XA 3KPLB 4M7LL 4JFFA 1RZFL 3SDCA 1E28B 4JQIH 3RNKA 1I7RB 2ZKHH 4AMKH 4I9WE 5EOCJ 4KKCD 5FM4A 3K2UH 3WFDL 2C4XA 4WTZG 3MO1B 2DLHA 2A77L 3SKUD 4PJ8D 3GMPA 2PR4L 5CMAA 2FEEL 4KI5E 5C0BE 1AO7B 5KVFH 4YIQB 1XF4A 4FG6D 3EYVB 5JIHA 1ZGLM 5IEKB 4LARH 4OLUH 3WN5A 4ODWA 3DRTA 3T4AA 2M1KA 1DN0B 3K74B 2F53B 5C0NC 1HSBA 4P4KD 3O6KL 4N0YL 2IFFH 4JLRB 2DM3A 1R24A 4IOIA 3MCKA 2RJMA 5JXEA 2J6EL 3IJSA 4N5EC 3EO0A 4HIHA 3KPSA 5LVEA 5EZIH 1EFQA 2X1QA 5FF6A 1RV6X 4M62H 2BSRB 5CP7A 5CP3H 2H26A 4F7TA 4H0HB 1MQKH 4HULB 4NO0A 4K8RD 4GXVL 3EJYD 4KTDH 4OFIA 1FGVL 1QEWB 1S9XA 4YHLL 1MI5B 1QBAA 1BQHA 1WEJH 1CTOA 1SJXA 2DJUA 5DFTA 5TQ0H 5EBMA 4JKPL 1AO7E 5EBGA 1DQJA 2YN5A 1T89A 2EH7L 5C2BH 1D5IL 1MWAL 1JP5A 1KLUB 3VRLE 3JVGA 1CL7H 4L8CA 4JPVH 4KMTL 4Y5YB 2F53E 4N0YH 3N1GC 5CZXC 4YHPA 5EZJA 1HILB 2O5XH 3PHSA 4PJ9B 5J12B 4EXKA 1JWMB 3VGAB 2XQBH 2O5ZH 2J6EH 1E6OL 4JRWA 2R0WH 2C7UA 4LCUB 4GG6B 1AXIB 1FZKB 3O6FA 4WWID 4NHUA 3SDYL 1BVLA 3RWJA 3GJFB 4HUMB 3WBDA 4ZFZA 5CP3A 1QRND 4NBZB 4KRMB 3PWPD 2VZVA 2R2CA 3P73B 5DRXB 5TF1H 3NIGE 2E9WA 2X1PA 4UILL 1TITA 3U46B 4KXZH 1I7TA 2OCFD 1ZXQA 4U1SB 5JDJA 3SO3C 5J56B 2F5BL 1MJUL 1FSKB 3K2MC 3RNQB 1A4JA 1PKQA 1XR8B 3OG4B 4LSTH 5LQBH 4JPIB 3IU3B 1D5BB 3HE7B 2J6EA 1R3IL 5DK0A 4RNRA 2AEPH 5AYUL 4MSWA 4PJ7A 3REVA 4IIQA 1NKRA 5T1MA 1FGNL 4JQXC 3OG6B 2VDQL 2JK5A 5TGBA 3ZTNL 1I3GL 5CEZH 1SMAA 1VFOA 1EEZB 3ROLA 2ADFH 5E00B 1UYWH 4NHCH 3RHWF 1BFTA 4IDJH 1U58A 1A6VL 3JV4A 5L9DL 2QV2A 1XGUA 2BZDA 4YHML 2P1YA 1UJ3C 2R29H 5TFSH 5GGRA 5IVNA 1WZMA 3HAEA 3NZ8A 2F5AL 2Z91B 5D1XC 1MWAA 2NY1B 4HK3N 3VXNA 3TNMB 3MC0A 2P24A 3FZUC 3ILQC 2VXSL 2BNQD 2A83B 5CHNB 3Q0HA 5KG9A 5DVKA 3ARWA 1IEAA 3S35L 2GAZA 5MEQA 1ZLSL 4N0UA 3IVKB 1T1XB 1IGCH 2H9GA 1GIGL 4WFFD 4WI5A 3MLUL 2VDQH 3L1OL 4FTVA 1NCNA 2AJSH 2O26U 5CGTA 5ACMA 1OW0C 3BH8B 1JGEB 2IBGA 1DBBH 5C07A 1QLRA 1NGZA 2A9MH 4JFQB 2XY1A 4XCCH 4RFEB 5GRJH 2IWGA 1EEQA 1P5UA 5E94A 4P5TC 4MVBC 1CT8A 3C9NB 4DGIH 5JQHC 1F4WL 5E08L 4LSQL 4WNQA 1A21A 1ND0A 3TBYB 3SE4C 3SOBL 1G7PA 2LTQB 5D2LA 3JWOC 2YPKB 1G7IB 1RY7B 2K3TA 4CN1A 3CLFL 3BH9A 3CVIL 5E6IA 2UVEA 5KSAD 2NW3B 1YN6B 2WNGA 1PZUB 3IFLH 1U3HC 4PRNB 4NWTL 3ZE1F 5KBNC 5I16A 1GIGH 1X4YA 4MCYB 5HY9A 2VYRE 4DTGL 3CUPB 3VH8B 4E0RB 2D0HA 1MY5A 1NSNH 2AJVH 5T1DH 4HAGA 2YEZB 4CUCA 5JW5B 4LLUB 1MJ7L 1W0VA 3PV7A 3GBLA 4WI4A 3RFZC 4HWBH 3LKRB 1OGTA 4LCYB 3N1FC 1BBDH 3BESR 4LCWB 3BXNB 4QT5A 2DQHH 1EAJA 2J5LC 1IAOB 4GQ9L 1B4RA 5D96B 2NX5B 2AJ3B 1AC6A 3H42L 5GS2H 1NCDH 4IRSC 1XGYL 3MNZB 2A6KA 2XPGB 1AGFB 2VZ1A 4ZTPL 5EA0H 1KPUA 4PP1C 5FUZL 3UO1L 4Q2ZA 3LIZH 3UPAA 5I75B 4KKBD 3B9DA 5CSZB 3BQUD 2YUVA 3RVVC 2CR6A 1UKSA 1H0DB 1I3VA 1I3RB 4XPFL 2Q86A 3QIWA 1CFQA 3MODL 2GK0A 5D8JL 5HJ3B 3MRBA 4LCWE 1BWWA 1FZMA 1ZEAH 1VHPA 4AT6A 3ZT5A 4PJ5B 1IM9A 3CZFA 5SX4I 5ITBL 4OAWA 2P8MB 2NX5E 3SE3C 4BFBD 5F97E 3PWJA 3CGTA 4KJQC 1U8LB 3HG1A 1IL1A 4NKQB 2X4SA 3BUYA 1JPTL 4RGNE 4LVNB 2DICA 3GBNH 4LL9A 4X6EB 4Q9QL 2F9BT 1B2WH 4YXHL 4DZBB 3HKFA 2FX7L 4S11A 4K3JL 3KDMB 2KL6A 2ZG1A 1ZHNB 3RGVB 4OCSH 2IALA 5IWLC 5DJ6A 3QISA 3VXUA 1WLHA 4JZNA 4YDLC 2DL2A 4BFGA 3MLYH 4Y4FD 4O4YH 3VG9B 2HFTA 3OAYH 4NO2B 3GGWA 4K8RL 4PJ5E 4IEFB 1IKNA 1DLFL 4BQ9A 3L3OB 5GS0L 4Q74A 1KIQB 1JPTH 3MYZA 3D39D 1LEGA 2XN9B 4D9RE 3OKEB 4YGVB 4NIKB 4OFYD 3R0NA 3DI2B 3HC3H 4RAUA 4HKZB 4U1GC 5FOBA 4GMSH 4AJ0A 4U1IB 4DEPB 2X4QB 4ELMF 3TPUB 3BD4A 3KYAA 2Q76A 1Q1JH 1JPST 2UZXB 3SPVA 5BZWB 1L9MA 2YMXH 3FB7A 3BSZL 4FQJH 5T3ZH 5EOQL 1EEUA 2CDEA 4O2CA 5DD3L 5HHXL 3IU4L 4JPWL 2VXVH 5E5MB 2PXYD 3X3FL 5FM5M 1TDQA 4UDTB 1BZ9B 1VACB 1K6QH 1UKTA 3SY0B 1MAMH 4PJ8A 4QHLA 3EYQD 3LDBB 3MA9H 1OSPL 3EFDH 2B4CL 2CPCA 2Q8AH 1Z5LA 4ETQB 1ZT7A 1FBIL 2XN9E 2YZ8A 3MV8D 5K9OA 1B88A 4GRMA 1NEZA 3TCLA 4YFLI 2Z31C 3G5ZA 1JHKL 3Q6FA 2BSSB 5B21A 1GXEA 2R23B 3S37L 4H5SB 3NIDE 1TFHA 5MENB 5I6XC 4CW1A 3TVMD 4Y89A 4HUKB 4P4KB 3O4OB 1CXIA 4ZO9A 2QADB 5FA4B 1A8JH 4X0KB 4OZIF 3MREB 3DRQA 4QOKB 4YHIA 3LQAL 5KSVA 1N64L 4ONGL 1AY1L 5MHSD 3KWWA 3ABZA 3RI5K 4MJ6B 1PAMA 5DI8B 1A1NB 2ED9A 3GSXB 1D6VL 3KYKH 5GGVY 3MBED 4WI2A 3WD5L 2E27H 2EYRB 1JRHI 3VGDA 4QCIB 5CBEB 4TUJA 5SV3A 4Z5RB 3S37H 1J1OL 4MJID 1JJUA 3V9FA 4O51A 3VXQA 2NY0D 5MENE 3TFKD 1XGQA 4RISL 1F45A 1SYSB 4Y5VC 2HTKC 3BDBA 4ETYA 4JG0L 2DM4A 4KUCF 5ACZB 3MRKB 1KEGH 2PO6C 4QRPA 1QZ1A 2FBJH 2FDBP 4NKOB 4CMMA 3BHBA 1AY1H 4UIMA 4QOKE 1EO8L 1I9RL 3ZHDA 1KJ3H 3T2NH 2IPKA 5DS8B 4B0MM 1CU4L 3VD5A 1JHLH 3ZDXE 4U1KB 2X5PA 5JA9A 3VXOB 1KLFA 1C8PA 1A0QL 3TT1L 3MX0A 2ARJA 2NYYC 5D7IF 1S7XB 4HFWA 4X99B 5DC9B 5JPNB 1U9KA 3LKPA 3QFJD 4MWFA 3UTQB 1F00I 1JTPA 2PYED 3UROR 1PG7L 1DFBH 1C08B 2EDNA 4HIJA 3B3IA 4L5FL 5KZCB 5CJ8A 5GIRA 1LHZA 3BPOC 1F4XL 2HLAA 3MUGA 5AD0B 5FO8B 1RJLA 4ZNCD 5AG9A 5LXGL 3HR5A 4MQXC 3RWEB 5FO7A 3MRDB 1ACZA 5E2VL 4YUEH 3FO1B 4OCXH 5ENWB 1S7VB 4PUBH 1NFDB 4LVEA 2Q87A 5J1AA 3FT3B 3U9PL 5HYSA 3CD4A 4NQXB 1X5IA 3B43A 4WY7H 3I50L 3MXWH 2Q6WB 3VFOA 1FH5L 3IJYB 1HKLL 3FFDA 1I7UB 2FCBA 3HZMB 5TJWK 4HH9B 4HIIA 3FB8A 3MNWB 3V5HA 5ID1B 3TO4C 3EGSB 4QHKI 4RMSA 5DO2C 4R6UA 1QP1A 1PLGH 3J7HA 4HFUH 5FYKD 1NCBH 4EN3B 5DHXB 4OI8A 3Q48A 4X6DF 1G7JB 4Z0BH 5D7KD 2A2QT 4FNLH 1KCRH 1N0XL 3IXAB 1UA6L 4H1LH 3K8KA 3VGHA 4WWKC 3SJVD 1AXTL 4NYLA 3ZYZA 4QTHB 1X6NA 5EN2A 1EVTC 4GKSB 4R7NA 1NFDE 2YD3A 1J5OH 4ODXB 5DJDB 3O0RL 1SEBA 3E3QE 1IQDB 4K7PH 4FFWC 3GM8A 2AP2A 3HMXL 4TRPH 3E8UL 5DC4B 1DZBA 4WDIB 5BRZA 3THML 4XNXH 5E8OA 2J8HA 3MXVH 5JUEL 3O3DA 4MGXA 4WTWA 1DVFB 3FT2A 1FNHA 4O58H 4JN2B 1CDCA 1F3RB 1C5CH 3BIBX 4XVUD 4ZFGL 4P2QD 1DQLH 5KSAA 3FO0H 4GRLC 1UA6H 1BF8A 3ZZ1A 1FG2B 3NBNA 5GRVL 2J7LA 1ZAGA 3ARGD 3WKMH 3P0VL 4JJ5B 4XWOD 2B1HH 3D25A 3DYPA 3FB5B 3QHFL 4L8BA 3I9GH 1EGJH 3MA7B 4PREB 2DQFA 3GMRA 4F58L 1H8NA 4F2MA 4MB3A 1IQWL 5T3XH 3MUJA 4G6JH 4GKOA 4WGWB 4D0CB 4Y5XB 1RSFA 4L8DA 2H1PL 3CSBA 4HDIB 3FRUB 4OJFH 4Z7UE 4JHBA 4YK4B 3SE8L 3CXHJ 2BJML 4H0IA 4O5LL 5B4MD 3MMEA 4LKCA 5CIPA 3HI1B 1KELL 2F74B 1CLCA 3QCUH 4AM0B 4M4RA 1S7RA 1RUPL 3GSWB 1WV7T 5HGGS 3WJLC 5A2LH 2G60L 3D2UD 1TVBB 1T7VA 5D9SA 3ISWA 4M1DH 1T22B 4S1DC 4L4VD 3BEVA 5DWUH 5F72S 1GGCL 1IGFL 1T66D 1N3NB 3HMXA 3BQUB 4XCFL 4I48B 5BQ7B 3L6FA 4L9LC 1MCOL 3P30L 3DUUA 4ZUWA 2FJHB 4X8JA 3RTQD 3TJHC 5CD5C 4OB5L 4OKVB 2XQYG 3JWOH 1OT2A 5JHDB 3BGMA 1BFOA 2JLLA 2AGJH 4M4PA 1Y0LB 1I85A 1FLRH 4Q6IB 1SM3H 4H1LG 4OV5A 5FIEA 2AJXL 2GJZB 4U49A 3IDMB 4HPOL 1ZLUH 5D7JC 2K9UA 5LWYH 4ZYKB 1S8DB 1F8TH 1IJ9A 1OAZL 3DROB 1ZHLA 4XX1E 1HOCA 4GKNB 1I7ZA 3EOBA 4TSCL 3SBWA 5JORA 4J4PD 5J4MA 1FO0L 3HNSH 1MCOH 1OY3B 2BFVL 1EEYB 4LLYA 4Y4FA 2V7NA 5C9JA 4KRLB 3TO2B 5E56A 3MRJB 3BO8A 4P5TA 1WBZA 3EJZD 4A6YL 5TQ2H 1IGYB 3E6HB 5JHDE 1T1ZA 2VH5H 2Y5TA 1WF5A 4OFYA 1FNGB 1VGEL 2VL4A 3D39B 4XNYL 1U3HA 2ADGA 1CLOL 1FYHB 3H3PL 3ARZA 3BMWA 3NIGF 1TMCB 2O5YL 3TF7C 3IF1B 4JFED 1NAML 3HB3C 1CDUA 5LCVL 4PLJD 3G6DH 4J3XA 2CLVB 5D7LB 4DN4L 1A7NH 4YDVA 3H7BA 3GSNH 5F3BB 1EHLH 1AGDA 2ZSVA 3ULVL 1FZOB 4G6AC 3OZ9L 4E5XA 3EKCA 2DI9A 4FQQA 4KJPC 4UTAL 2J4WL 3R06B 2HWZH 4YQXH 3QWOB 4GG6F 1FNAA 2PXYB 4OD2B 2V9RA 5J13B 3UDWC 4XRCB 5DA0B 1CD1B 5J3HC 8FABA 3QIBD 3MV8A 3RUGE 4PJXA 2CJUH 1WFNA 1HI6A 4PJAB 4AIOA 1F6AB 5DRZA 1T5XA 3D39E 3RZCC 2ADJB 2HLFD 5CS7A 3I6GB 1JN6A 3SDDC 2NY7L 4HUXA 3BN9C 3LEVL 3MRHA 4R8WH 4FFVD 5EOTA 1DTUA 3I75B 3NFSL 4GAGL 4DUVA 1DJSA 4FZEH 3TVMA 2AJYH 2R2BB 5KVGL 4XB7A 2BNRD 5D7LE 3NCJH 4KVNL 2NY2C 1ODAA 3ULVH 2BVQA 2Q8BL 2E6JA 2VIRB 1AQDB 3TYGL 1YYMH 2NPLX 3GSNA 2M26A 4HWEL 2BVPA 3OR6B 5A3ID 5JIKA 4PRPB 3C09B 4NBXB 4YHOL 1X5FA 1W0WA 5DR5L 2VLKA 4YDJB 3MBXH 3WHXA 1T21A 1FP5A 1IAII 3QR2A 1AE6H 1FVEA 3CVHL 4HLZG 3SE3A 1EZVX 1WWAX 3S35X 1KPRB 1J0IA 1JBJA 4HJ0D 4PJAE 4BQ8A 3MBEB 3TBSA 1CF8L 4XZUB 3V4UH 5DJAA 2YPVH 3QXUA 1E4KC 5FYKL 4LCCC 5DJYB 5JIIA 1JMZA 5HDOA 3HE6C 3U48A 3QXWA 4MJIB 5F9OL 2X89D 4KVNH 5GQBA 2C1OA 4ZO6A 4KRPD 3PWVB 3LEYL 2Q8BH 5HGBA 3VMNA 1C5BH 3AVEA 2NY0B 1NAMB 4XHQA 3X13B 3VXSD 3PWLB 5D4QA 3C8DA 3D9AL 1F3JB 5E2WH 4JDVB 5IOPA 4TUKH 1I9EA 1HEZB 4PRPE 2F8XC 4ZS6C 3CVHH 3GHEL 5MHSE 3KNBB 1NBQA 2J1KA 3RVWC 3W39B 1J0KA 4OLYH 5CEXB 3ARDD 1QSFD 2ADIA 3WS6C 3FQNA 3ZKXB 4RDQF 4KHXH 3QFJA 2DIAA 2EDYA 5F88B 2AVGA 1CFBA 4XNQA 3RKPA 3OGOE 1G9MC 3WEXB 1WIUA 3SDXE 1UVQA 1NGPL 4MJIE 2PYEB 1RZ7L 1VENA 3NTCL 3ESVF 4APQC 3MSPA 3HHRB 4OI9A 3EO9H 2XTJC 3LHPH 3VWKC 4IM8A 4HIXH 1U8OA 1T20B 3C6SA 1A7QL 3QQ3A 5JDSA 1O7VA 1AFVH 1LNUB 4MA7L 5ALCH 3DHJA 25C8H 5D1QD 2JELH 5E2JA 1KB5L 1HIMH 3QUXA 4UU9A 3Q3GB 3ZTJG 1UACL 4WW1B 5BJTA 3FQXB 2IF7A 5CZKA 1BAFH 2QSVA 1UCTA 3TIDA 5ITFA 1A2YB 3K4DA 3CVHA 5EU7E 5IBLD 1MVUB 3GI8H 5C0DA 1KUMA 5DVMA 5F7FA 1U3JA 1XF2A 1TVHB 4PJHF 4Z77A 2CK2A 2HG5A 3MOAL 1TCRB 4I0PC 5F89A 1DBJL 3F7PC 4AK1A 2HT4D 1A6TA 1BOGA 2UV3A 1HXYA 2FJGA 3GKZA 3IDYB 2PYEE 1ZHKB 5H2BA 4J7RA 1HZHH 4CVZB 4PD4J 1NDMB 4MA7H 1LEIB 1I75A 1QVOB 5C09A 4Q9BA 3WO4B 3CFDA 5GGQL 3SJVB 4GW5B 1E27A 1D5MB 4LNRB 4XAKD 1VFUA 4JZOB 5K9JH 4D3CL 3TBWB 3NN8A 4OD3L 4EJ1C 3QSKB 4HAFA 3Q6GL 1LP9A 4NP4H 5C0IB 2VDOL 3S34L 2OJEB 3VJ6B 5CD3B 4KKAC 4LHUA 3QNYB 2A6IB 2ESVA 3O3AB 4O9HL 1NDGB 5FK9B 2CMRL 3WL9B 1RUQL 1VFMA 4P2QA 1FNSL 2V2TA 5ESVB 2NY3D 4PGBB 3TN0B 1MSPA 2F8OA 1OAUL 2PO6A 1C12B 3JSSA 1K8IB 3T4YA 1ONQB 1YECH 1QYGL 4Y2DD 4C83A 1NUDA 1QLFA 3SJVE 5I30L 1R3HB 3QDJE 4HIEB 4LF3B 2R2EB 3IDNA 1T3FB 4HH8A 5F93C 5AEAA 1KB5B 3ARFB 3GNML 3PL6C 1N7MH 3MLVH 3ULUE 1NCTA 4IRJB 2VAJA 5HHMD 3NA4A 4PRDA 4JY6A 5C2UB 2CMRH 5EZOH 4GAYA 2G75B 1YY8B 1QFWI 3L3DB 3IDJA 3WFCL 5LGJB 5GS2D 4XPTH 4U1HB 2QBWA 4M43L 4U1JB 2DWDA 1H3UA 2JF1A 1SQ2N 3BP4B 4FFZH 3Q5TA 1ULVA 4CL7A 1K4CA 2EDXA 1U8NB 1K3ZA 4P59H 5IW6B 1MIMH 3CIQA 3PXJA 2J2ZA 3FO2A 2NTSP 5IV2B 2G9HB 4KRNA 2XA8H 4L4VA 3D2UB 2V17L 5EBWA 4X98A 4XMPL 3LKSB 4J23A 3I6LD 4WHDA 4AH2B 3KYMB 2ATKB 5GS3A 2OTUA 3UBXB 3U4BH 4NWUL 2QKIA 1CGTA 5E2UL 1NC2D 4G6MH 4DKDC 1W72H 3BEWA 4S2SB 3RTQA 1FRGL 1KTRL 3TO4A 2FO1A 1LQSR 3S37X 2X4TB 4S1RH 5KJRL 5L88H 1TNNA 4EI6A 3TZVB 1F2QA 3FT4B 3DUSA 3U9UB 5ETUB 2EDOA 4GBXD 3OSKA 2V6HA 4MXQC 3VWJC 1UEYA 4WWKA 3GB7A 4JRYE 3V6BR 1MF2H 2CK0L 5HYFA 3JWDC 5FDWB 2PW1B 1H5BC 5T33L 3P4NB 3D0VA 4QWWC 3STLB 2FEDD 1TJIH 2OMBA 1KTLB 2HAZA 3B8YA 1QR4A 3KJ6H 4ODVL 5L2JA 2D0GA 1CE6B 2EEDA 4ZUTB 4NGHL 4ODHL 4EI5A 3DETD 4R4FH 1EX0A 4TPRL 3MYJA 1FRGH 4QLRA 3CXHK 4NZTL 3UYOD 5H94A 3NCMA 3WXWH 2RIKA 2B7DT 3B6SA 4JFYA 4RAVB 5EUKA 2QQQA 5GGTH 3OKMA 4OTXL 5JHLL 1RK1A 1W72A 3MJ7A 3MRFA 5GSRA 1EDQA 2A1WH 3E6FB 3CLEL 4PJIE 5FYLL 3UXFA 4RMRA 4B41A 3VXTB 3KHOA 1T1WA 4PTTA 1PX4A 2FZ3B 5J8OA 1QOKA 3ZDXF 1G9NL 3DXAA 2AJUL 3RWIB 2FO4A 2P5WD 1P4IH 1OL0A 4XP5L 5TDPA 3HI5H 3N1MC 4KI5C 3S9DB 4W4OC 5T33H 2WBJA 1KIRB 4JFEA 4UQ2A 5HI3C 1X5HA 3WLBA 1D6EB 1I8LA 4N8VA 3VFTB 3QH3A 1M71A 4N8CH 1B4JL 4ODHH 4CU7A 5KSUA 4U6XB 3ES6A 4NZTH 3QRFM 2FD6H 1FZJB 5J9PB 2OZ4L 3N85L 4G7VH 1KC5H 4W6WB 2W9DL 4ZPVB 3IDIB 3NABH 35C8H 4JFFE 5CP7B 5CWSB 1RUAL 2H26B 4JY5L 5JOFA 4BYHA 4PLNC 3GBMH 4KK5D 3GRWH 5C0AB 4Y8AA 2ZSWB 1P6AB 1HNFA 5DVNA 4YDIH 4ENED 3V7MA 1D9KB 1FAIL 4HC1L 3QI9C 4P2OC 4PG9A 2EO1A 4YWGL 5DSCB 4TVPH 3KPTA 4ZPTA 5D6CA 1S7SB 2LFGA 5I8OH 2W65B 5HDQL 4I0KA 3LZFH 2HJFB 1JPSH 5EZJB 4YHPB 3TA3B 4I3RH 1YYLH 3NH7L 2EC9U 1TZHA 1AHWC 2BNRA 2OQJA 3P40A 3MLRL 5GRYA 3U0WL 2I60L 3P4MB 5C08A 3T0EC 4OGXH 5EO0A 3FN0L 3U4EB 5GRWA 1BVLB 4RQQB 2Y07L 1UT9A 4HKBB 3HPJA 4H0GA 4YEEA 1DL7H 2Q3AA 3MFGB 4L3EA 4M7ZC 3UJIH 4OM1L 2JJSC 5F8RC 1NANI 4NDMA 5C0AE 2BC4B 1KIPA 4WO4B 4GUPA 4YHYC 4DKFH 3V8OA 2ZCKL 2VDLH 5IKCA 2IQAA 1V3LA 3P77B 3WO3B 3S3JA 3BZDA 1Y6MR 4UZGA 4GKZB 5D7JA 5E8PA 2CGRH 4HXBL 1WWCA 4HG4J 2L4OA 4TSAL 4I13B 5IHBA 5JW4R 2VQ1B 3QIUD 1H3PH 3CNKA 3FN0H 3VXSA 4KRPB 1U8JA 2XIDA 2W0KA 3RHWK 2Z35A 3FOLA 2H2PC 4X7SH 3IJHA 2KUTA 5GRUH 1CXHA 3O8XD 4V1DB 3UJTH 1MFAH 4WV1A 3ARBB 5EFIA 3ARUA 4NRXA 4HGKC 3OR7B 2ZCKH 2DBLH 4HC1A 4R97C 1U41A 2I9LA 5JQ6H 3ETBF 5DMIL 2QQKH 2OL3H 2JIXA 5EO9A 5GGRB 1QSFB 3RX8A 4FQCL 1JHTA 4GO6B 3BPCA 3VFNB 2JJWA 5ESQB 3GFUA 4JCLA 1PKQE 1FVCA 3EYFA 3QZWG 1J87A 1DBML 2CKNA 4LCIL 5F9WB 1RIHL 5HGAB 2A38A 4ELKA 4K2UH 1BIIB 1MCEA 4ZUUB 1DLHA 2LAAA 4F7MA 4S1SH 2BY2A 2UZYB 5AZEL 1A7PL 3BIKA 1G7LA 2WIMA 4P57B 3SGDI 4FTVB 4M6ML 4NT6A 3WUWA 3KPRA 3TH4T 1MQ8A 2KPNA 1QUNA 5C07B 4ZMAT 2V9TA 5ABDE 3QPQC 4V1DE 3UDWA 4Y4KC 5ISZB 3WNKA 4JO1L 5E8DH 4D0DB 1RZJC 2E7MA 2ORBL 2N7BA 2AV1A 1MFCL 3W0WD 1FFPA 1VEOA 5F7DB 2B0SH 4U7MA 4XP6H 4Y4HD 1CBVL 3T0DA 1CK0H 1D5ZA 1ND0B 1MRDL 2J3SA 1A5FL 2Z4QA 2IGFL 1OF2A 2EE9A 2A6JB 1JRHH 2OM5A 4LSVL 2GK2A 1U91A 2NY4B 5DRWB 5FV1L 5C70A 1GGUA 1EK3A 4BUHA 5FEBA 2Y36L 4FTVE 4H88L 3BW9B 4NFCA 5KOVC 1R3KB 4YE4L 1QBMH 4ZFOB 5C07E 5GSVB 3DWTA 5EO1A 5CEZE 2D7TH 4XC3L 5ISZE 3WIHL 2QQLL 4NM4L 1OGTB 5HI5D 3V7AE 2NXZD 5DUML 4K23L 3MCG1 4M3JA 4LLAA 2HVJB 1X5ZA 1NH6A 1G9MH 1OPGH 1KCKA 2X70B 1E4KA 2IBZY 5D2LE 5IMOA 3HE6A 4ZQKA 5IVOA 1AR1D 3TESA 1NJ9A 5I8CB 2AEQH 5TPWL 1G0DA 2A6KB 4FABL 2ZG2A 1FIEA 4K9EL 4HBCL 4URTB 3VGFA 3UTOA 5DXWA 1XEDA 4ONHA 4JPKH 3NCBB 4Z6AT 1T7ZA 4G9DA 4JZJB 1J0JA 3TWCL 4Z0XA 4F7CA 1MRCL 2F19L 2N56A 4Y2DB 2EECA 4MD4B 4NQSB 5IHZA 1A9BA 4WU5A 1Q94B 5C0RH 1FLTX 1O0VA 1YNTA 4O2EA 5DUMH 3WFZA 2C9AA 2EXYD 5GGSB 5D1XD 1OTUC 5FKPA 5ICXA 3QXDA 5BMFL 1OCWL 3MRBB 2Z93A 3ILQD 5HHMB 1N26A 4AT6B 4TQEH 2YBRA 5HYJA 3CZFB 4X6FB 4Q6YA 4XCEA 1VKXA 1INEL 5DTFA 4KROB 1EAPA 3NMEA 1XAUA 3PWJB 2VSCA 4ORZC 3AGVA 4NN6C 4APQA 4I4WB 2YD1A 1JE6A 4Q0XH 3VWKA 5IGXL 4TOYL 3C6LD 1KN2L 2VDPH 1S9VA 2XACC 4NZRH 2AABH 4PR5A 4DAGH 2X40A 4FQ1L 4XP9L 2I07B 5SX5K 4P46B 2OLDA 1GC1C 3ZDYE 4D94A 1NBVH 3NGBB 4OFDA 2IALB 3VXUB 4MVBD 3WIHA 1YEIH 2HKHH 4P4RB 4AYFA 3KS0J 3L3JB 3TNNA 3GGWB 2ZUVA 1NC2B 3MRGA 3X12A 5FCSH 3GIZH 2JJVA 3TT3H 2AI0L 2MCG1 4DGYH 3HA0A 3HFMH 5KS9F 2HJLB 4M6NH 2DLGA 4GBXA 4OZ4A 3V52L 3VXMD 4ZS7L 1FIGL 1MPAL 1Q9WA 4LPWA 4OSUH 4Q9CA 1JGDA 3MRNB 3EYUH 1QBBA 4MD0B 4DUXA 2BOCA 4YZFE 4UT9L 1EFXA 3SPVB 5IW1A 4JFZL 1TETL 5FGBC 2FYYA 2VXUH 4FS0A 5JPMA 3VXUE 3GK8L 3QNXB 3HNTH 1RIUL 1ZA3B 1NC4A 2P5EA 2AQ2A 4N0FB 4TUOA 2WLZA 4XP1H 3B5TA 4EIGB 2Y6SD 1UM4H 4OM0H 5FGSA 4IRSD 1G7HA 3PP4H 5IB5B 1XF5B 3GEWB 3UTSA 1Z5LB 2NR6C 4X5LA 2VAAB 1P84J 4GRMB 3RVXD 1Q0XH 3QEQD 5K59E 2WUCL 2AK4D 4ZODA 1DBAH 1RUML 3CPLA 1C1EH 2D3VA 3RDTC 4U6YA 2P5WB 1G7QA 1P1ZA 4JFZH 3O6LH 1TETH 3WFEL 4X7CC 3BUTA 4BSVA 1KXVC 3G6JA 1BX2B 1CE1H 4LU5H 3TC9A 5AAWA 5E7BA 1OQXA 2EC9T 1VEPA 2DIJA 4I3SL 2CUHA 1HHIB 1JZ6A 4LRIC 3DECA 4KJWC 4LP5A 5KSVB 1IC4L 3MGTB 3UZEA 4EVNA 1HYSC 3KWWB 3K0WA 1YEDA 1YEGL 4E41A 4YDKL 3ZKQD 5L7XH 2HTLD 2UZIL 4JO3L 5EU3A 2ZCLH 2VDRL 2BVOA 1DSFH 3N1PC 3OKKA 1IE5A 1CGYA 1TQCC 4HXAH 1P7QA 1H9VA 5JXAL 3T0AA 1HH6A 5IB2A 2EH8H 4JDTH 4X4MA 3JWDH 2DF3A 2P5WE 1MEXL 2P8LB 2Y1VA 3N0PB 5DUPH 4PJDA 4KC3B 4NFDA 5EULV 1N5AA 3OKDB 3MCLH 3PQYA 2HT2C 4XMKL 5T3ZE 2FX9H 3SCMD 5F9AC 2IAND 4YXKL 2Y06H 1LO0H 4AEHL 5F96L 1I8MA 3QUYC 1GZPA 1OTTD 3WXVL 4D0BA 4P9ML 2YA0A 1ETZB 4U6VL 5DC0A 1I1FA 1R3LA 2ARJB 4JRXD 32C2A 2VWEE 5JOPD 4ZO7A 4N9GB 1RVFL 1XZ0B 3BZ4A 1KTDA 4TTDC 2BRRH 3AROA 1KG0A 3QHZL 3VWJA 4X9GA 3NCFB 4F7EB 3FL7A 3DVGA 4HIJB 1H5BA 4PB9L 3BD3A 4JFHD 4X4XA 1QBLL 3MUGB 1GH7A 2VLLA 5CJOL 1XF3A 5SWSD 1UXWB 2V5TA 5SWQB 3NPZB 3PGFH 3UCRA 1FNLA 3BOVA 4CMHC 3EHBD 5FGRA 5F7EL 2KZWA 2WSKA 5FHAL 1NQBA 4QRUB 1GHFL 5LGHH 1QA9B 2A9NH 3O8XA 3V5KA 4FQLH 2NZIA 5F6IC 3ZKND 4RWYL 1TJGL 1X5LA 3SGJA 1RJYB 4KVCH 5ICYB 5GPRA 1FVDA 1IBGL 3VCLA 2RB8A 4MAYD 3DUHA 1BPVA 2ZUXA 4HBQA 3BKML 1MFEL 3KLAB 3C5SB 4NQDB 2FECL 4YGAB 1U8HA 5I1IH 5F7KC 5BS0D 2ZPKH 3BYTA 4XP4L 3CFCL 1A1OA 3DMMC 4JB9H 2PW2B 2XG5A 5EB9A 3C5ZD 3U30C 1S7TA 4MJ5A 5FYJU 2XFXB 5HD8C 4LLWA 1F90H 4RMVA 5F7HA 2WANA 1ZK9A 1V7NH 4RFOH 2Z0BA 4HT1L 4QF1B 5E2TL 1S9YA 2WIIA 1FDLL 5C1MB 4G8IA 1T0MB 3IFPA 1IT9H 2Q3ZA 3RY5A 1RZ8B 4X4YB 3VW3L 1WBYA 3V0VB 1IBGH 2VDMH 1PZ5A 5BRZB 4P2OA 3W0WA 4Y4HA 3BKMH 1IAIH 4HG4K 5D7SH 2DM7A 3LKOA 3DV6A 4KQ3L 1CDIA 1FE8H 3MACL 4NQDE 3RWDA 1V7MH 2HTKD 2A0LC 4Z7VF 5B8CB 3X14A 1J12A 3P0YL 3HZVB 2R56L 4GSDH 5HPMB 1PY9A 1NBZA 2EDKA 3F58H 3T1WA 2GCYA 4H1LB 4GMTL 4DVBA 4CKVX 1CZ8H 2BCKA 2B1AL 1FDLH 1BVKA 3O45B 2DIBA 2YUXA 4P9HL 1KLGA 5DVOA 1ZT1A 4OZHA 1JGVL 1XR9A 1G0XA 2OJZL 1G84A 1I9JL 4H25A 1UM6L 2NYYD 3DIFA 3EIFA 4PY8I 3N50A 4L9DA 8CGTA 2EZ0C 1GPOH 12E8L 3ZYOA 5BRZE 2OK0L 3QNZA 4PJGA 4ZAKD 5I8KH 1KJ2L 3KPNB 1LE9B 3SO3B 2NXZB 2XG4A 3QRGL 1FNEB 4G8FA 2IQ9L 1QPPA 2AQ1A 1HHKA 4OZFG 5DGRA 3JTSA 3RL1A 3RKDC 3MV7D 1CTNA 1J10A 3PABB 3QJHB 1G9EA 2GT9A 4KJYA 3SE9H 1NCWH 5D9SB 1AIFA 4Y1AD 4BZ1H 1FV1A 5I8EB 1BLNA 1T80A 1I9JH 4JFPB 5D72L 1WAAE 4I77H 4GH7B 3PV6B 3QDHA 12E8H 1RZJH 1MLCA 1MCWM 1QSEA 4LLQB 4PRHB 2VSDA 3O3EB 4X80H 4ZUWB 4OZGB 5CILL 1UC6A 1UJ3B 1FFOB 2VITB 5BVJB 1T04A 2IPUG 1MUJA 2DLEA 5D1XB 2MJWA 1J8HB 5GHWH 1UB6A 1R5WB 3HS0A 4HWZB 1BFOB 3H0TB 1UB5A 3DX6B 3QCVH 4G5ZH 3M17A 4P3CL 2DQEH 3H9SA 3ROOA 2D7MA 43CAA 1NLDL 1BGXL 4UDUA 5JA8B 1BD2D 3MGOB 4DCQB 4HWUA 3PWUB 3C6LB 4CVWA 4FFWD 1ZHLB 4FFYL 4XXCC 3G5YB 1M7IA 3UBXI 2ZUTA 3V4PH 2YKLL 1Z9MA 1OGAD 2XWTA 3UZVB 1HINL 4Y4KA 3KR3H 5T3XE 3RWGA 2EIZB 3GI9H 1WTLA 1RULL 3ILPA 3OF6D 4PRHE 3WIFA 4M1CC 1MREH 5J1SC 4P5TB 1KB9J 1U3YA 5DEGB 1E4WH 5HHVL 1KJ2A 4HQQL 4LLMA 2WINB 1J8HE 4JO4L 4ERSL 3BPLC 1P4BH 3V6ZA 4GRLD 2ICWA 4HK0B 1YNLH 3D0LA 4LEXL 5JLZA 3FONB 4ZSOA 3D5OF 1A6WL 4K07A 1MCNA 4EDWH 4OF5A 1GGYA 1EJ6A 3U7WH 5J89A 43C9A 4OLEA 5JZ7C 4XCYA 3VXMB 3QJFB 5I1JL 1YPZA 4L4JA 4HS6A 1KENL 2W0FB 3BP6A 2BHZA 4KDVA 1M6OA 1ZSDA 2ZZUT 3MLSL 4CADB 1VFAA 2C3XA 3CSGA 5CSGA 1XGPB 5IMMA 3CFIC 2D31A 2FSEA 2I25N 4YDVB 2VLJD 3GJFK 4HGMA 2AV7B 3K80A 4E5XB 2R8SL 1NFKA 3PGDA 3ARSA 4OGYL 5C0GA 4FQQB 1Y18A 3CXDH 1EMTL 2FL5A 2J5LB 3JUYA 4ZDHA 5HHOB 4QKXB 4LEXH 4CVXA 3IFNH 3PHQB 1RIVH 4QGTA 5A16B 4PJXB 4CNIA 2GFBA 2IG2L 4IRSB 2HYMA 2VOTA 3QEQA 1T5XB 2DKUA 2EYTB 3N1QC 2WP3O 1JN6B 3VI4E 3VXME 3ALXA 5L8LB 4S1DD 5EWIL 5JNYB 2C1PA 1GC1H 5KTEH 3CFBA 3IKKA 3FO9A 1A7OH 4R3SA 5IVXA 3QWQB 4F37F 3GSNB 2R69L 4EKXA 5CKGA 1I9IH 1UWEH 3IYLW 4ZD3H 2VQUA 5T5FH 1JGUH 4NC1C 5F9JB 3WHXB 3MLWH 5HHOE 1A22B 4DKAA 1CFSA 4B50A 2IG2H 3V5DA 3CSYB 1AJ7L 4M1GH 4OF0A 4PJXE 4HJGB 2DD8L 4Z76B 2ATPB 2HFFA 5IF0B 3X3GH 3DX8A 3PG2A 2GSIA 3QQ9C 4GAJH 1BZ7B 4WFGD 4LVOC 1RHFA 1OARL 3V0AC 3BGAA 1RZKC 5FECA 4Y7MA 1D5XA 4R0LA 3BD5A 2NY5L 4GW4B 5CSBA 3G08A 3RA7L 3QDMA 5BVPL 5CLWA 3LRSB 2IANA 1YMHA 4YDLB 5IOPB 3IT8D 4BKLA 4R7DB 4G7YL 1M05B 5DJ0B 3AREC 3BIAX 5HBBA 2OTPA 2JJTA 4TN9A 1JVKA 1MRFL 5GZNC 1BF2A 1U8PA 2NY6D 1OM3L 4P23D 4LQ1A 4HCRH 4D9QD 3IKCA 1MJ8H 1Q0YL 4LSUL 5C6PB 3T1FB 2C4FU 3W9DA 1KYOJ 1S7WA 4U1GB 4U6HA 4WCYH 2P8PA 5IMLA 2X4NA 1DN2A 2R1XA 4RFNC 5I1LB 3W82A 1ZHBA 1CL7I 3QUZC 2YUWA 2HA1A 4FP8H 4MJ4A 1EHXA 5JR1H 1YEEL 3B5HA 1UVQB 3VFRA 2JB5L 3WE6B 3WDIA 2VDNH 2NLJA 3MRPA 4NO3B 4XPBH 4GLRH 3CDGB 5FGBA 3NA9L 4G6AD 2DQTL 4BFEA 1NMBL 4RGOL 3ULVE 4Y19A 4ZXBA 3P9MA 5SWSB 1WC7B 5D1ZC 1EUTA 1DUZA 1VB9A 3VGBA 1U8KA 3P9LB 1PSKL 1CICC 4UAOC 1TTGA 1LO3L 3EZJB 5IB3A 1WJ3A 2ICEA 2RAMA 2D03H 3K1DA 2FJFB 2F54D 1ZT4B 2NXYC 4P99A 5C0DB 2V5YA 5ID0B 1JYWA 5DMGD 4N0RA 1CFTB 3OPZL 2LU4A 3SDDD 1CFVL 4F7PA 4Z77B 2E7HA 2DRUA 2Z31B 3DX9A 4UB0L 5E8EB 3RIFF 1N6QL 1R3JA 1JZ3A 4P2RD 3H9HB 3C08H 2FIKA 4AG4H 1BOGB 1DQQB 2FJGB 1RU9L 4QRRD 2XZAL 2NY2D 1YEHL 1G7MB 5I6XB 1FL6A 5C0FA 4F15C 2Q7NA 5B3JF 5IK3B 5BS0B 5E24E 1WITA 3C5ZA 2W91A 2X4UB 2CUMA 1GAFH 3E0GA 4B7IA 5DJ8A 5DD6B 5C09B 4C56D 2XKNA 4NPYB 4LKXA 5LGKA 4Y16D 1E6JH 5T1LD 2P43B 5GGUB 2YPLD 4CDGC 3V6OA 1PGRB 2UYLB 3EJJX 5MP6L 3AS2A 2AJZA 5I1KH 3U7YH 1EO7A 5C0JA 2EDHA 2OR9L 2XZCL 4AL8L 3LKQB 1MHEA 4G8GA 3ZDYF 1RFDH 1VERA 1JUFB 3R0MA 5DMJB 2AKRB 2XZAH 4Z7WB 1MCDA 4FA8A 4HEPG 2XI9A 2FGWL 3L5JA 4Y5VB 2EICA 2HFGH 5BS0E 4K7FB 5FHBH 4EUPA 3NCCB 3QPXL 5CJBA 1I1AA 5KVDL 1WBXA 5E4EC 2VTFA 5C09E 5DK2B 4C83B 5J6HB 1FPTL 1XH3A 5IMKB 3PE9A 1IKFH 1QNZH 1NAKH 2ZOKA 4UT6H 2FR4A 1LDPH 4YZFF 4PGDB 4XI5C 2OR8A 4NO5B 5D2NC 1YMMB 2BXYA 4D8PA 1F2XK 4DVRL 2MCPL 4JY6B 2NW2A 2DQUL 1FYTD 3D85D 5MEPB 5IEHB 1TZGL 3V4VH 4OQTH 1KEML 4KZEH 3MLTB 2R4SH 3SO5A 4KY1L 2DWDB 5B39A 3BZEB 3BPOB 1JZ4A 1NMCB 4X7FC 2MPAH 3O11A 2FLBT 3QEHB 2X4PA 1K4CB 5ERWB 4PY7A 4PPTA 2Q7YB 3T8XB 4WJ5B 2LAGB 1FL3B 5I2IB 5FKAB 5T1KD 1SVCP 2VISB 4FZ8H 5K59F 5CGYD 4OLVH 5JMOC 3BT2L 2DYPD 2HKFH 4Y1AB 1YEKH 5IG7B 3MROA 3SGDH 2NTFB 4HMDA 2VE6A 1YMME 3CU1A 3O2WL 4M7JH 4O02L 3IS0X 4R2GD 5KOMC 3TO4B 3CK0H 1U92B 3AB0C 1LO5B 3QA3B 1MFDL 1MFBH 5FA3B 1ORQA 1RK0A 4FQHB 1W8NA 3A6CL 5DD0L 4YJZL 3VFVB 3U2SB 3DMMA 5EH1A 3AU1B 2W0LA 4HGWB 1LWRA 1DP0A 4PJEB 3MJ8A 4WWKB 3C60C 2R2HA 4OUUB 1ZS8A 4M5ZH 3MV9A 1A9EA 3VE0A 1BD2B 5AWNH 4I18A 2IAMD 2XT1B 4X7DC 1DUYB 1AGCA 4OD1L 1FNFA 4JM2C 3EDFA 3GSVA 4Q97A 2DQJH 4NSKA 5IB4A 1OGAB 4KKAD 3ZHLA 1XIWC 3BDYL 4HX1A 5H94B 3WSQH 3GSOA 5I1AA 4ISVB 1W72B 3WUZA 3MJ7B 3CH1A 4PG2C 5HHNB 5I1DA 3D48R 5ANMB 2XXMB 3A67H 3IAPA 3FB6B 3G5VA 3T0BA 1KPVB 4PTTB 1T1WB 4GRLB 5F44A 2DWEB 2DQGH 2BSTB 4J3OC 3EOAA 5DHVH 5DDHA 1VPOH 3KPQA 1QKZL 3TLRA 5DQ9A 5CEYA 1AP2A 4OLZL 5GGVL 1AD9A 2CD0A 4EXPX 1EJOH 4S1QL 5IJVA 5FCUL 4XHJC 4OD1H 3QH3B 3PL6D 1A02N 1S5IH 3VA2C 1ITCA 3LN5A 1CGSH 4FMKA 3MJ9H 1MHHA 5KSUB 1JPGA 1OGAE 3GUTB 2VLJB 5KW9L 5J11C 2VN4A 3QO1B 5JOFB 4BH8A 2EKSA 3CFJB 1WQVT 3LPWA 4KK6D 3SDCC 1BVZA 5I73C 3FHAA 5ANME 3DGGB 4LIQH 5J7CC 4Y88A 2MQ3A 2QEJA 4BZ2L 4HS3A 2E3VA 2EXWC 1RPQA 2V7HA 1PBYA 1K5NB 4LMQE 4X5XA 3SDAC 4PY8J 5BV7L 3MOBL 4J12A 3DPBA 2ZP0T 5GGSY 3WN5C 1IC5H 1A3LL 3U0TA 5KSBB 3UPRA 3QZWB 2VDKL 2ITCB 2HMID 4H20L 5EO0B 2MHAA 3EO1B 1IGIL 2VLJE 3G6AA 4L9LB 4L3CA 2BMKA 4LDLB 4P0DA 3F12A 3MRLB 4DKEL 5I1EL 3ZSSA 1C7SA 4MA3A 5MEOB 4ZNEA 3GSUB 4EDXA 4GUPB 1YNKH 3AXLA 3G9VA 5ILTL 2OP4H 4WEBH 4K3DL 4MXVE 3IRZA 3VFMA 4XBPB 5GRZA 1OAYH 4NN5C 4TSBH 1FFNB 5IBTH 1ADQL 1S7UA 2XWJA 4AQ1B 4QTIH 4Z8FH 3LN4B 2MSPA 4M7KH 3HNVH 1SYVA 1T89C 4Y5YC 2ZG3A 3NCYP 3Q1SH 4ZTOL 1IC7L 5CZVL 3BPNC 1MCIA 5KSBE 3JVGC 4JAMB 5FFLA 4J1UB 2GKIA 4JFDB 4GS7C 3UEZA 4DW2H 2R1WB 4PTUA 3PHOA 3MRIB 1UCBH 5C08E 4G8EA 2QLVB 1Q72H 1Y6KR 4ZUSB 2X9XA 4TULL 4U1MB 5A2JH 7FABL 3RAJH 2QSCL 3MZGB 3RWCB 1AGBA 3F5WB 1PQZA 1YJDC 3O6FC 4PV9B 2BP3A 1DEEB 1NCCH 3SKNB 4Z78B 4QNPE 3P11L 4I9WD 4JG1L 4P23A 3NIFE 1G1CA 4WUUA 2HFEB 3JXAA 4PBWD 2NY6B 3HLAA 5C0BD 4KI5D 3GSRA 4LPVA 4XC1L 3EYOA 3L9RB 3BPCB 3KLHD 4X7TB 1N59A 4XVSH 4TVPE 4U1NB 4MNGB 3EYFB 1FVCB 3QCTL 4LASH 5H8DA 1DQMH 1BWMA 2A6DA 2XWBA 3HCVA 3T77A 4LSPH 1DQDH 4JFDE 4TNVF 3W2DL 4NKDA 1MCRA 4F7MB 1EERB 4MS8D 3OTTA 1UM5H 3KYOB 3FQWA 2L0DA 3SKOB 1G7LB 1P2CA 3TBTA 1T7XA 1N2RA 4R90H 4LSRH 4NKIH 1BBJB 4NRYB 4IIQC 3L7FA 4FQXD 3FOMA 2COQA 3I6KB 1L4IA 2J8UB 4YBHA 3BN3B 1LK2B 3B8SA 4JANA 2AV1B 4LPUA 2F54B 1WAAF 3QEGL 1A6UH 4P3DB 1AO7D 4RRPA 3RZCB 3RY6C 1MCWW 1MJJA 5BW7A 2OL3B 3MQIA 3SDDB 4MNGE 4OLWH 1KN4H 1RZKH 5KN5A 2I5YL 4P2RB 3HZKB 1IZJA 2F53D 4XX1G 2WLYA 4UUJB 5F7NC 1F11A 1MNUL 3FFCD 2NY2B 4EQ2A 4QHNA 1INQB 3F6IA 1HH9A 4C56A 1FHGA 3VFSA 1CG9B 4O00A 5T1LA 2J88H 2YPLA 1S5HA 4WI6A 5IBUB 4Y16B 4W6YB 5EU4A 4ELMA 4POZD 3EYSH 4OCNC 1KYOK 4YR6B 4YBQC 5FO9A 3MRRB 5D5MB 2F54E 4FQIH 4R96A 2DM2A 4UT7H 3OB8A 1HWHB 5DF0A 5TE6L 1T2XA 4RWHA 4M93C 1LDSA 2I5YH 4LAQH 4LCCB 4XNMA 2V2WA 3VD4A 1L0XA 1MNUH 2G2RA 2RBLA 3QXVA 4OZGF 2OSLA 4P2RE 3M8OH 1NJ9B 1WIOA 4PJ9D 3WFHB 1GZQA 4QRTA 1GOFA 3B9KC 5CUSH 5E6IC 3CX5J 5GRVK 3GIVB 4G9DB 3RU8H 4MZ2A 1KXTB 1C5DA 1T0NA 4Z0XB 4MD5A 1TJHH 4JHWH 4HZAA 2X4RB 1BM3L 1DANU 1T03H 1MH5A 1S9WB 1XGTB 4K3EH 4PLKC 5IHZB 4HHAB 1A9BB 4XH2B 5TE4L 3WKNA 1KJVA 3KPOA 4G80A 2XNAB 1N4XH 3BVNA 1YNTB 4PBVC 1UWGL 1I8IA 4R4ND 5FKPB 5FOJA 1N8ZA 1JV5A 3I2CH 5TE7L 3PNWA 5HYJB 3P3YA 5DTFB 3QUZA 3ARTA 4X6BA 1B0RA 2GTZA 4OZIA 1EAPB 1XGRB 4C59B 3D85B 5FYKU 1Q9OA 3PJSB 1P5VA 4APQB 3TM6A 3A6BH 3L3KA 3VWKB 4HKJB 4NM8H 1OSZB 2WW8A 2ZUYA 3HE7D 2AK1H 2Y23A 3DNKA 4JKLA 3QT2A 5T1KA 5D1ZA 2SEBA 3BKJH 5I75C 3QPQD 1VADA 1XCTB 3L95A 5I66B 3LMJH 3VFPB 4HS8H 2DYPB 5HDBE 4YHNB 1CR9H 1G6RH 3FQUA 4XAWH 2BHYA 4AENB 5F1IA 4PRBA 4MNQA 4RZCA 3QIWC 3TV3H 2XA3A 4I0PB 1KBGL 5HYJE 6FABL 2NY1D 3L5HA 1QR1B 4NJ9H 1HNGA 1NGYB 1CQKA 5DFWH 4N90E 2XTJE 3VXRA 3VG0L 5I1CL 4O2FB 3RPIA 1EXUB 1T1YB 4KUZH 1JNJA 2A73A 3RVTC 2ENSA 5IW1B 4X9FA 3LH2H 1KCSH 1WICA 3VFGH 5D7IA 3CCHB 2H8PB 1HHGA 4G3YH 1JYXA 1JWSA 5JW4N 5F70A 4U3XA 2M2DA 1PW3A 3ECBA 2PTTB 3BMVA 4UMGA 1G6RA 2EDWA 2HRPL 1AGEA 3DURA 1IGTB 2WQ8A 2Y72A 5ICZA 5ADPL 1RUKH 1CDGA 1B9ZA 2CKBL 5B38A 1ZANH 1H15A 3C2AH 3QWRD 4CDHA 1JGLH 1SJHB 1UZ8A 1YEFH 3CPLB 4HF5L 1X5XA 4G9FD 5HGDB 4K7PY 1CDJA 1ZOXA 3MR9A 2QL1A 1JI1A 1F4HA 3ZSTA 4MDIB 3WHE0 3T04D 4FXGB 3FAXA 3VRIB 1TQBC 3IDXL 1NCAH 1E4XH 4DN3L 5C6TL 4NQEA 1M7DB 3S88L 4ODSL 4HUVA 4M6OL 3PL6B 4RIRA 1BFVL 2APVA 4NN7C 4X6DA 3SQOH 2Y7QB 2GJ6B 4LCWD 2P5EE 2CIKA 2DI8A 2CDGA 3QDAA 1YC8A 5T5NG 5HHQA 1X5YA 2IADA 4HD9A 3OKYA 5ALBL 5CLTA 4KKCC 3UTSE 2NX5D 4ODUA 4KZDL 1JI2A 2BOBB 4PJ8C 3TIEB 2ZCHL 4RGND 4XCNB 4P5MA 3ULSA 3BRGC 5IESL 3U1SH 1S78D 1ZTXL 3KPPB 1U2HA 4DWHA 2AXGB 4N5UA 5K33A 4BJLA 1CD0A 1MCBA 5EC1B 4ODSH 5DLMH 5DFVD 3PQYB 5IQ7L 2CLZB 4NKMB 1MCLA 1CLZL 1N0LA 1KIUA 3NZHH 1Q9KB 5IVZA 2Y25A 1DBKH 3LS5L 2GJ6E 4E41E 3LV3B 5BCAA 1KFAH 4BA8A 3WS3B 3EOYG 5D70H 1JFQL 3N9GH 2CKBA 3U83A 4K8RC 1P4LA 3EJYC 3LN9A 2Z8RA 32C2B 5GS0C 3ZE2E 2FB4L 4JEGB 1Q9LB 2ENYA 4M8VA 1KG0B 3O9WD 4X4ME 1SEQL 1U8IA 4PB0L 5E6ZA 1H5BB 4XGZA 4PJCB 5DJ2B 2GY5A 4QRQB 5DJCB 2GUOB 5HTSA 3PQYE 4JFOB 3FQTB 5SWZD 3RGVD 4F33A 5GJTH 4TTGA 1KJMA 3JUZA 3MLXH 5HHPA 2ZUQC 4FXKB 1XIWA 5F3HB 4U1LB 2HVKA 3DOSA 4XBGA 3QBTB 5J6GA 3V5KB 1A14L 4CGTA 3B2VH 1TTUA 1CDHA 2GITA 5I17B 4ALAH 5IFJA 3BE1H 5C0BA 4J6RL 1MHPL 4QXTA 4OCLC 1WZKA 2B4CC 4QXUL 3RDTD 1JNHB 2H6PA 4PB0H 5E99H 1L7TH 5TDNB 5A2FA 3FQRB 1IGMH 2CIIA 4QHUB 4PJCE 4HJJL 4KQ4L 4UV4L 2LV4A 4CU8A 1A1OB 2VLRA 3AUVA 3QUML 1T4KA 4XPHL 1FFRA 1A3RH 3QG7H 1A6ZB 4KJWD 3S7GA 4Z7WF 1S7TB 5DRNA 5BXFB 2VKXA 4OZFB 3S4SA 5KANI 3HUJB 1HYSD 2KQNA 3L7EA 1T83C 4NRZA 1R6VA 4MZ3A 5CJQL 1IFHL 1OAKL 4D9LL 3KPLA 4PYGA 1CXLA 1E28A 1V5JA 2PYFB 4IHOB 1I7RA 3MFFB 4IDLA 2WIIB 4FQ2H 1I1YB 1TTFA 1OB1A 1QSZA 3LQAC 2DB8A 4UOW1 3IFPB 4HZLB 4LSSL 3MO1A 4BQCA 3RL2A 4FQXB 3QI9B 4P2OB 3TJEH 3LQMA 1AO7A 1I3UA 4YIQA 2VXQH 3WIIH 3EYVA 3SDAA 1ED3B 5BOZG 5L6YH 1S7QB 4N1HB 1RJZB 1QHOA 4K94L 3VRJA 5IT2H 4LP4A 1DN0A 3ARVA 5DYOB 3M07A 4HPYL 2HT2D 1SJEB 1AHWB 5MEND 4JLRA 1J05B 4QYOB 1ACYH 1R0AH 1J18A 4XVJL 3T0EB 3UBXG 2QADD 3HUJE 3FFCB 5IQ9B 3WMSA 3QUYD 5FYJH 1YJDH 2XZZA 4QOKD 2BSRA 3MZTA 3OKNB 1KLGB 1DANT 1ZT1B 4M7LH 4M7ZB 4LSSH 1RZFH 1AR2A 5F1OB 4H25B 1MI5A 3AS0A 4NC2B 4XVTL 3WFDH 4YHYB 5HXMA 4YC2B 2A77H 2PR4H 3RGHA 2E9IA 3A6OA 2VZUA 5GRXG 3LS4L 1KLUA 5EC2B 4HPYH 3QUKB 4Y5YA 4G8FB 1HILA 3OXSA 4PJ9A 3ZL4L 1JWMA 1H3WM 1VGKB 3JBG7 2LVEA 3RL1B 3O6KH 4LCUA 4GG6A 4OGAD 5KSAC 2IBBA 1F58L 1FZKA 1WSST 3T0EE 3QUMB 3FFCE 3HI6L 3GJFA 2LU7A 3T65B 3U36B 4PJEF 4S0SD 3WDHA 4L8SB 3P73A 4GXVH 5DRXA 3IFOB 1FGVH 1UQSB 5GISL 4R97B 4YHLH 3U46A 4M5YL 4R26L 1DR9A 2Z8VC 4U1SA 1MUJB 4JKPH 2R9HD 2UY6A 3DBXB 3TEUA 1UB6B 2EH7H 1D5IH 1ORSB 3HAEH 4WIQA 3RNQA 2P7TB 1MWAH 3UTTD 1LO4L 2KBGA 3CFKB 3LRHA 3S97C 2BNUB 4KMTH 5KZCD 4P2YA 3S98A 3ROOB 4IMKA 1F58H 5EBLB 4JPIA 3IU3A 1D5BA 3HE7A 4MAUL 2ERJC 5C6WH 4OIIL 1E6OH 2VR4A 3H3KA 3IXTB 2APFA 3C2SA 5MERB 2VC2L 2M8XA 3SDYH 1UZ6E 4HUWB 1P9MC 4IJ3C 1JTOA 4KKBC 3GMNB 4F3FB 3BQUC 3NAAL 3RWGB 1QSEE 1BQHG 2IPTL 4R26H 4Z95L 3B2UC 1J1PL 1KCUL 3S3SA 4UILH 1AI1L 3RY6A 1HQRB 1II4E 2Z91A 2VR9A 2A0LD 3TNMA 1RZGB 5HGHB 1FC2D 2ICWB 5I1HL 2F5BH 2A83A 5CHNA 1MJUH 4EN3D 1AQKL 1I4FA 4N8PA 4X4ZA 3LSOB 1U93A 4WW2B 2AXHA 3CX5K 4OIIH 3BWUC 2R1YB 1I85C 4AY0A 1JWUB 1AD0B 3IVKA 4GQPH 1YPZB 1T1XA 1R3IH 4MXVF 1M6OB 5AYUH 5DD5L 1ZSDB 1W0YT 3BH8A 1JGEA 1WISA 1FGNH 5L2KD 1A6AB 5DMKB 3ZTNH 1I3GH 4JFQA 4RFEA 3QO0B 5EU6B 4GFTB 3SBWC 2WWMD 5KSBF 5C0GB 1A6VH 1Y18B 5L9DH 2AS5M 2FL5B 4YHMH 1ZLVH 4Y4FC 2VQTA 1ZVSB 3TBYA 1DVFD 2F5AH 4MA1C 2YPKA 3HPLB 2WP3T 4LMQI 1LGVA 2UWEB 2VXSH 3RKDD 1QHPA 1OTSD 4GG8A 3LRGA 4JN1L 2NW3A 4QNPF 3B9KA 4L4TB 3S35H 4DGVL 4MCYA 1YPZE 4JHZA 5J57B 3CUPA 4JO2L 1ZLSH 3RJQB 3FKUS 3VH8A 5JMRA 4F37K 4G9FB 4PGCB 1L7IL 3MLUH 3L1OH 3RBGA 5JW5A 4PJHA 1XCQB 4AIZB 4LLUA 4YHKL 4R3SB 5IVXB 3EW3B 3GMLB 5TDOB 4N1CA 2DQCL 2B2XL 3LKRA 3OAUL 5DHYB 4JJHA 5EU6E 3V8CA 5I19L 4LCYA 2H32B 5DD1L 4LCWA 3BXNA 1JPFB 4LLVA 3HAEG 1J0HA 2PXYC 3U0PA 1F4WH 1IAOA 4XWGL 5E08H 4LSQH 1CFSB 1KSRA 2KKQA 2AJ3A 2NX5A 4X9BA 4JN1H 2ICES 3FMGL 3SOBH 2UWEE 3EYQC 4UIKL 1MHCB 3CLFH 3CVIH 3MNZA 5HYQB 2ARWA 2XPGA 4L4TE 1AGFA 3TH2T 1T5WA 3KPMA 5F1NB 1MAJA 4NWTH 4RGNB 2LVCA 3NPSC 4ZOCA 2G5RA 4DTGH 4G9FE 4PS4L 3ZT7A 5CSZA 3ARYA 3TP4A 2EDBA 1H0DA 3WNOA 3TVMC 4OT1L 5IVXE 4YX2L 1MJ7H 5I1GL 4AEIL 4I1NB 3V7AG 5HJ3A 1CGVA 3D18B 3PGCB 4XWGH 3QULB 4B7LA 4YFDB 4PJ5A 4C4KO 2P8MA 4XMLL 5JHDD 1G6VK 1AKJD 2HH0L 3QXAB 4GQ9H 1U8LA 2GTWA 3OGCA 1HK6A 3MBEC 3H42H 3T09A 3UJJL 1XGYH 1LE5A 2WUBL 5IFHL 2X4NB 5A2KH 1K2DB 4KK8D 5KVMC 2J8UF 3FRPA 4X6EA 4PRAB 4DZBA 4ZTPH 3W11D 5FUZH 4FN0A 3O9WB 3UO1H 5IB1B 3KDMA 2C3WA 1ZHNA 3OJMB 2W0PA 3QDME 4XPAL 4ZFFB 4PYHA 4XPFH 5SWZB 4YFLF 1NGQL 4NO2A 4RMWA 3ULVC 3MODH 1NGXA 3KHQA 2P4AB 5D8JH 4MXWL 3F7QA 4KV5E 5IB3B 1RQ5A 3RIFK 1X7QB 2VXTL 3L3OA 4WU7B 2YD8A 4H26A 3U7AA 1B0GB 1KIQA 5BZDB 5ITBH 2RCSL 5JTWA 5DT1L 2XN9A 3OKEA 4YGVA 3NCYS 4U1IA 2X4QA 5ELIA 3TPUA 3RDTB 1UXSB 3T3PE 5D5MF 3GHBL 5E9DB 4YXHH 4Q9QH 5BZWA 3BP7A 1ZMYA 1FL6B 1ZGLA 4NNXB 1E0OB 1OP5H 3LB6C 2FX7H 1J8KA 4NUJB 1YQVL 4K3JH 5D7LD 4KTEL 5D71L 2I26N 5TF0A 1QQDA 4Y19E 2D9CA 4HV8B 5SWZE 3JV6B 2NNAB 4UDTA 1BZ9A 1UWXH 3B4NA 2VXTH 4IS6B 1VACA 4HKXB 3QDGB 5IFAL 5F21B 3C5JB 2MQCA 3KGRA 3QUXC 4K8RH 4UQ3B 3RVUD 1DLFH 4KK9D 4U3CA 3DSFL 4DK3A 5EU5B 4ETQA 5GS0H 3F7RA 1TQCB 5E1AB 4G8GB 4M9OA 1SBBA 3INUL 4R4BB 3W9EA 1DE4B 2WAHA 2BSSA 5HDBF 3OXRB 3ZDZF 2R23A 5C0CB 1JCKA 3DX7A 5JOEA 3QG6B 4H5SA 4NZJA 4XNUL 3PDOB 5E9DE 5MENA 2ZJSL 3F6LA 3BDXA 2ED7A 4P4KA 3BSZH 4MYWB 5FA4A 5EIIA 5EOQH 2FWOB 3OX8B 4X0KA 3RP1A 3MREA 5DD3H 4BH7B 4QOKA 4OV6F 3QFDB 5HHXH 3IU4H 4JPWH 5I15L 4MX7A 3O2VL 3QUYB 4PRPD 2B20A 4UNVA 3X3FH 1C16B 4MJ6A 3QDGE 1NLBL 4L29B 1A1NA 4P5KB 5DI8A 5FB8B 3G04B 4N9OB 3L3IB 1NGWA 1OSPH 2B4CH 1T2QL 3L3HB 4G8GE 1FBIH 4QCIA 1KNOB 1V8HA 4PGZA 5CBEA 1FN4B 4Z5RA 4PRIB 4EQ3A 1JHKH 5C0CE 1JNLL 3H9ZA 5IHUL 3CX2A 3IGAA 2FNBA 3D69B 1SYSA 3K1KC 2XZQL 2LABA 4ODTL 3O11B 5ACZA 3MRKA 1PD6A 4NKOA 3QQ4B 2KH2B 1MY7A 4CMHB 4XBEL 2I24N 3ARGC 2OI9C 2V2XB 4NQUA 1X5GA 4M48L 4H8WL 3LQAH 2WWKO 1N64H 4ONGH 3UTPE 4N0CD 4DQOL 3HMWL 3VXOA 2DMCA 1QRNA 5GJSL 1D6VH 5FUOL 3PWPA 1S7XA 1OP3K 3WD5H 1NEZG 2VZOA 4X99A 4LVHC 3UTQA 1R5VB 4PJBF 1IC1A 4PRIE 1INDL 3D3VD 2XV6B 3O4LD 4OCWL 2W92A 4KDTC 1J1OH 1C08A 2AXJA 1RK0B 5B4MC 3QAZC 3DMMB 3UTTB 4LBEB 4RISH 5AD0A 4CN6A 3O2DL 1KCLA 3SKMA 4GT7A 4KKLD 1FORL 4JG0H 3U30B 3RWEA 3MRDA 4ONFL 3FO1A 3AAZB 1T83A 1S7VA 2FRGP 5ENWA 1QO3B 1A9EB 5DA4A 3VE0B 4RCAA 1EO8H 1I9RH 4ZUVB 1SBSL 1CU4H 3FT3A 2EDJA 4NQXA 1ZVHA 2Q6WA 2X4OA 4IRZL 3IJYA 1F4AA 1T66C 4G6KL 1A0QH 1I7UA 3TT1H 3HC4L 2FH8A 5DJXB 4HH9A 3GSQA 2CDFA 3MNWA 1HE7A 3OAZH 4MCZA 3EGSA 1PEZA 3O6ML 5CFHA 1YEJL 3RTQC 1MCSA 1PG7H 4OF7A 2ID5A 3NFPB 3WNMA 2W9EL 3O2DH 4L5FH 1J1XL 2BNQA 3UTTE 5E5UB 1FORH 1N5YL 3IXAA 3EOAB 1F4XH 2UY7A 4UNTA 1DQTA 5LXGH 4QTHA 3LPFA 5E2VH 3MV9E 4QHMB 4GKSA 5EZLA 3WV0A 2FATL 5D93C 5C7XL 3MRMB 1UG9A 3ALWA 3B9AA 3QDJD 4ODXA 5DJDA 3SEPA 1IQDA 2FBOJ 4Z7NE 4KFZC 2R4RL 4NJAL 2DDQL 5JW3L 3U9PH 1OAQL 3CMOL 5L2KB 4M03A 3ULUD 3I50H 1FH5H 1ZGLP 1HKLH 4EI5C 3DV4A 2EKSB 2YZ1A 3S96B 5B22A 1MCPL 2QR0B 3ZLQC 4RA0C 4JKKA 3TYFB 2JCCB 3EJZC 3BKCL 4Z7UB 1LEKA 1K8DA 1LO2L 5FV2A 5CIPH 4NQCD 1KV3A 4HS3B 3GO1L 1FG2A 3O2DA 1NMAL 3TN0D 3I02A 2DQDL 5C8JB 3HRZB 1N0XH 1HDMB 5DHVB 4JJ5A 3LQZB 3EDJA 3EOTL 1AXTH 3FB5A 1U95B 4JR9L 1K4DB 4PREA 2YC1A 1LD9B 2R4RH 4EBQL 2WBJC 3O0RH 2R39A 2VLME 3RY4A 4FMFA 4PLJC 1I8LC 3ARFD 4D0CA 4Y5XA 5L2KE 3AY4A 4QXGL 4PJCF 3HMXH 3VXPB 3E8UH 4HDIA 4IRJD 3MRCB 3DI3B 3FRUA 3THMH 1IM3B 4JREC 5JUEH 3K3QA 1MCCA 2JCCE 2WMPA 4LEOA 3NFNB 3HI1A 4U31A 4EDXB 1KF9B 2CO6B 2BHUA 4AM0A 4ZFGH 4U0QB 3QIBC 3GSWA 4L1HA 4A2MA 3ZT6A 4PJFB 2DQIL 5CBAB 4JRYD 1NCUA 1TVBA 2HLFC 3P0VH 1T22A 4ORGB 3O41B 4JM2D 1QLEL 2VABB 1O7SA 3HC0B 3QHFH 1P9MA 2HJKB 2VB5A 4F58H 3OJDB 4KI5F 1I1CA 2NZ9D 1IQWH 4QXGH 3BQUA 1QFUL 5BQ7A 1CN4A 1H8SA 3OJ2C 2H1PH 2FJHA 2W07A 4LLDB 4EOWL 5A3IC 1KXQE 3HUJF 3WFBL 3SE8H 3ZE1E 3AS3A 5JHDA 2BJMH 4LRNL 4O5LH 1Y0LA 3I3BA 4C54A 3TZVD 1KELH 4Q6IA 1HQ4B 5A1AA 4XPGL 4LIQE 3BP5A 1AKJB 2GJZA 2GYSA 3IDMA 1MCQA 4HJ0C 4PJFE 4TNVK 1RUPH 1CS6A 1G9NC 1Z6JT 2YD5A 4XHJD 5CCKL 4DFHA 4MA8L 2GHWB 4ZYKA 1S8DA 3K4AA 4FQPA 3KVQA 2G60H 2APBA 3QEUB 2XQYK 3DROA 1U8MB 2A6DB 4GKNA 3DO7B 2XRAL 3UC0L 3DLQR 4NKDB 5C3LD 2Y4SA 1GGCH 1IGFH 3F7VB 1EEYA 2VL5A 3VFUB 4XCFH 4J3WA 2R0KL 3TBTB 3TO2A 1ZA6A 2PNDA 3MRJA 3VRLF 2C3VB 3WNNA 4JFFD 4KKNA 3P30H 3SDCD 1VFBB 4F57L 5IJKA 4LRNH 3BWAA 1IGYA 3E6HA 1BJ1H 1WUNT 5BO1L 4OB5H 5CINL 1FNGA 4JANB 3BZFB 5DEFB 4WV1C 3ARDC 3D39A 4WUKL 3RUGB 2ZOLB 4YO0B 2O61B 3NACL 2AJXH 4HPOH 1HXMB 3IF1A 1BECA 1SY6L 5DQDL 1OAZH 2RHEA 3S5LA 4HK3J 2YK1L 5C0EB 1EBAA 1YY9D 2C5DC 4TSCH 3UPCA 4UOJA 5F3BA 5DEZA 5JXED 5MI0C 1QACA 5DQJB 1HH9B 3MLPA 1FO0H 3KPSD 1FZOA 2BFVH 5KS9A 5I18L 5IR1B 5D1QC 5C3TA 3R06A 3QWOA 2PXYA 1TENA 1WCBB 3IDUA 4A6YH 4PP2B 4Z7QE 2BK8A 4NO0D 5C0AD 1CD1A 3DVNA 1DCLA 1UZ6F 3VFWA 2YWYA 1D9KD 5IBLC 1F6AA 1FQ9C 1VGEH 3CFEB 3NACH 5F7MC 4NC0B 2ADJA 3I6GA 4XNYH 4NZDA 1CLOH 1JF1B 1FL5B 3H3PH 2O5YH 2HT4C 3TA3D 2R2BA 4RA3A 1NAMH 5KAQG 5EPMB 5LCVH 1R5IB 1CI5A 1S9KC 4IOFD 2VIRA 4DN4H 1AQDA 1MCFA 1BQLL 3O6FD 4X6CB 5H37H 4ACPA 2GSGB 2RFXB 2DLTA 1C5DB 2VZ3A 4MD5B 3OR6A 1FO0A 4PRPA 3AREB 3OZ9H 2EYSB 4NC1E 4YDJA 1KJVB 4UTAH 2J4WH 4ELME 4A6YA 1I8IB 4Z7OE 4WO4D 3IETB 5D6DA 2JB6B 1KPRA 1NL0L 2WBKA 3LVEA 3MBEA 2YXFA 4XT1C 4XZUA 2FECI 4B5EA 1F6LL 2YRLA 2QHLA 4RFNB 4W6XB 5DJYA 2WZPD 2NY7H 3LEVH 4LQFL 4MJIA 2C3HA 3F8UB 5HVGB 3NFSH 1P7KB 3PWVA 1CFNB 4GAGH 3L3KB 3SDXB 1HWGB 3V0WL 1NAMA 5KVGH 2NY3C 3X13A 4ZO8A 3L5XL 5HYIA 3PWLA 1ZLUK 1IARB 1QFHA 1F3JA 4X6CE 4JZJC 4LFHG 5D1ZB 3TYGH 2SEBB 2I9TA 4JDVA 4MB4A 3T0XA 4WW2F 5F1KC 1HEZA 1CICB 4U3HA 4Y2DC 4HWEH 4UAOB 4WHTB 3M1BB 4F80A 4YHOH 3KNBA 3L95B 5DR5H 2UVFA 4V1DD 2NXYB 3W39A 3ARBD 5CEXA 3ULUL 4YAQB 4YHZL 4HUUA 4M8QB 3K8LA 5F1IB 2D4DA 4Z18A 1CF8H 5E8NB 4XTRD 4DOHB 3JV0A 4UTBL 4OZIE 2EDQA 5FYKH 2PYEA 3D3VB 3O4LB 2BDNL 5GS1C 4F15B 5F9OH 2PCPB 4WI8A 2V5SA 3LEYH 3VD3A 1PG7W 3GJEB 1LNUA 5IM7B 3FCTB 2A73B 2UWEF 3TPKA 3D9AH 2ILLA 3Q3GA 4FTVD 2DMBA 5HVHC 4WW1A 3FQXA 2XKSA 4YBQD 1M4KA 5C07D 4JHAL 2MWCA 3GHEH 5CEZD 5ADOL 5ISZD 1ZV5A 1MVUA 1IEBB 4OLXL 1TVHA 1G6RB 1YA5A 1OAXL 2ICWI 3K4ZA 3MLZL 4YPGB 1ERNA 5AZ2L 3FTGB 4RAHA 4DOHE 4DZ8B 3TBVB 5B38B 3O4LE 3D3VE 1RZIB 1WT5C 1ZHKA 4E42B 3O3BA 1NGPH 4RMUA 1RZ7H 3NTCH 4CVZA 1UZ8B 1J9CT 3BKYL 1NDMA 1HYRC 1LEIA 2NY4D 2GQHA 2MOVA 5E4EB 4UV7L 5INDA 1A7QH 4GBXC 4K9EC 3SJVA 1J86A 1A4KA 4I5BB 1UH4A 2OMNA 3OKLB 3GKWL 1KB5H 3REWA 1D5MA 2DTML 4LNRA 4WTXA 1UACH 3QDJB 4JZOA 4HUVB 4RIRB 3TBWA 2FEDC 4NZUL 1IAKB 3OKOB 6CGTA 2W60A 2WQRA 5D2NB 1S3KL 3DETC 5C0IA 2OJEA 5I9QC 1U36A 2EKJA 2LU3A 4Y0GA 3QNYA 2A6IA 3O3AA 4NNPL 1IGJB 4BSWB 1NDGA 5FK9A 5HHQB 2IADB 2ITDB 3MOAH 3ZKMD 1DDHB 3WL9A 1DBJH 1IZKA 4I2XB 5ESVA 2B39A 3FJTA 4CVUA 5EUOB 2PUQT 3LD8C 4P48A 4PGBA 3TN0A 4HW6A 5JO5B 4KV5F 4OBSA 4JDZA 2H45A 4NQCB 4PV8B 3KYNB 4P5MB 1C12A 1K8IA 2DJSA 3KXFB 1KT2B 2VZTA 1PKOA 3ARGA 4LPCA 1F4YL 1R3HA 1Z2KA 15C8L 5KANG 2E6QA 3W81A 5GGQH 4LF3A 4G43A 2R2EA 3B83A 1QG3A 1T3FA 3CZJA 4DJMA 4Q9RL 3EDEA 4NQEE 1KB5A 3V6FB 1MIEL 4X5WA 4G42B 3T3PF 2NCMA 4D3CH 4IRJA 1BIHA 4OD3H 5D2NE 4JY4B 4Z7VA 3STZB 4MQ7B 3Q6GH 1A7RL 1JK8B 3S34H 2VDOH 2G75A 1YY8A 3MJ6A 3AB0B 5H35B 4L1DA 3L3DA 4O9HH 4KDTA 2YUZA 1CLYL 4AEFA 3IAGC 5LGJA 4KROD 5LBSL 4KK5C 4I2XE 1RUQH 4U1HA 1FNSH 5EUOE 3EFFB 3HG1D 4WTZA 3BP4A 4ENEC 5DZNA 5HVWA 5FM8A 4U05A 3GMMA 2IBZX 4NQCE 3IDGB 3C60B 4XNZC 2HP4A 5DJZB 5DZOA 1OAUH 3KXFE 2XKUA 3STBA 1QYGH 2G9HA 3I84A 4Q9RH 4JRYB 2DLFL 3D2UA 5AUMB 2AERT 5I30H 3LEXB 5L0QC 3LKSA 4P46D 4AH2A 4JM2B 3KYMA 5FXCH 2ATKA