3QO1B

Monoclinic form of igg1 fab fragment (apo form) sharing same fv as iga
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
219
structure length
219
Chain Sequence
b'VQLVESGGGLVQPGGSLKLSCAASGFTLSGSNVHWVRQASGKGLEWVGRIKRNAESDATAYAASMRGRLTISRDDSKNTAFLQMNSLKSDDTAMYYCVIRGDVYNRQWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab fragment of IMMUNOGLOBULIN G1 LIGHT CHAIN
publication title Structure of a human IgA1 Fab fragment at 1.55 angstrom resolution: potential effect of the constant domains on antigen-affinity modulation
pubmed doi rcsb
molecule tags Immune system
total genus 46
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2011-02-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qo1B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qo1B01
1XGTB 2AKRA 2HT4D 3OJDA 5CP7A 2EH7H 4WHYG 3H42H 3BP7B 2Z93A 1QG3A 1TVHA 5KSBA 1L0YA 4EXPX 1UH3A 4KC3B 1E4JA 1T89A 4FXGA 2VWEC 1B6UA 3DECA 5FF6A 3WLWC 1J8HE 3OKDA 3S5LA 2FATL 4OF8A 4KY1H 1T6VN 3I2CL 5I1KH 1AIFB 2XG4A 1CGWA 3IRZA 3M17B 4JFDB 1HYSC 5F9OL 4HH8A 1CBVH 2QSCH 1ZA3B 2CLVB 4RBPK 4AMKL 2R56L 1R5IA 2FD6H 4HJJL 3VW3H 3EO1A 4YGVB 1MLCB 1KT2A 3RY6C 2VLKE 3NCYS 4WU7B 4KKAD 3S34L 3LQAL 1XZ0B 4R4FL 3ULVH 1DLHB 4YDVB 4YX2L 5FUCC 2WLZA 4Z0XB 1JPFB 4Z0BL 3VXSE 2K9UA 5TJWK 3ZKXC 1KN2L 3FFDB 3DX6A 1S5HA 1IGMH 2CIKB 3O6FD 2XN9D 3TZVB 2QSVA 5FYLL 5EUOF 3HE7B 1HKLH 2IPUG 3O6KH 3DUUB 4O2CA 1WZMA 1QLRA 4HKXB 3K8LA 1BQUA 4PREA 2NY4B 1I8IA 2YD5A 3P73A 5MERB 4FFVC 1HK6A 1BQHG 3BW9A 1GZQA 4ZYKB 2BNRA 3NA4A 5FYKD 1MIMH 1MCWW 5EO9B 3O4OC 2PXYB 2BOCA 4PRDA 3K80A 4HK0A 3L95A 4Y2DB 4WNQA 1M4KA 2XKUA 4LSVH 2HN7A 1X5LA 2R1WA 1KCSH 5DFVC 3HG1B 4LLVA 5K59F 3LMJH 1RIVL 3OKEB 5FO7B 5C0EB 2ZSVA 1E4KC 1PQZA 3OAUH 3VMPA 3O3DB 3OXRB 1QSZA 4PJHE 1UADC 3CDCA 3QNYB 3G6AA 4HUNB 5EU5B 4HX1B 1QBLH 2VLKD 3CZFA 3WN5A 1J11A 5GS0D 3PWJB 4KTYA 2W59A 2VB5A 5DJYA 4OI8A 2P7TA 5EOTB 2HTKD 4OCXH 3KPMB 1DQJB 3DVFA 4WO4A 4YDKL 5ENWB 3VXSD 2CD0A 1G9ML 8CGTA 2NY3B 1ZS8B 4KXZI 5IB1A 1KIRA 1V7MH 4GRLD 4UU9B 1INEH 2NYYD 4MA1B 4TSAL 4ETQB 4JHBA 5EZLB 3RPIB 5C0ND 3CXDL 3E6FB 4OFVA 1NC2A 5JIPA 3EZ8A 3CCHA 3VD4A 2DWEB 4R3SB 4MB5A 2VZSA 1AGDA 2BVOB 4JREB 1CQYA 4LSRH 4OLZL 3UJJH 4M6AA 2APBA 1ZVHA 5EOCJ 1DE4A 1GGIL 3T4AA 3B2VH 5T1MB 4AIZA 3GSXB 4QTIL 4LSSH 5JQHC 4HWBL 2E9BA 5EUOB 4IRSA 4YDLC 3LY6A 2WUCH 1AGFA 3WFCL 1YEFL 4QRPA 5E9DA 4JRXA 3U4AA 2D31B 4I3SL 5KG9A 1XH3B 3I50L 2MQ0A 4RA3A 4XWOC 1DBML 1FZOB 2ICWI 1IGCL 3E3QE 1NAKH 3FTGA 5CJXC 5D2LE 2VSDA 3FONB 4Y4FB 4PRPE 4RAUA 4NCDA 3U83A 1U8MB 3ME0A 3MOBL 4YNYA 4KKLD 2V9TA 1RSFA 5LQBH 3MRNA 3V79C 1J7VR 1XF5A 2DQDH 4GRWE 1GOGA 4WW2F 3EIFA 1DP0A 1DQLL 1EO7A 4RIRA 2XTJE 2D0HA 3C09B 5LWYL 5IFAH 4TUJB 4HPOL 2BY1A 4JQVC 3O3AB 1JZ2A 2YPLE 1KCVH 1CZ8L 2VDOL 2B1AL 3AROA 5IBLC 3DUHA 4N0FA 3ZO0A 3AVEA 3C2AH 4LPTA 5F1IA 4PJXB 3MRLA 5C0FB 1JGDB 3MUGB 1IARB 2RB8A 3PGFL 5GRXG 1N2RA 1UM4H 5L7XH 1QR4A 5C6PB 3QI9C 4KUZH 3S3PA 1NCWL 2RR3A 4I18A 1F13A 5IK3A 3OKLA 2Q76A 2EICA 5J13C 3KLAA 2AK4E 1A2YA 5E6ID 1X3DA 4X4ME 4UILH 3EOTL 3ZLQC 2HFFB 1P4LB 3BT2L 1T4KB 4L9LB 1G9NL 1N4XH 4Z76A 1BECA 3UYPA 2P45B 4N1EA 4ZDHA 1YNKH 4ODSL 2VLJA 3WIFB 2V7NA 1WQVT 4Y5YA 1FL6A 5I8EA 2GSIB 2YBRB 4KAQH 3HE6B 3DURB 1CDUA 3V6OA 4PRPD 1P7KA 5EZOH 2BVUA 1FP5A 2ARJB 4N0CC 2ESVA 5A16A 1WZ1H 2IFFL 2R1XA 3P30L 4XB8A 3EJYD 3V4PH 4X5XA 4FQLH 3DX9B 2XTJD 5BRZA 3SGEH 4M61B 4KWUA 2R0KL 3QO0A 1CFTA 2Q3AA 2EDYA 2YPLD 2E9IA 1T83A 2P42B 2CO6B 4QRSA 2CIIA 4J3TA 3GSRA 5A2KH 5E8OA 1A64A 4UIMB 5ERWA 3EYUH 1G7IB 4ZUVB 1N64H 4FTVA 4JFQA 1FNSL 5A2JH 2AKRB 5CP7B 3OJDB 4KTDL 4JO4L 5CJ8A 2IQ9H 3ECBB 2Z93B 3ARED 2DBLH 2NW2A 4NZDA 1CE6B 5HHVH 5KVEL 5KSBB 3I3EA 1DLFL 3QAZB 2AK4D 2BVYA 1IC7L 5FF6B 4D0CB 2R15A 3NIFF 3CFEA 3OSKA 4K8RH 3V4UH 5DR5L 2VXSL 4HFUH 1IRAY 3CFDB 3EJJX 4CMHB 4M7LH 4KPHL 2E7LA 1A9EB 4YE4L 3MUZ1 4UINL 4M00A 4XNXH 5E2JA 3ARGD 2E9WA 4KRPC 3G6JF 4HK3N 3BYYA 5DD6B 2EDTA 3EO1B 2ADFH 3QHFH 1KT2B 4ODTL 1DUZA 4OGYH 2GTZA 3OHXB 2HJFB 2EDRA 2YN5A 2PTUA 1Z5LA 2D03H 2DS4A 4HXAL 4S1SL 1B4JL 4MHHI 2NXZC 3L3DA 4OLYL 4N0UE 1PKQA 4FQXD 5J3HC 4ELMA 3DX6B 1S5HB 2H32B 2VNCA 1WFNA 5ITBL 1A6TA 4L3EA 2O26U 1ERNA 4FQCL 4PLKD 4HUVA 4Z7WA 4HQQL 1TJGL 4O2CB 1QLRB 2X41A 5I18H 4D9RE 3HMWL 4PREB 1DSFH 4FQ1H 4NWTH 3WL9A 3W2DH 1I8IB 1BFVL 3P73B 2HKFH 3BEWA 4ZTOH 5BQ7A 5ACMA 4ZO9A 4KHTH 1NGQH 1Q9OA 4KKNA 2BNRB 4PRDB 1JHKL 2MSPA 4CJ0A 2VLMD 3DVGA 4TYUA 3L95B 2WBJC 4WNQB 3IU4H 2FX7L 1D9KC 2HN7B 2PN5A 1OTUC 43CAA 1EGJA 2YA2A 4KKCC 5F3HA 4P4KA 3K4AA 4M3KB 5IW1A 3FB6A 4XBGA 5F7UA 2A0LC 3BN9D 4X7FC 1G1CA 1T0NA 1P5VA 5D4QA 3X12B 2ZSVB 1CLCA 1PQZB 3FRPA 5DQJA 3VGFA 3LIZH 4OGAD 2DLFL 3Q1SL 1RJLA 1N59A 3G6AB 5KANG 4XP9H 1WAAE 3JWDC 4NO0B 3CZFB 4MXVE 3WN5B 1LO5A 1YEHL 3ARDD 2FGZA 5DJYB 4UI2A 1B4RA 1XIWD 5DK2B 3MSPA 4WO4B 2G60H 4JQIL 3QXWA 5I1CL 4JY6B 5HHQB 2XQBH 5IB1B 1KIRB 3FZUC 3BKYH 5D1ZC 4UTAL 3WO4B 4U1GB 4YO0A 2Y6SC 5H35A 1NC2B 4P2OD 3CCHB 4MNHA 2PCPB 4OCYH 5DMJB 2VDLH 4M6ML 5I6XB 1F90L 1AGDB 4D9RD 2PYFA 1F3DH 3LRHA 5FYKL 4GW5A 1IVLA 3H9SE 4M1CD 3T4AB 1NGZA 3IDJA 3SOBH 4QXUL 4AIZB 1I9JH 4KJPC 1MUJA 1IZJA 1LNUA 2XIDA 4IRSB 2DQJL 3TT3H 1IAII 3MRKA 4EVNA 2BXYA 4QRPB 5E9DB 5GGTH 3DROA 4JRXB 3MLZH 2I60H 3ZDZE 5KG9B 1EGJH 1BMGA 3T2NH 2MPAL 2CK0H 4D2NA 2OZ4A 2BY0A 4G8EA 3M8OL 2B0SL 1WLHA 1JGVL 1GPOH 3FTGB 4YH6A 4B53A 4RAUB 5DF0A 1EHXA 1CGUA 5CILL 4YNYB 5GS0L 4NC1E 1IEAA 4I13B 4ZO7A 1XF5B 4PJ9C 4M7KH 5GGSA 2YD8A 5CIPA 5F7LB 1FVDB 1GC1C 4RIRB 4JHAL 5E99H 3A6BH 5CLWA 4RISL 4LNRA 1QO3A 3MV7A 4M7ZC 4LFHG 4TSBH 4ZFOA 4N0FB 3CH8A 12E8L 2XFXB 5HGBA 4L8BA 3LB6C 4X9HA 5F1IB 2ILLA 5F96L 3AB0C 1RZFL 2P5EE 1T1XB 1U36A 1XR8A 2ORBL 3H9SD 4G9FA 1FRGL 1RUAH 3HAEA 3MRMB 4I18B 2YPKA 1CGTA 4JKKA 2VXUH 4N68A 2ADJA 1IGJA 3AS2A 5HGHA 5BZWB 1RZIA 2Y07H 4ZOBA 3X3GL 3KLAB 2C9AA 1I8MB 5KVFH 3RKDC 1AXTL 2HFGH 4Z76B 4AJ0A 4HWNA 4PGZA 1LWRA 4R90L 4ZDHB 1H3XA 3D25A 4PJAA 4Y5YB 1VGEL 3V5DA 4X6BA 3C6LC 1FL6B 4PJ5E 1F4XH 5I8EB 1FSKB 4CVWA 4ENED 2HKHL 3KPNA 1PG7L 1LE5A 1TQBC 3ARSA 1P7KB 5AWNL 4PJHF 2ESVB 5D7JC 5IV2A 4HWEL 3X3FL 3O2DL 4ZUTB 5IB4A 5E2WH 1DQTA 5I74C 2R1XB 3VXUE 4HS3A 5CINH 5T3XL 4PV9A 4YBLB 4M02A 2WSKA 1OP3H 4X5XB 3OZ9L 4G80A 1U3YA 5BRZB 5DVNA 2WUBH 1WC7A 3UBXA 1FV1A 3QO0B 2EYRA 5GGVH 1WWBX 5DDHA 4R9HA 3H3KA 3ZKNC 5ESAA 4QRSB 2CIIB 2VRAA 1EHLL 3RL1A 1Y6NR 3GSRB 4PJFE 4KI5C 3HMXA 5E8OB 3OB0K 4MVBC 4PYHA 3JTSB 4BQ8A 3T4YA 5ERWB 4MJIA 3RVUC 1JNHA 3UTZA 5I9QB 4FTVB 4P23D 3E8UH 4JFQB 2P5ED 1FG2A 4GRLB 2CKBH 2EC9T 2BSTA 3NTCL 4GAYA 3HAEH 4C56E 2NW2B 3A6CH 4FFZL 3WKMH 1FLRH 3O2WL 3EYQC 5GRVL 4S1RH 4XVJH 4NWUL 4UV4L 2W60A 1IFHH 2XZAL 2EYSA 4J6RH 5BO1L 3RUGE 1MFBH 3HZMB 2XZCH 3BIBX 4PJ5D 4AM0A 4PRBB 1KCRL 3MBEC 5D2LF 15C8L 4JM2D 1NQBA 1ZLVK 4F33B 4LASH 1J1OL 1IAKA 4BUHA 5DHVA 5HD8C 3HI1A 5I30L 4GRWF 5MP6H 3VXUD 3X11B 4OF6A 2MKWA 5MHSD 1DUZB 5DD0H 3CFBA 5I75B 2GTZB 3RHWK 4QXWA 2ZOLB 1LP9A 4GLRH 4Y89A 1T66C 1UACH 1Z5LB 5A40E 3TA3A 4WHCA 3BFOA 5FGBA 3EO9L 1PKQB 4L5FL 3QCVL 4ELMB 2R2BA 4HV8A 3L3HA 5FOJA 1WBXA 4R4BB 1CDGA 3HMXH 1W0YT 1A6TB 4L3EB 1EBPA 4UT7H 2QTEA 4HUVB 1LD9A 1W0VB 4Z7WB 1IQDA 1FAIH 3U0WL 1JZ3A 1MAJA 1FGVL 1HH9A 4WCYH 1YMME 2CLRA 1G7HA 2GQHA 3WL9B 4C56D 2OZ4L 3BEWB 5BQ7B 1RHFA 3TM6A 2YC1B 1EPFA 1Q9OB 2EH8L 1MF2H 5DTFB 3UDWA 1ONQA 3SDYH 3AMLA 2GJ6D 5F6HJ 1OSPL 1ITCA 3C5ZD 4MMZC 2MQ3A 4JVWA 1QBBA 43CAB 5F3HB 3B2UC 4R0LA 4P4KB 1KIPA 3CC5A 2YS4A 3ESUF 4L8SC 3FB6B 4UNTA 4XBGB 5IW1B 3WXWL 4LVHB 5E6IB 1DBKH 4RGOL 4WHDA 1AQDB 3C8HA 5DHVH 1B90A 1IC5H 5DQJB 2ADGB 4PGEB 4LPWA 3Q6FA 1RJLB 1N59B 3U30B 2P1YA 4GMSL 2HJLB 1U8JA 2XXMB 5M94B 1LO5B 1MNUL 4JR9L 2DTMH 4MDJA 4X9GA 1P84K 2BHZA 5AYUL 5F44A 5DRXA 1H3TA 1HHGB 3P4OA 4RMUA 1HWHB 1EJOL 3KS0H 3QQ4A 3QULA 5ANMA 4HXBL 4GRWB 2YZ1A 2A6KA 1JN6A 2D2OA 3O2VH 4YO0B 4U33A 4R7NA 4OV5A 4MNHB 3ARFD 3WNKA 35C8L 1P9MC 4QY8B 3GIVB 2CXGA 1YMMD 2PYFB 3FMGH 3V0VA 2V9RA 3FQWA 2VITA 2FBJH 4GW5B 1QUNA 1NGZB 1JNNH 1I3RA 1TIUA 4XAWH 3ARUA 4Z7UA 3Q6GL 1MUJB 1LNUB 2R4SL 1K3IA 3MRKB 2X1PA 3QXAA 3ULUL 3QDJE 1D5XB 4EVNB 4OQTA 4B41A 1V7NL 3DROB 5DK0B 3UYRH 5BCAA 3JBG7 1G84A 2QSTA 4WI9A 3QIBC 4RZCA 3VRJA 4OI9A 1SM3L 2EECA 5GS3A 5T5NG 4G8EB 3BIAX 2AK4B 1GGCL 3CVIH 2Q8AL 5JO5B 3WUWG 4G8GE 4KDTC 4D3CL 5D6DA 1QFWI 3BN3B 3PWPA 2FX8L 3N9GH 3V6ZA 1MAMH 2UWEA 4NJ9H 4RMVA 1SVCP 2N56A 1KPVB 5IROA 4I0KA 1QP1A 1A7QL 5GGSB 3BXNA 5CIPB 5C7XL 3VG0H 4L4TE 3V5HA 3ARGB 2CKNA 2DOCA 1H3GA 3UPAA 2X9WA 3U0TA 4B50A 1LILA 3MV7B 4ETYA 2DMCA 2D0FA 1YEIH 3G08A 3QPXL 1DBJL 2NCMA 3VFNA 4L8BB 1U0QA 1QSEE 2QADC 1NMCB 3BKCL 5EULV 3QNZA 1LO4L 3EDJA 1I7TB 1QOKA 5FA4B 1IT9H 4KQ3L 3W39A 4HLZH 3ZSSA 4NGHL 5BZDA 3IJHA 4G9FB 3HAEB 4W70A 4CN6A 1VDGA 2EDBA 2F5BH 5B3JE 5J12B 5CZKA 5J1SC 1J1XL 2ADJB 1IGJB 3BO8A 5HGHB 1L9MA 2X7LA 3QDJD 4YEFA 1RZIB 2VO5A 3QUXC 2X10A 3ILQC 4NFCA 4F7MA 1FZMA 1Z9OA 3VFGH 4UTBH 1A6PA 2VZ3A 4WI7A 3D25B 3V5DB 4EI5C 4X6BB 4PRHD 3KPNB 4N0YL 1OAUH 4G8GD 5D9SA 4X6DE 4EUPG 1NMAH 2HT3C 5IHUL 1RZKH 1YQVL 4EKXA 5IV2B 1WAAF 4J23A 2GYSA 4X7EC 1FO0A 3B83A 2ED7A 2GAZA 4I2XE 1FL3B 4HS3B 1M7IA 4NRYA 4PV9B 3S36L 1J0KA 5GPRA 1QSFA 3EYSH 1UXWA 4G80B 4L4TD 1I7ZB 2Q20A 4A6YA 4XI5C 4XPFL 1P4BH 4E0RB 5CZXD 1OAYH 1WC7B 4UDUB 4YHZL 1FV1B 2EYRB 4OAWB 1HOCA 4LARH 1IQWL 4PBXA 2ZJSH 5I19L 5ESAB 3AS1A 2J8UA 5ACLA 2UVEA 1MCSA 3RL1B 2AI0H 5B38A 1JFQL 2D7TH 1QSED 4M4RA 1YJDC 4DKDC 3GMLA 2OBGA 1CDCA 1BQLH 1ZHNB 1I8LC 3FO2A 3BP4A 4MJIB 1JNHB 1TJIL 1NBVL 3HFMH 2FCBA 2BSTB 3DRTA 4GAYB 2YPVL 4Y4KA 3AMKA 5HGAB 3IVKB 3SO3B 4NZUH 3VRIA 4OZHE 4OLUH 3RWCA 2NY6C 1VACA 5HJ3A 2R2HB 4UAOC 2MOVA 2W60B 3L7FA 4N8VG 5C6TH 3EZJB 5IJKC 3ZDZF 4P3CH 3HS0B 2Y5EA 2ZG1A 1HNFA 4AM0B 1RJCA 4O58L 3STZA 2ZNWA 1VEMA 4MNQA 5BW7C 1KB5L 2YN3A 3RNQA 1IAKB 1FO0H 4ALAH 1P6FA 3FCTB 2FATH 3HI1B 5KANI 1U6AH 4P5TC 2DD8L 1HQRB 2E27L 4P2RA 3CFBB 3U36A 5C0AE 3MREA 4A6YH 1LP9B 5F9OH 3LRGA 2ZUSA 5I71B 1ADQA 1KLUA 4IJ3B 1A47A 2G75A 3L5WB 4G6KL 3TA3B 8FABA 1S9WA 4UBDC 3RVTD 2RQ8A 4S1QH 2R2BB 3L3HB 4KK9C 3DMMC 4KHXH 4XP6L 2VWEE 5F3BA 1WBXB 2BRQA 2WWKO 5HY9B 4OQTL 1BP3B 1LD9B 2DN7A 4OLEA 1IQDB 4TUOA 5K9JH 5D2NC 1OLLA 4HIEA 4CN4A 2QQLH 1HH9B 3OAZH 5ICYA 2CLRB 1G7HB 1TMCB 3HI5L 3S6CA 1EVTC 3MRDB 4FMKA 4RRPA 2P46B 4Y5XA 4FNLH 4HG4K 4GUPA 2YD7A 1JPST 2EXYD 5FECA 1E6OH 4IOFC 4FZEL 1YN6A 3KPLA 4K07A 5IEKA 1DL7H 1KIUA 1NH6A 1RUPL 1SVZA 4H0HB 4JO3L 4OSUH 4QHNA 5FUCE 1BEYH 2J5LB 4XNQA 1AQKL 5J1AB 2KBGA 4R0LB 4X99A 1AR1C 1KIPB 2ATPA 2WNGA 3GSWA 4DFIA 3UTOA 2VDPL 4JM2F 1NC4A 1H8NA 5JXEA 4WI8A 3TPKA 1MREL 4U6TA 3QUMA 5EWIL 5FUOL 4K2UH 1IEBA 4UT9H 3KS0J 1U8JB 4K94L 5C0AD 5GGRB 1RIVH 3PABA 4JFFA 1TLKA 3QFDA 5IVXE 4MDJB 5EZIL 5L88H 5DRXB 3P4OB 4G42A 4LPVA 4YBHA 4Q7DA 3QQ4B 1CR9H 5ANMB 1KB5B 3MJGX 4JKMA 1NEZA 5CBEB 1BHGA 4BFBD 3WLWD 1JN6B 2VIRA 5CZVL 2JCCE 2VKWA 1HHHA 1QYGH 4OV5B 5IGXH 1D6EA 3MRPA 4OLWH 1G9MH 3RPKA 4X4YA 1X44A 1LDPL 4GBXA 3B8YA 1HYSD 3V0VB 3FQWB 2JELL 5F88A 2CDFB 2X05A 5IHZA 2DQEL 4LKXB 1I3RB 3SQBA 4JPWH 3VCLA 4Z7UB 1UKTA 4YC2B 1A14L 1BD2A 2XY1A 1Q0YH 3QXAB 3RUGF 4BZ2L 1XR9A 4OLZH 1SMAA 3K4ZA 2WP3O 3RIAK 4DQOL 5BV7L 1GGIH 4NT6A 3S37L 4QTIH 5GZNC 2ZCLH 1ZANL 2XICA 5C0BD 4RZCB 3BGAA 1NJ9A 3MO1B 1MI5A 4X6CE 1MCOH 3JWOC 3UO1L 2OI9C 1X5ZA 3SKJL 4RGNB 5E1AA 1VESA 1MSPA 4JQXA 3V8OA 2HYMA 3PWPB 4NP4L 3V6ZB 2UWEB 3GDBA 3NZ8A 1AI1L 4M43H 4OZGE 1DBMH 1YYLL 3BXNB 3UROR 4NKOA 1U8HB 4HC1H 3V5HB 4N8PA 5KSUB 2AGJL 3TN0A 2XA8H 1HQ4A 3HTLX 1C16A 5FIEA 3FOLA 4L8DA 2ZCKL 3U0TB 3CLFH 2X4NA 5B8CC 3GIZL 2OTWA 3D69A 4QGYA 4FFYH 3FT2B 1H3PL 3G08B 5T5NF 4NQDA 1CL7L 1DQLH 3MX0A 3VFNB 3QB7C 1I1YA 2YRPA 2DTSA 2EDDA 4OJFL 5DFVD 4N8CL 5C09A 3MQIA 3MOQA 4PG2A 2B1AH 3RI5K 1JHTB 2DQIL 2OR8A 3W39B 3R8QA 5IQ9A 2GCYA 1TETL 1NBZB 4WIQA 4I77L 5BZDB 3IJHB 1PBYA 3GMPA 3FQTB 5I15L 1IILE 2VXTH 3C5JA 1OWRM 1RZ7H 4RMRA 4LP4A 2VDRL 1P4IH 3BO8B 5DEFA 3UTPE 4JN1L 3PGFH 4MX7B 3OB8A 2F58L 4TSCH 3UJTL 4GXVL 1A1MA 1HXMB 2Q7YA 2CUIA 3BRFA 3ZE2E 4XMKH 3V7AE 4OZIA 3PDOA 3UPCA 1WT5A 1YPZA 3D5OF 4K3EH 1BF8A 3VDAA 3RUGB 2BOBB 4A2LA 5I8OH 4P4RB 2GJ6B 5GIRB 3WEXA 4IIQC 2DQUL 4LEXL 4R8WH 4JGUA 3BD5A 5EIVA 5EO0B 4DEPC 2BC4A 3QQ9C 4NRYB 5D93C 1M7IB 5BV7B 2IGFH 3FHQA 4W81A 5DWUL 5LGHH 1QSFB 1UXWB 4H8WL 4MA8H 4A6YB 3RZCA 2APFA 2DI7A 3F12A 4YFLF 4HIHA 1FNGA 1S9XA 1SHMA 1IAIH 1HOCB 3V5KA 3P30H 3P4LA 5CP3H 2ICWJ 5B39B 2J8UB 5B38B 4OD1H 1AJ7H 4P2QD 5DA4A 5HVFB 1NGPH 1QRNA 4S0TD 3GMLB 4MNGA 1IE5A 5TDOA 3SDCA 4QRRA 3BP4B 4YXHH 4XWOD 3MC0A 1JTTA 1F02I 4XVSH 4C58B 2FH6A 2ZUWA 3DRTB 4O51B 1ZGLP 3CK0L 3OMZA 4J4PA 1G7LA 4TQEH 5IMOA 2VL4A 1TNNA 3VRIB 4RWYH 3RWCB 2V5RA 1VACB 2B2XL 3TBSA 3ARBA 1XAUA 3OBAA 4PJBA 3L7FB 1YEKL 4TULH 4J3OC 1AKJD 3ROLA 2D4FA 4M93B 5H2BA 1JYVA 4CGTA 5GZOC 5JW3L 1DLFH 4U1IA 5IBLD 2H9GA 4KMTL 3STZB 5JW5B 4LHQB 5E94B 3TZVC 5F7WC 3HE7C 3U7WL 2GY7B 1ZEAL 4HBCH 4PGBB 5DR5H 1Q72H 3UEZA 4IRJA 3DGGA 2AJ3A 4WHYH 3V4VH 1EEYA 4KPHH 5KVGL 3QI9D 4P2RB 1EUTA 2NY4C 4RFOL 3MREB 2EO9A 3SBWC 1E4WL 1KLUB 5C86A 5F7YC 5TE7H 3QFJA 2ZUYA 1NCDL 8FABB 2H8PA 3INUL 4KKBC 2PXYC 4JFPA 3TNMB 1N5YL 4OQ1A 1KGCE 1L6ZA 3V7AG 3ULSA 4Y2DC 5DUPL 5I1EL 1DQDH 3RFZC 1GL4B 3HI6H 1B4JH 3I3BA 5HHOB 1TFHA 4TUOB 3MOAH 1FNFA 3SGKC 3ZTNH 1K9TA 4LCCA 4XP4H 2XN9A 4DZ8B 1IGFL 2AJUL 3IDYB 4JO1H 5ICYB 1IGYA 5J8OA 4N0CD 5ADOL 2P49B 4P46A 1UEYA 1XF1A 5B3JF 2OSLA 3IB4A 1WEJH 2PW1B 3NGBB 4Y5XB 5HI5C 4GUPB 1KTLA 4GXUN 1KJ3H 5FECB 1MFCL 3QQ3A 3VE0A 3KPLB 2F53E 5IEKB 3LCYA 1BFVH 4QWWC 1P2CA 2Z31C 5I1IH 2BFVH 4XNQB 2NY3C 2DLEA 5SX5H 5T3ZE 2Y06L 4WV1A 3SE9L 4X99B 3TF7C 4MA1C 1J8HA 3GSWB 3ES6A 2VJXA 3IGAB 1HCFX 4X6DF 1NC4B 4JFZL 2AK1L 3GMRA 4M5ZH 1CL7I 3QUMB 3MLRH 4DAGL 1S78C 1IEBB 4M5YH 1OAXH 4JREC 2X89D 4PRHB 4JG1H 4OLVL 5I16A 3PABB 4JFFB 3QFDB 1MVUA 2MTPA 3VH8G 4NQEA 4G42B 4AH2B 1VFAA 4JDTH 2NMSA 2CK2A 1J8KA 1KGCD 5FOBA 4IMKA 2YK1L 4PD4K 4QXGH 1NEZB 5TFSL 3LPWA 1CLZL 5MENE 3T0EA 2VIRB 4K23H 1INQB 5HVHB 4U3XA 1HHHB 1T5XA 4P3DA 4WUUA 3T77A 4M8VA 1D6EB 3MRPB 1T20B 2BMKB 4JQIH 5DMYA 4FQ2H 4PJEA 5ICXA 3NPZB 5I1CH 2DMKA 3S98A 4Y1AA 4GBXB 4P9HL 4Y4FC 3DSFH 3SJVE 5CKGA 5DSCA 1C7TA 4OZHF 2IBZX 3H7LA 3VCLB 4MA3A 4LPYA 3MV8E 4LVNC 2RJMA 4M6MH 3CXHK 2F53D 1XR9B 4TTDC 1QLFA 5AYQA 5DZNA 2I9TA 5KVMC 3OGCA 4YFLI 1JHLH 3C09C 4PB9L 2NXZD 5CEYA 4D0DA 3MJ9L 1GIGH 5T3ZD 5J3HD 3O6ML 1NLBH 5GGQH 1NJ9B 3LH2H 1MI5B 5FA3A 1BJ1H 5CGYC 5L2KE 1UWEH 3E6HA 1UKSA 5E1AB 3WNLA 3SKOA 5TF1L 2F54E 1W2KT 4NQCA 4HUUA 3BZDA 3NZ8B 9CGTA 1MFEH 2V5MA 4U31A 1ZMYA 4U6XB 4XGZA 3TVMA 5AD0A 1UM5L 4NKOB 4X6DB 3ALXA 3G5YA 1T0PB 5KTEL 4HT1L 4OKVA 4K3DH 2VC2L 3DTXA 3QRGH 1HQ4B 1C16B 2XZZA 3FOLB 4L8DB 4LSUL 2X4NB 2OTWB 3D69B 1UT9A 3I6GA 4L9LC 2WBJD 4NQDB 3FB7A 1IBGH 2MKLC 4JHAH 1D9KD 5CLTA 1OTUD 1I1YB 1PY9A 4JVPA 4KKCD 3STLA 4ONHA 3WDJA 1KJMA 5C09B 3SDXE 1L7IH 3HE6C 1SBSL 2OK0L 2IWGA 4YHIA 3SJVD 5IQ9B 5EU6E 5D8JL 2GCYB 1R5WB 1WBYB 3GMPB 3WXVH 3QBTB 3MUY1 1FQ9C 3C5JB 3MV8D 3BESR 1MCJA 5F96H 1JYWA 2CXKA 3DETC 4YHMH 5E2TL 3O4LA 4PJDE 1H3UA 3H0TA 1A1MB 4XTRC 2Q7YB 3EFDH 4OF3A 3ULVC 2ATKA 2EIZA 2R0LH 4LIQL 4JGJA 1T7YA 1UM6H 2EDJA 4WDIB 3U9UA 1P7HL 4WVRA 3PDOB 1FN4A 4F3FB 5DD3L 5EU4A 2R0ZH 1YPZB 3L3KB 5D1ZD 2IBGA 1I1RA 1ACYL 4HHAA 3WCYA 4XHQA 2Y6SD 4APQA 2G9HB 1A21A 2F54D 3WEXB 4ONFL 1BLNA 1FFQA 1A02N 5DUBA 2Z8RA 3MXVL 3K4DA 2YD4A 1ZLWH 4PRPA 5FB8A 5IVXF 3RWJA 4ZUUB 1S9VA 5L9DL 3RTQA 3NA9L 5AWNH 1E27B 4MJ6A 3BH8A 3RZCB 3GKWH 4PRNB 1KEML 5D7LE 4XPAH 3F12B 4KJPD 3QAZC 1FNGB 4OTXL 5K93A 4HSQA 1T89C 1LEIA 2BCKA 2JTDA 5INCA 5JIIA 2JCCF 4MLSA 3OZ9H 1I9IH 2CRZA 4FZ8L 1ZGLM 1QRNB 4LMQI 4JEGB 4MNGB 5TDOB 3SDCB 4HLJA 4QRRB 4UQ3A 4CMHC 1CU4H 4YHOH 1QFUH 3LKPA 3MRHA 5EU6D 4KTEH 4J8RB 4H25A 4OM0H 3M1BA 1QVOB 1QFWH 5IMOB 3W0WD 1UCBL 4Z5RA 4X6FA 3U48A 3EHBC 1X5JA 4V2BA 1LO2L 4PJGE 4PJ9D 4NNYA 3TNNA 5JW4Q 1CG9A 3TBSB 2AQ1A 3OF6A 3KR3H 4PJBB 3F6LA 2VH5H 4NZRL 3NTCH 4GAGL 2DL2A 1A0QH 5DUMH 3K0WA 5ISZE 4FFZH 4FXLA 4X6CF 5BVPL 1P69B 4U1IB 5L8JB 2H9GB 3LB6D 4KI5E 1IGTB 4HGMA 1K4CA 3QDHA 1UB5A 2FWOB 3ZKXB 3DGGB 2AJ3B 5C0BB 3TBWA 1EEYB 4PJCA 3O81A 3DYPA 4FQHA 4WGWB 1RUKL 2PTVA 5D7LD 3AXLB 1WK0A 4H1LG 2BHYA 2RBLA 3BH9A 5I30H 2H8PB 1RZJL 4WRLA 4E41E 4JFPB 3NCJL 4G5ZL 1NSNL 4JPVL 3GBLA 1A6UH 3RKDD 5IVXB 4OCSH 3KHOA 4XP5H 3ULSB 3DI2B 3K2MC 1FG9C 3C6LD 5D70H 4YBQD 3EO9H 4L5FH 4LCCB 5GRJL 5DRNA 4FABH 5LGKA 1R3KA 2DRUA 2R23A 1IGYB 4OFKA 2AJVH 4YHKL 5D7JD 5CAYB 5IB3A 4P46B 3VXTA 2XWBB 4OFYA 4XCCL 5E08H 4M48L 1KTLB 4GSDL 1BZ7A 2AXJA 4MAUH 4DVRH 5C0RL 4MAYA 3WN5C 1IGIH 4K3GA 2A6IA 1A5FL 1TZIA 3QQ3B 3VE0B 4UB0L 3ZE2F 3WIIL 1T03H 4WO4C 3GRWL 5MEOA 2FO4A 5BMFH 2JK5B 4PRAA 3KGRA 3ZKND 3WO4C 2IG2H 2DQGH 3VGHA 3GMRB 5FKPA 4MVBD 3WE6B 3SE3C 3RGVA 3RVUD 5JPMB 3DHJA 5I6XC 1J1PL 2WMPA 3VWKA 5I16B 1U8QA 4PS4H 1U2HA 2W07A 1VERA 4JRYA 4NQEB 5C2BL 1XF2A 3E1F1 3EYQD 2CDEA 4IRSC 4E41D 4NNPH 3NACL 3T2QA 1A4KA 4U1HB 4O2FA 4JR9H 1TXKA 2EEDA 4JN2A 2JIXA 4PLJC 3T0EB 4CW1B 4P3DB 4WUUB 4M6OL 1F4AA 4FXKB 5T1KD 3GM0A 1DANU 4PJEB 1ZA6A 3MBED 2HLAA 4HXBH 5SWSE 1XFPA 4Y1AB 1LO3L 3ZMRA 4Q97A 5DSCB 4P2QB 5HD8D 2EXWC 2DQFA 3MCLH 4LDOB 1OGAE 1EERB 3TWCL 5I66B 3O9WA 4MA3B 2GI7A 1KN4H 2IPKB 2VDQH 3WIHL 3QT2A 1CDBA 4PB0L 1BJ1J 1T66D 3QSKB 1QLFB 2ED9A 2FEEI 4U3HA 1G9EA 3OGCB 4XPGL 3LVEA 4XBPA 2XQYK 3D39E 4XRCA 5JHDA 3NAAL 4LBEB 4PY8I 2R4SH 1F6AA 4XCEA 4XAKE 5FA3B 4KKAC 2AEQL 5JNYA 5D5ME 2F19L 3E6HB 2PF6A 3SKOB 3L6FB 4QOKA 2NZIA 1QPPA 3TEUA 2OJZL 3W9EA 4NQCB 3PWNA 3QDMD 4X8JA 2HAZA 3RBSA 5FGCE 3TVMB 2Q8AH 5AD0B 2IJ0C 3G5YB 4JFYA 4OKVB 1G7PA 1DN2A 3KJ4B 3DTXB 4I18C 2VR5A 1F4WL 5TGBA 4AIOA 1LK2B 4X4ZA 3SE4C 1F4YH 1YECL 4U6HA 5F8QC 1A7QH 2ENSA 1U3ZA 4WEMB 3FB7B 1CGSL 4E42A 5HYEA 1VKXA 1S3KL 2DQTH 4Y5YC 4E5XA 3MMEA 1FSKC 4JFOA 1HILA 4ONHB 5FXCH 1KJMB 5SWSD 5L6YL 3BZEA 3P0GB 5JW4M 2JJSA 3U1SL 4LRIA 3RHWF 1TZHA 1OGAD 2P5WA 5KAQG 4K7PH 4ZAKA 1FNLA 4ONGL 3O3UN 1ZTXH 3GO1L 1S9YA 5JOEA 4IHOA 3O4LB 3HC4L 1I85A 2DWDB 2FGWH 3AU1A 2ATKB 3C60A 4X7DC 3D39D 3U9UB 3KYKL 4AYFA 4MJ2A 1J1XH 1T83C 1FN4B 4XAKD 4ZG1A 4HEME 3NCFB 2R4RL 4HHAB 5HYSA 4YDIL 2Z0BA 4Z9KB 3U46A 4APQB 1KYOK 3KXFE 3VGEA 1KJ2A 3OKOA 1BLNB 1KB9K 1KTRL 5DUBB 1RJYA 1TNMA 5I9QC 4C54A 4RMWA 5FB8B 3RWJB 3SE8L 2X4QA 3Q2CA 1S9VB 3RTQB 4QRTA 1X5KA 5IHUH 4MJ6B 3BH8B 2NY0B 5IBTH 4P48A 3OV6A 2V2WA 5DEZA 2VLRE 2VMFA 1LEIB 4NZJA 2BCKB 3T3PE 3WNOA 4R97B 3QHTC 3ZYJA 5KBNC 4IOIB 3QIBD 2A77L 1T1ZA 4FQQA 4UQ3B 2LTQB 4Q0XL 2E7LC 1B2WL 2LABA 4NC2B 3JV0A 4PJ7E 5T1LD 5I19H 3MRHB 3PWLA 4H25B 1QHOA 3ZZ1A 3JWDL 3M1BB 3MTRA 1N6QH 3ZL4H 1EZVX 4P3WA 4EN3A 3TNNB 1TJIH 1XGYL 5I75C 1NBVH 3F58L 4ZNCD 4OFIA 2NY5H 1NCAH 4GFTB 1KC5L 1NUFA 2YUXA 4O9HH 3GBML 3SKNA 4AEHL 4MD5B 5EO1A 4XPBH 3U4EA 2AQ3A 1S9KC 2VZ1A 1JMXA 3S3SA 1MLBB 1KULA 2VDKH 3VFSA 3KXFD 1KJ2H 2Y36L 2QADD 2NXZB 3PJSA 1K4CB 1UB5B 3N1QC 3UPRA 3LEXA 3MZTA 4HMCA 3TBWB 4PJCB 4NKDA 2VABA 4G6ML 1A7OH 4KVCL 3MRQB 4EDXB 5FK9B 2XRAH 3I84A 3GSNA 2CUHA 1MWAA 1DVFA 1VFUA 1I3GH 3BH9B 2VLRD 1CICA 4YAQB 3LPGA 3QUXD 3ILQD 5GRYA 3REVB 2OL3L 4YWGL 4M6NL 4JG0L 1S7TA 3SQOL 5DC0A 4U1MA 2OP4H 1SJVA 3SDXF 4LAQL 2AEIT 2YXMA 4P4KC 4JCMA 4TVPE 4BJLA 3S36X 4PJFA 3TBYA 5DRNB 4OIAA 4LVHC 3QUYA 4KMLB 4XP6H 1R3KB 2HT3D 2R23B 2I9LB 5DMKB 3VXTB 2VDNL 2ZOKA 1FORH 1G0XA 3TBVA 3U30C 1GC1L 1BZ7B 3D0LA 3GSOB 4PJDF 1CLOL 3ARQA 2A6IB 1TZIB 3DXAA 2C3XA 3HI5H 4XI5D 3ZHDA 1AP2A 4ZQKA 2CRYA 4X7SH 4CU8A 1CD0A 2BNUA 3HC0A 4IM8A 5MEOB 2FO4B 3D18A 3VRLE 4OGXH 4PRAB 5EC2B 2YD2A 1NFIA 3HUJE 2AJXH 1KLFA 3N1MC 3QZWG 2ICCA 3SKMA 5FKPB 2B39A 32C2A 3RGVB 4YXLL 2UUDH 5CJOH 5D2NE 2PO6A 4NN5B 3VWKB 2HH0L 2VDPH 4B5EA 4DVBA 2FRGP 2I5YL 5BVJA 3JTTA 1T04A 3GSNH 4JRYB 4LNVA 2W9EL 5EWIH 4JRWA 2DKUA 3RJQB 2NY6D 1R0AL 3TO4A 5CHNA 2OTPA 1TCRA 1A4KB 1MJ8L 4URTB 3U82B 4O2FB 3NFPA 1UCTA 4Q9RL 4LCIH 2JIXB 1W8NA 3KPRE 1JCKA 4TVPD 3HB3C 1Y18B 4YUEL 1ZA6B 1I4FA 2HLAB 1BIIA 2RIKA 2EE6A 4NJAL 3KPSE 3QUZA 3WUWA 5FCUL 5CFHA 1KENH 4U7MA 3MRFA 4QRQB 5KS9E 4BZ1L 4KVNL 2DQFB 4PJGF 1U58A 4FQJL 3O9WB 1YMMA 4KJWC 4P5TD 3BHBA 1UJ3A 3CIQA 5ESVA 2IANA 1KCUL 3EO0A 4PFEA 3RA7L 3VWJA 2QV2A 1ZHKB 5SWQA 1KV3A 1N6VA 4JZNA 3W0WB 4XBPB 2HWZL 1PLGH 4UBDD 4XRCB 5JHDB 4Z8FL 5J11B 4KK9D 4ODHL 3DMMD 1F6AB 2YSSA 1KELH 3OKKA 5JNYB 2ICEA 4H88L 4MQXC 4PJIE 1FVEB 4QOKB 1B0RA 3S37H 3W9EB 3X13B 2KDGA 1JF1A 3PWNB 5JR1H 2YMXH 4R2GB 1FYTE 5I1JL 3TYFA 4EBQL 2HG5B 4JFYB 5HHNA 1A6ZA 1FAKT 5EOQL 1G7PB 1CI5A 4JFHE 5J12C 1OOAA 3FQRA 5TGBB 1N0XH 3FKUS 2PNDA 1X5FA 2K7QA 4O4YL 2DIBA 5IEHB 4GKNA 2UY7A 5CEXB 4OM1L 5I1DA 4U6HB 2CLZA 4NUGL 1YYLH 2WLYA 3TJEL 3B9AA 1INDH 3KPRD 3O0RH 4E42B 4YEEA 1VKXB 4FOMA 3SY0A 3P11H 2AGJH 4E5XB 1YEJL 3MMEB 4JFOB 1DQQA 3CX5K 1AR1D 2ZCKH 3PP4H 4UIKL 3GIZH 1IAOA 3KPSD 3LOWA 4U7SA 4F7CA 4AIXA 2XTLA 1KG0B 2CGRL 3GSVA 3IDIA 3KVQA 4RBPH 1TZHB 2P5WB 3HNSL 3ULUC 2IQAB 4HKZA 5GJSL 3CVHA 1G6RA 3IS1X 4O5LL 4XP1H 2DQIH 3WD5H 3AU1B 4OGAC 4JPIA 5LXGL 3C60B 1BPVA 5I15H 2EE9A 1UZ6E 2VDRH 1QTYT 3O11A 1PZUB 4L29B 5ABDE 5IW3A 3ZHLA 5HYSB 4IMLA 4Q9CA 1IKNA 3UJTH 4L9DA 3U46B 3RL2A 2H6PA 4DN3H 2E6PA 1A7RH 4HD9A 5JPNA 3AY4A 1AGBB 1NCNA 1V8HA 2J7LA 3OKOB 3T8XA 5KAQF 4KUCD 1FYTD 2B4CH 1NL0L 2GT9A 1G7JA 3LN9A 2QQKH 4QRTB 3S37X 3QEUA 4JFHD 3SO3C 1DZBA 3I75A 1M7DA 4RNRB 3L1OL 1NCTA 3O3BA 1JI1A 4QHKI 1W72A 4AT6B 4QTHA 5IFHH 3BEVB 4H8WH 3NZHL 1JVKA 3VXRE 5GZND 3QJHA 1T1ZB 4FQQB 3PL6B 4NZTH 3BUYA 1CK0H 4F58L 4Y19D 4EUPH 2HRPH 3PWLB 3S88L 5F1NB 1PDKA 2DB8A 2I26N 4GRMB 2DQHL 4XVTL 1OP5H 1G6RH 2CUMA 4MZ2A 4EN3B 4KZEL 3BDYL 4YGAB 4F57L 2X4RA 5I71C 2Y7QA 4IJ3C 3SKNB 3TA3C 2F5AL 3CMGA 5EO1B 4EQ3A 5FGBC 4ONOA 5C08A 5A2FA 5EBWA 1DDHA 1WF5A 4NOFA 1EO8L 2F8OA 4L4JA 5AZEL 3HZYA 3MROA 2WBKA 5D5MF 1UWGH 3VFTB 5FDWA 1HSAA 2H26B 3VFSB 3LHPH 1JGLH 1OTTD 3S3JA 7FABL 3PJSB 4LU5H 1R3IL 2Y23A 1MQKH 1PVHA 3Q3GB 4OGZA 3UPRB 5JW3H 4X4XA 3LSOA 4XMLH 3ILPA 4NKDB 4JFDE 2VABB 1GGBH 4RQQB 3T65A 2XPGB 3O8XA 4OIIL 5HVGB 4AZ8A 2YWZA 4XPTL 4I2XA 5IMLA 1F58L 1RUMH 4NRZA 3UDWC 1MWAB 1DVFB 3B9EA 3V6BR 1BZ9A 3WUZA 3QDMB 1CICB 1W72H 1NEUA 4NQUA 2EIBA 1T0MA 4DGVH 3KJ6L 3VXRD 3L3JB 2C3WA 1E4WH 2UZIL 2NXYB 1IZKA 2J5LC 3DX7A 1HE7A 3T3ME 4R0LC 5B22A 2C7UB 3INUH 2DQCL 3TBYB 5BXFB 2L0DA 4FMFA 1N5YH 3LAFA 3QUYB 1SJEA 1VPOH 3OKYA 2EDOA 4L3CA 1RVFL 1JPSL 1HSBA 2ZOKB 5LAXA 3TBVB 3CPLA 3MLYL 3D0LB 1F3RB 5J6HA 3QQ9D 3S4SG 1FNHA 3U0PA 4L8SB 1TCMA 1MJ7H 3DXAB 4PJ8A 2RHEA 5ADOH 1KPRA 1AP2B 1FIGL 4FP8H 3DI3B 2BNUB 3HC0B 3D18B 1GHFH 3PWVA 1NFIB 4NHCL 2L4OA 5DZLA 5IBUB 3TYGH 1YA5A 1D5IH 4OZFB 3HNVH 3RI5F 3SKMB 5H94B 32C2B 3HG1E 4I3RH 2PO6B 3SE9H 4JFDD 3B3IA 4CVXB 4MD0A 5FUZH 4DVBB 1BAFH 5BVJB 3JTTB 2C1OA 2ITDA 1GSMA 3C87A 1AO7A 3L3OA 4M03A 5IQ7H 3CX2A 2J88H 5J6GA 4YC2C 5CHNB 3TO4B 1TCRB 5TE6H 2PR4L 4LCYA 4QHLA 3T3PF 4JKPL 3NFPB 2FL5B 3GMMB 3CVHL 1NDMA 4LSQH 5D1XA 5FEBA 1VEOA 1M05B 2VR4A 1IAMA 5DJXA 1N7MH 3WSQL 3FO1A 5K9OB 5GZOD 2DLHA 1EVUA 4OZ4A 1HYRC 1I4FB 1BIIB 3O6LL 4RGNC 4TPRL 3RZWA 3QUZB 2W9DL 5C2UB 2JJVA 3CFKA 5A2IH 1MFDL 3MRFB 5D6DC 1S7QA 1U8PA 3HE7D 1RZKC 2G5BB 4N9GA 3MUJA 3HC3L 3QIBB 1IEHA 5IROC 3BHBB 2Z9TA 1UJ3B 2GFBA 2P8PA 5ESVB 2QJDA 2IANB 2NY4D 3EO0B 4LAJH 5GSVA 4P9HH 3VWJB 5SWQB 3MV9A 1FFNA 3H9YA 4JZNB 2ICES 1YEGL 4X9FA 1ZHLA 5EUOE 3LEVH 4KKBD 2PXYD 5HHXL 3GNML 1P53A 1CFBA 2GKIA 2W1NA 5FYLE 4RAVA 4NKIL 3OKKB 3BUTA 4Y2DD 1B0RB 2WINB 2BVQA 2CH8A 4XNZC 1EEUA 3O6MH 3MA9L 3J7HA 3HR5A 4V1DA 3DO3A 3TYFB 3UMTA 1V05A 1MEXH 5HHNB 1Q1JH 5C0JB 5BS0E 5D7SH 5HI5D 3FQRB 3IXAB 2RFXA 4GKNB 3RAJH 3BISA 4DUWA 4Z7OF 2CLZB 4POUB 1PSKL 2IPTH 4JO2L 5IM7A 3QXDA 4HIXH 1BBDL 4QWWD 3Q5OA 1OQOA 3THMH 2Z31D 1XCQA 2NY3D 1DQQB 5DD1H 2HFEA 1U8IA 2X4TA 4UMGA 5ALCL 3AS3A 1IAOB 2W65A 1I9RH 2WV3A 3GSVB 2GUOA 2QQQA 3OKMA 3V0WL 3WNMA 4Z7NE 4PJXE 1S78D 1CVRA 5HDOA 5C0CA 3BPCB 3UTSA 5BV7C 3KYMA 3PQYA 3CVHB 4IEFB 1HKFA 5CUSH 5T1DL 3TH4T 4H5SA 5KVDL 5JOFA 5D8JH 4Y16A 2Y25A 5JLZA 3KLDA 1YN7A 2B20A 2IH3A 3MLXH 3VRLF 4HF5H 2YD6A 3RX7A 3GI9H 3HUJF 3IT8D 5DS8B 1J05A 4NC0B 3O11B 1IC4L 5D1QA 2VUYA 5E8PA 1AC6A 2XA3A 3GK8H 4WTWA 2H6PB 5JPNB 2P8MA 3T8XB 4W6XB 4YK4B 5FHAL 2GT9B 1G7JB 2ZCHH 3KYOA 4Y4FD 3AGVA 4DTGH 4Y4KC 4M1GH 5BS0D 3AS0A 1K4DA 1WUNT 4KV5E 4OZGA 5ELIA 5BJTA 4MA7H 2CQVA 3I75B 1LDSA 1M7DB 3MXVH 4NN7B 4XWGH 3D2UA 3OX8B 5F7MC 1FFPB 2Y4SA 3L5HA 1W72B 4QTHB 4TTDD 3BQUA 1FGNH 3R4DA 1P5UA 1I1FA 1OY3B 3ULVE 1ZE3C 1KEMH 1BGXH 4M93C 3W9DA 4MD4A 4OTXH 1XF3A 3BUYB 5AUMA 2XWTB 5CGYD 5GSRA 1OM3H 3TIDB 1HHIB 25C8L 4HKBA 5KS9F 4XXDA 2SEBA 1E4XL 3MACL 5LCVH 5E6ZA 4AENB 3LV3A 4E9LA 2AV1B 4H20H 2HVJB 4DFHA 1X4XA 1S5IL 4AG4H 2VQTA 5E8EA 3REWA 2X4RB 1QQDA 3QCTH 3MLWH 2Y7QB 1T5WA 5KSBE 1C5BH 3WDHA 2XQYG 4JDVB 4JY5H 4PRIA 4P5TB 3GHEL 3B5GA 2O61B 3HZYB 4PJIF 3ALPA 4P5MA 2CRIA 5FDWB 3T04D 1HSAB 2ADIB 2BDNL 3P9MB 1ZLSL 3IFLL 4GAGH 1ITBB 4ODUB 3HE6D 3HUJB 3TT1H 4X4XB 3LSOB 2NW3A 3ILPB 4LHJB 2Q3ZA 2VZTA 5E8NA 1WIPA 4EDWH 4WEBL 3O8XB 5L2JA 4Y5XC 3NGBC 1MRDH 2IMMA 2O5YH 4NRZB 3MRBA 4LSDA 4QKXB 4FQPA 4GS7B 1BZ9B 4GQPH 3DETD 1T6WA 1CFVL 1T0MB 2D7OA 4ORGA 1GAFL 3OR7A 3V95A 4XTRD 3DX8A 3ULVD 2I25N 3DX7B 4JKWA 4ZMAT 3N1FC 6CGTA 4G5ZH 5JXEC 2VXVL 1SJEB 1S7RA 2B7DT 2F74A 4ODWB 4RMSA 3QDGA 2FO1A 4EJ1C 4L3CB 4YHLL 4YLQT 1GCFA 4EOWL 1EFXA 4MHHG 5JXAL 4BH7A 1IL1A 2A9ML 1VGKA 2XKSA 1FL5A 2Z8SA 5J6HB 3LS5H 1HEZB 1QKZL 3QISA 4UUJA 3P3YA 4F7TB 3VI4F 1UWXK 3CLEL 4PJ8B 4M9PA 4AEIL 1KPRB 1UZ6F 1NANH 1U92A 2BRRL 2NY1D 3W5NA 2BNRE 4ZD3H 4JAMA 1OSZB 4HUWA 5E5UB 3SDAA 2VTFA 3PWVB 3CJJA 3S35L 4MXQC 3MV01 2QHRH 2YXFA 5TPWH 3PG2A 5HVHC 3EYFB 2J4WH 1A7NL 2J2ZA 3GRWH 4YPJA 2BXZA 5DJ0A 2IC2A 3E0GA 1BOYA 4GBXC 4ZUSA 1X5XA 3L5XH 1II4E 3MODL 5T5FL 2VISA 3B3IB 2EDLA 4MD0B 1NLDL 2V17L 1UXSA 1JP5A 2LQRA 2ZUQB 4OB5H 2C1OB 2FIKA 3MLTB 2J6EA 3LEYL 3Q5YA 3EHBD 3NIFE 3P77B 1AO7B 3L3OB 5AZ2H 1DBAH 1JUFA 4XPHH 4GQ9H 5I2IB 4LCYB 2HA1A 3NCCB 4QHLB 1ACZA 5GHWL 1DANT 5I1AA 5J1TC 1NDMB 2HTLC 5DJXB 4UNVA 3FO1B 1NFDF 5E0QA 2EDHA 4OZ4B 4MSWA 4HDIA 5FAAA 5D96C 4JZJA 4Y2OA 4JQXC 3DLQR 1ZAGA 4N9GB 5IWLA 3V7MA 3CSYA 5HVWA 5JDJA 3JV5A 2CJUH 2X4OA 4KJYA 3OKNA 3BRGC 2GFBB 2P8PB 2AEWA 4JCLA 2NY7L 2JB5L 1LO3H 3P9LA 4Y19B 5GSVB 2ZKHL 3TPUA 1MIEL 1EV2E 1KNOA 1SYVA 3MV9B 4HMDA 1FFNB 2V6HA 3TN0C 4KMQA 2BNRD 2R0WL 1UA6H 1JJUA 1ZHLB 3C08L 1JWMA 1JZ6A 4UOW1 2XYCA 4P59H 5GRWA 4I1NB 5F9WB 5HDQH 4B0MM 4RAVB 4QRPE 4PB0H 5E9DE 4JRXE 3RWGA 3OB0H 1CE1L 1EUUA 1A6VL 5I1LB 4XPGH 3VXMA 2AV7A 1JNLH 2BVQB 1DQML 5IB2B 5LJYH 3MXWL 3NAAH 4PG2C 5TQ2L 4MMXC 5B8CB 1ES0A 1NAMA 4BYHA 4V1DB 5EBLA 5CD5C 2AJSL 5F89A 5DJDA 4ZS7L 2J6EH 1TDQA 4DUVA 1Q9LA 3LN4A 5ALBL 1T2QL 4U6VL 3MFFA 2RFXB 1KPUA 2DIAA 1RU9L 2X44D 4NNXA 3D1MC 3MLVH 5FV2A 4ZS6C 4LOUC 5IM7B 3QXDB 4WO4D 3P0YL 3T3MF 5DHXB 4KJQC 1XCQB 1WT5C 5FHBL 2HFEB 1TTFA 1U8IB 2X4TB 4Y4HA 5MENA 5DLMH 1MCNA 1NC2D 4AEFA 1OCWL 2ZPKL 2GUOB 3OKMB 3VXRB 3MRIA 2OR9L 4GAJH 4NHUA 1RY7B 1PJ9A 3UTSB 1X6LA 5CCKL 3U4BH 1NFDB 3PQYB 4HCRL 5LG1A 4G9DA 3GHBL 5JOFB 2WZPD 1FH5H 4Y16B 3RZCC 3DNKA 5JLZB 3U1SH 2H1PL 5GISL 1D5BA 3BDBA 1JK8A 1CTNA 1R3LA 4HMEA 4IRSD 5EOCL 4YFEA 3F5WA 3QH3A 1J05B 3FFCA 5D93B 5HTSA 2XWJB 4QRPD 5E9DD 5D1QB 1MHCB 3FAWA 3BP5A 4JRXD 5E6YA 5E8PB 5T3ZH 4PLJD 3NABL 1E6JL 4LLDA 3SDCC 3SEPA 4P57A 4TVSa 1BQSA 4BSJA 1YY8A 5L2KA 5FYKE 1NAMH 3N85L 3A67L 4HFWA 1U91A 5I1HH 1CCZA 1JRHL 3BJLA 3KYOB 2R4RH 3IDXH 1XGUA 1OARL 1RMFH 4YDIH 2ESVE 3VXPA 3H3BC 2GK0A 2EXWD 3QO1A 5BJTB 4OCWL 3OAZK 4PGDA 3ARBC 4H0GA 3D2UB 1U8OA 4PY8J 3SE8H 4U1KB 4ZNEA 1FDLL 1ZOXA 5BRZE 5ADPH 3BQUB 1D3CA 5D71L 1I1FB 1KFAL 3GKZA 3TFKC 2YKLH 3LZFH 1QNZL 1JPGA 2MCPL 3W9DB 5E7FA 1XF3B 3EYVA 3FHAA 5AUMB 4ZPTA 5GSRB 3QG7L 1F6LL 4HKBB 2AJZA 4XXDB 3CFCL 4XBEL 4BH8B 2SEBB 4Y0GA 1A7PH 1KXVC 3LV3B 4IRJC 4DZBB 4FTVE 2UYLA 3VJ6A 1BM3H 5IB5A 2KUTA 3N50A 3FQXA 3REWB 5C07A 3JWDH 1QQDB 3WHE1 1T5WB 5EORH 4Z7VA 3O3EA 4UT6H 3FOMB 4F2MB 2F15A 2W0KA 4PRIB 2VN7A 3RVWC 4CUCA 2A9NL 2VSCA 2DLIA 4P2YA 4P5MB 3VFRA 1JGUH 1FPTL 4M62H 2VLJD 3D9AL 1KC5H 5DJ6A 3TCLB 4AEHH 5F21B 1YYMH 1C12B 4LCCC 1DFBL 1IKFL 2NW3B 2I27N 2A1WL 5JHLL 3W11C 1LMKA 1H0DA 2ESVD 4P46C 1MH5B 5L2JB 1GZPA 4I0PA 1N5AB 1T22A 3FO0H 1YMHA 3H7BB 1EH9A 3TC9A 4ORGB 5BRZD 3OR7B 1CIDA 4NDMA 1L7TL 3R1GL 4GKZA 3DX8B 3OPZH 3RWEB 3OWEA 1EEZB 1PKQE 4ELME 3BVNB 5E2UH 2WQRA 3T2OA 1CN4A 1S7RB 2F74B 4KGJA 4L3EE 3QDGB 4M6NH 4PJXF 1DN0A 1LGVA 4PP1C 5GGUA 4Z7NF 2A83A 5T3XE 1EFXB 1RJZA 2EH7L 4Z7WE 3H42L 1IL1B 2Z31B 4FTVD 1RURH 1A4JA 2FBOJ 4C4KO 4UUJB 4J3WA 5DJ8B 4H1LH 2VDNH 3IDGA 3QUKB 5TQ0H 5FM5M 1CWVA 1BX2A 1U92B 3MNWA 4LHUA 3UJIH 4CMMB 1GC1H 4HUWB 3I6LE 4HJ0C 4IMKC 4Y8DC 3SDAB 1ZT7A 4L4VA 2IFGA 1GGTA 3B43A 5DXWA 3T0EC 5ISZA 3QR2A 4KY1L 5FKAA 5I1KL 3BYTA 2X70A 5DJCB 2IBZY 4I5BA 3ZKSD 1NGXA 5DJ0B 1CBVL 4Q6IA 4MGXA 1J88A 1H15A 2VISB 3LRSA 4QT5A 4LDEB 3BE1H 4KV5F 1RZJC 3VW3L 3GI8H 2NY2B 2FIKB 1T2XA 5EA0H 3GSUA 4Z78A 4MWFA 4G6AC 3ULVL 1BOGA 3AC0A 3V6FA 1V3JA 3ULVF 1YNTA 2FDBP 5BS0B 1C1EH 2QR0A 1EHNA 4LVNB 3H9ZA 4V2CB 4MSWB 4Q2ZA 4HDIB 3S96A 1PZ5A 2H45A 1HKLL 3O6KL 4L3ED 1SY6A 5T3XD 1QR1A 5AAMA 5F7KC 3CSYB 4O02H 4BSWA 5E24E 2X4OB 4YUEH 4DK6A 3OKNB 1WZLA 2LV4A 1WBZA 3TVMC 4OFPA 3P9LB 3KNBA 4G6JL 3TPUB 2RCSL 5FCUH 5KSBF 3KJ4C 3FQUA 1MIML 1KNOB 1MPAH 4RMQA 1SYVB 5JA8B 4KVNH 4NBXB 1MVFA 3I6LD 4FQJH 1FLTX 5IMMA 4KZDH 1JWMB 5DEGA 3VFUB 2VR9A 3RDTA 1EXUA 3VD3A 1KCSL 4GG6A 3Q0HA 5D7IA 3EOBB 3VXMB 2AV7B 1KEGL 1JTOA 4P4KD 3AUVA 2HWZH 3D3VA 3ARXA 4JM4H 1MJJA 3OAUL 1WTGT 3C6SA 3A0OA 3VXNA 1XGPB 1ES0B 4ODHH 3CSGA 5EBLB 3EYOA 3NIGE 1Z6JT 3D85A 1QBLL 5F89B 4W4OA 1JF6A 5I1GL 5KSAA 1NCBH 4QNPE 1JV5A 4BK5A 5H37G 3VXOA 3MFFB 3IKCA 4OCXL 1KPUB 2ZP0T 1NGWA 5IIEB 1V5JA 5L8LB 4NNXB 5ETUA 3ISWA 4EEEA 4PGJA 1J18A 1V7ML 2QHLA 5FO8A 5ILTH 3MV7E 3EOAB 1YY9C 4Y4HB 5I8KH 4OM1H 1SY6H 2WQ8A 4APQC 2O5ZH 5DJAB 4X5LA 3MRIB 4LSRL 1WSST 2DDQH 4QHUA 3MBXH 3FRPG 3LKSA 3B2VL 4U7KA 4NBZB 3RTQC 5FFLA 4LSSL 2DYPA 43C9A 4LSPH 2NY0C 4G9FE 2DJ4A 1D5BB 3HNSH 1JK8B 1R3LB 1N3NA 1AFVH 5F1KC 4BSVA 5ITFA 3F5WB 3QH3B 5E2VL 3FFCB 1CXEA 3BP5B 4R97C 1BFTA 1CQKA 2X40A 1TVHB 4LLDB 4PJAE 3HB3D 1H3VA 2LTQC 2NY1B 4P57B 1XF4A 4HFWB 4IDJH 1U91B 4FXGB 4YXKH 3D6GA 1XGUB 5LQBL 3FN0H 1BFSA 2VLME 1RPQA 3OKDB 2GK0B 3GBNH 3S5LB 3U7YL 1BF2A 2CR3A 1F3JA 3ULUE 3QO1B 4KJWD 4PGDB 3DV4A 4YPGA 3WFDL 1NL0H 3ETBF 1KCVL 1ZT4A 2A73A 5CJ5A 1IC1A 4NRXA 1R5IB 1MAKA 1EMTL 5D72H 1HZHL 3GMOA 1JPGB 3MV7D 4HS8H 1V3MA 3EYVB 1LK3H 3C2AL 4ZPTB 1RK0A 1GGYA 4MQXD 1MFAL 4F8QA 2AJZB 1P84J 2Z4QA 3NCMA 3F62A 3FT4A 5KOVC 4X0KA 5L7XL 1FFOA 4MJIE 3SDDA 1WVZA 4Q6YA 2UYLB 3VJ6B 2C5DC 5IB5B 4KDTA 4F58H 4N5UA 3FQXB 1JF5A 4G9FD 5C07B 1P6AB 2A2QT 3S88H 4K9EC 4GAFB 2E5EA 4Z7VB 4X80H 4NQXA 4UILL 5DGQA 4RFEA 3K8MA 5IVZA 3KYAA 2F8VA 1A3LH 2JF1A 1N4XL 4RDQG 4BZYA 1YNKL 4KZEH 5E8DH 4BUGA 3VFRB 4F57H 2R8SH 4PTUA 3KYNA 4KAQL 5DJ6B 5KW9L 1AY1H 1GZQB 2F5AH 3BW9B 5JIKA 1CFNA 5B4MC 3BMWA 2BOCB 4WWID 3MLPA 4JVUA 5EPMA 5JOPE 1LO0H 1WZ1L 4HK0B 4LLUA 1U8NA 2QBWA 5GGTA 3ULUD 3V4PL 1GZPB 4I0PB 5L0QB 1EFQA 4RMTA 2R1WB 4FQLL 3IETA 1HIML 1MCRA 4LLVB 4MAYC 4LK4A 4CVZA 4X6EA 1YMHB 4GOSA 5TDNA 5CSGA 3HAEG 4ZSOA 3UC0H 1LP9E 3RVXC 4NDMB 4L1HA 4GKZB 5GJTL 3MLUH 3PGDA 3UZEA 1ROWA 4OIIH 4D9LH 4XPTH 2JE8A 4BELD 5FYJH 3HHRB 1MRFH 1UVQA 1J0JA 1VA9A 2P7TB 4EI5A 1DN0B 5GGUB 3LQMA 4LGRB 4MJID 3RGVC 1RJZB 2IQ9L 4ORZC 2DBLL 4NN5C 1MHHA 2JJTA 3VWKC 1A4JB 5E00A 2G2RA 3CH1A 4QHKJ 2COQA 2X9YA 2D7PA 3QHZH 1CXHA 4K3JL 3V0AC 3IDGB 1BX2B 4LHUB 3BWAA 3WFBH 2E8ZA 2FLBT 5JQ6L 2Z92A 1ZT7B 4L4VB 5HHME 3ARZA 5MI0B 3V4UL 3CFJA 4GG8A 4HFUL 1DE4B 4R4NC 4ODVH 1IJ9A 1FIGH 2X70B 4P9MH 2IMNA 4I5BB 4DGYH 1NGXB 4XNXL 4Q6IB 5JOPD 1AGFB 4NHCH 1H15B 2GITA 3LRSB 4QT5B 1K8DA 2ADFL 3E2HB 3B9VA 3IF1A 3O9WC 1WJ3A 4OGYL 3GSUB 4Z78B 3ZDYE 5DQ9A 2UZXB 3KLSA 1BOGB 3OR6A 1F00I 5DT1H 1YNTB 5E56A 1CD8A 3TA3D 4OKDA 5DRWA 2XV6B 4PG9A 4ISVA 2QR0B 3MRNB 2UY6A 5ANME 5J11C 4OCRH 4TTGA 3QWRA 4W4NA 1EDQA 4Q2ZB 3S96B 4RGMB 5GGSY 1EBAA 1QR1B 5I18L 3EFFA 1DSFL 3L7EA 4FQ1L 2M8XA 4NWTL 4R2GC 2HKFL 2LAGB 1WBZB 4G8IA 3O6LH 4MYWB 4MB4A 4KHTL 1NGQL 4GW4A 3TBTA 2W9DH 4KK8C 5IESH 4A2MA 1MFDH 3G9VA 2PYEA 4I4WA 3MRLB 3KAAA 4Z7UE 5H8DA 5F7HA 2AABH 5DEGB 1N2RB 4U0RB 5HHMD 3IU4L 1FFRA 3RDTB 1F2XK 2CKBA 1EXUB 1P7QA 4GG6B 1RIUH 5D7IB 3VG9B 2A6DA 2C3HA 2YA0A 5IK3B 3OJ2C 3FB8A 3OKLB 2Q76B 4OD3L 4YHYB 1YJDH 1MJJB 2KL6A 4Q9QH 1GVIA 3C6SB 3VXNB 1F8TL 1A2YB 3LIZL 4ZPVA 3J8F7 3IAGC 5JA9A 3B5TA 4RGNE 2JJSC 4LRIC 3D85B 4XP9L 1X5IA 5KSAB 4TNVK 2UVFA 2VLJB 2V7NB 4ZAKC 3GGWA 1AGEA 3PWPE 4JFEA 1U3HA 3BPNB 2UWEE 4YBQC 5C0GA 3VXOB 5EN2A 1A3RH 3IKCB 5DQDH 1LEKA 1NGWB 2XZQH 1I85C 2G60L 4TOYL 2H41A 2YD1A 2NY5C 3W5MA 5A16B 2XQBL 5HYJA 3C60C 3BKYL 2EIDA 4ELMF 3T1WA 3CSBA 5FO8B 4LGPB 2ZG3A 1PD6A 5MHSE 2EIEA 4OCYL 4TVPH 1S7WA 4P2CG 2VDLL 4PY7A 4Z7WF 4ZFGL 3QXVA 1BBDH 1CFTB 4DN4L 2EO1A 1BVKA 4QHUB 3HZVA 1X4ZA 3G04A 1KACB 3SOBL 3LKSB 4GO6B 3PHOA 4DOHB 1I9JL 2X6MA 4PGCA 2DYPB 3EUUA 3TT3L 4UDTA 4HWZA 3WS3A 3VFPA 4BSVB 4CU7A 5ITFB 2APVA 4P99A 3SGEI 3MLZL 3P4MA 2DLTA 4PV8A 1EGJL 3T0BA 5T1DH 3T2NL 1C5DA 4WUKH 2CK0L 2P24A 4DW2H 3PL6C 4ZO6A 2ENYA 4HG4J 4F9PA 1EZVY 3L9RA 1XF4B 2PUQT 1DBBH 1R3HA 1IC4H 4RGND 3VGBA 1I1AA 2GJ6E 3CFEB 3PWPD 4I9WD 4M7KL 1B0WA 4X7TA 1F3JB 2N4IA 2KZ1B 3PGCA 4EN3C 3FL7A 3DV4B 3ARVA 4J12A 4YPGB 5E99L 3A6BL 1QLEH 5J56B 3DIFA 1K5NA 1PEWA 1QSFE 1X9QA 5EU7C 3G5ZA 3CGTA 2A73B 3MR9A 1G7QA 4TSBL 4NRXB 4YIQA 5ID0A 3B9KA 3GMOB 1RK0B 2J8UE 2MFNA 5F7NC 4LRNH 1MCPH 2DM2A 4NO2A 4CU6A 1JPTH 3FT4B 3L3DB 4WFEE 1FFOB 3BD3A 3K8KA 3SDDB 5AEAA 4ZTPL 4HULB 2FB4H 1RUAL 2N1KA 3IS0X 1U8KA 1D6VL 2VXUL 1NFKA 4ZFFA 4MQ7A 2C26A 5IHLB 4UOW0 4DKFL 3MACH 4CADA 2ID5A 1DVFC 5KVFL 4NQXB 1XGRA 1CICC 2AXGA 1EO5A 5IVZB 2HFGL 3T1FA 5IFJA 3GMNA 4Z7QE 1F4XL 5EUKA 2NXYC 3NFSH 4PUBH 3WFZA 6FABH 3IJSA 2RAMA 1X6NA 2BSED 3NIGF 3GHEH 3QUYC 5EPMB 3MGTA 3DVGB 4LLUB 5E2WL 1U8NB 2BDNH 3SCMA 3QEQA 3VGDA 1J0YA 4QNPF 5CINL 2R2CA 1CDYA 3GSQA 2AW2A 1FE8H 3IETB 3DVIA 2AJYL 4CVZB 2WUBL 4X6EB 5TDNB 4P2RE 1QSFD 4ZSOB 3HLAA 1T0NB 4AL8H 2H3NA 4PR5A 4RDQF 2ZWLT 5GGVL 5KN5A 3QG6A 1A7BA 4WEBH 4ZFOL 3PGDB 4HZAA 4K71B 3GMQA 5SX4H 1URLA 3CDGA 1REIA 1UVQB 4CVUA 2E7HA 4LLQA 4M1DH 5GGRY 4JKLA 3QIUA 3E8UL 5JDSA 4WFED 3OG6B 5HHOE 3JWOH 2CKBL 2PO6C 2EDQA 3DPBA 3A6CL 1YNLH 1MHPH 2G2RB 3CH1B 3WKML 1FLRL 4QF1A 4Y4KD 4S1RL 5H35B 4XVJL 3SN6N 5KZCB 4YHLH 3IFOA 4G8FA 2L7JA 1IFHL 3TO4C 3BWAB 4J6RL 1MFBL 2XZCL 2Z92B 5DVKA 2FIRT 4NO5A 3CFJB 4GG8B 4PJAF 3IDJB 5C0DA 2GSGA 2WIMA 2H2SC 4GMTL 4HPYH 5B39G 2P4AB 1OWWA 2EE2A 5E70A 1AD9A 2NX5A 1I8KA 3QUZC 4MNQD 1ZLUH 4EIZC 5MP6L 1K8DB 4G7VH 3ULUF 2AERT 3IF1B 3H3PH 2C3VA 3DRQA 4WFHE 5DQ9B 5EBGA 1UJ3C 1TPXC 4P2RD 4PRHE 2BSSA 1UACL 2Z8WC 2ARJQ 4JFFE 5DD5H 3VWJC 1FBIH 4LCUA 1NLDH 1FC2D 4JB9L 5DRWB 1IEAB 4WU7A 4PG9B 4ZXBA 3HMXL 3MLSL 1XZ0A 1X5YA 4MDIA 5GHWH 3I3DA 1FAIL 1K85A 3HPJA 5B21A 1FC1A 5HHOD 1U93A 1SJXA 3EFFB 3H6JA 4WCYL 4DWHA 3L7EB 3BAEH 4LNRB 3SGDI 5E5MA 4X83A 2W0FA 1VFBA 2R29L 1QO3B 2BERA 5E4EB 3WHE0 1KBGH 1JWUA 2FHFA 3JV6A 4ZFOB 3TZVA 2B4CC 4G8IB 1HCVA 1BWWA 3NH7H 1V3KA 5F7FA 3FB5A 5HGBB 1MF2L 3TBTB 4KH2A 4LCWA 4I4WB 3IFNL 1G1YA 1BD2E 2ICWA 4S2SA 1J5OH 5I17A 3K7UA 1XR8B 2CKBB 4FN0A 1C5CH 2ZKHH 4ZYKA 3RWFA 5EO9A 3JWNC 4GW1A 4KRLB 4WI2A 2PXYA 2A6DB 2YPKB 1MJUH 3B6SA 1K6QL 2CMRL 3FB8B 1DBKL 1MI5E 1NC4D 5JXED 4NM4L 3HG1A 4N1CA 4WFHD 5TF0A 3BPLB 1G0YR 4PJAB 3GGWB 1AGEB 3OKEA 4JFEB 4KXZH 1U3HB 5FO7A 2MWCA 5EN2B 1DQMH 1XEDA 4LMQE 4JFFD 1LP9F 1LE5B 3PXHA 1A6AA 5EU5A 3R0NA 4ZS7H 5IB4B 3PWJA 4L1DA 3O2VL 3KPMA 2BJMH 4MXQD 5ENWA 1IKNC 1S7WB 4NQDE 3BWUC 4OF7A 4U1JA 1QEWA 1TITA 4NYLA 3UBXB 3AY4C 3FMGL 4ETQA 4YK4C 1BVKB 5DDHB 5EZLA 2FBJL 5C09E 3RPIA 3HZVB 2IH1A 4GBXD 2VXQH 3VXQA 4M7JH 3CDFA 2DWEA 5GXBB 3PHOB 4XAWL 4PGCB 1G6VK 3K2UH 1FJ1A 3TESA 3T4YB 4UDTB 3WS3B 3VFPB 2OR9H 4NN7C 1BD2D 3UTZB 1RHHA 3C8DA 3IAPA 1FG2B 2W92A 3L3GA 4FFWD 1VB9A 3P4MB 3GSXA 5TE4L 1C5DB 1NKOA 4G6FB 5EUOA 2P24B 3QEGH 3TJHC 2HTLD 4OZIE 2QL1A 3CVIL 3W82A 1DUYA 5M95B 1MI5D 3L9RB 1YPZE 3C2SA 2V9QA 3LDBC 1XH3A 1SEQL 2ZUUA 2EYSB 3N9GL 1H8SA 4KK5C 4NJ9L 3WKNA 2B5IB 2NZ9C 1I1AB 3PF2A 5K33A 1FZOA 3ZDYF 1L0XA 4RX4A 4N0RA 4X7TB 1K2DA 2QQNL 3PGCB 1NCUA 5I0ZA 1J12A 3DIFB 1K5NB 1JTPA 4Y7MA 3G5ZB 5GS2D 3TN0D 1WIOA 5A43C 3MR9B 1CGYA 4FRWA 5DHVB 4YIQB 5ID0B 3B9KB 2NTFA 4FHBD 3X17A 3I2CH 5F72S 4NQDD 2UZYB 1GH7A 3OJVC 1ZK9A 4HEPG 1QRNE 4ZOEA 4NO2B 4MNGE 2BNQA 4AMKH 2R56H 1IT9L 1YZZA 4QRRE 5C09D 1QNZH 4HJJH 1RFDL 4HV8B 4PD4J 2F5BL 5CD5D 3S34H 1U8KB 4YFDB 3O8XC 3LQAH 4R4FH 2UUDK 4ZFFB 4MQ7B 4YX2H 4Z7UF 2AP2A 2VQ1A 4CADB 2FSEA 3NFNA 1EA9C 4Z0BH 3QIWA 4GS7C 1XGRB 2AXGB 1KN2H 3SO5A 4M9OA 1WWAX 3VFGL 4UTBL 4PJBE 3UBXI 4ZS6D 1U2CA 4LOUD 3GMNB 4LSTL 5FYLH 4WI5A 4JHZA 4KJQD 4XHJC 1OAUL 5IVOA 2EEAA 1H8OA 1NMAL 3IJSB 1T4KA 1ONQB 1RZKL 3BMVA 3CXHJ 5HHMB 4XMPL 3WNNA 1DR9A 2GSIA 3QEQB 2UWEF 3GSQB 3EYSL 2DM7A 3CC5B 4HWBA 5C0BE 4NQVA 1OAYL 2YR3A 3FO9A 3HLAB 4LIQE 3L5JA 4U2ZA 4PJ8C 5KN5B 3RZCD 3CSPA 4XX1E 3QG6B 1QBAA 3IFPA 1T3FA 1IM9A 2ZJSL 3Q6FB 1KOAA 3DX9A 2AI0L 2D7TL 1RAMA 3CDGB 1WFUA 3MA7A 4LLQB 1QRND 3QIUB 5HPOA 3SDCD 5JDSB 4HC1A 3WDIA 4QRRD 3HFML 4WWKA 2MNUA 1QZ1A 3QULB 5JUEL 4WW2A 3LN5A 4J3UA 4UIMA 4NZUL 2A6KB 4BA8A 2ZUQC 4QF1B 4ZUVA 4OLUL 4J4PD 4R7NB 1CFQA 4YDKH 3UTTA 5C6TL 3ECBA 4ZFZA 3ARBD 4P3CL 2JLLA 3U9PL 1CE6A 4WHTA 4TSAH 4NO5B 3NPSB 2VITB 5D1XC 3CXDH 5LVEA 4NSKA 5C0DB 2GSGB 1GYAA 5ACZA 3TFKD 2KZWA 3BKJL 2Q86A 4DGIL 3MRRA 4D0CA 1AD9B 2NX5B 2WANA 1FO0L 1I8KB 4ALAL 3HNTL 4KGLA 3CFDA 3PHQA 1U6AL 1CD9B 2OR7A 5KSVA 4LP5A 3DRQB 2C3VB 4IRJD 4HWBH 1A9EA 4A6YL 3VRJB 3VD5A 2BSSB 3VDBA 3WFCH 4Q9BA 5DD6A 1YEFH 4PPTA 4LCUB 4NQEE 5IT2L 4I3SH 4U1NA 4S1QL 3I50H 3QFJD 4FQIL 4KHXL 3OHXA 2HJFA 4ZXBB 1PYWA 3RVWD 3JVGA 2J8UF 1IGCH 5F9WC 4MDIB 2EDEA 5K9JL 4WTZG 2DAVA 3T0EE 3HPJB 4XCFL 4WUUE 1U93B 3MOBH 2QQLL 2H32A 4YHPA 4PJEE 5E5MB 2W0FB 1VFBB 4QLRA 3JV6B 1JWUB 2IAMA 4Y1AE 5CP3A 3W11D 4FNLL 5FYJU 4P46D 3FB5B 4LCWB 1E6OL 4P2QE 1OTTC 5CJQL 5LWYH 4HPOH 1DL7L 4Y5VA 4BFIA 4CL7A 3QNZB 4XNZB 1CZ8H 2VDOH 4XX1G 2ICWB 5DO2C 4S2SB 5J0BA 3QNXA 4OSUL 4Z7QF 3OAYK 5I17B 3ZKMC 4G6JH 1BEYL 1ZXQA 2RCSH 3RWFB 4GW1B 1OAZL 3B6SB 4KROB 4K7FA 1J8HD 2X7LB 3QPQC 1NMBL 2DMBA 2X1OA 4F7MB 1IMHC 5F93C 4K2UL 1FZMB 4PP1D 3B9DA 3OXSA 4UT9L 5ESQA 1NCWH 4NQCE 5DMIL 1KEGH 2N7AA 3U79A 1ADQL 3X12A 5L88L 5CSZA 3VMOA 5D9SB 3EOTH 4NQED 4Y16C 3BT2H 1OP5K 1A6AB 1G9NH 5JZ7C 1CR9L 5I1GH 4GH7B 4NO0A 4ODSH 5M7QA 1AE6L 1A6WL 2G5RA 1FO0B 4HJ0D 4RWHA 2GAZB 5D6CA 5DK2A 1QYGL 5D1QC 3CNKA 2A38A 3T0ED 5IGXL 4OLWL 3G6JA 1DEDA 4U1JB 1QEWB 4WUUD 2H32H 4JY6A 4NYLB 4ZOAA 5HHQA 2IFFH 4JZOA 2IH1B 4Y1AD 3VXQB 2DI8A 2PCPA 3SE3A 4JPWL 1B9ZA 3ARYA 4Z95L 1FJ1B 3S9DB 1RK1A 2R0KH 3D48R 5SWZA 1Q0YL 4POYA 3FO2B 1MY7A 3RBGA 4HAFA 3L5IA 3HA0A 4G6AD 1RHHB 4NPYA 1OL0A 2Y1VA 1EK3A 3L3GB 1MRCL 3I02A 4I8DA 3O4LE 3F7PC 4NKQB 3BQUC 2ZCLL 4Y4KB 1MCOL 1DUYB 4ERSL 4IRZL 4OF0A 5HJ3B 4MJ5A 3QUML 1FNSH 5E2VH 2HLFC 3MGOA 4KTDH 4JO4H 1QFPA 4C57C 4O2EA 1F42A 1I3VA 5I73B 4M43L 4NQCD 5KVEH 2PETA 1K2DB 4HC1L 3TVMD 2Z35A 1NUNB 1IC7H 2XA8L 4MNQB 3RNQB 3CLFL 5HI4C 4KU1A 2VXSH 4JJ5A 4FFYL 3U7YH 3PWUA 4UV7L 2J12B 1FVDA 2NTFB 4MCYA 2D3VA 4NCC1 3U36B 4KI1A 3WFDH 1T2JA 1RD6A 4YE4H 4UINH 3AAZA 2X1XR 4OD2A 1BQHA 4LGSB 4TRPL 3ROOA 2BNQB 2G75B 5BOZG 5F9DC 1S9WB 4LVOB 1EMTH 4S1DC 5EDXA 1HZHH 2XFXA 4ODTH 5F3BB 2VXTL 1VSCA 3VD9A 1RZ7L 2C3GA 2XNAA 1MFAH 3CU1A 1P4IL 1HI6A 4P5KA 3DOSA 4HXAH 4S1SH 2VQ1B 2FSEB 3NFNB 3QIWB 4OLYH 4TSCL 2A6JA 1T1XA 3WJJA 2ZUVA 3O6FA 4HIEB 3O4LD 3N1GC 2ERJB 4XMKL 3MRMA 5ITBH 2MCG1 1H3WM 5BZWA 4PTTA 4FQCH 2V5TA 4HQQH 1TJGH 4K3EL 3SE4A 1I8MA 1YY9D 5I8OL 3HMWH 1YN6B 5J9PA 4APQD 4R8WL 1D5MA 4QHNB 2V5YA 2GJZA 5KW9H 1L4IA 2IGFL 5LGHL 2NNAA 2ATPB 4MA8L 4IOSD 4PJCE 3RTQD 4NQVB 4XB7A 3FO9B 4PBWD 1JHKH 4ZUTA 2NY0D 1IAIL 3IDUA 1GRWA 1F4HA 1XCTA 3IFPB 1HXYA 1T3FB 2FX7H 1IM9B 1HIMH 3BI9X 3SDAC 4OD1L 1AJ7L 4XC3L 4C83A 1NGPL 2YA1A 3OQ3B 3MA7B 4HIIA 5FM4A 4YXHL 1RULL 3GJFA 1JYNA 5GJTH 4XVSL 2VLKA 2DLFH 2VDML 3Q1SH 4WWKB 1P1ZA 4WW2B 3LN5B 2DM3A 4TQEL 4U0QB 3RY5A 4DCQA 3JTSA 1YEHH 2WBWB 3VXSA 4RWYL 4MXWL 4F7PA 2NY2C 1CFQB 4GRLA 3UTTB 4TULL 4ZFZB 3KPQA 4X4YB 3OF6D 5F1OB 1A1NA 4UTAH 4WHTB 2WAHA 1T7ZA 4OCLC 5F88B 3SHSA 5IHZB 4OZIF 3ALWA 4NSKB 1LEGA 4K3JH 2EDWA 5ACZB 2YZ8A 1YPZF 2BVTA 1SQ2N 1LE9A 2Q86B 3MRRB 1BD2B 1F90H 4KQ4L 2BHUA 3HZMA 5JQ6H 2R9HC 4HBCL 2K3TA 4NQSA 1NCCL 4JZJC 1JBJA 1AXIB 1Q72L 5FYKH 3PHQB 2XOTA 4PRBA 4NT6B 5CJBA 3V4VL 5IWLC 4QXUH 5KSVB 1CXIA 1OW0A 4F33A 2H2PC 2DQJH 4BQ6A 2CPCA 4W6WB 5FM5O 1NBYA 5TE7L 5D96B 4JRYE 3X11A 4FS0A 4U1NB 2CR6A 1KYOJ 5DA0B 2ZOLA 2MPAH 1KB9J 1PYWB 1DQDL 3M8OH 2B0SH 5GRUL 1JGVH 2WWKT 4N90E 4PJHA 3HI6L 3GJFH 4N5EC 4F7EA 3MOAL 1LQSR 3ZTNL 3CMOL 2V7HA 4XP4L 5CILH 5GS0H 3TN0B 3D0VA 4XVUC 4JO1L 2ITCA 4R4BA 3O2DA 4YHPB 1HINL 5B4MD 1B88A 2IAMB 1Q9WA 1WEJL 1W0VA 2W38A 3VU2A 4OFYD 1KJ3L 2QSQA 4KFZC 2NR6C 4MAYD 4RISH 4Y5VB 4HBQA 4BFIB 4PJBF 3QNXB 3RVXD 12E8H 3P9WB 4G7YL 5I1IL 2BFVL 2YC1A 5DTFA 1RZGA 3W0WE 4K7FB 5GQBA 5DEFB 5JHDE 5DVLA 4Y4HC 4M5ZL 1G0DA 1RZFH 4HGWA 1U8LA 3MLRL 1OB1A 2ORBH 2Z91A 1F6FB 4R96A 2HRLA 1OAXL 2DICA 3OXSB 4M5YL 4QOKE 5ESQB 3RGVD 5T33L 1FRGH 4POZC 4OZIB 4JG1L 3UTQA 1SYSA 3FQNA 5E6IA 3VWKD 2JJUA 1UFUA 4OD3H 1AQDA 1G7MA 3EAKA 3X3GH 2Q6WA 5CSZB 5F7EL 4UQ2A 1F8TH 1TTUA 3C9NA 2ADGA 4PGEA 1AXTH 2YOCA