3QODA

Crystal structure of heterocyst differentiation protein, hetr from fischerella mv11
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
296
structure length
294
Chain Sequence
SNDVDLIKRLGPSAMDQIMLYLAFSAMRTSGHRHGAFLDAAATAAKCAIYMTYLEQGQNLRMTGHLHHLEPKRVKAIVEEVRQALTEGKLLKMLGSQEPRYLIQFPYVWMEKYPWRPGRSRIPGTSLTSEEKRQIEQKLPSNLPDAHLITSFEFLELIEFLHKRSQEDLPKEHQMPLSEALAEHIKRRLLYSGTVTRIDSPWGMPFYALTRPFYAPADDQERTYIMVEDTARFFRMMRDWAEKRPNTMRVLEELDILPEKMQQAKDELDEIIRAWADKYHQDVPVVLQMVFGKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of transcription factor HetR required for heterocyst differentiation in cyanobacteria.
pubmed doi rcsb
molecule keywords Heterocyst differentiation protein
molecule tags Dna binding protein
source organism Fischerella thermalis
total genus 70
structure length 294
sequence length 296
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03574 Peptidase_S48 Peptidase family S48
A PF18460 HetR_C Heterocyst differentiation regulator C-terminal Hood domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1670 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3qodA03
1.10.10.1680 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3qodA02
4HRIA 4J00A 3QODA 4YRVA 4IZZA 3QOEA 4J01A
chains in the Genus database with same CATH superfamily
2J5PA 2FU4A 2M5WA 2VBXA 3ESWB 3CP8A 2XROA 3I53A 1QHHD 4O6JA 1G3TA 3F22A 5LD2C 3I0TA 2V1XA 3AKZA 5M3MJ 2L7ZA 3BR2A 3N4MA 4DBRA 1FYKA 2LFBA 2EZKA 1M1EB 3CMMA 1ENHA 4L5EA 3ABMH 2OBPA 2VE8A 2KT0A 2JZYA 3U9GA 2VI6A 4Q48A 5HS9A 2HDWA 3QWLA 1FEXA 4ZC3A 4D5CA 5KNLA 3V7CA 3K2ZA 1H9TA 3SDBA 4MLOA 2Y9ZA 4BEHA 3ZQGA 4HBLA 3VB2A 3QU3A 4YIFA 4I76A 2KDOA 2EFQA 1QZEA 3GLXA 1FJLA 4A3CJ 2LYCA 1YJ9I 3ZR8X 3TGNA 1SVOA 3GLLA 5GPAA 4M6XA 1A35A 3RPUD 3TKYA 3ZRGA 2Y0SA 2VJIA 1G6NA 4FQGA 1BOAA 5FD5A 2BY0A 4B47A 4G12A 3BPXA 3BJ6A 3K7AJ 1BI3A 1EH7A 1Y6IA 3I3LA 3T5XA 3SJMA 4A3IJ 2M7AA 3KZZA 2RNGA 1VQ6I 2B0LA 5TJJA 1BC7C 3M8EA 2HTJA 1XGOA 4Y33A 3TEDA 2EZIA 3E6CC 2QSFX 2L9RA 2R5ZB 4UB8C 4ON0A 5IP9J 4QLCU 4RAGA 4GFBA 2R0QC 3RYPA 4OWRB 1T08B 1K78A 2K86A 3A0HC 2CG4A 3OIOA 5J8FA 3CCVI 1HBXG 5LRSA 2DOAA 5DTDA 5ILVA 3BR1A 3LSMA 1BW5A 2X1EA 4OAZA 4BQNA 1TLHB 2NOGA 3KPHA 1OCPA 1YE9A 4IHSA 4E4HA 4QWQA 3GXOA 2A3SA 2E1CA 1MBHA 4K2EA 1S7EA 2RC4A 3LAPA 4A0YA 2L9SA 5GTHC 2L9VA 1ZELA 2QCOA 3PQKA 4ENNA 4LB6B 2ZXIA 4WXCA 3FM3A 4D7NA 1S3JA 5B5EC 2ZMEB 1YYVA 2ICWG 4CYCB 1ZGAA 2LMDA 4G8XA 3F8BA 2ECCA 2GLOA 1R36A 2D5VA 4XL9A 3OSFA 5HOOA 2WA0A 1HQCA 2EZHA 1R49A 1Z0XA 4M72A 2L7MP 1S5LC 2FOWA 3OOPA 3FWEA 1YFHA 2Z9OA 2WAQN 1UFMA 1L0OC 4I98B 2CV0A 3C3WA 1CF7A 4O5VA 2ZJQF 3MCZA 1QZYA 2DA3A 2QENA 3Q9VA 3KP5A 4EJOA 4WX9A 4M9SA 2BVMA 1LDKB 4HLXA 1U5TC 4CA0A 1IDYA 5CQEA 2XB5A 3CUOA 2KMUA 4PK4A 2PG4A 1DPRA 2JSCA 3OS0A 1LB2A 2CQ7A 1RI7A 2JMWA 2QGUA 3CDLA 3JREA 1SFKA 5GP9A 4E7SA 3HSEA 4UXNA 2K9MA 2FEZA 1OFCX 1SAUA 2FBHA 3S1MJ 3MKZA 4ZYAA 3LWFA 1HSTA 2CQQA 2E60A 2LKPA 4RGUA 1ZLJA 5CLSA 2MBFA 3OYFA 1PUEE 3G6EI 4V2FA 5ILSA 3DTEA 1U3EM 3OL4A 3OR1C 3BZCA 1Y56A 1JKPC 3S1NJ 5DYMA 1TW3A 3T1BA 4XONA 1P7IA 2LK2A 4KUMA 5E18F 2VC0A 3KIOA 4D0PA 2DAOA 5M5WJ 3A01B 2E71A 4LJZF 3F8CA 1RUNA 1WI3A 2BGCA 2XKPA 2JJ7A 3MKLA 2HTSA 3GTKJ 1X2NA 4M74A 5M3FJ 2RV8A 1NK2P 4G94A 4E7ZA 3GFJA 3OYKA 3D5RC 1V3FA 4II3A 3WU2C 2XRLA 5F6FA 3O2PE 3GWZA 5KVRA 1ZN2A 2P81A 1HW5A 3AG1H 4X1EA 5E3OA 3H9GA 4NHJA 3JCUC 5FO5A 2PX9A 2E2HJ 1B8IA 3A03A 2XC7A 1MJ9A 1IRXA 3AG2H 2Y2ZA 1T98A 4MNUA 3TOAA 4BHCA 2DMUA 5ERIA 1QZZA 2LRDA 4C2MJ 3DKYA 4H0EA 2LF7A 3IUOA 1N77A 1HKTA 1TC3C 5F0FA 2ISYA 5B3SH 3GUDA 1BR2A 3KZIC 3LSPA 2R7WA 1TWFJ 2JRMA 2F4OB 3K70D 3GFLA 2DFIA 4RGXA 1SD5A 4EJVA 4DYCA 2BEOA 2K27A 3CQZJ 3R60A 2ZXJA 3SFIA 5HLHA 4M3GA 2WADA 1FY7A 1O4XA 3MWMA 3PNTA 3Q0VA 4KA4A 3ABKH 3HGGA 3F6VA 3FBNB 3TDZC 1S72I 3TO7A 2KDZA 1W36C 1ZTRA 4BU2A 5D8LB 5E17F 3GO5A 3TOBA 2GA2A 5C4JJ 1D1CA 5HNHA 3W2WA 1LJ9A 3E7LA 1XMXA 1P2FA 4J01A 4C30A 2RN7A 3GTGJ 4LLLA 1PDNC 4L18B 2YR2A 2Z3YA 3P9IA 4PSWA 1J7KA 4XKCA 1BIBA 2OTJI 1AKHA 2DBBA 3DPLC 1S9HA 2DN0A 1F5TA 1Z7UA 1JHHA 1HA8A 1B1BA 3HSFA 1A6QA 2FD5A 1Z21A 1BN5A 2RQPA 1X19A 4Y52J 2M45A 2MLKA 4IO9F 4Y4RA 1P9QC 4KNYA 1TT5B 4BNCA 4UNOA 2CGPA 2O7OA 1MZBA 3HKZA 2NNNA 3K1MA 2JUCA 2XRNA 3F9KA 2R5YA 1I39A 2D2WA 2IP2A 5KK1A 1R9TJ 4S0HB 1TQIA 2M30A 4PGGA 1K6OA 1BA5A 1KYWA 1AA7A 1YW9A 2CUZA 2VONA 1G3SA 3FXKA 5LBQA 1GDTA 1R1TA 4DNCA 4LLGF 3TW7A 2FMLA 3OR2C 1Z67A 2MABA 1JKRC 1BBYA 2KISA 2DA1A 1WPKA 1ONVA 3KP7A 3GTJJ 2AXLA 4M9ZA 2V6EA 1XPXA 3HM5A 2CWEA 3ELKA 2QQBA 5DUKA 1KQ0A 1XD7A 5EEAA 4X0GA 4F7ZA 1IC8A 2O8XA 3TW6A 2KIQA 1J2XA 4ZTJA 1HF0A 2FQ3A 3T0YA 2RGVA 4BHPA 5K7FA 3P7NA 3FF5A 2K3PA 2UXNA 3KP2A 4YG2F 1SD6A 3DFGA 3K10A 1BC8C 1WRJA 4HNTA 4G6TB 1T2KA 3C2GA 2EA4A 3DV8A 4L5JA 2JA5J 2Z16A 3ABLH 3ZMVA 3EETA 1YS7A 3BG5A 2YSRA 2IT0A 5E79C 4HV6A 2V1UA 3RPUA 2BY2A 2FMYA 5JI6A 2CRGA 3J81Z 5IT9K 2H94A 1QPIA 1LDDA 2VT2A 5K5OA 5F64A 2R4GA 4IHWA 3QOPA 5L3FA 5KAFC 1IN6A 4NNJA 3DKWA 3P9KA 3IKTA 3L09A 4BE2A 2OQGA 3LFKA 5LHGA 1FOKA 2COBA 1R6RA 3ZQLA 3M07A 2A05A 4AM3A 1YS6A 4XORA 4RS8A 3BR3A 3CCSI 4II2A 2FE3A 4ZTFA 2RAEA 3V7SA 1NG6A 3CMEI 1HDPA 5F1RA 3A02A 5E8IA 4XRSA 3HTUA 2DQRA 1LE8B 4I2OA 2AXTC 2EV0A 2K02A 3REOA 3VPRA 4XKBA 2BY1A 2CW7A 1MMAA 3TP0A 4XKVA 3FXRA 3FXUA 4N0BA 3L2RA 4IF4A 2IRFG 4Y7NJ 3W2AA 2X9DA 3H36A 3QU6A 3ECHA 3I4PA 1R71A 4EGZA 2H27A 3BG3A 3OYLA 1W7PD 4YIIA 1BR4A 2VUMJ 3GZ6A 2V6CA 4S05A 2EV6A 4XKWA 4GCVA 1LNWA 1FPQA 1RC9A 3VOEA 5J4VA 3M1EA 4MFEA 1ZK8A 4RGSA 4I02A 3D5LA 3FKJA 3ZMUA 3IRRA 1Y1WJ 4CDGA 4CCMA 1Z91A 3I58A 3RDIA 2ZSIB 1WGXA 3BG9A 5CPRB 2L7FP 3MAJA 1F9NA 3HZJA 3TMOA 4LIVA 1ZGJA 2DMQA 4HX8A 2HYFA 1ZG1A 5H2FC 5H6QA 2P4WA 4CCJA 3PM1A 3PQJA 4QPOA 4YFKF 3MKWB 3LSTA 1W1WE 4IQ4A 1NHAA 1I6HJ 2ECBA 3NWSA 3L1PA 2H1KA 3E5UA 3M7GA 4E7LA 2R3SA 4IKFA 4KN7X 3CCRI 2KRCA 1VFCA 1OCCH 4NC8A 4YRVA 1P92A 4GYIA 3DEWA 1GXPA 3E5XA 5B1AH 1O3RA 2OCCH 3QOEA 3L2VA 2OJED 4PJJA 1EV7A 2E2JJ 1H0MA 1S8NA 5A2QK 1AU7A 2KKOA 4AYBA 1U78A 2I10A 2X6YA 4EGYA 4LOCA 3PL8A 5FKOA 2VL8A 2XGXA 1N78A 4CHUA 3L2WA 3U2RA 1QVUA 4E6KG 4W1UA 5CVVA 1PP7U 3GCMA 1T39A 2HYJA 2WB1N 4ZZDA 5HDKA 1HCRA 3GTLJ 1FTTA 1VF9A 2IXSA 2K9QA 3FXQA 3JTHA 5CVRA 4AUXA 4CH7A 3AL0B 4BKXA 3SFZA 2EV5A 1JHFA 5F08A 1D0ZA 2VBYA 1SMYF 3CP2A 1TWCJ 5D5XB 4EJTA 3BR0A 4LLNA 4RA2A 2MC3A 3FM5A 3WHCA 1FBQA 2JVHA 3ASNH 1B72A 2HQAA 2M1BA 1IV8A 1E2XA 2M0MA 4HV5A 2FOKA 4EMSA 1BW6A 2YPRA 2P8TA 1XDUA 2Z1DA 4OAYA 5JLXA 1YX5A 2HWVA 4I99C 1JUSA 1UCRA 2BW3B 3S8PA 1GVDA 3OYHA 2EIMH 4BE0A 3TO9A 1FT9A 2M7BA 2OUMA 3FMQA 4B09A 3W6VA 1OISA 3HRTA 1SMTA 1MBJA 3L00A 2LG4A 4ZJZA 4H4KC 1ON2A 2IGKA 3RI4A 2IGMA 2X1DA 2L5QA 2OCEA 5B66C 3OYMA 1K61A 3H3UA 1EF4A 4E7JA 1UG0A 4U0WA 3WG9A 1DU0A 1FIPA 1OYIA 3D5SC 2K5CA 2M0CA 2DYRH 1YRNA 1YQAA 2KQRA 3O3KA 1DU6A 3M8FA 1WHUA 2L2OA 1XSXA 2OAZA 2HOEA 2NOJB 1ZAOA 1VQ7I 4M73A 5L3GA 5CQGA 1JE8A 3J7YJ 4BHBA 1T38A 2Y48A 2JWTA 1NK3P 2MD5A 3FXJA 5E3MA 1U8RA 4B1RA 2LP0A 3H0GJ 4LD5A 2ZXWH 1R23A 4PSXA 1FBSA 2O0YA 3ASOH 3OL3A 2WAQA 3AG4H 2FXAA 4RBOA 2PJRA 2DA5A 4C3HJ 1TWAJ 3DPTA 3K9TA 3QP6A 4CZCA 3E6BA 2R7FA 3HRSA 3HJEA 3WTXC 1Y0NA 1CGPA 2YS9A 4NQWA 1QBJA 2W57A 3W6JB 2X1CA 2LBFB 3ABUA 4IHVA 2ZFUA 1EH8A 4L9VA 2ME6A 2E35A 2ELJA 1OCOH 3R0JA 1MBFA 1QA6A 1N75A 2TRTA 3LAJA 1ITYA 2AQEA 1LKXA 2XAQA 6PAXA 1X1AA 5EZHA 4HYEA 2K40A 4QIWN 3DEEA 4MEYF 2OD5A 3F72A 3TL4X 2VXDA 1ZYRF 4FASD 2KZVA 5K7HA 3O8GA 5HS8A 1J9IA 2LDUA 2DFHA 2IBDA 2CW8A 1E3OC 2IS4A 2R7TA 4MGRA 4Z2YA 3DTKA 3I59A 1YTYA 2CUEA 2NVQJ 2LY9A 2WAFA 3V4GA 1MMNA 5EGOB 3OYNA 3D1NI 1D8KA 3M1CA 2XPVA 2R93J 4RMNA 2UZKA 3Q5FA 3BTIA 5KHDA 3HUGB 1U5TB 2DMPA 2VC1A 1IRZA 3ZPLA 1WVRA 1AWCA 2PJPA 1X3WB 4U88A 4R1HA 3WTVC 3KP4A 2JA8J 1RESA 2VKHA 4UV9A 1DP3A 1GV5A 5DUIA 3DBLB 5IP7J 2YU9J 3KX2A 3T8RA 5J6XA 2QSGX 3BCBA 1O7LA 3ZQHA 3BTCA 2VKDA 4F92B 1Y8QB 1XGNA 2MG4A 3LQRA 1SVMA 4BEHB 5HS7A 5IPAA 5LLQA 5AIPA 4HF2A 3DF8A 4XQFA 1T6SA 2EBIA 5CVIA 1GXQA 1DDNA 2RDPA 3KEOA 3SXYA 1JI8A 3K70C 1RZ4A 1YIOA 4HQMA 5LEJA 2XGDA 2PMZN 1QU3A 4IJAA 2LLKA 2K7LA 4A93J 5TISC 2F48A 1XX5A 1JXSA 3ZMTA 1ZHFA 2IW5A 2KLOA 4OIPF 4ZYHA 4P9UA 1FP2A 3I71A 2DO7A 5IYCJ 4Q47A 3ZQ7A 1LVKA 1OLTA 2QSHX 2A6HF 2WAEA 3CO7C 1EA3A 4Y13A 2WWYA 1BI1A 1Q1VA 3JRDA 2F5VA 3G4SI 2XASA 2VKEA 2E7WA 2DLLA 2W84A 4L9TA 1K78B 3T8TA 3C2BA 4M6YA 2ME0A 2PN6A 3EUAA 2QA4I 4C3IJ 4P9FA 2R7XA 3LA2A 2BE5F 2N8GA 1SFUA 2RREA 5FLXZ 1P7JA 3ZMSA 1YOVB 5BS6A 3JRIA 1W7PA 3UKGA 1DP7P 4A3MJ 2VASA 1Z1DA 3LQQA 5LRRA 4KMFA 3OWTA 5E1XA 2M8EA 5LGNA 3S17J 1MMGA 1HC8A 1HW1A 2JQ7A 4C9YA 2IA0A 3WTYC 2HQ5A 3OYAA 2UWMA 1ETOA 5J1UA 4AWXB 3WTTC 2HVQA 3NWTA 1MKMA 2A6EF 4GGGA 5FFZA 4X6AJ 1ACIA 3FIWA 2NS0A 5DM7F 1T95A 2AQFA 3QODA 1LEAA 4XN3A 1J75A 3QPTA 5E3NA 1ZG3A 5BQTA 5HDGA 1KYZA 3OYDA 4NDLA 1VQMI 2B7EA 5BMZA 5FROA 4HX4A 1CF7B 1ETKA 1WH5A 2IA1A 4LK0F 5ICFA 2XPWA 5J40A 3VDXA 2OTLI 2OZ6A 1U9NA 3CF5F 3MEXA 2O61A 4WCGA 2R92J 5H6RA 4D1QA 2VPLA 3JRAA 4KDPA 4CGZA 2X48A 2E1MC 1P4AA 2EQRA 3BQZA 4ENJA 2OC6A 3W3CA 3BZKA 3S93A 1MJAA 2BHYA 2M4GA 3E97A 3QQAA 4YFXF 1JJ8C 4MIMA 5AONA 2CMPA 3BG6A 2GBYA 1WSUA 1B9NA 3GW2A 2P6SA 2Y31A 2DYSH 2VJ5A 3ROUA 2LY2A 3LSKA 1MD0A 2GXBA 2HGCA 2H6BA 1SAXA 1PVEA 2DXIA 1FIAA 1OYYA 3DP7A 4HAMA 3SZGA 5CKTA 2LC2A 4UVCA 2NXNB 4EM1A 2VIXA 2DDAA 3R0AA 4Q4ZF 3FDYA 5GAEJ 4KYWA 5D4RA 4DZJA 2ELHA 2O5RA 3LA3A 2FQ4A 1MSEC 2HZTA 4DJAA 4A3BJ 2FA5A 3K4KA 4RDUA 1JUPA 3JSPA 1FBUA 4GO1A 1HOMA 3BWGA 4ZYDA 2QQ8A 2GOXB 1PJRA 1RIOH 2A68F 4UUSA 3ZQCA 3VODA 3V8LA 4XLAA 3VSKA 3LNQA 4Y15A 1O7FA 1SVLA 3F6OA 2IGNA 2VBWA 1QHGA 3KP3A 3VYUB 5F27A 4DOZA 2WC2A 3UNGC 2DOEA 3HOTA 4UUSB 2HDDA 2XF6A 4LITA 2CQXA 1B8IB 3HOSA 1A5JA 1IN5A 3NEUA 4HG2A 3KP6A 3RJPA 3DPUA 3AFHA 1ODDA 1XGSA 3H1CA 1VQ5I 4A3GJ 1ZR4A 2H1LA 3OV8A 2CJJA 1IN8A 2ZNYA 3I9V2 1JTXA 4BAYA 5IOYA 4A3KJ 1MIJA 1KU3A 2A07F 3BP8A 5ICGA 1J09A 2UV1A 4HF1A 4WF2A 4OIQF 1UELB 2E36A 3LL7A 2NS7A 2IS6A 4C2TA 5F0CA 3OY9A 4EATA 3U1DA 2KJBA 2OZUA 2HDCA 3F8MA 1LVAA 2EFWA 1XTAA 2ZSHB 1WFXA 3HPGA 3MKYB 4KIFA 5JHFA 4A5NA 2EA2A 1R22A 1ON1A 2VQGA 2ZBKA 2K4BA 4PCQA 4UVBA 1WQ2A 2QKLB 2R7RA 5FD6A 3FXMA 1D0XA 3HHGA 3LFUA 3OMYA 3JRHA 4PJLA 3RKYA 1X4OA 1YW7A 5LGTA 3CDHA 1EKEA 1X1CA 2V26A 1FOXA 2VOOA 3ERMA 1OCRH 1ZLKA 2QBYA 2F4IA 5J4YA 4YIRX 2RVCA 2F5FA 2K9NA 2QZ8A 3CO6C 4RM2A 2HFHA 1AKHB 4CO8A 2MSYA 2LF8A 3FMRA 4IPAA 2EB7A 1LFUP 2M3AA 2KIUA 2ZJRF 3HOZJ 4JBAA 1XS9A 4BBRJ 2DTZA 1B4AA 2O3FA 5IP6A 1XCBA 2L01A 3MZYA 1FZPB 5H20A 3GEZA 4P1WA 5HLTA 3M4OJ 2X6WA 4HPQA 2FUG2 3ZQQA 4J19A 2BVLA 4RLQA 1FNNA 4BE1A 2H8WA 1FMWA 1V55H 3JRBA 2STTA 5TRDA 4D9JA 4HX7A 5ICEA 2R5YB 1XDSA 3MMYB 4WXDA 1DQUA 3RKWA 3SEZA 1TNSA 2FX0A 3HEFA 1YJNI 3JTGA 2HS5A 3E0JB 2QF7A 4CXFA 3SZTA 3K6GA 2WB1A 4XIDA 1MBEA 1IXRC 2MW8A 4EV0A 1Y1VJ 3G1MA 1E17A 5C3EJ 3UR3C 2NVUB 5FGMA 3HL2A 4PGHA 1RKWA 2LSOA 1SANA 1QVTA 1YX3A 3E3VA 4UV8A 1D3YA 1SD7A 4ZZLA 2EZLA 2K9SA 3VSLA 3CCJI 3GX4X 3HYIA 3IP4B 1OYWA 4PFPA 3CC4I 1H88C 3WTWC 4F3QA 1R7JA 2YX7A 2ZCWA 3GVAA 1K4TA 1W5CC 4B3XA 1FX7A 4KIBA 4BQAA 2MLGA 3C7JA 5LGUA 4M9XA 3QPHA 3HGYA 1QPMA 1WH7A 1FC3A 2OQRA 2L02A 1W0TA 2V7FA 4M71A 3K4NA 1X3UA 3J81K 3CUQA 1O3QA 2DT7B 4UB6C 3VFZA 3EUKL 2R7ZJ 2DFEA 5EG0A 2OA4A 1FSEA 2WY7Q 1CQTA 1FLIA 2L9NA 1X1PA 4BY7J 1APLC 4N9IA 3WU1B 1YO5C 1SFEA 2EIJH 2BHZA 5J47A 4KT6A 3CJRB 3WGGA 2R7SA 2NRAC 1STZA 2Y75A 1MDMA 2ZKZA 3RIRA 5EG0B 4N4NB 4L0ZB 1T8IA 1UB9A 3LSJA 3RSNA 3H3ZA 5FKLA 2NAZA 3OYIA 2LKSA 2JPCA 2O8KA 1BR1A 3B02A 3ZMZA 3S2WA 5K1YA 4BUPA 1S29A 2HKXA 3ZQFA 4W97A 4ANJA 1K6YA 3HG9A 3G3ZA 2W4SA 1Z3XA 2X0LA 2XGEA 2GZWA 2KL4A 3KYDB 4G9YA 1GVJA 2M2EA 3ZGKA 4FTHA 2QKMB 3E5QA 1ERDA 1X58A 5E8GA 2EJRA 2Z33A 2QVOA 4IHTA 1MJBA 3BROA 3K69A 3ONQA 4HQEA 2KJCA 3GTPJ 3JAMZ 1B59A 4XN0A 5EEHA 2V9VA 1G3WA 2CFXA 2NS8A 4ZH4F 1R5HA 3Q0UA 1S7AA 1YW8A 3IHUA 3IH2A 4LMYA 2FBIA 1TBXA 4DW6A 4BDZA 2E1NA 3CCQI 2PFBA 3L2CA 3IV5A 3N97A 2KPMA 1Y0UA 1JGSA 1TT0A 4DIQA 1VQLI 4S04A 5HDNA 4ENKA 1YJWI 2VQHA 3HOVJ 4PJNA 2E19A 3CTAA 3QYBA 2ZC2A 2VXZA 3DCFA 4QPQA 1WI9A 2XPUA 3OIQA 5L3DA 3G71I 4G7OF 3E6MA 5LEKA 4A3EJ 4D7MA 3H0DA 5FKNA 5JVGF 1D5YA 1I1GA 5DCFA 3OYGA 4KIGA 3VEPA 4A12A 2EINH 1ETQA 2XKOA 3A0BC 3KYCB 5J1RA 1HKQA 5EYRA 2O9LA 1QNTA 1W0UA 3S3OA 4B8XA 2MD0A 4JQFA 2JA6J 4MEXF 2G7UA 2Y0MA 3CMYA 3VWBA 4FT8A 5EF6A 2P5KA 3NAUA 1LQ1A 1IDZA 3K4CA 3C1DA 5FKKA 1XB4A 1A6IA 2A6TA 1T0FA 2V1NA 2X6XA 2QEXI 4HNVA 4BY1J 2XF5A 1D1AA 3DU6A 3OIPA 3DKXA 3LSGA 5AIQA 2F5CA 4DZPA 4KITB 4WXHA 1MGTA 4NUBA 3NARA 4XMYA 5BNGA 2DPUA 1I1SA 1R1VA 2V79A 2RQQA 2P7CB 1R58A 1SFOJ 3WHBA 4BL0B 1TWGJ 1NG7A 1YLFA 4FE4A 4BDYA 3K4LA 3H3VK 4MFDA 4E70A 5D5VB 1WJBA 3CUQC 4AVZA 4KFCA 2CUJA 3S3MA 3BJOA 1XCVA 1IO2A 1ZH5A 4PZJA 1XC5A 4HSTA 2PMZA 4I0AA 4XLEA 2YX4A 2WV1A 3RYRA 2R7DA 4R79A 1ZRFA 3S14J 2ZFWA 4HDVA 4BJ6C 4NC6A 1OR7A 4KT5C 5GAGJ 1B72B 2FNAA 4RB3C 2DQLA 3ZN1A 2D1HA 1Z9CA 2EPFA 1ZR2A 4EM0B 2GWRA 3H5RA 2IEKA 3DEUA 3RQIA 2BY3A 2HI3A 2FNPA 1TL8A 3GF2A 2CQNA 2Z5UA 4N9HA 5GADJ 4PJMA 5FRMA 4A3JJ 1W5TA 1ZREA 5B1BH 2VODA 2LD5A 1JT6A 3BCAA 1MNMC 1H89C 4QTRA 2Z99A 2C6YA 4AIKA 1IF1A 5EZGA 1S6LA 3JRGA 4UUTA 3VYRB 2JA7J 2G9WA 2DK8A 2NVYJ 4MTDA 4F52A 3H5NA 1UHMA 3H5AA 4Y17A 3J80Z 1BL0A 5JLWA 5IY5H 4DGWB 3IKVA 3CCYA 4ZDLA 2P5VA 1RR7A 1IW7F 4AD9A 1YRNB 3A2KA 3SZPA 1Y8RB 3ISPA 4DYQA 4A0ZA 3FISA 1MBKA 4FHTA 4JX6A 1XMAA 1NH3A 4P55A 1KZHA 2QYOA 5TGTA 3M3YJ 1D5VA 4XBFA 2MC4A 3S32A 1Z77A 1WJEA 4XRSG 2KRHA 5DD4A 4GRIA 3G2BA 1XN7A 4ITVA 3KETA 3FXOA 2DODA 4L0YB 1TP4A 5C44J 2DA6A 3OYBA 3RKQA 2PJRB 3RZDJ 1Q1HA 5EDNA 4IRHA 4AVPA 2X4HA 5HODA 3B6CA 3ZN0A 4A2UA 1DUXC 1UAAA 1P4WA 3QYFA 3TO6A 3S2HJ 2A5WA 2LOOA 2HPMA 2Q2EA 4NQWB 5J8CA 4IXAA 4HF0A 3BJAA 5DS9A 2FBKA 3HTSB 2DT6A 3TQNA 1WCMJ 3S3NA 5D5WB 2L0KA 4CYDA 3MD2A 3RQ4A 1USTA 2STWA 2EK5A 3TP3A 1N25A 5E1WA 1R4NB 2DOFA 2WBMA 3KZYA 5F04A 3BTJA 3BG7A 4XLNF 4AIJA 3Q0WA 3CLOA 5EEGA 4WWCA 4ENMA 1KQ9A 2CQKA 2HR3A 4BBSJ 2CFOA 5BPIA 2KFDA 1T0FC 3MZ8A 4RM3A 4KICA 2QQ9A 2IGOA 2NNYA 4B3AA 5CVJA 1VI0A 3P5JA 4RLFA 4FISA 1OCZH 1PUFA 3CZ6A 2F2EA 1I27A 4F91B 1PP8F 5CYVA 4RAFA 4AIHA 1E0EA 1QO0D 4EQQA 2K85A 1DGRM 3I4NJ 2JUGA 2M8GX 3DLLF 3DXJF 3L2UA 3I59B 5K7ZA 4NBQA 5L3CA 1QGPA 3PIOF 4BGDA 1PUFB 2D1VA 3PFYA 2E1MB 4C2UA 3JRCA 3R61A 4ETSA 4IRIA 2BV6A 4I6ZA 3CLQA 4XR6A 1MMDA 4UY8I 4GXOA 4ZYGA 2JA2A 2Y30A 1U0JA 2MA3A 4BJ5C 1IV6A 1E3PA 1OR7C 1POGA 4AYBN 3K4BA 4L9JA 3JSOA 1VQ4I 2UUZA 3S2DJ 5K5RA 4HRIA 5FLVA 1U8BA 4FCYA 3IC7A 4DBQA 3I55I 2WV0A 2HEOA 2I8DA 2NYXA 4BXUA 4KJZA 2KIFA 3S16J 1FTZA 1VQPI 4JK1X 4IOCF 4ESFA 4XLFA 2BZTA 4A3LJ 1OPCA 2W82A 1MNEA 3GFMA 1XGMA 2P6TA 1VQOI 2R7VA 2GIZA 3LSIA 1KU2A 3HOWJ 1BJAA 1V5EA 1B6AA 1UMQA 1QQIA 1SC7A 2VKVA 2F5EA 4P5OA 4XRMA 1MH4A 2R5ZA 2QLZA 4DYRA 4HDUA 2KZGA 4IX7A 1G4DA 3GTMJ 2CH0A 1JJ6C 3PO2J 4E7HA 1ZG5A 4XRFA 1TQMA 4LB5A 1FP1D 2EILH 2A5YB 3HDDA 4BH9A 2OPTA 4U0YA 1K79A 4CICA 3S1RJ 3H92A 2MYSA 3DU5A 1FWZA 1G3YA 1GV2A 4LK1F 4IEJA 4PDKA 4DQ2A 3GYHX 1TWHJ 2H09A 1FOYA 2B9SA 1WWXA 1XSVA 2K4JA 4G6QA 3BLYA 2V4JC 3EDPA 5ICCA 2XB0X 4NC7A 4AC0A 4F55A 3FHZA 4IHXA 2B63J 2VJ4A 4ZDOA 1F36A 2EIKH 4Q5SF 2XV4S 1XSDA 2KP6A 4FETA 3OSGA 5FLXK 3A4CA 4XSZF 1W5SA 5GPCA 2ZMEA 4XICA 4CYCA 2Y69H 4P96A 4MO7A 4XLCA 1Z7LA 5E3LA 1G59A 4MQ9F 5J3LA 1W7PB 1JKQC 2W48A 2HXOA 3I64A 1WKMA 2HOAA 1G2HA 2BXZA 4B48A 2PEXA 2IAIA 2ESNA 4OU0A 1VNDA 1BI0A 1EH6A 4F93B 3CCMI 1ETXA 3WE3A 4ZDPA 5DDGA 1KQ8A 2JT1A 5IYBJ 5L3EA 4KISA 3HB9A 4HOBA 3TDUC 2V1DA 1J59A 4E7IA 1F4KA 2K9LA 3P9CA 1RUOA 5DCMA 4HZFA 1L3LA 1F43A 3F8FA 2OU2A 2DJNA 3H35A 1AHDP 1RKTA 2VB6A 3DBHB 2EH3A 3HHHA 4M6VA 1P4XA 1Z3YA 3LA7A 4XOPA 4HNUA 3JRFA 2LVSA 2CYYA 1VZ0A 2JRTA 1HKSA 5DCMB 2EFPA 1ZRDA 5D5UB 2R7UA 3FXLA 1RRJA 5JFRA 1FOWA 2F5DA 1O3SA 2HKOA 2P5LC 1F1ZA 2L7KA 4MTEA 4BJTA 3PO3J 2DI3A 3FBIB 3RKXA 4EJUA 3HOUJ 2TDXA 3NQOA 1BJZA 4OOIA 4U7BA 1I50J 2VE9A 4ESBA 3H9JA 4IVNA 4N4OB 2GXGA 2IA2A 3PIPF 3FZVA 3A01A 2DDBA 2DA4A 3FMSA 4RB0A 2AS5F 4XNFA 3G1OA 3Q3SA 4RAZA 1IN7A 1XMKA 4IRGA 2HOTA 1YG2A 3LMMA 1IGNA 1D8JA 3X2QH 2HNHA 1R4MB 4A69C 3CC7I 4ABZA 1JGGA 2PLYA 1HLVA 3C18A 4IL6C 4CCLA 5IOZA 1FMVA 4Z6YA 2ETHA 3VYSB 3U1KA 1BIAA 4XLPF 3WE2A 4HLYA 1LUJB 2ELKA 1WJDA 2X51A 3AAFA 3DQVC 5D8KB 4U87A 5FJ8J 2HZDA 2RKHA 4LG0A 2O03A 2DMTA 2EFNA 3I5UA 3KEYA 1X2MA 3K0LA 4PJ0C 5DEQA 3ZXSA 2W00A 4JP0A 4BQOA 3E6DA 3EQLF 2VLAA 1V5GA 2W85A 4FX0A 3RTRA 4BXFA 1A31A 2PMUA 2GM4A 2M34A 2W1OA 2BXYA 3ZOBA 2EFOA 2M4KA 1JUMA 3QP5A 4LG0B 3GZNB 3IAS2 2Y0SN 2AHQA 3F23A 3M9AA 4MQVA 4RGRA 3PFIA 4XM3A 1RNLA 3PUFA 4OMZA 2ADUA 1SD4A 2YU3A 3ABTA 3V8JA 1Z05A 1I3AA 2HU9A 3BQYA 2RNJA 5HLIA 3BOQA 2E5NA 3BZ6A 1OMIA 3SYTA 2OV7A 2GQQA 3HRMA 1G8XA 2ZMEC 3BPVA 1R00A 2DMNA 3OYJA 1ETWA 5DV5A 3KLNA 1ULYA 2FRHA 4AIDA 1Z6RA 2MH9A 2COMA 2KIMA 1DPUA 3B6AA 5KAIC 5FFXA 4YFNF 3KE2A 1EJ9A 2DT5A 2PMHA 4RB2C 4Y3OA 4G7HF 4KN4X 2K3FA 3EUHA 4QSHA 4I01A 2X85A 3I4MJ 5M5XJ 3PNVA 2BOLA 1J5YA 2ZO4A 3FK7A 1W4MA 3GTOJ 3PUBA 1X1DA 4EJWA 2QBYB 1IG7A 1V54H 3R4KA 3PSFA 4A3DJ 2TCTA 1TW2A 4M3EA 2YUSA 1D1BA 3QAHA 3CDIA 1XG1A 4OINF 5GTIC 3KYLA 2VOPA 2DW4A 2VQLA 3IAM2 2VPRA 1ETYA 3GMEA 1DGWY 3V7RA 3O6BB 5E1ZB 2KRFA 1K7AA 1VQ9I 4LG3A 1FSHA 2XAHA 3PJRA 2XAFA 2E5ZA 1JKOC 4BXXJ 1BI2A 4CCKA 5CVUA 3I56I 1UG2A 3FK6A 2LTPA 3HXLA 2CS3A 2ID3A 2DJIA 5JR3A 3J7AO 3W6KB 9ANTA 2PBIA 3V42A 5F1JA 2JVGA 1YI2I 4WK8F 1O3TA 3OYEA 3DLAA 1YIJI 2KHMA 4XLHA 3WGHA 3GFIA 3RZOJ 2E34A 1E3HA 2DA7A 3V8KA 4B43A 3BDDA 3CF2A 1ETVA 2QUFA 4R8HA 1IXCA 1V5FA 4G6DA 1HXDA 1IRGA 5ILUA 2XSDC 2XVCA 3AG3H 1WJAA 2L4MA 3CJQB 5BPDA 1HW2A 2DCEA 1R1UA 4IOAF 3IWFA 3N05A 4OIRF 5IT3A 3GZ5A 2HXIA 4L9NA 1P6RA 2LKXA 2ZJ2A 1JTYA 3DTIA 1HSJA 3MQ0A 3LSRA 3SEQA 2HQRA 5ED4A 3BR5A 3ERED 3WTZA 1ORKA 4EEFG 3CMAI 5E20A 4IZZA 4HW0A 4M3BA 1V4RA 4HA8A 3IWZA 2IVMA 4UVAA 4BQQA 2V9KA 4PUSA 2CV1A 3BTLA 1TQPA 4C3JJ 2Y9YA 5JVTA 4GYGA 4MHGA 2A69F 5D6FA 4RB1A 4YELA 3I54A 2D45A 4OMYA 1VTNC 4CUGA 5IT9Z 1X1BA 2DPDA 1YITI 2HVSA 2X6OA 4B44A 3SDGA 1WJ5A 3QPSA 2J5OA 2VQCA 3HBLA 3Q9SA 3SQNA 1GLNA 4JX5A 2JPBA 3CUQB 3RCOA 3VYTB 4YEJA 2A61A 1YHQI 2LR8A 2MFZA 1Y39A 3WTUC 2ACJA 1OKRA 2HVRA 5M5YJ 1T33A 2FJ1A 3KEQA 4M3DA 2ZJPF 3L7WA 4IHYA 4V2GA 1IRFA 3IL2A 1MW7A 1LE8A 3GTQJ 1ZRCA 2DFFA 1IJWC 3HOYJ 4CCNA 1MDMB 2GAUA 1LFPA 3FHNA 2XAUA 5K5QA 4UHTA 3EUHC 5FKMA 1S7OA 3U21A 3HSRA 4LIUA 4EVIA 2GIVA 1OQYA 3SHFA 4U0VA 4L5IA 1REPC 3OS2A 3E1SA 3K1PA 1X4PA 1IUYA 1K83J 3IH4A 4XK4A 3EYYA 3F0CA 1U9OA 3HIFA 1IUFA 2E2IJ 1W36D 1LFBA 2OF7A 1VQKI 5J1YA 3JAMK 5D6EA 1JT0A 2DA2A 3PSIA 1D0YA 3IRQA 4FE7A 3F21A 4CSWA 5HNFA 1H8AC 4RAYA 2QM3A 5JHUA 1IXSB 2NVTJ 1KONA 3KCCA 5FRNA 5L3BA 4XOTA 1WZ2A 4CCOA 1R5GA 3DBRB 1OCTC 1KU7A 1A36A 4JX4A 3COAC 1ZARA 1UHSA 4BACA 3K2AA 3MZHA 4BS9A 1MH3A 2WTEA 3OYCA 2GXAA 2JK3A 3F3XA 3ZMDA 2PQ8A 4J00A 5HLGA 1GUUA 4G7ZF 1ZKGA 3WGIA 2XAJA 3JW4A 3R6SA 3JR9A 4BYYA 1OJLA 2I5UA 2HOSA 2R7OA 4ASNA 3CCUI 2IS2A 1I5ZA 1MNDA 3B73A 3HKZN 2V9PA 2MH2A 5DM6F 1J0RA 3G1LA 3L2QA 3G73A 4AU7A 1AOYA 1UJ8A 2CW0F 2ZXHA 2HQNA 2DU9A 2FF4A 1U2WA 3HPHA 1LEBA 2CSOA 1GHCA 2H8RA 3GBGA 5A2QZ 2F6CA 2NVXJ 5FLMJ 2UXXA 2BYVE 4CZZA 1SFXA 2JSPA 2JTVA 5LFAA 2CU7A 3MN2A 3BT9A 4JYKA 4KMUX 3LSHA 2MGQA 3HRUA 1KU9A 3MFKA 3S1QJ 2DK5A 3BY6A 2H6CA 4M3FA 5C4XJ 4U7DA 3TBIA 2ISZA 4TV7A 5F0HA 4HSRA 3CJTB 2XIGA 2E7XA 3W2VA 1BM9A 2P7VB 2HYGD 3ZCOA 5CJ9A 4JOMA 3WODF 3WU0A 4GDFA 2ID6A 1MMSA 2LH9A 3ECOA 2XF7A 2F4MB 5HVQC 2LREA 2W25A 4I09A 3HOXJ 3J7AY 4B4CA 2VN2A 4A3FJ 4OIOF 3OOUA 2ZB9A 2LNBA 2M9HA 2Z2SB 3H9QA 4V19K 1T56A 2Q1ZB 2IPQX 3WTSC 1KGSA 1K4SA 1WJFA 2BW3A 3NRVA 2XGCA 4A6DA 2G0EA 3QRFF 1LPQA 5EJCA 1MSFC 3CC2I 2JN6A 1A04A 1BOBA 2ZNZA 4NB5A 3CJNA 3L9FA 2XUBA 3CCLI 1X3ZB 2IJLA 2XHKA 1KA8A 1B9MA 3HC7A 4XSXF 2E1OA 2DTRA 4HEA2 5KCMA 1TNTA 2L4AA 3CESA 3DWLE 3RPQA 3BC8A 3A1YA 1U6GA 5BOXA 3ZQIA 3ULQB 1FYLA 2QQAA 4LGWA 3FKIJ 3CCEI 4UUVA 5DD8A 1RR8C 2XAGA 1MBGA 3MVPA 2LY1A 3EPZA 3J80K 4E7KA 2Q0OA 3KFWX 3QPLA 1USSA 1IAWA 5FB2A 4PFOA 5D4SA 4A6EA 3K4MA 1ZGWA 3J7ZI 2FSWA 1SEUA 1WJCA 2XDVA 3QYEA 3BR6A 4ESJA 2AO9A 4EM2A 1QRYA 2ESHA 5LHIA 2O6GE 1VQNI 1NTCA 2CV2A 2EWNA 3K1NA 1FYMA 4FX4A 1O57A 1TZLA 1ZQ3P 1Z6TA 2CO5A 3EYIA 1HDDC 1UHWA 2W24A 3C2HA 3KLOA 1UZCA 1PYVA 2GOMA 2LBFA 3WG7H 5LHHA 4I7HA 1RETA 4D5FA 4I0BA 3O8HA 5GAHJ 1VQ8I 3LOCA 2CUFA 3ZP5A 2M87A 2QWWA 3S15J 3K4JA 1IZ1A 3F8NA 4A5MA 2G7HA 2GA1A 2PI0A 2P0WA 4O3MA 2Q2EB 1R5ID 1TTYA 2R7QA 3PNYA 3D0SA 1I3QJ 5IYDJ 4A0XA 1RPWA 3OS1A 2VBZA 1H9GA 2VT3A 2Q8KA 1IN4A 2L54A 1C0WA 2IS1A 2VJJA 4ZYEA 3FX3A 2WY8Q 1LDJA 1I6XA 1GT0C 3ML6A 2W7NA 2XSJC 2BBYA 5EGOA 3IH3A 4IQJA 3M8JA 4LFUA 3AL0C 3CD6I 2L3DA 3HUGA 1U5TA 2HPIA
chains in the Genus database with same CATH topology
2X6YA 3PL8A 2VL8A 3CP8A 3UR3C 1N78A 1QHHD 4U7BA 3L2WA 3HL2A 4E6KG 3H9JA 5LD2C 3AKZA 4DBRA 4N4OB 1YX3A 3CMMA 2IXSA 4XNFA 3VSLA 4CH7A 2HDWA 4ZC3A 5KNLA 3AL0B 3LMMA 3SDBA 3IP4B 4PFPA 4MLOA 2HNHA 4BEHA 1D0ZA 4F3QA 3CP2A 4B3XA 2KDOA 4CCLA 1FMVA 3VYSB 2LYCA 2JVHA 3ZR8X 2HQAA 1WJDA 2X51A 2M0MA 3DQVC 3RPUD 4U87A 2HZDA 2V7FA 3ZRGA 2Y0SA 2VJIA 3K4NA 3ZXSA 3KEYA 4B47A 2Z1DA 2W00A 4OAYA 1YX5A 4BQOA 2DT7B 1Y6IA 3I3LA 2VLAA 1V5GA 3S8PA 2BW3B 4BE0A 3OYHA 2M7AA 3RTRA 4BXFA 2M7BA 2OUMA 3EUKL 2RNGA 2W1OA 2WY7Q 2M4KA 2L9NA 3IAS2 4Y33A 2LG4A 4ZJZA 4H4KC 4XM3A 4KT6A 3CJRB 2IGKA 2R7SA 2IGMA 2X1DA 2L5QA 3OYMA 2HU9A 4OWRB 4N4NB 4E7JA 1UG0A 3RSNA 2E5NA 3D5SC 3OYIA 3SYTA 2K5CA 2OV7A 1BR1A 1G8XA 2KQRA 2DOAA 4BUPA 3LSMA 2L2OA 2X1EA 4OAZA 4BQNA 3OYJA 4ANJA 1K6YA 3HG9A 1YE9A 2NOJB 4E4HA 5CQGA 2W4SA 1Z3XA 2KL4A 2L9SA 3ZGKA 2QKMB 4PSXA 1ERDA 1ZELA 2ZXIA 4Y3OA 3OL3A 3ONQA 2WAQA 2PJRA 2X85A 4XN0A 3PNVA 3DPTA 2BOLA 4CZCA 3PUBA 4XL9A 5HOOA 2WA0A 1X1DA 4BDZA 2KPMA 2X1CA 3PSFA 2LBFB 1TT0A 1D1BA 4DIQA 3KYLA 2ZFUA 2CV0A 2VQLA 2VQHA 4PJNA 2ELJA 3QYBA 2VXZA 3IAM2 4QPQA 3OIQA 1DGWY 1N75A 4LG3A 2AQEA 2BVMA 1LDKB 3PJRA 1LKXA 3H0DA 2E5ZA 1X1AA 3OYGA 4CCKA 3DEEA 4CA0A 3HXLA 5CQEA 3TL4X 2CS3A 2VXDA 2DJIA 2KMUA 4PK4A 4FASD 3V42A 2KZVA 3OS0A 2JVGA 3OYEA 3S3OA 3DLAA 1SFKA 2KHMA 2MD0A 4XLHA 4JQFA 2CW8A 4E7SA 3VWBA 2K9MA 2IS4A 2R7TA 4B43A 3DTKA 1SAUA 3K4CA 3MKZA 3CF2A 4ZYAA 2WAFA 3OYNA 1MMNA 1V5FA 2A6TA 3M1CA 2E60A 2V1NA 2X6XA 4RMNA 2XF5A 1D1AA 3DU6A 3OIPA 1WJAA 3DKXA 5KHDA 3OYFA 3HUGB 3CJQB 3LSGA 2DCEA 4KITB 3N05A 3DTEA 3OL4A 3OR1C 4NUBA 1Y56A 4XMYA 2VKHA 2RQQA 4XONA 1DP3A 3DTIA 3SEQA 4BL0B 1NG7A 3KX2A 4BDYA 4IZZA 3K4LA 3BCBA 1WJBA 2VKDA 4F92B 4AVZA 2CUJA 4BQQA 2V9KA 3S3MA 4PUSA 2CV1A 4E7ZA 3OYKA 3D5RC 4HSTA 4BEHB 4II3A 2PMZA 4XLEA 4YELA 4XQFA 3H9GA 4R79A 4CUGA 1X1BA 4BJ6C 2HVSA 4B44A 2XC7A 1IRXA 1WJ5A 1JI8A 2VQCA 3K70C 1GLNA 2LRDA 3DKYA 3H5RA 1QU3A 3IUOA 1N77A 3RCOA 3VYTB 4YEJA 2MFZA 4PJMA 2KLOA 1BR2A 2R7WA 5FRMA 2HVRA 3BCAA 3K70D 1LVKA 1OLTA 2WAEA 1EA3A 3VYRB 1MW7A 2WADA 2F5VA 4F52A 3H5NA 3H5AA 3PNTA 4CCNA 1LFPA 3FBNB 3FHNA 4DGWB 2XAUA 4ZDLA 3EUHC 3U21A 3EUAA 4LIUA 4BU2A 1W36C 2R7XA 3A2KA 3OS2A 1D1CA 5HNHA 2RREA 3E1SA 3W2WA 1X4PA 4J01A 4C30A 5TGTA 2MC4A 3S32A 2VASA 1WJEA 1W36D 2KRHA 4GRIA 3G2BA 3OWTA 4ITVA 4PSWA 4XKCA 1MMGA 4C9YA 3DPLC 3OYAA 3PSIA 1D0YA 2UWMA 1S9HA 3OYBA 2PJRB 1HA8A 4CSWA 5HNFA 2HVQA 3NWTA 1Z21A 1UAAA 1X19A 1KONA 1T95A 2AQFA 3QODA 3QYFA 4XN3A 1P9QC 2A5WA 2LOOA 4XOTA 4Y4RA 4NQWB 2HPMA 4CCOA 3OYDA 3HKZA 2DT6A 3S3NA 4BACA 5FROA 4BS9A 3OYCA 3F9KA 3MD2A 3RQ4A 3VDXA 4J00A 2WBMA 3BG7A 1AA7A 4D1QA 2VPLA 2CUZA 2CFOA 2R7OA 2IS2A 1MNDA 1T0FC 2E1MC 4RM3A 2IGOA 2OC6A 3W3CA 3S93A 3L2QA 4RLFA 4AU7A 2M4GA 2ZXHA 3OR2C 2MABA 3CZ6A 3HPHA 4F91B 2CMPA 3BG6A 3GBGA 2V6EA 2F6CA 1E0EA 1DGRM 2JUGA 3L2UA 5FRNA 2JSPA 2VJ5A 5LFAA 2LY2A 3LSKA 3LSHA 2DXIA 4BGDA 3PFYA 2E1MB 4X0GA 3SZGA 4C2UA 5CKTA 2LC2A 3TBIA 4ZTJA 4HSRA 2VIXA 4XR6A 3FDYA 3W2VA 1MMDA 2K3PA 3ZCOA 4JOMA 2JA2A 4BJ5C 1U0JA 2O5RA 1OR7C 3K4BA 4DJAA 2LH9A 2UUZA 3K10A 4HRIA 3K4KA 4HNTA 4G6TB 2XF7A 5HVQC 3C2GA 2LREA 4DBQA 3J7AY 2GOXB 1PJRA 2I8DA 2Z16A 3OOUA 4KJZA 4XLAA 3VSKA 2Z2SB 3H9QA 2IGNA 1QHGA 4XLFA 3VYUB 2Q1ZB 4DOZA 2W82A 1MNEA 1WJFA 2BW3A 3UNGC 2R7VA 3LSIA 3HOTA 1V5EA 2XF6A 4LITA 3HOSA 2R4GA 4HG2A 4P5OA 1BOBA 3DPUA 3AFHA 4NNJA 4IX7A 4BE2A 2CH0A 4E7HA 3HC7A 3I9V2 4HEA2 5KCMA 3CESA 3DWLE 1R6RA 3BC8A 1J09A 3A1YA 2UV1A 2MYSA 3DU5A 1UELB 4XORA 3LL7A 4ZTFA 4II2A 2IS6A 4C2TA 3OY9A 1NG6A 4EATA 2LY1A 3EPZA 4E7KA 3BLYA 2V4JC 4XKBA 2ZSHB 4NC7A 1WFXA 3HPGA 2CW7A 1MMAA 4PFOA 4F55A 3MKYB 4XKVA 5JHFA 3K4MA 3L2RA 2VQGA 2VJ4A 4ZDOA 1WJCA 3W2AA 2QKLB 2XDVA 2R7RA 2KP6A 3QYEA 4FETA 3A4CA 3LFUA 1D0XA 3OMYA 3OYLA 4PJLA 1X4OA 2CV2A 1BR4A 4XLCA 1X1CA 1Z7LA 2V26A 1G59A 1TZLA 4XKWA 2F4IA 3C2HA 2LBFA 1PYVA 2GOMA 4RM2A 4B48A 3D5LA 3FKJA 2M3AA 4CCMA 4F93B 4ZDPA 2ZSIB 3K4JA 5CPRB 4KISA 3TMOA 4LIVA 4P1WA 5HLTA 2P0WA 2X6WA 4HPQA 2FUG2 4E7IA 2K9LA 2Q2EB 3PNYA 2R7QA 3ZQQA 4CCJA 4QPOA 3MKWB 2BVLA 4RLQA 4IQ4A 4BE1A 3NWSA 1FMWA 3OS1A 4E7LA 4IKFA 4D9JA 3H35A 2KRCA 2VB6A 3MMYB 4NC8A 1DQUA 1Z3YA 4YRVA 3SEZA 2IS1A 2VJJA 4XOPA 4HNUA 2WY8Q 1VZ0A 3E0JB 2W7NA 2XSJC 3QOEA 3L2VA 2R7UA 4PJJA 4IQJA 3K6GA 3M8JA 2WB1A 3AL0C 2L7KA 4BJTA 4AYBA 3FBIB 2HPIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HRI A;  4J00 A;  3QOD A;  4YRV A;  4IZZ A;  3QOE A;  4J01 A; 
#chains in the Genus database with same CATH topology
 2J5P A;  2FU4 A;  2M5W A;  2VBX A;  3ESW B;  3CP8 A;  2XRO A;  3I53 A;  1QHH D;  4O6J A;  1G3T A;  3F22 A;  5LD2 C;  3I0T A;  2V1X A;  3AKZ A;  5M3M J;  2L7Z A;  3BR2 A;  3N4M A;  4DBR A;  1FYK A;  2LFB A;  2EZK A;  1M1E B;  3CMM A;  1ENH A;  4L5E A;  3ABM H;  2OBP A;  2VE8 A;  2KT0 A;  2JZY A;  3U9G A;  2VI6 A;  4Q48 A;  5HS9 A;  2HDW A;  3QWL A;  1FEX A;  4ZC3 A;  4D5C A;  5KNL A;  3V7C A;  3K2Z A;  1H9T A;  3SDB A;  4MLO A;  2Y9Z A;  4BEH A;  3ZQG A;  4HBL A;  3VB2 A;  3QU3 A;  4YIF A;  4I76 A;  2KDO A;  2EFQ A;  1QZE A;  3GLX A;  1FJL A;  4A3C J;  2LYC A;  1YJ9 I;  3ZR8 X;  3TGN A;  1SVO A;  3GLL A;  5GPA A;  4M6X A;  1A35 A;  3RPU D;  3TKY A;  3ZRG A;  2Y0S A;  2VJI A;  1G6N A;  4FQG A;  1BOA A;  5FD5 A;  2BY0 A;  4B47 A;  4G12 A;  3BPX A;  3BJ6 A;  3K7A J;  1BI3 A;  1EH7 A;  1Y6I A;  3I3L A;  3T5X A;  3SJM A;  4A3I J;  2M7A A;  3KZZ A;  2RNG A;  1VQ6 I;  2B0L A;  5TJJ A;  1BC7 C;  3M8E A;  2HTJ A;  1XGO A;  4Y33 A;  3TED A;  2EZI A;  3E6C C;  2QSF X;  2L9R A;  2R5Z B;  4UB8 C;  4ON0 A;  5IP9 J;  4QLC U;  4RAG A;  4GFB A;  2R0Q C;  3RYP A;  4OWR B;  1T08 B;  1K78 A;  2K86 A;  3A0H C;  2CG4 A;  3OIO A;  5J8F A;  3CCV I;  1HBX G;  5LRS A;  2DOA A;  5DTD A;  5ILV A;  3BR1 A;  3LSM A;  1BW5 A;  2X1E A;  4OAZ A;  4BQN A;  1TLH B;  2NOG A;  3KPH A;  1OCP A;  1YE9 A;  4IHS A;  4E4H A;  4QWQ A;  3GXO A;  2A3S A;  2E1C A;  1MBH A;  4K2E A;  1S7E A;  2RC4 A;  3LAP A;  4A0Y A;  2L9S A;  5GTH C;  2L9V A;  1ZEL A;  2QCO A;  3PQK A;  4ENN A;  4LB6 B;  2ZXI A;  4WXC A;  3FM3 A;  4D7N A;  1S3J A;  5B5E C;  2ZME B;  1YYV A;  2ICW G;  4CYC B;  1ZGA A;  2LMD A;  4G8X A;  3F8B A;  2ECC A;  2GLO A;  1R36 A;  2D5V A;  4XL9 A;  3OSF A;  5HOO A;  2WA0 A;  1HQC A;  2EZH A;  1R49 A;  1Z0X A;  4M72 A;  2L7M P;  1S5L C;  2FOW A;  3OOP A;  3FWE A;  1YFH A;  2Z9O A;  2WAQ N;  1UFM A;  1L0O C;  4I98 B;  2CV0 A;  3C3W A;  1CF7 A;  4O5V A;  2ZJQ F;  3MCZ A;  1QZY A;  2DA3 A;  2QEN A;  3Q9V A;  3KP5 A;  4EJO A;  4WX9 A;  4M9S A;  2BVM A;  1LDK B;  4HLX A;  1U5T C;  4CA0 A;  1IDY A;  5CQE A;  2XB5 A;  3CUO A;  2KMU A;  4PK4 A;  2PG4 A;  1DPR A;  2JSC A;  3OS0 A;  1LB2 A;  2CQ7 A;  1RI7 A;  2JMW A;  2QGU A;  3CDL A;  3JRE A;  1SFK A;  5GP9 A;  4E7S A;  3HSE A;  4UXN A;  2K9M A;  2FEZ A;  1OFC X;  1SAU A;  2FBH A;  3S1M J;  3MKZ A;  4ZYA A;  3LWF A;  1HST A;  2CQQ A;  2E60 A;  2LKP A;  4RGU A;  1ZLJ A;  5CLS A;  2MBF A;  3OYF A;  1PUE E;  3G6E I;  4V2F A;  5ILS A;  3DTE A;  1U3E M;  3OL4 A;  3OR1 C;  3BZC A;  1Y56 A;  1JKP C;  3S1N J;  5DYM A;  1TW3 A;  3T1B A;  4XON A;  1P7I A;  2LK2 A;  4KUM A;  5E18 F;  2VC0 A;  3KIO A;  4D0P A;  2DAO A;  5M5W J;  3A01 B;  2E71 A;  4LJZ F;  3F8C A;  1RUN A;  1WI3 A;  2BGC A;  2XKP A;  2JJ7 A;  3MKL A;  2HTS A;  3GTK J;  1X2N A;  4M74 A;  5M3F J;  2RV8 A;  1NK2 P;  4G94 A;  4E7Z A;  3GFJ A;  3OYK A;  3D5R C;  1V3F A;  4II3 A;  3WU2 C;  2XRL A;  5F6F A;  3O2P E;  3GWZ A;  5KVR A;  1ZN2 A;  2P81 A;  1HW5 A;  3AG1 H;  4X1E A;  5E3O A;  3H9G A;  4NHJ A;  3JCU C;  5FO5 A;  2PX9 A;  2E2H J;  1B8I A;  3A03 A;  2XC7 A;  1MJ9 A;  1IRX A;  3AG2 H;  2Y2Z A;  1T98 A;  4MNU A;  3TOA A;  4BHC A;  2DMU A;  5ERI A;  1QZZ A;  2LRD A;  4C2M J;  3DKY A;  4H0E A;  2LF7 A;  3IUO A;  1N77 A;  1HKT A;  1TC3 C;  5F0F A;  2ISY A;  5B3S H;  3GUD A;  1BR2 A;  3KZI C;  3LSP A;  2R7W A;  1TWF J;  2JRM A;  2F4O B;  3K70 D;  3GFL A;  2DFI A;  4RGX A;  1SD5 A;  4EJV A;  4DYC A;  2BEO A;  2K27 A;  3CQZ J;  3R60 A;  2ZXJ A;  3SFI A;  5HLH A;  4M3G A;  2WAD A;  1FY7 A;  1O4X A;  3MWM A;  3PNT A;  3Q0V A;  4KA4 A;  3ABK H;  3HGG A;  3F6V A;  3FBN B;  3TDZ C;  1S72 I;  3TO7 A;  2KDZ A;  1W36 C;  1ZTR A;  4BU2 A;  5D8L B;  5E17 F;  3GO5 A;  3TOB A;  2GA2 A;  5C4J J;  1D1C A;  5HNH A;  3W2W A;  1LJ9 A;  3E7L A;  1XMX A;  1P2F A;  4J01 A;  4C30 A;  2RN7 A;  3GTG J;  4LLL A;  1PDN C;  4L18 B;  2YR2 A;  2Z3Y A;  3P9I A;  4PSW A;  1J7K A;  4XKC A;  1BIB A;  2OTJ I;  1AKH A;  2DBB A;  3DPL C;  1S9H A;  2DN0 A;  1F5T A;  1Z7U A;  1JHH A;  1HA8 A;  1B1B A;  3HSF A;  1A6Q A;  2FD5 A;  1Z21 A;  1BN5 A;  2RQP A;  1X19 A;  4Y52 J;  2M45 A;  2MLK A;  4IO9 F;  4Y4R A;  1P9Q C;  4KNY A;  1TT5 B;  4BNC A;  4UNO A;  2CGP A;  2O7O A;  1MZB A;  3HKZ A;  2NNN A;  3K1M A;  2JUC A;  2XRN A;  3F9K A;  2R5Y A;  1I39 A;  2D2W A;  2IP2 A;  5KK1 A;  1R9T J;  4S0H B;  1TQI A;  2M30 A;  4PGG A;  1K6O A;  1BA5 A;  1KYW A;  1AA7 A;  1YW9 A;  2CUZ A;  2VON A;  1G3S A;  3FXK A;  5LBQ A;  1GDT A;  1R1T A;  4DNC A;  4LLG F;  3TW7 A;  2FML A;  3OR2 C;  1Z67 A;  2MAB A;  1JKR C;  1BBY A;  2KIS A;  2DA1 A;  1WPK A;  1ONV A;  3KP7 A;  3GTJ J;  2AXL A;  4M9Z A;  2V6E A;  1XPX A;  3HM5 A;  2CWE A;  3ELK A;  2QQB A;  5DUK A;  1KQ0 A;  1XD7 A;  5EEA A;  4X0G A;  4F7Z A;  1IC8 A;  2O8X A;  3TW6 A;  2KIQ A;  1J2X A;  4ZTJ A;  1HF0 A;  2FQ3 A;  3T0Y A;  2RGV A;  4BHP A;  5K7F A;  3P7N A;  3FF5 A;  2K3P A;  2UXN A;  3KP2 A;  4YG2 F;  1SD6 A;  3DFG A;  3K10 A;  1BC8 C;  1WRJ A;  4HNT A;  4G6T B;  1T2K A;  3C2G A;  2EA4 A;  3DV8 A;  4L5J A;  2JA5 J;  2Z16 A;  3ABL H;  3ZMV A;  3EET A;  1YS7 A;  3BG5 A;  2YSR A;  2IT0 A;  5E79 C;  4HV6 A;  2V1U A;  3RPU A;  2BY2 A;  2FMY A;  5JI6 A;  2CRG A;  3J81 Z;  5IT9 K;  2H94 A;  1QPI A;  1LDD A;  2VT2 A;  5K5O A;  5F64 A;  2R4G A;  4IHW A;  3QOP A;  5L3F A;  5KAF C;  1IN6 A;  4NNJ A;  3DKW A;  3P9K A;  3IKT A;  3L09 A;  4BE2 A;  2OQG A;  3LFK A;  5LHG A;  1FOK A;  2COB A;  1R6R A;  3ZQL A;  3M07 A;  2A05 A;  4AM3 A;  1YS6 A;  4XOR A;  4RS8 A;  3BR3 A;  3CCS I;  4II2 A;  2FE3 A;  4ZTF A;  2RAE A;  3V7S A;  1NG6 A;  3CME I;  1HDP A;  5F1R A;  3A02 A;  5E8I A;  4XRS A;  3HTU A;  2DQR A;  1LE8 B;  4I2O A;  2AXT C;  2EV0 A;  2K02 A;  3REO A;  3VPR A;  4XKB A;  2BY1 A;  2CW7 A;  1MMA A;  3TP0 A;  4XKV A;  3FXR A;  3FXU A;  4N0B A;  3L2R A;  4IF4 A;  2IRF G;  4Y7N J;  3W2A A;  2X9D A;  3H36 A;  3QU6 A;  3ECH A;  3I4P A;  1R71 A;  4EGZ A;  2H27 A;  3BG3 A;  3OYL A;  1W7P D;  4YII A;  1BR4 A;  2VUM J;  3GZ6 A;  2V6C A;  4S05 A;  2EV6 A;  4XKW A;  4GCV A;  1LNW A;  1FPQ A;  1RC9 A;  3VOE A;  5J4V A;  3M1E A;  4MFE A;  1ZK8 A;  4RGS A;  4I02 A;  3D5L A;  3FKJ A;  3ZMU A;  3IRR A;  1Y1W J;  4CDG A;  4CCM A;  1Z91 A;  3I58 A;  3RDI A;  2ZSI B;  1WGX A;  3BG9 A;  5CPR B;  2L7F P;  3MAJ A;  1F9N A;  3HZJ A;  3TMO A;  4LIV A;  1ZGJ A;  2DMQ A;  4HX8 A;  2HYF A;  1ZG1 A;  5H2F C;  5H6Q A;  2P4W A;  4CCJ A;  3PM1 A;  3PQJ A;  4QPO A;  4YFK F;  3MKW B;  3LST A;  1W1W E;  4IQ4 A;  1NHA A;  1I6H J;  2ECB A;  3NWS A;  3L1P A;  2H1K A;  3E5U A;  3M7G A;  4E7L A;  2R3S A;  4IKF A;  4KN7 X;  3CCR I;  2KRC A;  1VFC A;  1OCC H;  4NC8 A;  4YRV A;  1P92 A;  4GYI A;  3DEW A;  1GXP A;  3E5X A;  5B1A H;  1O3R A;  2OCC H;  3QOE A;  3L2V A;  2OJE D;  4PJJ A;  1EV7 A;  2E2J J;  1H0M A;  1S8N A;  5A2Q K;  1AU7 A;  2KKO A;  4AYB A;  1U78 A;  2I10 A;  2X6Y A;  4EGY A;  4LOC A;  3PL8 A;  5FKO A;  2VL8 A;  2XGX A;  1N78 A;  4CHU A;  3L2W A;  3U2R A;  1QVU A;  4E6K G;  4W1U A;  5CVV A;  1PP7 U;  3GCM A;  1T39 A;  2HYJ A;  2WB1 N;  4ZZD A;  5HDK A;  1HCR A;  3GTL J;  1FTT A;  1VF9 A;  2IXS A;  2K9Q A;  3FXQ A;  3JTH A;  5CVR A;  4AUX A;  4CH7 A;  3AL0 B;  4BKX A;  3SFZ A;  2EV5 A;  1JHF A;  5F08 A;  1D0Z A;  2VBY A;  1SMY F;  3CP2 A;  1TWC J;  5D5X B;  4EJT A;  3BR0 A;  4LLN A;  4RA2 A;  2MC3 A;  3FM5 A;  3WHC A;  1FBQ A;  2JVH A;  3ASN H;  1B72 A;  2HQA A;  2M1B A;  1IV8 A;  1E2X A;  2M0M A;  4HV5 A;  2FOK A;  4EMS A;  1BW6 A;  2YPR A;  2P8T A;  1XDU A;  2Z1D A;  4OAY A;  5JLX A;  1YX5 A;  2HWV A;  4I99 C;  1JUS A;  1UCR A;  2BW3 B;  3S8P A;  1GVD A;  3OYH A;  2EIM H;  4BE0 A;  3TO9 A;  1FT9 A;  2M7B A;  2OUM A;  3FMQ A;  4B09 A;  3W6V A;  1OIS A;  3HRT A;  1SMT A;  1MBJ A;  3L00 A;  2LG4 A;  4ZJZ A;  4H4K C;  1ON2 A;  2IGK A;  3RI4 A;  2IGM A;  2X1D A;  2L5Q A;  2OCE A;  5B66 C;  3OYM A;  1K61 A;  3H3U A;  1EF4 A;  4E7J A;  1UG0 A;  4U0W A;  3WG9 A;  1DU0 A;  1FIP A;  1OYI A;  3D5S C;  2K5C A;  2M0C A;  2DYR H;  1YRN A;  1YQA A;  2KQR A;  3O3K A;  1DU6 A;  3M8F A;  1WHU A;  2L2O A;  1XSX A;  2OAZ A;  2HOE A;  2NOJ B;  1ZAO A;  1VQ7 I;  4M73 A;  5L3G A;  5CQG A;  1JE8 A;  3J7Y J;  4BHB A;  1T38 A;  2Y48 A;  2JWT A;  1NK3 P;  2MD5 A;  3FXJ A;  5E3M A;  1U8R A;  4B1R A;  2LP0 A;  3H0G J;  4LD5 A;  2ZXW H;  1R23 A;  4PSX A;  1FBS A;  2O0Y A;  3ASO H;  3OL3 A;  2WAQ A;  3AG4 H;  2FXA A;  4RBO A;  2PJR A;  2DA5 A;  4C3H J;  1TWA J;  3DPT A;  3K9T A;  3QP6 A;  4CZC A;  3E6B A;  2R7F A;  3HRS A;  3HJE A;  3WTX C;  1Y0N A;  1CGP A;  2YS9 A;  4NQW A;  1QBJ A;  2W57 A;  3W6J B;  2X1C A;  2LBF B;  3ABU A;  4IHV A;  2ZFU A;  1EH8 A;  4L9V A;  2ME6 A;  2E35 A;  2ELJ A;  1OCO H;  3R0J A;  1MBF A;  1QA6 A;  1N75 A;  2TRT A;  3LAJ A;  1ITY A;  2AQE A;  1LKX A;  2XAQ A;  6PAX A;  1X1A A;  5EZH A;  4HYE A;  2K40 A;  4QIW N;  3DEE A;  4MEY F;  2OD5 A;  3F72 A;  3TL4 X;  2VXD A;  1ZYR F;  4FAS D;  2KZV A;  5K7H A;  3O8G A;  5HS8 A;  1J9I A;  2LDU A;  2DFH A;  2IBD A;  2CW8 A;  1E3O C;  2IS4 A;  2R7T A;  4MGR A;  4Z2Y A;  3DTK A;  3I59 A;  1YTY A;  2CUE A;  2NVQ J;  2LY9 A;  2WAF A;  3V4G A;  1MMN A;  5EGO B;  3OYN A;  3D1N I;  1D8K A;  3M1C A;  2XPV A;  2R93 J;  4RMN A;  2UZK A;  3Q5F A;  3BTI A;  5KHD A;  3HUG B;  1U5T B;  2DMP A;  2VC1 A;  1IRZ A;  3ZPL A;  1WVR A;  1AWC A;  2PJP A;  1X3W B;  4U88 A;  4R1H A;  3WTV C;  3KP4 A;  2JA8 J;  1RES A;  2VKH A;  4UV9 A;  1DP3 A;  1GV5 A;  5DUI A;  3DBL B;  5IP7 J;  2YU9 J;  3KX2 A;  3T8R A;  5J6X A;  2QSG X;  3BCB A;  1O7L A;  3ZQH A;  3BTC A;  2VKD A;  4F92 B;  1Y8Q B;  1XGN A;  2MG4 A;  3LQR A;  1SVM A;  4BEH B;  5HS7 A;  5IPA A;  5LLQ A;  5AIP A;  4HF2 A;  3DF8 A;  4XQF A;  1T6S A;  2EBI A;  5CVI A;  1GXQ A;  1DDN A;  2RDP A;  3KEO A;  3SXY A;  1JI8 A;  3K70 C;  1RZ4 A;  1YIO A;  4HQM A;  5LEJ A;  2XGD A;  2PMZ N;  1QU3 A;  4IJA A;  2LLK A;  2K7L A;  4A93 J;  5TIS C;  2F48 A;  1XX5 A;  1JXS A;  3ZMT A;  1ZHF A;  2IW5 A;  2KLO A;  4OIP F;  4ZYH A;  4P9U A;  1FP2 A;  3I71 A;  2DO7 A;  5IYC J;  4Q47 A;  3ZQ7 A;  1LVK A;  1OLT A;  2QSH X;  2A6H F;  2WAE A;  3CO7 C;  1EA3 A;  4Y13 A;  2WWY A;  1BI1 A;  1Q1V A;  3JRD A;  2F5V A;  3G4S I;  2XAS A;  2VKE A;  2E7W A;  2DLL A;  2W84 A;  4L9T A;  1K78 B;  3T8T A;  3C2B A;  4M6Y A;  2ME0 A;  2PN6 A;  3EUA A;  2QA4 I;  4C3I J;  4P9F A;  2R7X A;  3LA2 A;  2BE5 F;  2N8G A;  1SFU A;  2RRE A;  5FLX Z;  1P7J A;  3ZMS A;  1YOV B;  5BS6 A;  3JRI A;  1W7P A;  3UKG A;  1DP7 P;  4A3M J;  2VAS A;  1Z1D A;  3LQQ A;  5LRR A;  4KMF A;  3OWT A;  5E1X A;  2M8E A;  5LGN A;  3S17 J;  1MMG A;  1HC8 A;  1HW1 A;  2JQ7 A;  4C9Y A;  2IA0 A;  3WTY C;  2HQ5 A;  3OYA A;  2UWM A;  1ETO A;  5J1U A;  4AWX B;  3WTT C;  2HVQ A;  3NWT A;  1MKM A;  2A6E F;  4GGG A;  5FFZ A;  4X6A J;  1ACI A;  3FIW A;  2NS0 A;  5DM7 F;  1T95 A;  2AQF A;  3QOD A;  1LEA A;  4XN3 A;  1J75 A;  3QPT A;  5E3N A;  1ZG3 A;  5BQT A;  5HDG A;  1KYZ A;  3OYD A;  4NDL A;  1VQM I;  2B7E A;  5BMZ A;  5FRO A;  4HX4 A;  1CF7 B;  1ETK A;  1WH5 A;  2IA1 A;  4LK0 F;  5ICF A;  2XPW A;  5J40 A;  3VDX A;  2OTL I;  2OZ6 A;  1U9N A;  3CF5 F;  3MEX A;  2O61 A;  4WCG A;  2R92 J;  5H6R A;  4D1Q A;  2VPL A;  3JRA A;  4KDP A;  4CGZ A;  2X48 A;  2E1M C;  1P4A A;  2EQR A;  3BQZ A;  4ENJ A;  2OC6 A;  3W3C A;  3BZK A;  3S93 A;  1MJA A;  2BHY A;  2M4G A;  3E97 A;  3QQA A;  4YFX F;  1JJ8 C;  4MIM A;  5AON A;  2CMP A;  3BG6 A;  2GBY A;  1WSU A;  1B9N A;  3GW2 A;  2P6S A;  2Y31 A;  2DYS H;  2VJ5 A;  3ROU A;  2LY2 A;  3LSK A;  1MD0 A;  2GXB A;  2HGC A;  2H6B A;  1SAX A;  1PVE A;  2DXI A;  1FIA A;  1OYY A;  3DP7 A;  4HAM A;  3SZG A;  5CKT A;  2LC2 A;  4UVC A;  2NXN B;  4EM1 A;  2VIX A;  2DDA A;  3R0A A;  4Q4Z F;  3FDY A;  5GAE J;  4KYW A;  5D4R A;  4DZJ A;  2ELH A;  2O5R A;  3LA3 A;  2FQ4 A;  1MSE C;  2HZT A;  4DJA A;  4A3B J;  2FA5 A;  3K4K A;  4RDU A;  1JUP A;  3JSP A;  1FBU A;  4GO1 A;  1HOM A;  3BWG A;  4ZYD A;  2QQ8 A;  2GOX B;  1PJR A;  1RIO H;  2A68 F;  4UUS A;  3ZQC A;  3VOD A;  3V8L A;  4XLA A;  3VSK A;  3LNQ A;  4Y15 A;  1O7F A;  1SVL A;  3F6O A;  2IGN A;  2VBW A;  1QHG A;  3KP3 A;  3VYU B;  5F27 A;  4DOZ A;  2WC2 A;  3UNG C;  2DOE A;  3HOT A;  4UUS B;  2HDD A;  2XF6 A;  4LIT A;  2CQX A;  1B8I B;  3HOS A;  1A5J A;  1IN5 A;  3NEU A;  4HG2 A;  3KP6 A;  3RJP A;  3DPU A;  3AFH A;  1ODD A;  1XGS A;  3H1C A;  1VQ5 I;  4A3G J;  1ZR4 A;  2H1L A;  3OV8 A;  2CJJ A;  1IN8 A;  2ZNY A;  3I9V 2;  1JTX A;  4BAY A;  5IOY A;  4A3K J;  1MIJ A;  1KU3 A;  2A07 F;  3BP8 A;  5ICG A;  1J09 A;  2UV1 A;  4HF1 A;  4WF2 A;  4OIQ F;  1UEL B;  2E36 A;  3LL7 A;  2NS7 A;  2IS6 A;  4C2T A;  5F0C A;  3OY9 A;  4EAT A;  3U1D A;  2KJB A;  2OZU A;  2HDC A;  3F8M A;  1LVA A;  2EFW A;  1XTA A;  2ZSH B;  1WFX A;  3HPG A;  3MKY B;  4KIF A;  5JHF A;  4A5N A;  2EA2 A;  1R22 A;  1ON1 A;  2VQG A;  2ZBK A;  2K4B A;  4PCQ A;  4UVB A;  1WQ2 A;  2QKL B;  2R7R A;  5FD6 A;  3FXM A;  1D0X A;  3HHG A;  3LFU A;  3OMY A;  3JRH A;  4PJL A;  3RKY A;  1X4O A;  1YW7 A;  5LGT A;  3CDH A;  1EKE A;  1X1C A;  2V26 A;  1FOX A;  2VOO A;  3ERM A;  1OCR H;  1ZLK A;  2QBY A;  2F4I A;  5J4Y A;  4YIR X;  2RVC A;  2F5F A;  2K9N A;  2QZ8 A;  3CO6 C;  4RM2 A;  2HFH A;  1AKH B;  4CO8 A;  2MSY A;  2LF8 A;  3FMR A;  4IPA A;  2EB7 A;  1LFU P;  2M3A A;  2KIU A;  2ZJR F;  3HOZ J;  4JBA A;  1XS9 A;  4BBR J;  2DTZ A;  1B4A A;  2O3F A;  5IP6 A;  1XCB A;  2L01 A;  3MZY A;  1FZP B;  5H20 A;  3GEZ A;  4P1W A;  5HLT A;  3M4O J;  2X6W A;  4HPQ A;  2FUG 2;  3ZQQ A;  4J19 A;  2BVL A;  4RLQ A;  1FNN A;  4BE1 A;  2H8W A;  1FMW A;  1V55 H;  3JRB A;  2STT A;  5TRD A;  4D9J A;  4HX7 A;  5ICE A;  2R5Y B;  1XDS A;  3MMY B;  4WXD A;  1DQU A;  3RKW A;  3SEZ A;  1TNS A;  2FX0 A;  3HEF A;  1YJN I;  3JTG A;  2HS5 A;  3E0J B;  2QF7 A;  4CXF A;  3SZT A;  3K6G A;  2WB1 A;  4XID A;  1MBE A;  1IXR C;  2MW8 A;  4EV0 A;  1Y1V J;  3G1M A;  1E17 A;  5C3E J;  3UR3 C;  2NVU B;  5FGM A;  3HL2 A;  4PGH A;  1RKW A;  2LSO A;  1SAN A;  1QVT A;  1YX3 A;  3E3V A;  4UV8 A;  1D3Y A;  1SD7 A;  4ZZL A;  2EZL A;  2K9S A;  3VSL A;  3CCJ I;  3GX4 X;  3HYI A;  3IP4 B;  1OYW A;  4PFP A;  3CC4 I;  1H88 C;  3WTW C;  4F3Q A;  1R7J A;  2YX7 A;  2ZCW A;  3GVA A;  1K4T A;  1W5C C;  4B3X A;  1FX7 A;  4KIB A;  4BQA A;  2MLG A;  3C7J A;  5LGU A;  4M9X A;  3QPH A;  3HGY A;  1QPM A;  1WH7 A;  1FC3 A;  2OQR A;  2L02 A;  1W0T A;  2V7F A;  4M71 A;  3K4N A;  1X3U A;  3J81 K;  3CUQ A;  1O3Q A;  2DT7 B;  4UB6 C;  3VFZ A;  3EUK L;  2R7Z J;  2DFE A;  5EG0 A;  2OA4 A;  1FSE A;  2WY7 Q;  1CQT A;  1FLI A;  2L9N A;  1X1P A;  4BY7 J;  1APL C;  4N9I A;  3WU1 B;  1YO5 C;  1SFE A;  2EIJ H;  2BHZ A;  5J47 A;  4KT6 A;  3CJR B;  3WGG A;  2R7S A;  2NRA C;  1STZ A;  2Y75 A;  1MDM A;  2ZKZ A;  3RIR A;  5EG0 B;  4N4N B;  4L0Z B;  1T8I A;  1UB9 A;  3LSJ A;  3RSN A;  3H3Z A;  5FKL A;  2NAZ A;  3OYI A;  2LKS A;  2JPC A;  2O8K A;  1BR1 A;  3B02 A;  3ZMZ A;  3S2W A;  5K1Y A;  4BUP A;  1S29 A;  2HKX A;  3ZQF A;  4W97 A;  4ANJ A;  1K6Y A;  3HG9 A;  3G3Z A;  2W4S A;  1Z3X A;  2X0L A;  2XGE A;  2GZW A;  2KL4 A;  3KYD B;  4G9Y A;  1GVJ A;  2M2E A;  3ZGK A;  4FTH A;  2QKM B;  3E5Q A;  1ERD A;  1X58 A;  5E8G A;  2EJR A;  2Z33 A;  2QVO A;  4IHT A;  1MJB A;  3BRO A;  3K69 A;  3ONQ A;  4HQE A;  2KJC A;  3GTP J;  3JAM Z;  1B59 A;  4XN0 A;  5EEH A;  2V9V A;  1G3W A;  2CFX A;  2NS8 A;  4ZH4 F;  1R5H A;  3Q0U A;  1S7A A;  1YW8 A;  3IHU A;  3IH2 A;  4LMY A;  2FBI A;  1TBX A;  4DW6 A;  4BDZ A;  2E1N A;  3CCQ I;  2PFB A;  3L2C A;  3IV5 A;  3N97 A;  2KPM A;  1Y0U A;  1JGS A;  1TT0 A;  4DIQ A;  1VQL I;  4S04 A;  5HDN A;  4ENK A;  1YJW I;  2VQH A;  3HOV J;  4PJN A;  2E19 A;  3CTA A;  3QYB A;  2ZC2 A;  2VXZ A;  3DCF A;  4QPQ A;  1WI9 A;  2XPU A;  3OIQ A;  5L3D A;  3G71 I;  4G7O F;  3E6M A;  5LEK A;  4A3E J;  4D7M A;  3H0D A;  5FKN A;  5JVG F;  1D5Y A;  1I1G A;  5DCF A;  3OYG A;  4KIG A;  3VEP A;  4A12 A;  2EIN H;  1ETQ A;  2XKO A;  3A0B C;  3KYC B;  5J1R A;  1HKQ A;  5EYR A;  2O9L A;  1QNT A;  1W0U A;  3S3O A;  4B8X A;  2MD0 A;  4JQF A;  2JA6 J;  4MEX F;  2G7U A;  2Y0M A;  3CMY A;  3VWB A;  4FT8 A;  5EF6 A;  2P5K A;  3NAU A;  1LQ1 A;  1IDZ A;  3K4C A;  3C1D A;  5FKK A;  1XB4 A;  1A6I A;  2A6T A;  1T0F A;  2V1N A;  2X6X A;  2QEX I;  4HNV A;  4BY1 J;  2XF5 A;  1D1A A;  3DU6 A;  3OIP A;  3DKX A;  3LSG A;  5AIQ A;  2F5C A;  4DZP A;  4KIT B;  4WXH A;  1MGT A;  4NUB A;  3NAR A;  4XMY A;  5BNG A;  2DPU A;  1I1S A;  1R1V A;  2V79 A;  2RQQ A;  2P7C B;  1R58 A;  1SFO J;  3WHB A;  4BL0 B;  1TWG J;  1NG7 A;  1YLF A;  4FE4 A;  4BDY A;  3K4L A;  3H3V K;  4MFD A;  4E70 A;  5D5V B;  1WJB A;  3CUQ C;  4AVZ A;  4KFC A;  2CUJ A;  3S3M A;  3BJO A;  1XCV A;  1IO2 A;  1ZH5 A;  4PZJ A;  1XC5 A;  4HST A;  2PMZ A;  4I0A A;  4XLE A;  2YX4 A;  2WV1 A;  3RYR A;  2R7D A;  4R79 A;  1ZRF A;  3S14 J;  2ZFW A;  4HDV A;  4BJ6 C;  4NC6 A;  1OR7 A;  4KT5 C;  5GAG J;  1B72 B;  2FNA A;  4RB3 C;  2DQL A;  3ZN1 A;  2D1H A;  1Z9C A;  2EPF A;  1ZR2 A;  4EM0 B;  2GWR A;  3H5R A;  2IEK A;  3DEU A;  3RQI A;  2BY3 A;  2HI3 A;  2FNP A;  1TL8 A;  3GF2 A;  2CQN A;  2Z5U A;  4N9H A;  5GAD J;  4PJM A;  5FRM A;  4A3J J;  1W5T A;  1ZRE A;  5B1B H;  2VOD A;  2LD5 A;  1JT6 A;  3BCA A;  1MNM C;  1H89 C;  4QTR A;  2Z99 A;  2C6Y A;  4AIK A;  1IF1 A;  5EZG A;  1S6L A;  3JRG A;  4UUT A;  3VYR B;  2JA7 J;  2G9W A;  2DK8 A;  2NVY J;  4MTD A;  4F52 A;  3H5N A;  1UHM A;  3H5A A;  4Y17 A;  3J80 Z;  1BL0 A;  5JLW A;  5IY5 H;  4DGW B;  3IKV A;  3CCY A;  4ZDL A;  2P5V A;  1RR7 A;  1IW7 F;  4AD9 A;  1YRN B;  3A2K A;  3SZP A;  1Y8R B;  3ISP A;  4DYQ A;  4A0Z A;  3FIS A;  1MBK A;  4FHT A;  4JX6 A;  1XMA A;  1NH3 A;  4P55 A;  1KZH A;  2QYO A;  5TGT A;  3M3Y J;  1D5V A;  4XBF A;  2MC4 A;  3S32 A;  1Z77 A;  1WJE A;  4XRS G;  2KRH A;  5DD4 A;  4GRI A;  3G2B A;  1XN7 A;  4ITV A;  3KET A;  3FXO A;  2DOD A;  4L0Y B;  1TP4 A;  5C44 J;  2DA6 A;  3OYB A;  3RKQ A;  2PJR B;  3RZD J;  1Q1H A;  5EDN A;  4IRH A;  4AVP A;  2X4H A;  5HOD A;  3B6C A;  3ZN0 A;  4A2U A;  1DUX C;  1UAA A;  1P4W A;  3QYF A;  3TO6 A;  3S2H J;  2A5W A;  2LOO A;  2HPM A;  2Q2E A;  4NQW B;  5J8C A;  4IXA A;  4HF0 A;  3BJA A;  5DS9 A;  2FBK A;  3HTS B;  2DT6 A;  3TQN A;  1WCM J;  3S3N A;  5D5W B;  2L0K A;  4CYD A;  3MD2 A;  3RQ4 A;  1UST A;  2STW A;  2EK5 A;  3TP3 A;  1N25 A;  5E1W A;  1R4N B;  2DOF A;  2WBM A;  3KZY A;  5F04 A;  3BTJ A;  3BG7 A;  4XLN F;  4AIJ A;  3Q0W A;  3CLO A;  5EEG A;  4WWC A;  4ENM A;  1KQ9 A;  2CQK A;  2HR3 A;  4BBS J;  2CFO A;  5BPI A;  2KFD A;  1T0F C;  3MZ8 A;  4RM3 A;  4KIC A;  2QQ9 A;  2IGO A;  2NNY A;  4B3A A;  5CVJ A;  1VI0 A;  3P5J A;  4RLF A;  4FIS A;  1OCZ H;  1PUF A;  3CZ6 A;  2F2E A;  1I27 A;  4F91 B;  1PP8 F;  5CYV A;  4RAF A;  4AIH A;  1E0E A;  1QO0 D;  4EQQ A;  2K85 A;  1DGR M;  3I4N J;  2JUG A;  2M8G X;  3DLL F;  3DXJ F;  3L2U A;  3I59 B;  5K7Z A;  4NBQ A;  5L3C A;  1QGP A;  3PIO F;  4BGD A;  1PUF B;  2D1V A;  3PFY A;  2E1M B;  4C2U A;  3JRC A;  3R61 A;  4ETS A;  4IRI A;  2BV6 A;  4I6Z A;  3CLQ A;  4XR6 A;  1MMD A;  4UY8 I;  4GXO A;  4ZYG A;  2JA2 A;  2Y30 A;  1U0J A;  2MA3 A;  4BJ5 C;  1IV6 A;  1E3P A;  1OR7 C;  1POG A;  4AYB N;  3K4B A;  4L9J A;  3JSO A;  1VQ4 I;  2UUZ A;  3S2D J;  5K5R A;  4HRI A;  5FLV A;  1U8B A;  4FCY A;  3IC7 A;  4DBQ A;  3I55 I;  2WV0 A;  2HEO A;  2I8D A;  2NYX A;  4BXU A;  4KJZ A;  2KIF A;  3S16 J;  1FTZ A;  1VQP I;  4JK1 X;  4IOC F;  4ESF A;  4XLF A;  2BZT A;  4A3L J;  1OPC A;  2W82 A;  1MNE A;  3GFM A;  1XGM A;  2P6T A;  1VQO I;  2R7V A;  2GIZ A;  3LSI A;  1KU2 A;  3HOW J;  1BJA A;  1V5E A;  1B6A A;  1UMQ A;  1QQI A;  1SC7 A;  2VKV A;  2F5E A;  4P5O A;  4XRM A;  1MH4 A;  2R5Z A;  2QLZ A;  4DYR A;  4HDU A;  2KZG A;  4IX7 A;  1G4D A;  3GTM J;  2CH0 A;  1JJ6 C;  3PO2 J;  4E7H A;  1ZG5 A;  4XRF A;  1TQM A;  4LB5 A;  1FP1 D;  2EIL H;  2A5Y B;  3HDD A;  4BH9 A;  2OPT A;  4U0Y A;  1K79 A;  4CIC A;  3S1R J;  3H92 A;  2MYS A;  3DU5 A;  1FWZ A;  1G3Y A;  1GV2 A;  4LK1 F;  4IEJ A;  4PDK A;  4DQ2 A;  3GYH X;  1TWH J;  2H09 A;  1FOY A;  2B9S A;  1WWX A;  1XSV A;  2K4J A;  4G6Q A;  3BLY A;  2V4J C;  3EDP A;  5ICC A;  2XB0 X;  4NC7 A;  4AC0 A;  4F55 A;  3FHZ A;  4IHX A;  2B63 J;  2VJ4 A;  4ZDO A;  1F36 A;  2EIK H;  4Q5S F;  2XV4 S;  1XSD A;  2KP6 A;  4FET A;  3OSG A;  5FLX K;  3A4C A;  4XSZ F;  1W5S A;  5GPC A;  2ZME A;  4XIC A;  4CYC A;  2Y69 H;  4P96 A;  4MO7 A;  4XLC A;  1Z7L A;  5E3L A;  1G59 A;  4MQ9 F;  5J3L A;  1W7P B;  1JKQ C;  2W48 A;  2HXO A;  3I64 A;  1WKM A;  2HOA A;  1G2H A;  2BXZ A;  4B48 A;  2PEX A;  2IAI A;  2ESN A;  4OU0 A;  1VND A;  1BI0 A;  1EH6 A;  4F93 B;  3CCM I;  1ETX A;  3WE3 A;  4ZDP A;  5DDG A;  1KQ8 A;  2JT1 A;  5IYB J;  5L3E A;  4KIS A;  3HB9 A;  4HOB A;  3TDU C;  2V1D A;  1J59 A;  4E7I A;  1F4K A;  2K9L A;  3P9C A;  1RUO A;  5DCM A;  4HZF A;  1L3L A;  1F43 A;  3F8F A;  2OU2 A;  2DJN A;  3H35 A;  1AHD P;  1RKT A;  2VB6 A;  3DBH B;  2EH3 A;  3HHH A;  4M6V A;  1P4X A;  1Z3Y A;  3LA7 A;  4XOP A;  4HNU A;  3JRF A;  2LVS A;  2CYY A;  1VZ0 A;  2JRT A;  1HKS A;  5DCM B;  2EFP A;  1ZRD A;  5D5U B;  2R7U A;  3FXL A;  1RRJ A;  5JFR A;  1FOW A;  2F5D A;  1O3S A;  2HKO A;  2P5L C;  1F1Z A;  2L7K A;  4MTE A;  4BJT A;  3PO3 J;  2DI3 A;  3FBI B;  3RKX A;  4EJU A;  3HOU J;  2TDX A;  3NQO A;  1BJZ A;  4OOI A;  4U7B A;  1I50 J;  2VE9 A;  4ESB A;  3H9J A;  4IVN A;  4N4O B;  2GXG A;  2IA2 A;  3PIP F;  3FZV A;  3A01 A;  2DDB A;  2DA4 A;  3FMS A;  4RB0 A;  2AS5 F;  4XNF A;  3G1O A;  3Q3S A;  4RAZ A;  1IN7 A;  1XMK A;  4IRG A;  2HOT A;  1YG2 A;  3LMM A;  1IGN A;  1D8J A;  3X2Q H;  2HNH A;  1R4M B;  4A69 C;  3CC7 I;  4ABZ A;  1JGG A;  2PLY A;  1HLV A;  3C18 A;  4IL6 C;  4CCL A;  5IOZ A;  1FMV A;  4Z6Y A;  2ETH A;  3VYS B;  3U1K A;  1BIA A;  4XLP F;  3WE2 A;  4HLY A;  1LUJ B;  2ELK A;  1WJD A;  2X51 A;  3AAF A;  3DQV C;  5D8K B;  4U87 A;  5FJ8 J;  2HZD A;  2RKH A;  4LG0 A;  2O03 A;  2DMT A;  2EFN A;  3I5U A;  3KEY A;  1X2M A;  3K0L A;  4PJ0 C;  5DEQ A;  3ZXS A;  2W00 A;  4JP0 A;  4BQO A;  3E6D A;  3EQL F;  2VLA A;  1V5G A;  2W85 A;  4FX0 A;  3RTR A;  4BXF A;  1A31 A;  2PMU A;  2GM4 A;  2M34 A;  2W1O A;  2BXY A;  3ZOB A;  2EFO A;  2M4K A;  1JUM A;  3QP5 A;  4LG0 B;  3GZN B;  3IAS 2;  2Y0S N;  2AHQ A;  3F23 A;  3M9A A;  4MQV A;  4RGR A;  3PFI A;  4XM3 A;  1RNL A;  3PUF A;  4OMZ A;  2ADU A;  1SD4 A;  2YU3 A;  3ABT A;  3V8J A;  1Z05 A;  1I3A A;  2HU9 A;  3BQY A;  2RNJ A;  5HLI A;  3BOQ A;  2E5N A;  3BZ6 A;  1OMI A;  3SYT A;  2OV7 A;  2GQQ A;  3HRM A;  1G8X A;  2ZME C;  3BPV A;  1R00 A;  2DMN A;  3OYJ A;  1ETW A;  5DV5 A;  3KLN A;  1ULY A;  2FRH A;  4AID A;  1Z6R A;  2MH9 A;  2COM A;  2KIM A;  1DPU A;  3B6A A;  5KAI C;  5FFX A;  4YFN F;  3KE2 A;  1EJ9 A;  2DT5 A;  2PMH A;  4RB2 C;  4Y3O A;  4G7H F;  4KN4 X;  2K3F A;  3EUH A;  4QSH A;  4I01 A;  2X85 A;  3I4M J;  5M5X J;  3PNV A;  2BOL A;  1J5Y A;  2ZO4 A;  3FK7 A;  1W4M A;  3GTO J;  3PUB A;  1X1D A;  4EJW A;  2QBY B;  1IG7 A;  1V54 H;  3R4K A;  3PSF A;  4A3D J;  2TCT A;  1TW2 A;  4M3E A;  2YUS A;  1D1B A;  3QAH A;  3CDI A;  1XG1 A;  4OIN F;  5GTI C;  3KYL A;  2VOP A;  2DW4 A;  2VQL A;  3IAM 2;  2VPR A;  1ETY A;  3GME A;  1DGW Y;  3V7R A;  3O6B B;  5E1Z B;  2KRF A;  1K7A A;  1VQ9 I;  4LG3 A;  1FSH A;  2XAH A;  3PJR A;  2XAF A;  2E5Z A;  1JKO C;  4BXX J;  1BI2 A;  4CCK A;  5CVU A;  3I56 I;  1UG2 A;  3FK6 A;  2LTP A;  3HXL A;  2CS3 A;  2ID3 A;  2DJI A;  5JR3 A;  3J7A O;  3W6K B;  9ANT A;  2PBI A;  3V42 A;  5F1J A;  2JVG A;  1YI2 I;  4WK8 F;  1O3T A;  3OYE A;  3DLA A;  1YIJ I;  2KHM A;  4XLH A;  3WGH A;  3GFI A;  3RZO J;  2E34 A;  1E3H A;  2DA7 A;  3V8K A;  4B43 A;  3BDD A;  3CF2 A;  1ETV A;  2QUF A;  4R8H A;  1IXC A;  1V5F A;  4G6D A;  1HXD A;  1IRG A;  5ILU A;  2XSD C;  2XVC A;  3AG3 H;  1WJA A;  2L4M A;  3CJQ B;  5BPD A;  1HW2 A;  2DCE A;  1R1U A;  4IOA F;  3IWF A;  3N05 A;  4OIR F;  5IT3 A;  3GZ5 A;  2HXI A;  4L9N A;  1P6R A;  2LKX A;  2ZJ2 A;  1JTY A;  3DTI A;  1HSJ A;  3MQ0 A;  3LSR A;  3SEQ A;  2HQR A;  5ED4 A;  3BR5 A;  3ERE D;  3WTZ A;  1ORK A;  4EEF G;  3CMA I;  5E20 A;  4IZZ A;  4HW0 A;  4M3B A;  1V4R A;  4HA8 A;  3IWZ A;  2IVM A;  4UVA A;  4BQQ A;  2V9K A;  4PUS A;  2CV1 A;  3BTL A;  1TQP A;  4C3J J;  2Y9Y A;  5JVT A;  4GYG A;  4MHG A;  2A69 F;  5D6F A;  4RB1 A;  4YEL A;  3I54 A;  2D45 A;  4OMY A;  1VTN C;  4CUG A;  5IT9 Z;  1X1B A;  2DPD A;  1YIT I;  2HVS A;  2X6O A;  4B44 A;  3SDG A;  1WJ5 A;  3QPS A;  2J5O A;  2VQC A;  3HBL A;  3Q9S A;  3SQN A;  1GLN A;  4JX5 A;  2JPB A;  3CUQ B;  3RCO A;  3VYT B;  4YEJ A;  2A61 A;  1YHQ I;  2LR8 A;  2MFZ A;  1Y39 A;  3WTU C;  2ACJ A;  1OKR A;  2HVR A;  5M5Y J;  1T33 A;  2FJ1 A;  3KEQ A;  4M3D A;  2ZJP F;  3L7W A;  4IHY A;  4V2G A;  1IRF A;  3IL2 A;  1MW7 A;  1LE8 A;  3GTQ J;  1ZRC A;  2DFF A;  1IJW C;  3HOY J;  4CCN A;  1MDM B;  2GAU A;  1LFP A;  3FHN A;  2XAU A;  5K5Q A;  4UHT A;  3EUH C;  5FKM A;  1S7O A;  3U21 A;  3HSR A;  4LIU A;  4EVI A;  2GIV A;  1OQY A;  3SHF A;  4U0V A;  4L5I A;  1REP C;  3OS2 A;  3E1S A;  3K1P A;  1X4P A;  1IUY A;  1K83 J;  3IH4 A;  4XK4 A;  3EYY A;  3F0C A;  1U9O A;  3HIF A;  1IUF A;  2E2I J;  1W36 D;  1LFB A;  2OF7 A;  1VQK I;  5J1Y A;  3JAM K;  5D6E A;  1JT0 A;  2DA2 A;  3PSI A;  1D0Y A;  3IRQ A;  4FE7 A;  3F21 A;  4CSW A;  5HNF A;  1H8A C;  4RAY A;  2QM3 A;  5JHU A;  1IXS B;  2NVT J;  1KON A;  3KCC A;  5FRN A;  5L3B A;  4XOT A;  1WZ2 A;  4CCO A;  1R5G A;  3DBR B;  1OCT C;  1KU7 A;  1A36 A;  4JX4 A;  3COA C;  1ZAR A;  1UHS A;  4BAC A;  3K2A A;  3MZH A;  4BS9 A;  1MH3 A;  2WTE A;  3OYC A;  2GXA A;  2JK3 A;  3F3X A;  3ZMD A;  2PQ8 A;  4J00 A;  5HLG A;  1GUU A;  4G7Z F;  1ZKG A;  3WGI A;  2XAJ A;  3JW4 A;  3R6S A;  3JR9 A;  4BYY A;  1OJL A;  2I5U A;  2HOS A;  2R7O A;  4ASN A;  3CCU I;  2IS2 A;  1I5Z A;  1MND A;  3B73 A;  3HKZ N;  2V9P A;  2MH2 A;  5DM6 F;  1J0R A;  3G1L A;  3L2Q A;  3G73 A;  4AU7 A;  1AOY A;  1UJ8 A;  2CW0 F;  2ZXH A;  2HQN A;  2DU9 A;  2FF4 A;  1U2W A;  3HPH A;  1LEB A;  2CSO A;  1GHC A;  2H8R A;  3GBG A;  5A2Q Z;  2F6C A;  2NVX J;  5FLM J;  2UXX A;  2BYV E;  4CZZ A;  1SFX A;  2JSP A;  2JTV A;  5LFA A;  2CU7 A;  3MN2 A;  3BT9 A;  4JYK A;  4KMU X;  3LSH A;  2MGQ A;  3HRU A;  1KU9 A;  3MFK A;  3S1Q J;  2DK5 A;  3BY6 A;  2H6C A;  4M3F A;  5C4X J;  4U7D A;  3TBI A;  2ISZ A;  4TV7 A;  5F0H A;  4HSR A;  3CJT B;  2XIG A;  2E7X A;  3W2V A;  1BM9 A;  2P7V B;  2HYG D;  3ZCO A;  5CJ9 A;  4JOM A;  3WOD F;  3WU0 A;  4GDF A;  2ID6 A;  1MMS A;  2LH9 A;  3ECO A;  2XF7 A;  2F4M B;  5HVQ C;  2LRE A;  2W25 A;  4I09 A;  3HOX J;  3J7A Y;  4B4C A;  2VN2 A;  4A3F J;  4OIO F;  3OOU A;  2ZB9 A;  2LNB A;  2M9H A;  2Z2S B;  3H9Q A;  4V19 K;  1T56 A;  2Q1Z B;  2IPQ X;  3WTS C;  1KGS A;  1K4S A;  1WJF A;  2BW3 A;  3NRV A;  2XGC A;  4A6D A;  2G0E A;  3QRF F;  1LPQ A;  5EJC A;  1MSF C;  3CC2 I;  2JN6 A;  1A04 A;  1BOB A;  2ZNZ A;  4NB5 A;  3CJN A;  3L9F A;  2XUB A;  3CCL I;  1X3Z B;  2IJL A;  2XHK A;  1KA8 A;  1B9M A;  3HC7 A;  4XSX F;  2E1O A;  2DTR A;  4HEA 2;  5KCM A;  1TNT A;  2L4A A;  3CES A;  3DWL E;  3RPQ A;  3BC8 A;  3A1Y A;  1U6G A;  5BOX A;  3ZQI A;  3ULQ B;  1FYL A;  2QQA A;  4LGW A;  3FKI J;  3CCE I;  4UUV A;  5DD8 A;  1RR8 C;  2XAG A;  1MBG A;  3MVP A;  2LY1 A;  3EPZ A;  3J80 K;  4E7K A;  2Q0O A;  3KFW X;  3QPL A;  1USS A;  1IAW A;  5FB2 A;  4PFO A;  5D4S A;  4A6E A;  3K4M A;  1ZGW A;  3J7Z I;  2FSW A;  1SEU A;  1WJC A;  2XDV A;  3QYE A;  3BR6 A;  4ESJ A;  2AO9 A;  4EM2 A;  1QRY A;  2ESH A;  5LHI A;  2O6G E;  1VQN I;  1NTC A;  2CV2 A;  2EWN A;  3K1N A;  1FYM A;  4FX4 A;  1O57 A;  1TZL A;  1ZQ3 P;  1Z6T A;  2CO5 A;  3EYI A;  1HDD C;  1UHW A;  2W24 A;  3C2H A;  3KLO A;  1UZC A;  1PYV A;  2GOM A;  2LBF A;  3WG7 H;  5LHH A;  4I7H A;  1RET A;  4D5F A;  4I0B A;  3O8H A;  5GAH J;  1VQ8 I;  3LOC A;  2CUF A;  3ZP5 A;  2M87 A;  2QWW A;  3S15 J;  3K4J A;  1IZ1 A;  3F8N A;  4A5M A;  2G7H A;  2GA1 A;  2PI0 A;  2P0W A;  4O3M A;  2Q2E B;  1R5I D;  1TTY A;  2R7Q A;  3PNY A;  3D0S A;  1I3Q J;  5IYD J;  4A0X A;  1RPW A;  3OS1 A;  2VBZ A;  1H9G A;  2VT3 A;  2Q8K A;  1IN4 A;  2L54 A;  1C0W A;  2IS1 A;  2VJJ A;  4ZYE A;  3FX3 A;  2WY8 Q;  1LDJ A;  1I6X A;  1GT0 C;  3ML6 A;  2W7N A;  2XSJ C;  2BBY A;  5EGO A;  3IH3 A;  4IQJ A;  3M8J A;  4LFU A;  3AL0 C;  3CD6 I;  2L3D A;  3HUG A;  1U5T A;  2HPI A; 
#chains in the Genus database with same CATH homology
 2X6Y A;  3PL8 A;  2VL8 A;  3CP8 A;  3UR3 C;  1N78 A;  1QHH D;  4U7B A;  3L2W A;  3HL2 A;  4E6K G;  3H9J A;  5LD2 C;  3AKZ A;  4DBR A;  4N4O B;  1YX3 A;  3CMM A;  2IXS A;  4XNF A;  3VSL A;  4CH7 A;  2HDW A;  4ZC3 A;  5KNL A;  3AL0 B;  3LMM A;  3SDB A;  3IP4 B;  4PFP A;  4MLO A;  2HNH A;  4BEH A;  1D0Z A;  4F3Q A;  3CP2 A;  4B3X A;  2KDO A;  4CCL A;  1FMV A;  3VYS B;  2LYC A;  2JVH A;  3ZR8 X;  2HQA A;  1WJD A;  2X51 A;  2M0M A;  3DQV C;  3RPU D;  4U87 A;  2HZD A;  2V7F A;  3ZRG A;  2Y0S A;  2VJI A;  3K4N A;  3ZXS A;  3KEY A;  4B47 A;  2Z1D A;  2W00 A;  4OAY A;  1YX5 A;  4BQO A;  2DT7 B;  1Y6I A;  3I3L A;  2VLA A;  1V5G A;  3S8P A;  2BW3 B;  4BE0 A;  3OYH A;  2M7A A;  3RTR A;  4BXF A;  2M7B A;  2OUM A;  3EUK L;  2RNG A;  2W1O A;  2WY7 Q;  2M4K A;  2L9N A;  3IAS 2;  4Y33 A;  2LG4 A;  4ZJZ A;  4H4K C;  4XM3 A;  4KT6 A;  3CJR B;  2IGK A;  2R7S A;  2IGM A;  2X1D A;  2L5Q A;  3OYM A;  2HU9 A;  4OWR B;  4N4N B;  4E7J A;  1UG0 A;  3RSN A;  2E5N A;  3D5S C;  3OYI A;  3SYT A;  2K5C A;  2OV7 A;  1BR1 A;  1G8X A;  2KQR A;  2DOA A;  4BUP A;  3LSM A;  2L2O A;  2X1E A;  4OAZ A;  4BQN A;  3OYJ A;  4ANJ A;  1K6Y A;  3HG9 A;  1YE9 A;  2NOJ B;  4E4H A;  5CQG A;  2W4S A;  1Z3X A;  2KL4 A;  2L9S A;  3ZGK A;  2QKM B;  4PSX A;  1ERD A;  1ZEL A;  2ZXI A;  4Y3O A;  3OL3 A;  3ONQ A;  2WAQ A;  2PJR A;  2X85 A;  4XN0 A;  3PNV A;  3DPT A;  2BOL A;  4CZC A;  3PUB A;  4XL9 A;  5HOO A;  2WA0 A;  1X1D A;  4BDZ A;  2KPM A;  2X1C A;  3PSF A;  2LBF B;  1TT0 A;  1D1B A;  4DIQ A;  3KYL A;  2ZFU A;  2CV0 A;  2VQL A;  2VQH A;  4PJN A;  2ELJ A;  3QYB A;  2VXZ A;  3IAM 2;  4QPQ A;  3OIQ A;  1DGW Y;  1N75 A;  4LG3 A;  2AQE A;  2BVM A;  1LDK B;  3PJR A;  1LKX A;  3H0D A;  2E5Z A;  1X1A A;  3OYG A;  4CCK A;  3DEE A;  4CA0 A;  3HXL A;  5CQE A;  3TL4 X;  2CS3 A;  2VXD A;  2DJI A;  2KMU A;  4PK4 A;  4FAS D;  3V42 A;  2KZV A;  3OS0 A;  2JVG A;  3OYE A;  3S3O A;  3DLA A;  1SFK A;  2KHM A;  2MD0 A;  4XLH A;  4JQF A;  2CW8 A;  4E7S A;  3VWB A;  2K9M A;  2IS4 A;  2R7T A;  4B43 A;  3DTK A;  1SAU A;  3K4C A;  3MKZ A;  3CF2 A;  4ZYA A;  2WAF A;  3OYN A;  1MMN A;  1V5F A;  2A6T A;  3M1C A;  2E60 A;  2V1N A;  2X6X A;  4RMN A;  2XF5 A;  1D1A A;  3DU6 A;  3OIP A;  1WJA A;  3DKX A;  5KHD A;  3OYF A;  3HUG B;  3CJQ B;  3LSG A;  2DCE A;  4KIT B;  3N05 A;  3DTE A;  3OL4 A;  3OR1 C;  4NUB A;  1Y56 A;  4XMY A;  2VKH A;  2RQQ A;  4XON A;  1DP3 A;  3DTI A;  3SEQ A;  4BL0 B;  1NG7 A;  3KX2 A;  4BDY A;  4IZZ A;  3K4L A;  3BCB A;  1WJB A;  2VKD A;  4F92 B;  4AVZ A;  2CUJ A;  4BQQ A;  2V9K A;  3S3M A;  4PUS A;  2CV1 A;  4E7Z A;  3OYK A;  3D5R C;  4HST A;  4BEH B;  4II3 A;  2PMZ A;  4XLE A;  4YEL A;  4XQF A;  3H9G A;  4R79 A;  4CUG A;  1X1B A;  4BJ6 C;  2HVS A;  4B44 A;  2XC7 A;  1IRX A;  1WJ5 A;  1JI8 A;  2VQC A;  3K70 C;  1GLN A;  2LRD A;  3DKY A;  3H5R A;  1QU3 A;  3IUO A;  1N77 A;  3RCO A;  3VYT B;  4YEJ A;  2MFZ A;  4PJM A;  2KLO A;  1BR2 A;  2R7W A;  5FRM A;  2HVR A;  3BCA A;  3K70 D;  1LVK A;  1OLT A;  2WAE A;  1EA3 A;  3VYR B;  1MW7 A;  2WAD A;  2F5V A;  4F52 A;  3H5N A;  3H5A A;  3PNT A;  4CCN A;  1LFP A;  3FBN B;  3FHN A;  4DGW B;  2XAU A;  4ZDL A;  3EUH C;  3U21 A;  3EUA A;  4LIU A;  4BU2 A;  1W36 C;  2R7X A;  3A2K A;  3OS2 A;  1D1C A;  5HNH A;  2RRE A;  3E1S A;  3W2W A;  1X4P A;  4J01 A;  4C30 A;  5TGT A;  2MC4 A;  3S32 A;  2VAS A;  1WJE A;  1W36 D;  2KRH A;  4GRI A;  3G2B A;  3OWT A;  4ITV A;  4PSW A;  4XKC A;  1MMG A;  4C9Y A;  3DPL C;  3OYA A;  3PSI A;  1D0Y A;  2UWM A;  1S9H A;  3OYB A;  2PJR B;  1HA8 A;  4CSW A;  5HNF A;  2HVQ A;  3NWT A;  1Z21 A;  1UAA A;  1X19 A;  1KON A;  1T95 A;  2AQF A;  3QOD A;  3QYF A;  4XN3 A;  1P9Q C;  2A5W A;  2LOO A;  4XOT A;  4Y4R A;  4NQW B;  2HPM A;  4CCO A;  3OYD A;  3HKZ A;  2DT6 A;  3S3N A;  4BAC A;  5FRO A;  4BS9 A;  3OYC A;  3F9K A;  3MD2 A;  3RQ4 A;  3VDX A;  4J00 A;  2WBM A;  3BG7 A;  1AA7 A;  4D1Q A;  2VPL A;  2CUZ A;  2CFO A;  2R7O A;  2IS2 A;  1MND A;  1T0F C;  2E1M C;  4RM3 A;  2IGO A;  2OC6 A;  3W3C A;  3S93 A;  3L2Q A;  4RLF A;  4AU7 A;  2M4G A;  2ZXH A;  3OR2 C;  2MAB A;  3CZ6 A;  3HPH A;  4F91 B;  2CMP A;  3BG6 A;  3GBG A;  2V6E A;  2F6C A;  1E0E A;  1DGR M;  2JUG A;  3L2U A;  5FRN A;  2JSP A;  2VJ5 A;  5LFA A;  2LY2 A;  3LSK A;  3LSH A;  2DXI A;  4BGD A;  3PFY A;  2E1M B;  4X0G A;  3SZG A;  4C2U A;  5CKT A;  2LC2 A;  3TBI A;  4ZTJ A;  4HSR A;  2VIX A;  4XR6 A;  3FDY A;  3W2V A;  1MMD A;  2K3P A;  3ZCO A;  4JOM A;  2JA2 A;  4BJ5 C;  1U0J A;  2O5R A;  1OR7 C;  3K4B A;  4DJA A;  2LH9 A;  2UUZ A;  3K10 A;  4HRI A;  3K4K A;  4HNT A;  4G6T B;  2XF7 A;  5HVQ C;  3C2G A;  2LRE A;  4DBQ A;  3J7A Y;  2GOX B;  1PJR A;  2I8D A;  2Z16 A;  3OOU A;  4KJZ A;  4XLA A;  3VSK A;  2Z2S B;  3H9Q A;  2IGN A;  1QHG A;  4XLF A;  3VYU B;  2Q1Z B;  4DOZ A;  2W82 A;  1MNE A;  1WJF A;  2BW3 A;  3UNG C;  2R7V A;  3LSI A;  3HOT A;  1V5E A;  2XF6 A;  4LIT A;  3HOS A;  2R4G A;  4HG2 A;  4P5O A;  1BOB A;  3DPU A;  3AFH A;  4NNJ A;  4IX7 A;  4BE2 A;  2CH0 A;  4E7H A;  3HC7 A;  3I9V 2;  4HEA 2;  5KCM A;  3CES A;  3DWL E;  1R6R A;  3BC8 A;  1J09 A;  3A1Y A;  2UV1 A;  2MYS A;  3DU5 A;  1UEL B;  4XOR A;  3LL7 A;  4ZTF A;  4II2 A;  2IS6 A;  4C2T A;  3OY9 A;  1NG6 A;  4EAT A;  2LY1 A;  3EPZ A;  4E7K A;  3BLY A;  2V4J C;  4XKB A;  2ZSH B;  4NC7 A;  1WFX A;  3HPG A;  2CW7 A;  1MMA A;  4PFO A;  4F55 A;  3MKY B;  4XKV A;  5JHF A;  3K4M A;  3L2R A;  2VQG A;  2VJ4 A;  4ZDO A;  1WJC A;  3W2A A;  2QKL B;  2XDV A;  2R7R A;  2KP6 A;  3QYE A;  4FET A;  3A4C A;  3LFU A;  1D0X A;  3OMY A;  3OYL A;  4PJL A;  1X4O A;  2CV2 A;  1BR4 A;  4XLC A;  1X1C A;  1Z7L A;  2V26 A;  1G59 A;  1TZL A;  4XKW A;  2F4I A;  3C2H A;  2LBF A;  1PYV A;  2GOM A;  4RM2 A;  4B48 A;  3D5L A;  3FKJ A;  2M3A A;  4CCM A;  4F93 B;  4ZDP A;  2ZSI B;  3K4J A;  5CPR B;  4KIS A;  3TMO A;  4LIV A;  4P1W A;  5HLT A;  2P0W A;  2X6W A;  4HPQ A;  2FUG 2;  4E7I A;  2K9L A;  2Q2E B;  3PNY A;  2R7Q A;  3ZQQ A;  4CCJ A;  4QPO A;  3MKW B;  2BVL A;  4RLQ A;  4IQ4 A;  4BE1 A;  3NWS A;  1FMW A;  3OS1 A;  4E7L A;  4IKF A;  4D9J A;  3H35 A;  2KRC A;  2VB6 A;  3MMY B;  4NC8 A;  1DQU A;  1Z3Y A;  4YRV A;  3SEZ A;  2IS1 A;  2VJJ A;  4XOP A;  4HNU A;  2WY8 Q;  1VZ0 A;  3E0J B;  2W7N A;  2XSJ C;  3QOE A;  3L2V A;  2R7U A;  4PJJ A;  4IQJ A;  3K6G A;  3M8J A;  2WB1 A;  3AL0 C;  2L7K A;  4BJT A;  4AYB A;  3FBI B;  2HPI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...