3QODA

Crystal structure of heterocyst differentiation protein, hetr from fischerella mv11
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
296
structure length
294
Chain Sequence
SNDVDLIKRLGPSAMDQIMLYLAFSAMRTSGHRHGAFLDAAATAAKCAIYMTYLEQGQNLRMTGHLHHLEPKRVKAIVEEVRQALTEGKLLKMLGSQEPRYLIQFPYVWMEKYPWRPGRSRIPGTSLTSEEKRQIEQKLPSNLPDAHLITSFEFLELIEFLHKRSQEDLPKEHQMPLSEALAEHIKRRLLYSGTVTRIDSPWGMPFYALTRPFYAPADDQERTYIMVEDTARFFRMMRDWAEKRPNTMRVLEELDILPEKMQQAKDELDEIIRAWADKYHQDVPVVLQMVFGKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of transcription factor HetR required for heterocyst differentiation in cyanobacteria.
pubmed doi rcsb
source organism Fischerella thermalis
molecule tags Dna binding protein
molecule keywords Heterocyst differentiation protein
total genus 70
structure length 294
sequence length 296
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03574 Peptidase_S48 Peptidase family S48
A PF18460 HetR_C Heterocyst differentiation regulator C-terminal Hood domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1670 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3qodA03
1.10.10.1680 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3qodA02
4HRIA 3QODA 3QOEA 4IZZA 4YRVA 4J00A 4J01A
chains in the Genus database with same CATH superfamily
1Z6RA 3LSTA 2EFWA 1G4DA 3VB2A 1V54H 2IA2A 4Y52J 1BR1A 3FF5A 2VJ5A 4LG3A 3ECHA 3L2VA 1OR7C 4Y3OA 5E3LA 3ERMA 3C2HA 1YE9A 4YIFA 2K9QA 4CYDA 1W36C 3LAPA 3Q9VA 4OIPF 1QRYA 1ERDA 1BR2A 4B3AA 4EJTA 4CA0A 5CVIA 2KPMA 3JRCA 1LNWA 2PN6A 1MSEC 1TTYA 3D1NI 1FWZA 2H1LA 3HGYA 3BTIA 3S1NJ 3I3LA 1I3AA 3L9FA 2WV1A 5KVRA 1A6QA 2LF7A 2M8EA 5LGUA 5JVTA 1SFOJ 3EUHC 3KE2A 2LREA 1R1VA 4OAYA 5F1JA 3UNGC 2VN2A 1OFCX 4MQVA 2HVSA 4BACA 4BGDA 4IQ4A 4M6XA 1IF1A 1D8JA 1OCOH 2DAOA 3S2DJ 3M1EA 2NVUB 2F48A 4A3JJ 3L2RA 1D1AA 2DMNA 3OYMA 2DU9A 1U78A 5EEAA 2M3AA 1WVRA 4RAFA 3TO6A 2FD5A 3GTJJ 3BR6A 1I27A 1YO5C 3HUGA 3SEZA 3IKTA 3OS1A 3QRFF 1USSA 2HGCA 2D2WA 4UXNA 1QNTA 1G8XA 4MHGA 3VFZA 3HJEA 1BJAA 4II2A 5BPIA 1ZLKA 3TW7A 3CCMI 5CJ9A 3H5NA 1B59A 4IHVA 2PLYA 3KZYA 4IRIA 1B8IA 2IRFG 2E34A 3HTUA 2P6SA 3BWGA 2V79A 3ZMZA 1Z0XA 1XCBA 3FXMA 9ANTA 3L2QA 3KP3A 2HQAA 1EH8A 5JLWA 2JA5J 5FKMA 4CXFA 5EGOA 2B9SA 1QQIA 3B73A 3P9CA 1UZCA 3BR1A 3G1OA 2IAIA 5CQEA 4BYYA 3I55I 2LKSA 1DUXC 3CCUI 1BI1A 3HDDA 4XSXF 1BN5A 4YFKF 4ENMA 2Z16A 2H6CA 3OYEA 3DEWA 2V1XA 4IO9F 1NH3A 1KU3A 2VQLA 2DA4A 2F5DA 4LGWA 1YHQI 2BW3A 3PJRA 5DM6F 3KLNA 1XTAA 3J80K 5IY5H 4RB2C 1ZELA 3ERED 4A5NA 2DOEA 3MKLA 3E6BA 4OOIA 5EG0B 1X4OA 1TNSA 4QWQA 3VODA 5DM7F 4DNCA 4DOZA 3QU6A 2DT7B 4GRIA 4KN7X 4B1RA 1IN8A 2V9VA 2QCOA 3A02A 2R7VA 3ZMVA 2NVTJ 4G6QA 3EUAA 4LD5A 2MG4A 1B6AA 2V9KA 3E5QA 3CCQI 5BOXA 2O8KA 1TT0A 3N05A 1BOAA 2DMPA 1KYWA 2K9NA 3PQKA 2BXZA 5LHHA 4CCKA 1YLFA 1OYIA 3IHUA 1ZG3A 4P9UA 1MDMA 2NRAC 2E5ZA 4Y15A 2OV7A 1IUYA 2AHQA 2FNPA 4XLAA 2STTA 1QBJA 1O3TA 2FQ4A 2KQRA 2MYSA 1HC8A 1BOBA 4B8XA 5FKNA 2E5NA 2ZSIB 1XX5A 2E1MB 4OU0A 2ZJRF 2R7UA 5D5XB 4BKXA 4ITVA 3J81Z 2IT0A 5KCMA 4XN3A 3VSLA 1KONA 2IA1A 5EZHA 3DBRB 1QPMA 2O61A 5HVQC 4LLNA 4HNVA 5J47A 3RZOJ 2KZVA 4XMYA 1Q1HA 3HYIA 4ZZLA 5CVRA 2OQRA 2QQ9A 2M0MA 1R36A 5E8IA 4E7SA 3ZQLA 4DQ2A 2M7AA 3OR2C 4D7NA 2OF7A 2XPVA 3BJAA 2ISZA 1P2FA 3JSOA 4WK8F 4A6EA 3P5JA 4BNCA 5J4YA 3S16J 1WRJA 4BDZA 4E7IA 4IXAA 1HDPA 1HW2A 2R7TA 2PX9A 3V8LA 1YI2I 5LGNA 2X85A 1VQMI 3ULQB 1YOVB 2RNGA 4HDVA 1PJRA 4XRMA 1ETWA 4M74A 1MBJA 3HTSB 1VZ0A 3MEXA 2KP6A 1HQCA 2EINH 2GOMA 1QPIA 2LF8A 2M4KA 4BHCA 1WPKA 5FD6A 1Y8RB 4A3MJ 2LRDA 2VOPA 2IGNA 1O7LA 1JKQC 3SFZA 2JMWA 2VJIA 1HW1A 2OC6A 3S8PA 4HF2A 2BVLA 3F0CA 1B72B 2XUBA 2FEZA 2GZWA 4XKWA 3K1MA 2DK5A 3FDYA 1O3QA 1R00A 4LITA 3TQNA 2GM4A 2HQ5A 2HS5A 5J1YA 1IC8A 3SHFA 3TKYA 3E1SA 4YEJA 3QYFA 2QA4I 4FTHA 1UG2A 4A12A 2JA6J 1AOYA 2P6TA 2KDZA 1O3RA 2DK8A 1S6LA 2O3FA 5DEQA 1LE8A 1XG1A 2CO5A 3K4JA 3K10A 1HXDA 3BTCA 2BZTA 2LBFA 2JPBA 3K2ZA 5E1ZB 1I1SA 3GFJA 5ICFA 2Z5UA 1RETA 4A3LJ 4NUBA 2E60A 2OUMA 2PEXA 1HW5A 3S93A 2X1DA 4B43A 2DYRH 5EEHA 3FBNB 4M73A 4KJZA 4EM1A 2HR3A 4I01A 4FETA 5E20A 3LQQA 3GZNB 4XLCA 2QZ8A 4KMUX 1ETVA 2OPTA 4MEXF 1SFXA 2IS4A 3ABUA 1TT5B 2HTSA 4D9JA 1TWAJ 4CH7A 4XOTA 2QSFX 1YW7A 1YS7A 3WE2A 2NS8A 1ZG5A 1N25A 3NQOA 2DFIA 4KNYA 2R3SA 2BGCA 2MGQA 4UVCA 4DYQA 2LK2A 2RREA 2DBBA 3IH4A 2Q2EB 3OV8A 1MD0A 4BQQA 2JK3A 4EJWA 4A3FJ 1LJ9A 2V1DA 3LL7A 2CQQA 3NRVA 4UHTA 4ABZA 4MNUA 2HOTA 1FBUA 4L0YB 5IT9Z 2K7LA 4BL0B 1V55H 2KIQA 3BR3A 3K1PA 1MGTA 3H3UA 5KHDA 1PP8F 5LBQA 3E5XA 4M9SA 3RSNA 5E79C 3OIPA 3ZMTA 4ZYHA 4GDFA 4HF1A 3JTGA 4I6ZA 3MQ0A 2LSOA 3Q3SA 3C2GA 2IPQX 2L9RA 3QYEA 2Z3YA 2P5VA 3F3XA 2BHYA 4D5CA 2XVCA 3KP2A 1G3TA 2DFEA 2VKEA 3KYDB 1G3YA 2Y0SA 3IUOA 3EETA 4HX8A 2A5WA 2A6TA 2ME6A 3O2PE 3QYBA 4UB8C 2W57A 3JSPA 1WJFA 5BS6A 1J75A 1PUEE 5HS9A 3OOUA 2V1UA 2F4IA 2D1VA 1D1CA 3OYIA 1D0XA 2CQ7A 1SFUA 5DCMA 1IZ1A 4N9IA 4CGZA 2EK5A 2VXZA 4OIQF 2OTLI 1VQKI 2KFDA 5E3MA 5HDKA 4I98B 1VQ8I 2YX4A 2G7HA 3I5UA 3GW2A 5H2FC 3WTUC 2HVRA 4AVPA 2UXXA 4D7MA 1LB2A 3A0HC 2I10A 1GXQA 3LSJA 3RPUD 4YELA 3QP6A 2XB5A 3DPTA 4JQFA 1O3SA 4KISA 2DA6A 1DU0A 1GUUA 4NQWA 5TGTA 3GTGJ 1FZPB 4PSWA 4XRSA 4G7ZF 1JKPC 3JTHA 1TBXA 3ESWB 4CZCA 4I2OA 2LD5A 5LEJA 2IGMA 4ZDOA 3M7GA 1JHFA 1LE8B 5GTIC 4FX4A 4HX7A 2RDPA 2P5KA 2IXSA 4BXXJ 1K4SA 1UB9A 2MD0A 2EILH 3GTMJ 3JR9A 1ON1A 3QODA 3VWBA 3LFKA 1XN7A 3WHBA 5ICEA 3CMMA 1JXSA 4V2FA 1R9TJ 1S7OA 4PUSA 2YUSA 4RLQA 1WJAA 2L7FP 5FFZA 4QPQA 3BR2A 1P7JA 2DW4A 4S05A 4IX7A 2JSCA 3RTRA 2X48A 2QENA 1WGXA 3OYJA 4XQFA 3KETA 2M9HA 4KITB 4XKBA 5D4RA 2E1NA 1K61A 2VQHA 2ZB9A 3ROUA 4E70A 1FTZA 2HYGD 4DYCA 5E3OA 5J8CA 5IPAA 3JRGA 1JHHA 2TDXA 1ETKA 1X3WB 2WV0A 4RDUA 2JA7J 2CFOA 2D1HA 4DBRA 2G7UA 3L7WA 2EZHA 3RYRA 2X6XA 1VQ6I 2K86A 3OYNA 3BTJA 3PNYA 3SDGA 3GBGA 3BP8A 4U0WA 2ZO4A 3S17J 2DXIA 2LR8A 1OLTA 1TWGJ 4PJ0C 2KJBA 5EEGA 4OINF 3ZQIA 1N77A 1Y6IA 2DTZA 1YRNA 1R5ID 2H09A 2X1CA 1S9HA 5GAGJ 2V9PA 3FXJA 1Z21A 2O03A 1POGA 5LEKA 3ZPLA 2LP0A 3HRUA 2V7FA 3ASNH 5H20A 2NVQJ 2HXIA 2RV8A 1I3QJ 1FOXA 2MC4A 1P9QC 3MZ8A 3HRSA 5F04A 1W5CC 4EJOA 4UY8I 2R7DA 1ZREA 1R7JA 2CUFA 3PNVA 4LJZF 4BBSJ 3TEDA 1ZYRF 1OISA 4PCQA 2W48A 3CCRI 2QGUA 2KJCA 3AG2H 4AIDA 4QPOA 5D8LB 1WI3A 2UV1A 3C1DA 2X4HA 3CQZJ 4EATA 2AXTC 4YIRX 4HV5A 4EQQA 4G6TB 1J09A 3H35A 3HOTA 1FOYA 1R4NB 1FYKA 4A6DA 2XAHA 3FXRA 2X1EA 4A0ZA 2XASA 1BW6A 2TRTA 2O6GE 3ISPA 4YG2F 5DTDA 2XGXA 3R0AA 1OQYA 1RC9A 4IRHA 5LGTA 3F8NA 3JRAA 3QAHA 3KX2A 1M1EB 1VI0A 1N78A 2Y2ZA 4KT6A 2VE9A 1KQ9A 3RKQA 1F4KA 1EA3A 2ID6A 1FOKA 2LFBA 1HKQA 1MBFA 1ONVA 3QQAA 4EV0A 2FMLA 3V42A 3RCOA 1Z1DA 3WGIA 2R93J 4ENKA 3AG4H 2ZMEB 3B6AA 1W36D 4BQAA 3WU2C 3OWTA 2GBYA 2CU7A 4UUTA 3G4SI 2Y48A 3AG3H 2QSHX 3PO3J 3CJNA 2V6EA 5TJJA 5K7ZA 4HA8A 3H0GJ 2XAJA 3S1RJ 1UHMA 3SZPA 1BI0A 5K7HA 1E0EA 2W25A 3WTSC 1XB4A 3IP4B 3RQ4A 3CMEI 2R5YA 2HWVA 4A3EJ 1T0FA 3SQNA 4IKFA 4F3QA 5J40A 4G6DA 4L18B 2DYSH 2E36A 3JRDA 3PL8A 2DN0A 1B8IB 2IS6A 3MN2A 3Q0WA 2K3FA 1ZRFA 1JKOC 3IAM2 3BDDA 4AYBN 4PJLA 3BG6A 1S5LC 3LNQA 1BM9A 4XM3A 3WODF 3F9KA 1HLVA 5E1XA 3ZQ7A 1YTYA 1BIAA 3M8EA 3I56I 5F6FA 2FOWA 1MIJA 2HZTA 1P6RA 3J7ZI 1Z91A 4MGRA 1Z7UA 4JYKA 1XGSA 3UR3C 1IDYA 4KIBA 3CO6C 3I59B 3VPRA 4JP0A 3NAUA 5L3FA 2ZFWA 4IPAA 4HPQA 1FBQA 2NXNB 5J1UA 1DGRM 1IXRC 1UG0A 3BG9A 2AO9A 2L2OA 1MJAA 1VQ9I 4X6AJ 5DYMA 2LKPA 2ISYA 1F36A 2JZYA 5HS7A 3RZDJ 2E2IJ 1MMGA 1R49A 4D1QA 2OQGA 2ZMEA 1ZG1A 4G94A 3OS2A 3BG3A 3M8JA 1MH4A 1W7PA 4DBQA 3PUBA 3H5AA 1WJCA 2GXBA 1J5YA 4U7BA 2OTJI 2CW7A 4I02A 4BJ6C 2EFQA 1G3WA 3TP0A 2G9WA 2A05A 3W6JB 3CDIA 3KCCA 4F55A 5D6FA 1XGOA 2OBPA 5D5WB 1NK2P 2QKLB 3JCUC 4CYCB 2DJNA 4CSWA 2XKPA 3ZN1A 2ELKA 1KU7A 3OYKA 5FGMA 2GXGA 3CUQB 1LPQA 1FOWA 3RIRA 2K4JA 2LVSA 2XROA 2CV0A 2OCEA 2H94A 5E1WA 3FM5A 4Z2YA 3O8HA 5HNHA 3IWFA 3H3VK 5B66C 2K3PA 2EA4A 3GLXA 1JTXA 2L4AA 3FBIB 2DTRA 1T08B 1MBKA 2IGOA 4BE1A 1Y0NA 2L02A 4IHSA 5HNFA 1T0FC 3GO5A 2CYYA 1X3ZB 4RGUA 4PGGA 2Y69H 3VSKA 5D5UB 4LB5A 2OD5A 4HX4A 3K4BA 1GV5A 3U1KA 1KU2A 4IJAA 1U5TC 3EYIA 4ENJA 2FX0A 3M07A 2A6EF 4JBAA 1ACIA 1DP3A 1NG6A 2KIFA 4PDKA 3N4MA 5LRRA 3WTYC 4NB5A 3NWSA 3EYYA 4HF0A 3E5UA 4M3EA 1IN7A 3I59A 4HG2A 2BE5F 2JJ7A 1U5TB 1F9NA 2XRLA 1N75A 2L9VA 2WBMA 4RAGA 2XDVA 2CQNA 4XNFA 3GYHX 5AIQA 2QQ8A 1UHWA 1ULYA 1FBSA 4NBQA 3R60A 5IYBJ 1TNTA 4G12A 2L7MP 3CO7C 3PIOF 2ADUA 3F22A 2KKOA 2VBWA 5H6QA 1R5GA 2XGEA 3E0JB 1FMWA 1TW2A 3HHGA 2Y9YA 2PJRA 3DWLE 3FM3A 4RB1A 4RBOA 3HSEA 4HLXA 2KL4A 3MVPA 1LUJB 2DOAA 1OYWA 3V7RA 1X1CA 3TW6A 4IHYA 3KP5A 1DDNA 2MFZA 4AIJA 4IF4A 1RIOH 1TW3A 3LSKA 1E3PA 5FLVA 5HLTA 2QUFA 2VT2A 2DPDA 2W85A 3ELKA 4C3IJ 2JVGA 3R61A 1EH7A 4LK1F 1FSEA 2LMDA 1ETQA 5FROA 2VXDA 3KLOA 2ME0A 1QO0D 2LC2A 2ZC2A 3KFWX 3DTEA 1PUFB 3TO7A 2EV0A 1U9OA 1UCRA 1KZHA 3TL4X 1T98A 2WA0A 5J4VA 4EJVA 1FYLA 4P1WA 4P55A 5L3EA 5EF6A 2VL8A 2DT5A 4XR6A 2O5RA 1A6IA 3QPLA 2KT0A 2CG4A 4RGSA 3ZQHA 5IP6A 4L9VA 3M3YJ 3CUQC 5EDNA 2M8GX 2M4GA 4A2UA 1TWHJ 2LOOA 3FXOA 2BXYA 2PMUA 2YS9A 4MTDA 3K4NA 2L9SA 1GXPA 4Y17A 4IVNA 2HXOA 2Z9OA 2BOLA 2ZXIA 5CVUA 5TISC 1W0TA 3DTIA 5LRSA 4IHTA 3DKWA 3BPVA 5FLXZ 1J2XA 2DQRA 4OAZA 1QA6A 4G9YA 2MH9A 4Q48A 1ITYA 3FMSA 3GMEA 1J9IA 2PMHA 3F8CA 5ERIA 1TL8A 2L01A 2WY7Q 3I54A 3LQRA 4CHUA 3G2BA 2L9NA 2K40A 3KZZA 4AM3A 1SC7A 1FPQA 3MCZA 5DCMB 4GCVA 1ZH5A 3HKZA 5ED4A 3OYDA 4A93J 1IW7F 2E1MC 2JUCA 1Z3XA 3PIPF 4E7LA 4ZDPA 2W7NA 4RAZA 2V26A 5ICGA 4QTRA 5BPDA 2XC7A 3FWEA 3WGHA 2O7OA 3CC2I 2HKOA 5J8FA 4ZYEA 1EJ9A 1HOMA 1FP2A 1SVLA 4PFPA 3T8TA 3MKWB 4HZFA 3PFYA 2DQLA 1Z67A 2Y31A 4JOMA 1S3JA 1PDNC 4LG0A 4HV6A 2D5VA 5BMZA 1H0MA 1XGMA 3R0JA 3OOPA 1YW9A 4UUVA 3QP5A 1B9MA 2QVOA 5FO5A 1XPXA 4A3BJ 3MKYB 4A0YA 2HVQA 2BBYA 2EIKH 2EZIA 3TGNA 1GLNA 1ZAOA 4P9FA 4BU2A 1U6GA 2NOGA 3IC7A 2MLKA 3RDIA 3L09A 1G59A 4CCLA 3DCFA 4NNJA 5AIPA 3ZQQA 3O6BB 2I8DA 2MC3A 4UUSB 3A01A 2FRHA 3DKXA 1DQUA 3KEYA 1UJ8A 1SD5A 2CMPA 5L3GA 1R5HA 2H8WA 1Z7LA 1PYVA 4KN4X 2YU9J 3S14J 3I53A 2XV4S 4M9ZA 1OYYA 2WB1A 1D0ZA 2DMQA 3RKXA 4WF2A 5HS8A 3MZYA 3J7YJ 2KLOA 1BBYA 2ESHA 3K69A 5EG0A 4NDLA 2R7WA 4NHJA 4RB0A 1IDZA 3NARA 3Q5FA 3QOEA 4U0YA 3VEPA 3DEEA 1IV6A 1V5EA 1IN5A 5TRDA 4IHXA 4N4NB 3W2AA 2DT6A 1X1PA 3BLYA 2NNNA 3TOAA 3GXOA 4I7HA 4IL6C 1H89C 1AU7A 1SMTA 1U8BA 2VIXA 1WI9A 5CLSA 4DGWB 5K1YA 2OU2A 3WTTC 3GLLA 3HGGA 1RI7A 5F1RA 2DMUA 3OIQA 1QVUA 1HCRA 1X4PA 2UZKA 2K9MA 2QBYB 2GA2A 2A5YB 4BHPA 2VC0A 4IZZA 4Q4ZF 4HDUA 4RM3A 1W1WE 2ZMEC 1Q1VA 2JT1A 3CZ6A 1Y39A 2YPRA 3K4LA 4QIWN 1FMVA 1BI3A 3KEQA 1X3UA 2H6BA 2HQNA 4EMSA 2LDUA 1UAAA 3GTPJ 3AKZA 4V2GA 1IGNA 2ZXJA 4ESFA 4BDYA 3I64A 2J5PA 4XLPF 3GF2A 4FX0A 1A5JA 4OWRB 1I39A 2VJJA 1C0WA 1YS6A 4ESJA 2VB6A 1BC7C 4UVAA 2M2EA 3HM5A 2XAQA 2X51A 4M71A 1FTTA 2ZJ2A 4ZTFA 3JRIA 5IP7J 4LB6B 3VYTB 2WTEA 1IG7A 2XPUA 3QWLA 2K9SA 5BQTA 2EWNA 2OZ6A 2QYOA 3K9TA 3S1QJ 5FB2A 1X2MA 2ELHA 2LKXA 1NK3P 1VQ7I 4AUXA 3WHCA 1P92A 2W4SA 4G8XA 5A2QZ 4GYGA 2H8RA 3V8KA 1JKRC 1S29A 4UV9A 3LSPA 2JRTA 2CQXA 2A3SA 3O8GA 2W24A 3C3WA 3KEOA 2LG4A 5EJCA 4RS8A 4MIMA 3OYHA 1LEAA 2FBKA 4LFUA 1XMAA 1ZHFA 3F21A 1AKHA 1A04A 3H92A 4GYIA 1X1BA 3RPQA 2JSPA 2LYCA 3AAFA 3J7AY 2EJRA 1W5SA 3FKIJ 3EUKL 5GTHC 1D1BA 3GZ5A 3S2WA 4KFCA 1UELB 1IXSB 5GP9A 3H36A 1P7IA 3T8RA 3FXQA 2B0LA 5LD2C 1LDKB 1XMKA 2EQRA 3BZKA 1BL0A 1MZBA 2M5WA 4PJNA 1E17A 3ABTA 2HFHA 1Z05A 3MD2A 3DPUA 4FISA 2H1KA 1DPUA 1FLIA 5CVVA 1T38A 2VQGA 2CQKA 2L7ZA 1D5VA 1BC8C 4C9YA 2ZKZA 1LDJA 2VKVA 3LSGA 3BC8A 5FLMJ 4G7HF 3DKYA 3H9GA 4F91B 5HLHA 4C2MJ 1TC3C 4EGZA 3I0TA 1IRGA 2ETHA 2M45A 3GUDA 3BOQA 3ZGKA 1SAXA 4S04A 2Y75A 2UWMA 3ML6A 4FE7A 1YX5A 3S3NA 3TO9A 4C3HJ 1R23A 1YJNI 4AVZA 1Y0UA 5K5QA 3CJRB 1DPRA 3H5RA 4C2TA 3WU1B 2BV6A 2W00A 1J0RA 3AG1H 4HEA2 4N4OB 1SAUA 4AD9A 4ENNA 3QU3A 4XORA 1LFPA 1SVMA 3H9QA 2BY1A 2XF5A 3ZRGA 2IBDA 3G6EI 3S15J 3F72A 1BW5A 2XSJC 2ID3A 3I4PA 1CGPA 4F52A 1ZTRA 4I0AA 1LFUP 1K6OA 4ZJZA 2V6CA 4IQJA 2Y9ZA 2MLGA 1MNMC 3REOA 2R7RA 2P81A 2ZSHB 3C2BA 2ZNZA 1LEBA 2LTPA 3DTKA 1R71A 2PJRB 3ZP5A 1LQ1A 3U2RA 1XS9A 4OIOF 4AU7A 3PSIA 1OJLA 2VJ4A 3L1PA 5D4SA 4BE0A 2K5CA 5CQGA 5K5OA 2AS5F 2P8TA 4C3JJ 2LY1A 4XKCA 1DU6A 2R7FA 5E17F 5B3SH 3BT9A 3WG9A 4HQMA 1YX3A 3C7JA 5BNGA 4Z6YA 3JAMK 2Z99A 1WHUA 3LSHA 1ENHA 3W6KB 2AQFA 3QPTA 4O3MA 4XLEA 3DU6A 3GCMA 4L9NA 5FFXA 3WTXC 3CP2A 1OCTC 3HRMA 2VT3A 3HOSA 2KIMA 4AYBA 3AL0C 1U0JA 4CCJA 4BJTA 2ACJA 2EIJH 4BH9A 3OMYA 4BEHA 1MBEA 1RKWA 1VQOI 4ZYDA 2FF4A 4C30A 2JQ7A 3ZR8X 3JAMZ 3K4KA 3E6DA 1ZRDA 3FMRA 1R1TA 2XF6A 3SJMA 3AL0B 1T56A 3OL3A 1XGNA 2WY8Q 5C4JJ 3HUGB 1IAWA 3MMYB 5M5WJ 3OYLA 3L2WA 2EPFA 2DDAA 3JRFA 1TLHB 3CLOA 4WX9A 5IOZA 2PI0A 2K4BA 1MJ9A 3CUQA 1K78A 2DOFA 3TDZC 2FSWA 1OR7A 4GXOA 1JJ8C 2GAUA 1R6RA 1UMQA 2QKMB 3C18A 4XLHA 5F0CA 2F5EA 4S0HB 2HYJA 3SDBA 4U7DA 3K70C 3HEFA 4BAYA 5C44J 4XL9A 1JUPA 2XAGA 4D5FA 4XSZF 2CV2A 4NC8A 5E8GA 4EEFG 2XGCA 1ZRCA 2CW0F 1HSJA 3KP4A 2ICWG 4E6KG 3DF8A 1JUSA 2ZXWH 2GIZA 2IS1A 4B3XA 2XPWA 2KZGA 4IOAF 3FK6A 4OIRF 2FMYA 2BEOA 1TQMA 2YR2A 3S2HJ 3HOZJ 4EJUA 1CF7B 3KIOA 4B47A 2DLLA 5HLIA 3GWZA 2WADA 1JTYA 1SMYF 3K1NA 4CO8A 1XDSA 2O8XA 1D3YA 4XK4A 2IW5A 2R4GA 1TQIA 1XMXA 4KYWA 3IH3A 2F5FA 2ECBA 5HODA 2LBFB 5FRNA 3RKWA 2EA2A 1D5YA 4TV7A 1FSHA 2Q1ZB 2HDCA 1SFKA 3FK7A 1R4MB 1ON2A 1YIOA 1VF9A 1HSTA 2ZJPF 3DBHB 1E2XA 1T95A 2VBZA 4L5EA 2LY9A 5JFRA 2QEXI 1SD4A 2ESNA 2DODA 2ZNYA 1EKEA 4E7HA 1L0OC 2PFBA 4XOPA 3ZXSA 1LVAA 3DFGA 4A3IJ 2JPCA 2RAEA 2CUJA 2IGKA 1Y8QB 3CJTB 3OSFA 2FOKA 4OMZA 1BIBA 1IUFA 1S7EA 2M34A 5K5RA 2K27A 4DYRA 2EBIA 4J00A 2Y0MA 2WAFA 2DFHA 2FNAA 3TP3A 3BROA 3EPZA 2QSGX 1MMAA 4Y4RA 3I4MJ 4MTEA 2DPUA 3LSMA 5M5YJ 1QZYA 2Q8KA 5H6RA 2IJLA 3TBIA 5L3BA 2OCCH 3PUFA 3Q9SA 3WG7H 4M3BA 3ZMDA 1K83J 3K0LA 4CZZA 5DUKA 5IYCJ 2J5OA 2MSYA 5EZGA 3HOXJ 1LDDA 5FRMA 4FE4A 3ZCOA 1HDDC 2CGPA 5HDGA 3R6SA 2WC2A 4ZDLA 4O5VA 3WTVC 1TWFJ 4YIIA 1QVTA 1RRJA 1AHDP 4HBLA 4HSRA 4D0PA 2Y30A 1Z9CA 1TWCJ 4NC7A 1TQPA 3IRQA 4WXDA 3GZ6A 5F64A 1MKMA 2BYVE 2EFOA 5KAIC 5K7FA 1AWCA 2EB7A 1ZK8A 2A07F 3E6MA 4RGRA 4NC6A 2E35A 5L3DA 4CICA 5E3NA 5LHGA 2XHKA 1REPC 3OYGA 2X0LA 1GV2A 3BZ6A 2GOXB 3HXLA 3SXYA 3F6VA 1FEXA 4EGYA 2VLAA 5E18F 3CJQB 1SANA 4HNTA 4KA4A 1G6NA 1B9NA 1JJ6C 3GTLJ 3B02A 5DUIA 3PFIA 4GO1A 2NAZA 4GGGA 2TCTA 3QPHA 4R1HA 1K6YA 3IV5A 2CSOA 2L5QA 2Z1DA 2KDOA 2ZFUA 3CC7I 3GFMA 2YX7A 2R7OA 2MD5A 4WWCA 5FJ8J 4P96A 2P7VB 4EM2A 4YFNF 4MO7A 1V3FA 4W1UA 4AWXB 2HPMA 3A2KA 3COAC 3U21A 2E71A 4MLOA 5J3LA 3GEZA 3HZJA 2HKXA 2EV5A 5J1RA 3H1CA 1YITI 4AC0A 3FMQA 1P4WA 1LKXA 1KQ0A 1IRXA 2PMZA 3WGGA 2FA5A 2VQCA 2A69F 1ETXA 4B09A 3CUOA 3F8BA 1HBXG 1NHAA 1TZLA 2VKDA 2X6WA 5JVGF 3GTQJ 4FT8A 4UV8A 2YSRA 1MMSA 1VQPI 1U3EM 1HKSA 4HYEA 3OL4A 2PQ8A 3I4NJ 1JI8A 1IXCA 4UNOA 3ONQA 1SD7A 2QLZA 2R0QC 2W82A 4BXUA 4BS9A 3BJ6A 1VFCA 2XAFA 3W3CA 2LY2A 1SEUA 1I5ZA 1W5TA 2CW8A 3OSGA 2JRMA 2EFPA 5CKTA 4M3FA 4JX5A 1QZZA 3OY9A 3KZIC 3ASOH 3TMOA 2BY0A 2JN6A 1T39A 3CCLI 2F5CA 3BJOA 4XRFA 3HOWJ 1QU3A 1MMNA 1BR4A 4RAYA 4M3DA 2GXAA 5L3CA 1J59A 3J7AO 3RQIA 3W2WA 3HB9A 2R7QA 3WE3A 4E4HA 3S3MA 4ZC3A 2L4MA 1RUOA 5LHIA 1LVKA 3P9IA 1IRFA 2L0KA 1SFEA 2NNYA 3KP7A 2EZLA 1WJ5A 1YFHA 5EGOB 1YJWI 3SZTA 2VODA 5IT3A 3QPSA 3W6VA 3L00A 3H3ZA 1YIJI 2X9DA 4RA2A 1A35A 2F2EA 3S1MJ 3HBLA 5AONA 5GAEJ 3ZOBA 1WJEA 2P7CB 2R7XA 3P9KA 1XSVA 1WH5A 3CF5F 1O7FA 2F4MB 5F0FA 1VNDA 3CDHA 3LFUA 4XONA 3OR1C 1FX7A 3K70D 2NYXA 3G73A 4A3CJ 4A5MA 3KYCB 1G2HA 3ZQFA 3I71A 4WXHA 3CP8A 2CRGA 2QQBA 1OMIA 1KYZA 1QZEA 3D5RC 2BHZA 3RYPA 1V5GA 5JLXA 5M3MJ 1I6HJ 2XB0X 2EH3A 1GVDA 3RPUA 1OCPA 4DIQA 3DP7A 3HPGA 1PP7U 3MZHA 2CS3A 2WAEA 5IYDJ 1TP4A 3DLAA 4ZYAA 3ZMSA 4MFDA 4ANJA 1S8NA 3K4MA 4F92B 3BQYA 3KP6A 3CCEI 5JI6A 4LMYA 3F6OA 1R1UA 1KQ8A 3CCJI 1EH6A 1U8RA 1DP7P 2HZDA 5HLGA 3M1CA 2QM3A 4KDPA 2C6YA 2DA2A 2DDBA 3CCYA 3G1LA 3A03A 4FCYA 3GTOJ 4BEHB 3M8FA 4CCMA 4BJ5C 3HKZN 5DDGA 4X0GA 2M30A 2DI3A 2CWEA 4BXFA 3QOPA 2KISA 2Z33A 1GVJA 3K2AA 3FXUA 4DJAA 3MKZA 3HG9A 3S32A 2BW3B 2BY2A 2GIVA 3AFHA 1WFXA 3HHHA 5D6EA 1CF7A 2HQRA 1OCZH 1YW8A 2E2JJ 4JX6A 1F5TA 2RQPA 2ZCWA 3DEUA 4W97A 1I50J 2DA3A 2QQAA 3LMMA 5ICCA 2BY3A 5C4XJ 1T6SA 1E3HA 2UUZA 4RGXA 4B48A 1ZQ3P 3CD6I 3FIWA 1MW7A 2DJIA 3E97A 5GPCA 1FC3A 5JHUA 3DXJF 2NVXJ 2CUEA 1ZKGA 3LA2A 2G0EA 2DMTA 1U5TA 4F93B 3JREA 1ZGJA 1IV8A 4CCNA 3HIFA 4PJJA 1X19A 1AA7A 1KU9A 3D0SA 2ZXHA 1O4XA 1U2WA 2YU3A 3L2UA 2VBYA 1DGWY 4M6VA 4CDGA 1MBHA 1RESA 3VDXA 3G1MA 1AKHB 3E3VA 3DU5A 1HKTA 4I76A 5IT9K 2BVMA 3OYCA 2HDDA 4A3KJ 5FKLA 6PAXA 3RI4A 1BI2A 3IAS2 3NWTA 4KIFA 2XRNA 2JUGA 1ZGAA 1ORKA 3JW4A 4A3DJ 5EYRA 1Y1VJ 4LLGF 3PNTA 3L2CA 5CVJA 1HF0A 1UHSA 5F08A 2Z2SB 2HI3A 2EIMH 2CJJA 3ABMH 2CV1A 3BR5A 2JVHA 4CYCA 2DA1A 1BJZA 2CH0A 2F6CA 2MH2A 2VI6A 3EQLF 2XF7A 3RKYA 1HA8A 3E6CC 3IWZA 5DD4A 4FHTA 1IRZA 4I0BA 4CUGA 1A31A 1WQ2A 2NOJB 2E2HJ 4XLFA 3T5XA 4H0EA 4JX4A 5KAFC 1XDUA 2WB1N 1A36A 1W7PB 3OYAA 3D5LA 1GT0C 3V8JA 4KUMA 5C3EJ 3N97A 3LSIA 1VTNC 2FXAA 2GWRA 2ZJQF 3OYBA 2PBIA 3EDPA 5ILVA 4A3GJ 4H4KC 1Z3YA 1FNNA 3VYUB 3DQVC 1F43A 4XN0A 2HEOA 3DPLC 3D5SC 4HAMA 4CCOA 2VPRA 1OCRH 4I99C 1ZR2A 5LFAA 1EF4A 2VBXA 2R5YB 1YYVA 1X1AA 1WZ2A 1STZA 1WKMA 2IEKA 2LLKA 4Q47A 3PSFA 3UKGA 1H88C 2RNJA 3OIOA 2IVMA 5FD5A 2WAQA 2L3DA 2RC4A 2KRHA 1O57A 1NG7A 1VQNI 3WTWC 1IN4A 1Y1WJ 2R7ZJ 3V7CA 3SEQA 1E3OC 1VQ5I 2OJED 3A01B 1K79A 1XCVA 1FP1D 3FXKA 2L54A 4LOCA 2LNBA 4LIVA 2JA2A 4Y7NJ 1B72A 3T0YA 3BTLA 4R8HA 2COMA 2XGDA 4R79A 2STWA 1APLC 4IOCF 1MBGA 3HC7A 1ZLJA 2KIUA 4HSTA 4HNUA 3CF2A 3IH2A 1JT6A 2R5ZB 1YG2A 3PO2J 1JT0A 2CUZA 2R7SA 1CQTA 4FASD 2EFNA 4ETSA 1B1BA 2ECCA 4L0ZB 2ELJA 2MA3A 1XSDA 5B1BH 3CMAI 3A1YA 1W7PD 4EM0B 1X1DA 1RZ4A 1U9NA 1H9TA 4PJMA 3HOVJ 3E7LA 4F7ZA 2FU4A 2WAQN 3TOBA 4QLCU 4UB6C 4X1EA 5D8KB 4PSXA 4HLYA 2HPIA 3HSFA 2QBYA 4DW6A 1JGGA 3H0DA 3K7AJ 3CLQA 1Y56A 3M9AA 3NEUA 2MW8A 2IP2A 1B4AA 2JA8J 4AIHA 5DS9A 1QGPA 3I58A 4XIDA 1R58A 3ABKH 3EUHA 5B1AH 1QHHD 2P5LC 2RVCA 5D5VB 1RKTA 1RR7A 2AXLA 3HOYJ 4BQNA 1FT9A 4KICA 4NQWB 5HOOA 1ETOA 2N8GA 5IP9J 1ZARA 1G3SA 4L9TA 2V4JC 3M4OJ 3GVAA 3O3KA 1YQAA 4MEYF 5GPAA 3V7SA 1T2KA 2MBFA 1LFBA 1OCCH 2RQQA 3IKVA 2IA0A 1F1ZA 1H9GA 2W1OA 3F8MA 5LLQA 3CTAA 3J80Z 3W2VA 4BBRJ 3A4CA 4XICA 5KNLA 3FXLA 3LA3A 1RPWA 2M7BA 3DLLF 1V4RA 3J81K 1GHCA 3T1BA 2R92J 3V4GA 1K7AA 4ESBA 4RB3C 1D0YA 2EZKA 2FJ1A 1PVEA 4E7JA 1WWXA 4L5IA 5F0HA 4AIKA 1YJ9I 4HQEA 1KA8A 4HRIA 1SVOA 4C2UA 3HL2A 1RR8C 3ECOA 2A61A 1WCMJ 3CESA 1W4MA 2B7EA 4XKVA 1P4XA 1FIPA 3BZCA 4KIGA 4PZJA 4K2EA 3MFKA 2KRFA 3JRHA 2NVYJ 4BUPA 3X2QH 4HOBA 4B4CA 2XAUA 1XSXA 3GFIA 4M9XA 3TDUC 5ILSA 2M1BA 1VQ4I 2VUMJ 4DZPA 4MQ9F 4BHBA 2E19A 3SZGA 5ILUA 3FHNA 2K9LA 1QHGA 2GQQA 2K02A 5B5EC 2CFXA 2E1CA 1WSUA 4XBFA 1OPCA 3LA7A 2P4WA 3SYTA 2A68F 2OAZA 2F5VA 1P4AA 1H8AC 2VASA 1NTCA 4EVIA 4J19A 4RM2A 2ZBKA 4KMFA 3S3OA 1I1GA 4KT5C 3FZVA 1ZR4A 2XIGA 3Q0UA 2E7WA 3HPHA 2DCEA 2A6HF 2QF7A 2PJPA 3HOUJ 5JHFA 1JUMA 5F27A 3BG5A 2O9LA 4A69C 2E1OA 1IJWC 4Q5SF 2FUG2 1X2NA 2DA5A 2DFFA 5KK1A 2OZUA 4U0VA 3GFLA 1Z77A 2HDWA 1RNLA 4RLFA 4ZH4F 4OMYA 1T33A 2EV6A 1FY7A 2M0CA 1XD7A 3F23A 3MWMA 1YRNB 4GFBA 4Y33A 1PUFA 3K4CA 3KYLA 2HNHA 1FIAA 1MNEA 3BPXA 2LH9A 1T8IA 3VOEA 2O0YA 4IRGA 4QSHA 4ZYGA 5J6XA 2KMUA 3LAJA 4IHWA 2RKHA 4M3GA 2L7KA 4IEJA 4II3A 3G3ZA 4LLLA 2W84A 4JK1X 4U88A 3HRTA 1S7AA 2HOSA 2QWWA 4O6JA 4MFEA 1FYMA 3OYFA 3CCSI 3GX4X 3DBLB 2I5UA 2HYFA 2P0WA 4WXCA 4B44A 4UUSA 3ZQCA 1X58A 2DO7A 3P7NA 2OA4A 4PK4A 2COBA 4HW0A 5DCFA 2JWTA 2FBHA 2RN7A 4ON0A 3ZN0A 2DA7A 2VC1A 3WU0A 5JR3A 1K78B 2GLOA 2VE8A 4LK0F 2FBIA 4ZTJA 5DV5A 1MJBA 4M72A 3GTKJ 4ZZDA 1Z6TA 2Q0OA 4E7ZA 1MNDA 3R4KA 4I09A 1IN6A 4G7OF 2VPLA 3KPHA 2HOAA 2XSDC 1I6XA 3U9GA 3BG7A 4YFXF 4J01A 1USTA 1EV7A 1MMDA 3LWFA 2KHMA 4UVBA 1GDTA 3IL2A 5FKKA 3G71I 3LOCA 2GA1A 1KGSA 4ASNA 1RUNA 4YRVA 3A0BC 3HSRA 2F4OB 4P5OA 2B63J 3U1DA 3H9JA 2JTVA 1D8KA 1ZGWA 1MDMB 2VONA 1BA5A 1ETYA 2VKHA 4PFOA 3VYRB 4U87A 2Y0SN 3FHZA 5GADJ 4FQGA 5M5XJ 4A0XA 4BY1J 3ABLH 3IRRA 2UXNA 2AQEA 3FKJA 3SFIA 2MABA 2V1NA 3FX3A 2E7XA 2VOOA 2HTJA 1ZN2A 3K6GA 2KRCA 5CPRB 4E7KA 1R22A 4Y13A 4M6YA 1IO2A 1WH7A 4L9JA 3ZMUA 3BCAA 5M3FJ 2XKOA 1FJLA 2X6YA 3B6CA 3BR0A 5FKOA 3LSRA 2RGVA 1JE8A 3PM1A 2R5ZA 2M87A 1V5FA 3RJPA 4BY7J 1S72I 1JGSA 5A2QK 2HU9A 2D45A 3BQZA 2NS7A 1W0UA 2FE3A 1SD6A 4WCGA 2PG4A 2IS2A 1MH3A 3PQJA 2K85A 5GAHJ 1MSFC 1OKRA 2HOEA 3WTZA 1WJBA 4DZJA 3DV8A 2H27A 3VYSB 4LG0B 3OS0A 1XC5A 3Q0VA 1K4TA 4N9HA 4XLNF 2WWYA 3CC4I 3CDLA 3JRBA 1L3LA 5FLXK 2FQ3A 3I9V2 3ZQGA 4XRSG 4PGHA 3BCBA 4BQOA 1VQLI 1WJDA 2X6OA 2Q2EA 2NS0A 5HDNA 3FISA 2PMZN 4BE2A 1ODDA 3F8FA 3CMYA 4LIUA 3BY6A 4V19K 1UFMA 4L5JA 4N0BA 3CCVI 3MAJA 1J7KA 5IOYA 5CYVA 5DD8A 4RMNA
chains in the Genus database with same CATH topology
3MD2A 3DPUA 4F93B 2VQGA 1BR1A 4QPOA 4C9YA 2UV1A 2VJ5A 4CCNA 4LG3A 4PJJA 1X19A 1AA7A 4EATA 3L2VA 1OR7C 2ZXHA 3BC8A 3LSGA 4Y3OA 3DKYA 3L2UA 4G6TB 1J09A 3H9GA 4F91B 3C2HA 1YE9A 3H35A 3HOTA 1DGWY 3VDXA 2X1EA 1W36C 3DU5A 1ERDA 1BR2A 2BVMA 4CA0A 3OYCA 2KPMA 3ZGKA 3KX2A 2UWMA 1YX5A 3S3NA 1N78A 4KT6A 3IAS2 4AVZA 3NWTA 3CJRB 1EA3A 3H5RA 2JUGA 3I3LA 4C2TA 3V42A 3RCOA 2W00A 4HEA2 4N4OB 1SAUA 3EUHC 4OAYA 2LREA 4XORA 1LFPA 3PNTA 3H9QA 3UNGC 2XF5A 1W36D 3ZRGA 2Z2SB 3OWTA 2CV1A 2HVSA 4BACA 2JVHA 2XSJC 4BGDA 4IQ4A 2F6CA 2CH0A 2V6EA 4F52A 2XF7A 2R7UA 3L2RA 1D1AA 1HA8A 3OYMA 2M3AA 4ZJZA 4IQJA 4CUGA 1E0EA 2R7RA 3SEZA 2ZSHB 3OS1A 3IP4B 3RQ4A 2NOJB 3DTKA 4XLFA 2PJRB 1G8XA 3OYAA 3D5LA 4AU7A 4II2A 3PSIA 2VJ4A 4IKFA 4F3QA 3LSIA 4BE0A 2K5CA 5CQGA 3PL8A 2IS6A 2LY1A 3H5NA 4XKCA 3OYBA 4H4KC 1Z3YA 3VYUB 3DQVC 3IAM2 4XN0A 1YX3A 3DPLC 4PJLA 3BG6A 3D5SC 4XM3A 3F9KA 3LSHA 4CCOA 5LFAA 3L2QA 2AQFA 2HQAA 1X1AA 3DU6A 4XLEA 3UR3C 3CP2A 4HPQA 3HOSA 3PSFA 4AYBA 3AL0C 1U0JA 4CCJA 4BJTA 1DGRM 1UG0A 5CQEA 2L2OA 3OMYA 4BEHA 2WAQA 2Z16A 2KRHA 4C30A 1MMGA 1NG7A 3OYEA 4D1QA 3ZR8X 3K4KA 3SEQA 3OS2A 2VQLA 3AL0B 2BW3A 2XF6A 3M8JA 3PJRA 4DBQA 3PUBA 3H5AA 1WJCA 3OL3A 2WY8Q 1ZELA 2CW7A 4U7BA 3HUGB 4BJ6C 3MMYB 4LIVA 2JA2A 1X4OA 3OYLA 4DOZA 3L2WA 2DT7B 4GRIA 4F55A 2QKLB 4R79A 4CSWA 3HC7A 4HSTA 3OYKA 4HNUA 3CF2A 2R7VA 3EUAA 2CV0A 2V9KA 1R6RA 2CUZA 2QKMB 4XLHA 2R7SA 1TT0A 3SDBA 3N05A 5HNHA 3K70C 2K3PA 4FASD 3FBIB 4CCKA 4XL9A 2IGOA 2ELJA 4BE1A 2CV2A 2E5ZA 1T0FC 3A1YA 4NC8A 5HNFA 1X1DA 2OV7A 4XLAA 4PJMA 2KQRA 2MYSA 1BOBA 3VSKA 4E6KG 4PSXA 2HPIA 3K4BA 2E5NA 2ZSIB 2E1MB 2IS1A 4B3XA 3H0DA 4ITVA 1Y56A 1DP3A 5KCMA 1NG6A 4XN3A 3VSLA 1KONA 5HVQC 3NWSA 4B47A 2KZVA 4XMYA 4HG2A 1QHHD 2WADA 1N75A 2M0MA 4E7SA 2R4GA 2WBMA 2M7AA 2XDVA 3OR2C 4XNFA 4BQNA 2LBFB 5FRNA 4NQWB 5HOOA 2Q1ZB 1SFKA 2V4JC 4BDZA 4E7IA 3E0JB 2R7TA 1FMWA 1T95A 2X85A 2RQQA 2PJRA 2RNGA 3DWLE 2W1OA 1PJRA 4E7HA 2KL4A 2DOAA 4XOPA 1VZ0A 1X1CA 3W2VA 2KP6A 3ZXSA 3A4CA 2GOMA 2MFZA 5KNLA 2CUJA 2M4KA 2IGKA 2M7BA 3LSKA 5HLTA 2LRDA 1D0YA 2IGNA 4J00A 2JVGA 4E7JA 2VJIA 2WAFA 2OC6A 3S8PA 4HRIA 3EPZA 2BVLA 4C2UA 1MMAA 4Y4RA 3HL2A 5FROA 2VXDA 4XKWA 2LC2A 3CESA 3FDYA 4XKVA 4LITA 3DTEA 3LSMA 3TBIA 3TL4X 4BUPA 2WA0A 3E1SA 4YEJA 3QYFA 2XAUA 4P1WA 2VL8A 4XR6A 2O5RA 3K4JA 5FRMA 3ZCOA 3K10A 4ZDLA 2LBFA 3SZGA 2M4GA 2K9LA 3FHNA 1QHGA 2LOOA 4HSRA 4NUBA 2E60A 2OUMA 3K4NA 4NC7A 2L9SA 3SYTA 3S93A 2X1DA 2BOLA 2ZXIA 4B43A 2F5VA 3FBNB 3DTIA 2VASA 4KJZA 4FETA 4OAZA 4RM2A 3S3OA 4XLCA 3OYGA 3HPHA 2DCEA 2WY7Q 2IS4A 3G2BA 5JHFA 4D9JA 2L9NA 2GOXB 3HXLA 4CH7A 4XOTA 2VLAA 3CJQB 4HNTA 3HKZA 3OYDA 2E1MC 4E7LA 1Z3XA 4ZDPA 2FUG2 2RREA 2W7NA 2Q2EB 2V26A 1K6YA 4BQQA 2L5QA 2Z1DA 2XC7A 2HDWA 2KDOA 2ZFUA 3LL7A 4RLFA 2R7OA 4PFPA 3MKWB 4BL0B 4Y33A 3PFYA 2HPMA 3A2KA 3U21A 3K4CA 3KYLA 2HNHA 5KHDA 1MNEA 4JOMA 2LH9A 4MLOA 3RSNA 2KMUA 3OIPA 2L7KA 4II3A 3MKYB 2HVQA 1LKXA 3C2GA 3QYEA 1GLNA 1IRXA 2PMZA 2VQCA 4BU2A 3OYFA 1G59A 2P0WA 4CCLA 4NNJA 3ZQQA 4B44A 2I8DA 1TZLA 2VKDA 2X6WA 2Y0SA 3IUOA 3DKXA 1DQUA 2A5WA 3KEYA 2A6TA 4PK4A 3QYBA 2CMPA 1Z7LA 1WJFA 1PYVA 3OL4A 3OOUA 1JI8A 2F4IA 1D1CA 3ONQA 3OYIA 1D0XA 2W82A 4BS9A 4ZTJA 3W3CA 2WB1A 2LY2A 1D0ZA 2VXZA 2CW8A 2KLOA 5CKTA 4E7ZA 2HVRA 1MNDA 3OY9A 2R7WA 2VPLA 3TMOA 3QOEA 3DEEA 3BG7A 1V5EA 4J01A 4N4NB 3W2AA 2DT6A 3BLYA 1MMNA 1BR4A 3RPUD 1QU3A 1MMDA 2KHMA 4YELA 2VIXA 3DPTA 4JQFA 4DGWB 4KISA 3W2WA 2R7QA 5TGTA 4E4HA 3S3MA 4ZC3A 4PSWA 3OIQA 1LVKA 1X4PA 4CZCA 2K9MA 1WJ5A 2IGMA 4ZDOA 4IZZA 4YRVA 4RM3A 4P5OA 2IXSA 3CZ6A 3H9JA 2MD0A 1WJEA 3K4LA 2R7XA 1FMVA 2VKHA 3QODA 4PFOA 3VWBA 3VYRB 3LFUA 4U87A 4XONA 3OR1C 3K70D 1UAAA 3CMMA 4PUSA 3AKZA 3CP8A 4RLQA 1WJAA 3D5RC 1V5GA 2AQEA 3FKJA 2MABA 2V1NA 4QPQA 4BDYA 4IX7A 3K6GA 2KRCA 5CPRB 4E7KA 3RTRA 4DIQA 3HPGA 3OYJA 4OWRB 4XQFA 2CS3A 2WAEA 4KITB 4XKBA 2VJJA 3BCAA 3DLAA 4ZYAA 2VQHA 2VB6A 4ANJA 2X6YA 3K4MA 2X51A 4F92B 4ZTFA 1V5FA 3VYTB 2HU9A 2HZDA 2CFOA 4DBRA 3M1CA 2IS2A 2X6XA 4BEHB 2W4SA 1WJBA 4CCMA 3OYNA 3VYSB 3PNYA 3OS0A 4BJ5C 3GBGA 4X0GA 2DXIA 1OLTA 4BXFA 1N77A 1Y6IA 2X1CA 3I9V2 1S9HA 4DJAA 3MKZA 3HG9A 3S32A 2BW3B 2LG4A 1Z21A 3AFHA 1WFXA 3OYHA 3BCBA 4BQOA 2V7FA 1WJDA 1X1BA 2JSPA 2LYCA 3J7AY 2MC4A 1P9QC 3EUKL 4BE2A 1D1BA 3LMMA 1UELB 4LIUA 5LD2C 1LDKB 2UUZA 4B48A 1MW7A 2DJIA 3PNVA 4PJNA 4RMNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HRI A;  3QOD A;  3QOE A;  4IZZ A;  4YRV A;  4J00 A;  4J01 A; 
#chains in the Genus database with same CATH topology
 1Z6R A;  3LST A;  2EFW A;  1G4D A;  3VB2 A;  1V54 H;  2IA2 A;  4Y52 J;  1BR1 A;  3FF5 A;  2VJ5 A;  4LG3 A;  3ECH A;  3L2V A;  1OR7 C;  4Y3O A;  5E3L A;  3ERM A;  3C2H A;  1YE9 A;  4YIF A;  2K9Q A;  4CYD A;  1W36 C;  3LAP A;  3Q9V A;  4OIP F;  1QRY A;  1ERD A;  1BR2 A;  4B3A A;  4EJT A;  4CA0 A;  5CVI A;  2KPM A;  3JRC A;  1LNW A;  2PN6 A;  1MSE C;  1TTY A;  3D1N I;  1FWZ A;  2H1L A;  3HGY A;  3BTI A;  3S1N J;  3I3L A;  1I3A A;  3L9F A;  2WV1 A;  5KVR A;  1A6Q A;  2LF7 A;  2M8E A;  5LGU A;  5JVT A;  1SFO J;  3EUH C;  3KE2 A;  2LRE A;  1R1V A;  4OAY A;  5F1J A;  3UNG C;  2VN2 A;  1OFC X;  4MQV A;  2HVS A;  4BAC A;  4BGD A;  4IQ4 A;  4M6X A;  1IF1 A;  1D8J A;  1OCO H;  2DAO A;  3S2D J;  3M1E A;  2NVU B;  2F48 A;  4A3J J;  3L2R A;  1D1A A;  2DMN A;  3OYM A;  2DU9 A;  1U78 A;  5EEA A;  2M3A A;  1WVR A;  4RAF A;  3TO6 A;  2FD5 A;  3GTJ J;  3BR6 A;  1I27 A;  1YO5 C;  3HUG A;  3SEZ A;  3IKT A;  3OS1 A;  3QRF F;  1USS A;  2HGC A;  2D2W A;  4UXN A;  1QNT A;  1G8X A;  4MHG A;  3VFZ A;  3HJE A;  1BJA A;  4II2 A;  5BPI A;  1ZLK A;  3TW7 A;  3CCM I;  5CJ9 A;  3H5N A;  1B59 A;  4IHV A;  2PLY A;  3KZY A;  4IRI A;  1B8I A;  2IRF G;  2E34 A;  3HTU A;  2P6S A;  3BWG A;  2V79 A;  3ZMZ A;  1Z0X A;  1XCB A;  3FXM A;  9ANT A;  3L2Q A;  3KP3 A;  2HQA A;  1EH8 A;  5JLW A;  2JA5 J;  5FKM A;  4CXF A;  5EGO A;  2B9S A;  1QQI A;  3B73 A;  3P9C A;  1UZC A;  3BR1 A;  3G1O A;  2IAI A;  5CQE A;  4BYY A;  3I55 I;  2LKS A;  1DUX C;  3CCU I;  1BI1 A;  3HDD A;  4XSX F;  1BN5 A;  4YFK F;  4ENM A;  2Z16 A;  2H6C A;  3OYE A;  3DEW A;  2V1X A;  4IO9 F;  1NH3 A;  1KU3 A;  2VQL A;  2DA4 A;  2F5D A;  4LGW A;  1YHQ I;  2BW3 A;  3PJR A;  5DM6 F;  3KLN A;  1XTA A;  3J80 K;  5IY5 H;  4RB2 C;  1ZEL A;  3ERE D;  4A5N A;  2DOE A;  3MKL A;  3E6B A;  4OOI A;  5EG0 B;  1X4O A;  1TNS A;  4QWQ A;  3VOD A;  5DM7 F;  4DNC A;  4DOZ A;  3QU6 A;  2DT7 B;  4GRI A;  4KN7 X;  4B1R A;  1IN8 A;  2V9V A;  2QCO A;  3A02 A;  2R7V A;  3ZMV A;  2NVT J;  4G6Q A;  3EUA A;  4LD5 A;  2MG4 A;  1B6A A;  2V9K A;  3E5Q A;  3CCQ I;  5BOX A;  2O8K A;  1TT0 A;  3N05 A;  1BOA A;  2DMP A;  1KYW A;  2K9N A;  3PQK A;  2BXZ A;  5LHH A;  4CCK A;  1YLF A;  1OYI A;  3IHU A;  1ZG3 A;  4P9U A;  1MDM A;  2NRA C;  2E5Z A;  4Y15 A;  2OV7 A;  1IUY A;  2AHQ A;  2FNP A;  4XLA A;  2STT A;  1QBJ A;  1O3T A;  2FQ4 A;  2KQR A;  2MYS A;  1HC8 A;  1BOB A;  4B8X A;  5FKN A;  2E5N A;  2ZSI B;  1XX5 A;  2E1M B;  4OU0 A;  2ZJR F;  2R7U A;  5D5X B;  4BKX A;  4ITV A;  3J81 Z;  2IT0 A;  5KCM A;  4XN3 A;  3VSL A;  1KON A;  2IA1 A;  5EZH A;  3DBR B;  1QPM A;  2O61 A;  5HVQ C;  4LLN A;  4HNV A;  5J47 A;  3RZO J;  2KZV A;  4XMY A;  1Q1H A;  3HYI A;  4ZZL A;  5CVR A;  2OQR A;  2QQ9 A;  2M0M A;  1R36 A;  5E8I A;  4E7S A;  3ZQL A;  4DQ2 A;  2M7A A;  3OR2 C;  4D7N A;  2OF7 A;  2XPV A;  3BJA A;  2ISZ A;  1P2F A;  3JSO A;  4WK8 F;  4A6E A;  3P5J A;  4BNC A;  5J4Y A;  3S16 J;  1WRJ A;  4BDZ A;  4E7I A;  4IXA A;  1HDP A;  1HW2 A;  2R7T A;  2PX9 A;  3V8L A;  1YI2 I;  5LGN A;  2X85 A;  1VQM I;  3ULQ B;  1YOV B;  2RNG A;  4HDV A;  1PJR A;  4XRM A;  1ETW A;  4M74 A;  1MBJ A;  3HTS B;  1VZ0 A;  3MEX A;  2KP6 A;  1HQC A;  2EIN H;  2GOM A;  1QPI A;  2LF8 A;  2M4K A;  4BHC A;  1WPK A;  5FD6 A;  1Y8R B;  4A3M J;  2LRD A;  2VOP A;  2IGN A;  1O7L A;  1JKQ C;  3SFZ A;  2JMW A;  2VJI A;  1HW1 A;  2OC6 A;  3S8P A;  4HF2 A;  2BVL A;  3F0C A;  1B72 B;  2XUB A;  2FEZ A;  2GZW A;  4XKW A;  3K1M A;  2DK5 A;  3FDY A;  1O3Q A;  1R00 A;  4LIT A;  3TQN A;  2GM4 A;  2HQ5 A;  2HS5 A;  5J1Y A;  1IC8 A;  3SHF A;  3TKY A;  3E1S A;  4YEJ A;  3QYF A;  2QA4 I;  4FTH A;  1UG2 A;  4A12 A;  2JA6 J;  1AOY A;  2P6T A;  2KDZ A;  1O3R A;  2DK8 A;  1S6L A;  2O3F A;  5DEQ A;  1LE8 A;  1XG1 A;  2CO5 A;  3K4J A;  3K10 A;  1HXD A;  3BTC A;  2BZT A;  2LBF A;  2JPB A;  3K2Z A;  5E1Z B;  1I1S A;  3GFJ A;  5ICF A;  2Z5U A;  1RET A;  4A3L J;  4NUB A;  2E60 A;  2OUM A;  2PEX A;  1HW5 A;  3S93 A;  2X1D A;  4B43 A;  2DYR H;  5EEH A;  3FBN B;  4M73 A;  4KJZ A;  4EM1 A;  2HR3 A;  4I01 A;  4FET A;  5E20 A;  3LQQ A;  3GZN B;  4XLC A;  2QZ8 A;  4KMU X;  1ETV A;  2OPT A;  4MEX F;  1SFX A;  2IS4 A;  3ABU A;  1TT5 B;  2HTS A;  4D9J A;  1TWA J;  4CH7 A;  4XOT A;  2QSF X;  1YW7 A;  1YS7 A;  3WE2 A;  2NS8 A;  1ZG5 A;  1N25 A;  3NQO A;  2DFI A;  4KNY A;  2R3S A;  2BGC A;  2MGQ A;  4UVC A;  4DYQ A;  2LK2 A;  2RRE A;  2DBB A;  3IH4 A;  2Q2E B;  3OV8 A;  1MD0 A;  4BQQ A;  2JK3 A;  4EJW A;  4A3F J;  1LJ9 A;  2V1D A;  3LL7 A;  2CQQ A;  3NRV A;  4UHT A;  4ABZ A;  4MNU A;  2HOT A;  1FBU A;  4L0Y B;  5IT9 Z;  2K7L A;  4BL0 B;  1V55 H;  2KIQ A;  3BR3 A;  3K1P A;  1MGT A;  3H3U A;  5KHD A;  1PP8 F;  5LBQ A;  3E5X A;  4M9S A;  3RSN A;  5E79 C;  3OIP A;  3ZMT A;  4ZYH A;  4GDF A;  4HF1 A;  3JTG A;  4I6Z A;  3MQ0 A;  2LSO A;  3Q3S A;  3C2G A;  2IPQ X;  2L9R A;  3QYE A;  2Z3Y A;  2P5V A;  3F3X A;  2BHY A;  4D5C A;  2XVC A;  3KP2 A;  1G3T A;  2DFE A;  2VKE A;  3KYD B;  1G3Y A;  2Y0S A;  3IUO A;  3EET A;  4HX8 A;  2A5W A;  2A6T A;  2ME6 A;  3O2P E;  3QYB A;  4UB8 C;  2W57 A;  3JSP A;  1WJF A;  5BS6 A;  1J75 A;  1PUE E;  5HS9 A;  3OOU A;  2V1U A;  2F4I A;  2D1V A;  1D1C A;  3OYI A;  1D0X A;  2CQ7 A;  1SFU A;  5DCM A;  1IZ1 A;  4N9I A;  4CGZ A;  2EK5 A;  2VXZ A;  4OIQ F;  2OTL I;  1VQK I;  2KFD A;  5E3M A;  5HDK A;  4I98 B;  1VQ8 I;  2YX4 A;  2G7H A;  3I5U A;  3GW2 A;  5H2F C;  3WTU C;  2HVR A;  4AVP A;  2UXX A;  4D7M A;  1LB2 A;  3A0H C;  2I10 A;  1GXQ A;  3LSJ A;  3RPU D;  4YEL A;  3QP6 A;  2XB5 A;  3DPT A;  4JQF A;  1O3S A;  4KIS A;  2DA6 A;  1DU0 A;  1GUU A;  4NQW A;  5TGT A;  3GTG J;  1FZP B;  4PSW A;  4XRS A;  4G7Z F;  1JKP C;  3JTH A;  1TBX A;  3ESW B;  4CZC A;  4I2O A;  2LD5 A;  5LEJ A;  2IGM A;  4ZDO A;  3M7G A;  1JHF A;  1LE8 B;  5GTI C;  4FX4 A;  4HX7 A;  2RDP A;  2P5K A;  2IXS A;  4BXX J;  1K4S A;  1UB9 A;  2MD0 A;  2EIL H;  3GTM J;  3JR9 A;  1ON1 A;  3QOD A;  3VWB A;  3LFK A;  1XN7 A;  3WHB A;  5ICE A;  3CMM A;  1JXS A;  4V2F A;  1R9T J;  1S7O A;  4PUS A;  2YUS A;  4RLQ A;  1WJA A;  2L7F P;  5FFZ A;  4QPQ A;  3BR2 A;  1P7J A;  2DW4 A;  4S05 A;  4IX7 A;  2JSC A;  3RTR A;  2X48 A;  2QEN A;  1WGX A;  3OYJ A;  4XQF A;  3KET A;  2M9H A;  4KIT B;  4XKB A;  5D4R A;  2E1N A;  1K61 A;  2VQH A;  2ZB9 A;  3ROU A;  4E70 A;  1FTZ A;  2HYG D;  4DYC A;  5E3O A;  5J8C A;  5IPA A;  3JRG A;  1JHH A;  2TDX A;  1ETK A;  1X3W B;  2WV0 A;  4RDU A;  2JA7 J;  2CFO A;  2D1H A;  4DBR A;  2G7U A;  3L7W A;  2EZH A;  3RYR A;  2X6X A;  1VQ6 I;  2K86 A;  3OYN A;  3BTJ A;  3PNY A;  3SDG A;  3GBG A;  3BP8 A;  4U0W A;  2ZO4 A;  3S17 J;  2DXI A;  2LR8 A;  1OLT A;  1TWG J;  4PJ0 C;  2KJB A;  5EEG A;  4OIN F;  3ZQI A;  1N77 A;  1Y6I A;  2DTZ A;  1YRN A;  1R5I D;  2H09 A;  2X1C A;  1S9H A;  5GAG J;  2V9P A;  3FXJ A;  1Z21 A;  2O03 A;  1POG A;  5LEK A;  3ZPL A;  2LP0 A;  3HRU A;  2V7F A;  3ASN H;  5H20 A;  2NVQ J;  2HXI A;  2RV8 A;  1I3Q J;  1FOX A;  2MC4 A;  1P9Q C;  3MZ8 A;  3HRS A;  5F04 A;  1W5C C;  4EJO A;  4UY8 I;  2R7D A;  1ZRE A;  1R7J A;  2CUF A;  3PNV A;  4LJZ F;  4BBS J;  3TED A;  1ZYR F;  1OIS A;  4PCQ A;  2W48 A;  3CCR I;  2QGU A;  2KJC A;  3AG2 H;  4AID A;  4QPO A;  5D8L B;  1WI3 A;  2UV1 A;  3C1D A;  2X4H A;  3CQZ J;  4EAT A;  2AXT C;  4YIR X;  4HV5 A;  4EQQ A;  4G6T B;  1J09 A;  3H35 A;  3HOT A;  1FOY A;  1R4N B;  1FYK A;  4A6D A;  2XAH A;  3FXR A;  2X1E A;  4A0Z A;  2XAS A;  1BW6 A;  2TRT A;  2O6G E;  3ISP A;  4YG2 F;  5DTD A;  2XGX A;  3R0A A;  1OQY A;  1RC9 A;  4IRH A;  5LGT A;  3F8N A;  3JRA A;  3QAH A;  3KX2 A;  1M1E B;  1VI0 A;  1N78 A;  2Y2Z A;  4KT6 A;  2VE9 A;  1KQ9 A;  3RKQ A;  1F4K A;  1EA3 A;  2ID6 A;  1FOK A;  2LFB A;  1HKQ A;  1MBF A;  1ONV A;  3QQA A;  4EV0 A;  2FML A;  3V42 A;  3RCO A;  1Z1D A;  3WGI A;  2R93 J;  4ENK A;  3AG4 H;  2ZME B;  3B6A A;  1W36 D;  4BQA A;  3WU2 C;  3OWT A;  2GBY A;  2CU7 A;  4UUT A;  3G4S I;  2Y48 A;  3AG3 H;  2QSH X;  3PO3 J;  3CJN A;  2V6E A;  5TJJ A;  5K7Z A;  4HA8 A;  3H0G J;  2XAJ A;  3S1R J;  1UHM A;  3SZP A;  1BI0 A;  5K7H A;  1E0E A;  2W25 A;  3WTS C;  1XB4 A;  3IP4 B;  3RQ4 A;  3CME I;  2R5Y A;  2HWV A;  4A3E J;  1T0F A;  3SQN A;  4IKF A;  4F3Q A;  5J40 A;  4G6D A;  4L18 B;  2DYS H;  2E36 A;  3JRD A;  3PL8 A;  2DN0 A;  1B8I B;  2IS6 A;  3MN2 A;  3Q0W A;  2K3F A;  1ZRF A;  1JKO C;  3IAM 2;  3BDD A;  4AYB N;  4PJL A;  3BG6 A;  1S5L C;  3LNQ A;  1BM9 A;  4XM3 A;  3WOD F;  3F9K A;  1HLV A;  5E1X A;  3ZQ7 A;  1YTY A;  1BIA A;  3M8E A;  3I56 I;  5F6F A;  2FOW A;  1MIJ A;  2HZT A;  1P6R A;  3J7Z I;  1Z91 A;  4MGR A;  1Z7U A;  4JYK A;  1XGS A;  3UR3 C;  1IDY A;  4KIB A;  3CO6 C;  3I59 B;  3VPR A;  4JP0 A;  3NAU A;  5L3F A;  2ZFW A;  4IPA A;  4HPQ A;  1FBQ A;  2NXN B;  5J1U A;  1DGR M;  1IXR C;  1UG0 A;  3BG9 A;  2AO9 A;  2L2O A;  1MJA A;  1VQ9 I;  4X6A J;  5DYM A;  2LKP A;  2ISY A;  1F36 A;  2JZY A;  5HS7 A;  3RZD J;  2E2I J;  1MMG A;  1R49 A;  4D1Q A;  2OQG A;  2ZME A;  1ZG1 A;  4G94 A;  3OS2 A;  3BG3 A;  3M8J A;  1MH4 A;  1W7P A;  4DBQ A;  3PUB A;  3H5A A;  1WJC A;  2GXB A;  1J5Y A;  4U7B A;  2OTJ I;  2CW7 A;  4I02 A;  4BJ6 C;  2EFQ A;  1G3W A;  3TP0 A;  2G9W A;  2A05 A;  3W6J B;  3CDI A;  3KCC A;  4F55 A;  5D6F A;  1XGO A;  2OBP A;  5D5W B;  1NK2 P;  2QKL B;  3JCU C;  4CYC B;  2DJN A;  4CSW A;  2XKP A;  3ZN1 A;  2ELK A;  1KU7 A;  3OYK A;  5FGM A;  2GXG A;  3CUQ B;  1LPQ A;  1FOW A;  3RIR A;  2K4J A;  2LVS A;  2XRO A;  2CV0 A;  2OCE A;  2H94 A;  5E1W A;  3FM5 A;  4Z2Y A;  3O8H A;  5HNH A;  3IWF A;  3H3V K;  5B66 C;  2K3P A;  2EA4 A;  3GLX A;  1JTX A;  2L4A A;  3FBI B;  2DTR A;  1T08 B;  1MBK A;  2IGO A;  4BE1 A;  1Y0N A;  2L02 A;  4IHS A;  5HNF A;  1T0F C;  3GO5 A;  2CYY A;  1X3Z B;  4RGU A;  4PGG A;  2Y69 H;  3VSK A;  5D5U B;  4LB5 A;  2OD5 A;  4HX4 A;  3K4B A;  1GV5 A;  3U1K A;  1KU2 A;  4IJA A;  1U5T C;  3EYI A;  4ENJ A;  2FX0 A;  3M07 A;  2A6E F;  4JBA A;  1ACI A;  1DP3 A;  1NG6 A;  2KIF A;  4PDK A;  3N4M A;  5LRR A;  3WTY C;  4NB5 A;  3NWS A;  3EYY A;  4HF0 A;  3E5U A;  4M3E A;  1IN7 A;  3I59 A;  4HG2 A;  2BE5 F;  2JJ7 A;  1U5T B;  1F9N A;  2XRL A;  1N75 A;  2L9V A;  2WBM A;  4RAG A;  2XDV A;  2CQN A;  4XNF A;  3GYH X;  5AIQ A;  2QQ8 A;  1UHW A;  1ULY A;  1FBS A;  4NBQ A;  3R60 A;  5IYB J;  1TNT A;  4G12 A;  2L7M P;  3CO7 C;  3PIO F;  2ADU A;  3F22 A;  2KKO A;  2VBW A;  5H6Q A;  1R5G A;  2XGE A;  3E0J B;  1FMW A;  1TW2 A;  3HHG A;  2Y9Y A;  2PJR A;  3DWL E;  3FM3 A;  4RB1 A;  4RBO A;  3HSE A;  4HLX A;  2KL4 A;  3MVP A;  1LUJ B;  2DOA A;  1OYW A;  3V7R A;  1X1C A;  3TW6 A;  4IHY A;  3KP5 A;  1DDN A;  2MFZ A;  4AIJ A;  4IF4 A;  1RIO H;  1TW3 A;  3LSK A;  1E3P A;  5FLV A;  5HLT A;  2QUF A;  2VT2 A;  2DPD A;  2W85 A;  3ELK A;  4C3I J;  2JVG A;  3R61 A;  1EH7 A;  4LK1 F;  1FSE A;  2LMD A;  1ETQ A;  5FRO A;  2VXD A;  3KLO A;  2ME0 A;  1QO0 D;  2LC2 A;  2ZC2 A;  3KFW X;  3DTE A;  1PUF B;  3TO7 A;  2EV0 A;  1U9O A;  1UCR A;  1KZH A;  3TL4 X;  1T98 A;  2WA0 A;  5J4V A;  4EJV A;  1FYL A;  4P1W A;  4P55 A;  5L3E A;  5EF6 A;  2VL8 A;  2DT5 A;  4XR6 A;  2O5R A;  1A6I A;  3QPL A;  2KT0 A;  2CG4 A;  4RGS A;  3ZQH A;  5IP6 A;  4L9V A;  3M3Y J;  3CUQ C;  5EDN A;  2M8G X;  2M4G A;  4A2U A;  1TWH J;  2LOO A;  3FXO A;  2BXY A;  2PMU A;  2YS9 A;  4MTD A;  3K4N A;  2L9S A;  1GXP A;  4Y17 A;  4IVN A;  2HXO A;  2Z9O A;  2BOL A;  2ZXI A;  5CVU A;  5TIS C;  1W0T A;  3DTI A;  5LRS A;  4IHT A;  3DKW A;  3BPV A;  5FLX Z;  1J2X A;  2DQR A;  4OAZ A;  1QA6 A;  4G9Y A;  2MH9 A;  4Q48 A;  1ITY A;  3FMS A;  3GME A;  1J9I A;  2PMH A;  3F8C A;  5ERI A;  1TL8 A;  2L01 A;  2WY7 Q;  3I54 A;  3LQR A;  4CHU A;  3G2B A;  2L9N A;  2K40 A;  3KZZ A;  4AM3 A;  1SC7 A;  1FPQ A;  3MCZ A;  5DCM B;  4GCV A;  1ZH5 A;  3HKZ A;  5ED4 A;  3OYD A;  4A93 J;  1IW7 F;  2E1M C;  2JUC A;  1Z3X A;  3PIP F;  4E7L A;  4ZDP A;  2W7N A;  4RAZ A;  2V26 A;  5ICG A;  4QTR A;  5BPD A;  2XC7 A;  3FWE A;  3WGH A;  2O7O A;  3CC2 I;  2HKO A;  5J8F A;  4ZYE A;  1EJ9 A;  1HOM A;  1FP2 A;  1SVL A;  4PFP A;  3T8T A;  3MKW B;  4HZF A;  3PFY A;  2DQL A;  1Z67 A;  2Y31 A;  4JOM A;  1S3J A;  1PDN C;  4LG0 A;  4HV6 A;  2D5V A;  5BMZ A;  1H0M A;  1XGM A;  3R0J A;  3OOP A;  1YW9 A;  4UUV A;  3QP5 A;  1B9M A;  2QVO A;  5FO5 A;  1XPX A;  4A3B J;  3MKY B;  4A0Y A;  2HVQ A;  2BBY A;  2EIK H;  2EZI A;  3TGN A;  1GLN A;  1ZAO A;  4P9F A;  4BU2 A;  1U6G A;  2NOG A;  3IC7 A;  2MLK A;  3RDI A;  3L09 A;  1G59 A;  4CCL A;  3DCF A;  4NNJ A;  5AIP A;  3ZQQ A;  3O6B B;  2I8D A;  2MC3 A;  4UUS B;  3A01 A;  2FRH A;  3DKX A;  1DQU A;  3KEY A;  1UJ8 A;  1SD5 A;  2CMP A;  5L3G A;  1R5H A;  2H8W A;  1Z7L A;  1PYV A;  4KN4 X;  2YU9 J;  3S14 J;  3I53 A;  2XV4 S;  4M9Z A;  1OYY A;  2WB1 A;  1D0Z A;  2DMQ A;  3RKX A;  4WF2 A;  5HS8 A;  3MZY A;  3J7Y J;  2KLO A;  1BBY A;  2ESH A;  3K69 A;  5EG0 A;  4NDL A;  2R7W A;  4NHJ A;  4RB0 A;  1IDZ A;  3NAR A;  3Q5F A;  3QOE A;  4U0Y A;  3VEP A;  3DEE A;  1IV6 A;  1V5E A;  1IN5 A;  5TRD A;  4IHX A;  4N4N B;  3W2A A;  2DT6 A;  1X1P A;  3BLY A;  2NNN A;  3TOA A;  3GXO A;  4I7H A;  4IL6 C;  1H89 C;  1AU7 A;  1SMT A;  1U8B A;  2VIX A;  1WI9 A;  5CLS A;  4DGW B;  5K1Y A;  2OU2 A;  3WTT C;  3GLL A;  3HGG A;  1RI7 A;  5F1R A;  2DMU A;  3OIQ A;  1QVU A;  1HCR A;  1X4P A;  2UZK A;  2K9M A;  2QBY B;  2GA2 A;  2A5Y B;  4BHP A;  2VC0 A;  4IZZ A;  4Q4Z F;  4HDU A;  4RM3 A;  1W1W E;  2ZME C;  1Q1V A;  2JT1 A;  3CZ6 A;  1Y39 A;  2YPR A;  3K4L A;  4QIW N;  1FMV A;  1BI3 A;  3KEQ A;  1X3U A;  2H6B A;  2HQN A;  4EMS A;  2LDU A;  1UAA A;  3GTP J;  3AKZ A;  4V2G A;  1IGN A;  2ZXJ A;  4ESF A;  4BDY A;  3I64 A;  2J5P A;  4XLP F;  3GF2 A;  4FX0 A;  1A5J A;  4OWR B;  1I39 A;  2VJJ A;  1C0W A;  1YS6 A;  4ESJ A;  2VB6 A;  1BC7 C;  4UVA A;  2M2E A;  3HM5 A;  2XAQ A;  2X51 A;  4M71 A;  1FTT A;  2ZJ2 A;  4ZTF A;  3JRI A;  5IP7 J;  4LB6 B;  3VYT B;  2WTE A;  1IG7 A;  2XPU A;  3QWL A;  2K9S A;  5BQT A;  2EWN A;  2OZ6 A;  2QYO A;  3K9T A;  3S1Q J;  5FB2 A;  1X2M A;  2ELH A;  2LKX A;  1NK3 P;  1VQ7 I;  4AUX A;  3WHC A;  1P92 A;  2W4S A;  4G8X A;  5A2Q Z;  4GYG A;  2H8R A;  3V8K A;  1JKR C;  1S29 A;  4UV9 A;  3LSP A;  2JRT A;  2CQX A;  2A3S A;  3O8G A;  2W24 A;  3C3W A;  3KEO A;  2LG4 A;  5EJC A;  4RS8 A;  4MIM A;  3OYH A;  1LEA A;  2FBK A;  4LFU A;  1XMA A;  1ZHF A;  3F21 A;  1AKH A;  1A04 A;  3H92 A;  4GYI A;  1X1B A;  3RPQ A;  2JSP A;  2LYC A;  3AAF A;  3J7A Y;  2EJR A;  1W5S A;  3FKI J;  3EUK L;  5GTH C;  1D1B A;  3GZ5 A;  3S2W A;  4KFC A;  1UEL B;  1IXS B;  5GP9 A;  3H36 A;  1P7I A;  3T8R A;  3FXQ A;  2B0L A;  5LD2 C;  1LDK B;  1XMK A;  2EQR A;  3BZK A;  1BL0 A;  1MZB A;  2M5W A;  4PJN A;  1E17 A;  3ABT A;  2HFH A;  1Z05 A;  3MD2 A;  3DPU A;  4FIS A;  2H1K A;  1DPU A;  1FLI A;  5CVV A;  1T38 A;  2VQG A;  2CQK A;  2L7Z A;  1D5V A;  1BC8 C;  4C9Y A;  2ZKZ A;  1LDJ A;  2VKV A;  3LSG A;  3BC8 A;  5FLM J;  4G7H F;  3DKY A;  3H9G A;  4F91 B;  5HLH A;  4C2M J;  1TC3 C;  4EGZ A;  3I0T A;  1IRG A;  2ETH A;  2M45 A;  3GUD A;  3BOQ A;  3ZGK A;  1SAX A;  4S04 A;  2Y75 A;  2UWM A;  3ML6 A;  4FE7 A;  1YX5 A;  3S3N A;  3TO9 A;  4C3H J;  1R23 A;  1YJN I;  4AVZ A;  1Y0U A;  5K5Q A;  3CJR B;  1DPR A;  3H5R A;  4C2T A;  3WU1 B;  2BV6 A;  2W00 A;  1J0R A;  3AG1 H;  4HEA 2;  4N4O B;  1SAU A;  4AD9 A;  4ENN A;  3QU3 A;  4XOR A;  1LFP A;  1SVM A;  3H9Q A;  2BY1 A;  2XF5 A;  3ZRG A;  2IBD A;  3G6E I;  3S15 J;  3F72 A;  1BW5 A;  2XSJ C;  2ID3 A;  3I4P A;  1CGP A;  4F52 A;  1ZTR A;  4I0A A;  1LFU P;  1K6O A;  4ZJZ A;  2V6C A;  4IQJ A;  2Y9Z A;  2MLG A;  1MNM C;  3REO A;  2R7R A;  2P81 A;  2ZSH B;  3C2B A;  2ZNZ A;  1LEB A;  2LTP A;  3DTK A;  1R71 A;  2PJR B;  3ZP5 A;  1LQ1 A;  3U2R A;  1XS9 A;  4OIO F;  4AU7 A;  3PSI A;  1OJL A;  2VJ4 A;  3L1P A;  5D4S A;  4BE0 A;  2K5C A;  5CQG A;  5K5O A;  2AS5 F;  2P8T A;  4C3J J;  2LY1 A;  4XKC A;  1DU6 A;  2R7F A;  5E17 F;  5B3S H;  3BT9 A;  3WG9 A;  4HQM A;  1YX3 A;  3C7J A;  5BNG A;  4Z6Y A;  3JAM K;  2Z99 A;  1WHU A;  3LSH A;  1ENH A;  3W6K B;  2AQF A;  3QPT A;  4O3M A;  4XLE A;  3DU6 A;  3GCM A;  4L9N A;  5FFX A;  3WTX C;  3CP2 A;  1OCT C;  3HRM A;  2VT3 A;  3HOS A;  2KIM A;  4AYB A;  3AL0 C;  1U0J A;  4CCJ A;  4BJT A;  2ACJ A;  2EIJ H;  4BH9 A;  3OMY A;  4BEH A;  1MBE A;  1RKW A;  1VQO I;  4ZYD A;  2FF4 A;  4C30 A;  2JQ7 A;  3ZR8 X;  3JAM Z;  3K4K A;  3E6D A;  1ZRD A;  3FMR A;  1R1T A;  2XF6 A;  3SJM A;  3AL0 B;  1T56 A;  3OL3 A;  1XGN A;  2WY8 Q;  5C4J J;  3HUG B;  1IAW A;  3MMY B;  5M5W J;  3OYL A;  3L2W A;  2EPF A;  2DDA A;  3JRF A;  1TLH B;  3CLO A;  4WX9 A;  5IOZ A;  2PI0 A;  2K4B A;  1MJ9 A;  3CUQ A;  1K78 A;  2DOF A;  3TDZ C;  2FSW A;  1OR7 A;  4GXO A;  1JJ8 C;  2GAU A;  1R6R A;  1UMQ A;  2QKM B;  3C18 A;  4XLH A;  5F0C A;  2F5E A;  4S0H B;  2HYJ A;  3SDB A;  4U7D A;  3K70 C;  3HEF A;  4BAY A;  5C44 J;  4XL9 A;  1JUP A;  2XAG A;  4D5F A;  4XSZ F;  2CV2 A;  4NC8 A;  5E8G A;  4EEF G;  2XGC A;  1ZRC A;  2CW0 F;  1HSJ A;  3KP4 A;  2ICW G;  4E6K G;  3DF8 A;  1JUS A;  2ZXW H;  2GIZ A;  2IS1 A;  4B3X A;  2XPW A;  2KZG A;  4IOA F;  3FK6 A;  4OIR F;  2FMY A;  2BEO A;  1TQM A;  2YR2 A;  3S2H J;  3HOZ J;  4EJU A;  1CF7 B;  3KIO A;  4B47 A;  2DLL A;  5HLI A;  3GWZ A;  2WAD A;  1JTY A;  1SMY F;  3K1N A;  4CO8 A;  1XDS A;  2O8X A;  1D3Y A;  4XK4 A;  2IW5 A;  2R4G A;  1TQI A;  1XMX A;  4KYW A;  3IH3 A;  2F5F A;  2ECB A;  5HOD A;  2LBF B;  5FRN A;  3RKW A;  2EA2 A;  1D5Y A;  4TV7 A;  1FSH A;  2Q1Z B;  2HDC A;  1SFK A;  3FK7 A;  1R4M B;  1ON2 A;  1YIO A;  1VF9 A;  1HST A;  2ZJP F;  3DBH B;  1E2X A;  1T95 A;  2VBZ A;  4L5E A;  2LY9 A;  5JFR A;  2QEX I;  1SD4 A;  2ESN A;  2DOD A;  2ZNY A;  1EKE A;  4E7H A;  1L0O C;  2PFB A;  4XOP A;  3ZXS A;  1LVA A;  3DFG A;  4A3I J;  2JPC A;  2RAE A;  2CUJ A;  2IGK A;  1Y8Q B;  3CJT B;  3OSF A;  2FOK A;  4OMZ A;  1BIB A;  1IUF A;  1S7E A;  2M34 A;  5K5R A;  2K27 A;  4DYR A;  2EBI A;  4J00 A;  2Y0M A;  2WAF A;  2DFH A;  2FNA A;  3TP3 A;  3BRO A;  3EPZ A;  2QSG X;  1MMA A;  4Y4R A;  3I4M J;  4MTE A;  2DPU A;  3LSM A;  5M5Y J;  1QZY A;  2Q8K A;  5H6R A;  2IJL A;  3TBI A;  5L3B A;  2OCC H;  3PUF A;  3Q9S A;  3WG7 H;  4M3B A;  3ZMD A;  1K83 J;  3K0L A;  4CZZ A;  5DUK A;  5IYC J;  2J5O A;  2MSY A;  5EZG A;  3HOX J;  1LDD A;  5FRM A;  4FE4 A;  3ZCO A;  1HDD C;  2CGP A;  5HDG A;  3R6S A;  2WC2 A;  4ZDL A;  4O5V A;  3WTV C;  1TWF J;  4YII A;  1QVT A;  1RRJ A;  1AHD P;  4HBL A;  4HSR A;  4D0P A;  2Y30 A;  1Z9C A;  1TWC J;  4NC7 A;  1TQP A;  3IRQ A;  4WXD A;  3GZ6 A;  5F64 A;  1MKM A;  2BYV E;  2EFO A;  5KAI C;  5K7F A;  1AWC A;  2EB7 A;  1ZK8 A;  2A07 F;  3E6M A;  4RGR A;  4NC6 A;  2E35 A;  5L3D A;  4CIC A;  5E3N A;  5LHG A;  2XHK A;  1REP C;  3OYG A;  2X0L A;  1GV2 A;  3BZ6 A;  2GOX B;  3HXL A;  3SXY A;  3F6V A;  1FEX A;  4EGY A;  2VLA A;  5E18 F;  3CJQ B;  1SAN A;  4HNT A;  4KA4 A;  1G6N A;  1B9N A;  1JJ6 C;  3GTL J;  3B02 A;  5DUI A;  3PFI A;  4GO1 A;  2NAZ A;  4GGG A;  2TCT A;  3QPH A;  4R1H A;  1K6Y A;  3IV5 A;  2CSO A;  2L5Q A;  2Z1D A;  2KDO A;  2ZFU A;  3CC7 I;  3GFM A;  2YX7 A;  2R7O A;  2MD5 A;  4WWC A;  5FJ8 J;  4P96 A;  2P7V B;  4EM2 A;  4YFN F;  4MO7 A;  1V3F A;  4W1U A;  4AWX B;  2HPM A;  3A2K A;  3COA C;  3U21 A;  2E71 A;  4MLO A;  5J3L A;  3GEZ A;  3HZJ A;  2HKX A;  2EV5 A;  5J1R A;  3H1C A;  1YIT I;  4AC0 A;  3FMQ A;  1P4W A;  1LKX A;  1KQ0 A;  1IRX A;  2PMZ A;  3WGG A;  2FA5 A;  2VQC A;  2A69 F;  1ETX A;  4B09 A;  3CUO A;  3F8B A;  1HBX G;  1NHA A;  1TZL A;  2VKD A;  2X6W A;  5JVG F;  3GTQ J;  4FT8 A;  4UV8 A;  2YSR A;  1MMS A;  1VQP I;  1U3E M;  1HKS A;  4HYE A;  3OL4 A;  2PQ8 A;  3I4N J;  1JI8 A;  1IXC A;  4UNO A;  3ONQ A;  1SD7 A;  2QLZ A;  2R0Q C;  2W82 A;  4BXU A;  4BS9 A;  3BJ6 A;  1VFC A;  2XAF A;  3W3C A;  2LY2 A;  1SEU A;  1I5Z A;  1W5T A;  2CW8 A;  3OSG A;  2JRM A;  2EFP A;  5CKT A;  4M3F A;  4JX5 A;  1QZZ A;  3OY9 A;  3KZI C;  3ASO H;  3TMO A;  2BY0 A;  2JN6 A;  1T39 A;  3CCL I;  2F5C A;  3BJO A;  4XRF A;  3HOW J;  1QU3 A;  1MMN A;  1BR4 A;  4RAY A;  4M3D A;  2GXA A;  5L3C A;  1J59 A;  3J7A O;  3RQI A;  3W2W A;  3HB9 A;  2R7Q A;  3WE3 A;  4E4H A;  3S3M A;  4ZC3 A;  2L4M A;  1RUO A;  5LHI A;  1LVK A;  3P9I A;  1IRF A;  2L0K A;  1SFE A;  2NNY A;  3KP7 A;  2EZL A;  1WJ5 A;  1YFH A;  5EGO B;  1YJW I;  3SZT A;  2VOD A;  5IT3 A;  3QPS A;  3W6V A;  3L00 A;  3H3Z A;  1YIJ I;  2X9D A;  4RA2 A;  1A35 A;  2F2E A;  3S1M J;  3HBL A;  5AON A;  5GAE J;  3ZOB A;  1WJE A;  2P7C B;  2R7X A;  3P9K A;  1XSV A;  1WH5 A;  3CF5 F;  1O7F A;  2F4M B;  5F0F A;  1VND A;  3CDH A;  3LFU A;  4XON A;  3OR1 C;  1FX7 A;  3K70 D;  2NYX A;  3G73 A;  4A3C J;  4A5M A;  3KYC B;  1G2H A;  3ZQF A;  3I71 A;  4WXH A;  3CP8 A;  2CRG A;  2QQB A;  1OMI A;  1KYZ A;  1QZE A;  3D5R C;  2BHZ A;  3RYP A;  1V5G A;  5JLX A;  5M3M J;  1I6H J;  2XB0 X;  2EH3 A;  1GVD A;  3RPU A;  1OCP A;  4DIQ A;  3DP7 A;  3HPG A;  1PP7 U;  3MZH A;  2CS3 A;  2WAE A;  5IYD J;  1TP4 A;  3DLA A;  4ZYA A;  3ZMS A;  4MFD A;  4ANJ A;  1S8N A;  3K4M A;  4F92 B;  3BQY A;  3KP6 A;  3CCE I;  5JI6 A;  4LMY A;  3F6O A;  1R1U A;  1KQ8 A;  3CCJ I;  1EH6 A;  1U8R A;  1DP7 P;  2HZD A;  5HLG A;  3M1C A;  2QM3 A;  4KDP A;  2C6Y A;  2DA2 A;  2DDB A;  3CCY A;  3G1L A;  3A03 A;  4FCY A;  3GTO J;  4BEH B;  3M8F A;  4CCM A;  4BJ5 C;  3HKZ N;  5DDG A;  4X0G A;  2M30 A;  2DI3 A;  2CWE A;  4BXF A;  3QOP A;  2KIS A;  2Z33 A;  1GVJ A;  3K2A A;  3FXU A;  4DJA A;  3MKZ A;  3HG9 A;  3S32 A;  2BW3 B;  2BY2 A;  2GIV A;  3AFH A;  1WFX A;  3HHH A;  5D6E A;  1CF7 A;  2HQR A;  1OCZ H;  1YW8 A;  2E2J J;  4JX6 A;  1F5T A;  2RQP A;  2ZCW A;  3DEU A;  4W97 A;  1I50 J;  2DA3 A;  2QQA A;  3LMM A;  5ICC A;  2BY3 A;  5C4X J;  1T6S A;  1E3H A;  2UUZ A;  4RGX A;  4B48 A;  1ZQ3 P;  3CD6 I;  3FIW A;  1MW7 A;  2DJI A;  3E97 A;  5GPC A;  1FC3 A;  5JHU A;  3DXJ F;  2NVX J;  2CUE A;  1ZKG A;  3LA2 A;  2G0E A;  2DMT A;  1U5T A;  4F93 B;  3JRE A;  1ZGJ A;  1IV8 A;  4CCN A;  3HIF A;  4PJJ A;  1X19 A;  1AA7 A;  1KU9 A;  3D0S A;  2ZXH A;  1O4X A;  1U2W A;  2YU3 A;  3L2U A;  2VBY A;  1DGW Y;  4M6V A;  4CDG A;  1MBH A;  1RES A;  3VDX A;  3G1M A;  1AKH B;  3E3V A;  3DU5 A;  1HKT A;  4I76 A;  5IT9 K;  2BVM A;  3OYC A;  2HDD A;  4A3K J;  5FKL A;  6PAX A;  3RI4 A;  1BI2 A;  3IAS 2;  3NWT A;  4KIF A;  2XRN A;  2JUG A;  1ZGA A;  1ORK A;  3JW4 A;  4A3D J;  5EYR A;  1Y1V J;  4LLG F;  3PNT A;  3L2C A;  5CVJ A;  1HF0 A;  1UHS A;  5F08 A;  2Z2S B;  2HI3 A;  2EIM H;  2CJJ A;  3ABM H;  2CV1 A;  3BR5 A;  2JVH A;  4CYC A;  2DA1 A;  1BJZ A;  2CH0 A;  2F6C A;  2MH2 A;  2VI6 A;  3EQL F;  2XF7 A;  3RKY A;  1HA8 A;  3E6C C;  3IWZ A;  5DD4 A;  4FHT A;  1IRZ A;  4I0B A;  4CUG A;  1A31 A;  1WQ2 A;  2NOJ B;  2E2H J;  4XLF A;  3T5X A;  4H0E A;  4JX4 A;  5KAF C;  1XDU A;  2WB1 N;  1A36 A;  1W7P B;  3OYA A;  3D5L A;  1GT0 C;  3V8J A;  4KUM A;  5C3E J;  3N97 A;  3LSI A;  1VTN C;  2FXA A;  2GWR A;  2ZJQ F;  3OYB A;  2PBI A;  3EDP A;  5ILV A;  4A3G J;  4H4K C;  1Z3Y A;  1FNN A;  3VYU B;  3DQV C;  1F43 A;  4XN0 A;  2HEO A;  3DPL C;  3D5S C;  4HAM A;  4CCO A;  2VPR A;  1OCR H;  4I99 C;  1ZR2 A;  5LFA A;  1EF4 A;  2VBX A;  2R5Y B;  1YYV A;  1X1A A;  1WZ2 A;  1STZ A;  1WKM A;  2IEK A;  2LLK A;  4Q47 A;  3PSF A;  3UKG A;  1H88 C;  2RNJ A;  3OIO A;  2IVM A;  5FD5 A;  2WAQ A;  2L3D A;  2RC4 A;  2KRH A;  1O57 A;  1NG7 A;  1VQN I;  3WTW C;  1IN4 A;  1Y1W J;  2R7Z J;  3V7C A;  3SEQ A;  1E3O C;  1VQ5 I;  2OJE D;  3A01 B;  1K79 A;  1XCV A;  1FP1 D;  3FXK A;  2L54 A;  4LOC A;  2LNB A;  4LIV A;  2JA2 A;  4Y7N J;  1B72 A;  3T0Y A;  3BTL A;  4R8H A;  2COM A;  2XGD A;  4R79 A;  2STW A;  1APL C;  4IOC F;  1MBG A;  3HC7 A;  1ZLJ A;  2KIU A;  4HST A;  4HNU A;  3CF2 A;  3IH2 A;  1JT6 A;  2R5Z B;  1YG2 A;  3PO2 J;  1JT0 A;  2CUZ A;  2R7S A;  1CQT A;  4FAS D;  2EFN A;  4ETS A;  1B1B A;  2ECC A;  4L0Z B;  2ELJ A;  2MA3 A;  1XSD A;  5B1B H;  3CMA I;  3A1Y A;  1W7P D;  4EM0 B;  1X1D A;  1RZ4 A;  1U9N A;  1H9T A;  4PJM A;  3HOV J;  3E7L A;  4F7Z A;  2FU4 A;  2WAQ N;  3TOB A;  4QLC U;  4UB6 C;  4X1E A;  5D8K B;  4PSX A;  4HLY A;  2HPI A;  3HSF A;  2QBY A;  4DW6 A;  1JGG A;  3H0D A;  3K7A J;  3CLQ A;  1Y56 A;  3M9A A;  3NEU A;  2MW8 A;  2IP2 A;  1B4A A;  2JA8 J;  4AIH A;  5DS9 A;  1QGP A;  3I58 A;  4XID A;  1R58 A;  3ABK H;  3EUH A;  5B1A H;  1QHH D;  2P5L C;  2RVC A;  5D5V B;  1RKT A;  1RR7 A;  2AXL A;  3HOY J;  4BQN A;  1FT9 A;  4KIC A;  4NQW B;  5HOO A;  1ETO A;  2N8G A;  5IP9 J;  1ZAR A;  1G3S A;  4L9T A;  2V4J C;  3M4O J;  3GVA A;  3O3K A;  1YQA A;  4MEY F;  5GPA A;  3V7S A;  1T2K A;  2MBF A;  1LFB A;  1OCC H;  2RQQ A;  3IKV A;  2IA0 A;  1F1Z A;  1H9G A;  2W1O A;  3F8M A;  5LLQ A;  3CTA A;  3J80 Z;  3W2V A;  4BBR J;  3A4C A;  4XIC A;  5KNL A;  3FXL A;  3LA3 A;  1RPW A;  2M7B A;  3DLL F;  1V4R A;  3J81 K;  1GHC A;  3T1B A;  2R92 J;  3V4G A;  1K7A A;  4ESB A;  4RB3 C;  1D0Y A;  2EZK A;  2FJ1 A;  1PVE A;  4E7J A;  1WWX A;  4L5I A;  5F0H A;  4AIK A;  1YJ9 I;  4HQE A;  1KA8 A;  4HRI A;  1SVO A;  4C2U A;  3HL2 A;  1RR8 C;  3ECO A;  2A61 A;  1WCM J;  3CES A;  1W4M A;  2B7E A;  4XKV A;  1P4X A;  1FIP A;  3BZC A;  4KIG A;  4PZJ A;  4K2E A;  3MFK A;  2KRF A;  3JRH A;  2NVY J;  4BUP A;  3X2Q H;  4HOB A;  4B4C A;  2XAU A;  1XSX A;  3GFI A;  4M9X A;  3TDU C;  5ILS A;  2M1B A;  1VQ4 I;  2VUM J;  4DZP A;  4MQ9 F;  4BHB A;  2E19 A;  3SZG A;  5ILU A;  3FHN A;  2K9L A;  1QHG A;  2GQQ A;  2K02 A;  5B5E C;  2CFX A;  2E1C A;  1WSU A;  4XBF A;  1OPC A;  3LA7 A;  2P4W A;  3SYT A;  2A68 F;  2OAZ A;  2F5V A;  1P4A A;  1H8A C;  2VAS A;  1NTC A;  4EVI A;  4J19 A;  4RM2 A;  2ZBK A;  4KMF A;  3S3O A;  1I1G A;  4KT5 C;  3FZV A;  1ZR4 A;  2XIG A;  3Q0U A;  2E7W A;  3HPH A;  2DCE A;  2A6H F;  2QF7 A;  2PJP A;  3HOU J;  5JHF A;  1JUM A;  5F27 A;  3BG5 A;  2O9L A;  4A69 C;  2E1O A;  1IJW C;  4Q5S F;  2FUG 2;  1X2N A;  2DA5 A;  2DFF A;  5KK1 A;  2OZU A;  4U0V A;  3GFL A;  1Z77 A;  2HDW A;  1RNL A;  4RLF A;  4ZH4 F;  4OMY A;  1T33 A;  2EV6 A;  1FY7 A;  2M0C A;  1XD7 A;  3F23 A;  3MWM A;  1YRN B;  4GFB A;  4Y33 A;  1PUF A;  3K4C A;  3KYL A;  2HNH A;  1FIA A;  1MNE A;  3BPX A;  2LH9 A;  1T8I A;  3VOE A;  2O0Y A;  4IRG A;  4QSH A;  4ZYG A;  5J6X A;  2KMU A;  3LAJ A;  4IHW A;  2RKH A;  4M3G A;  2L7K A;  4IEJ A;  4II3 A;  3G3Z A;  4LLL A;  2W84 A;  4JK1 X;  4U88 A;  3HRT A;  1S7A A;  2HOS A;  2QWW A;  4O6J A;  4MFE A;  1FYM A;  3OYF A;  3CCS I;  3GX4 X;  3DBL B;  2I5U A;  2HYF A;  2P0W A;  4WXC A;  4B44 A;  4UUS A;  3ZQC A;  1X58 A;  2DO7 A;  3P7N A;  2OA4 A;  4PK4 A;  2COB A;  4HW0 A;  5DCF A;  2JWT A;  2FBH A;  2RN7 A;  4ON0 A;  3ZN0 A;  2DA7 A;  2VC1 A;  3WU0 A;  5JR3 A;  1K78 B;  2GLO A;  2VE8 A;  4LK0 F;  2FBI A;  4ZTJ A;  5DV5 A;  1MJB A;  4M72 A;  3GTK J;  4ZZD A;  1Z6T A;  2Q0O A;  4E7Z A;  1MND A;  3R4K A;  4I09 A;  1IN6 A;  4G7O F;  2VPL A;  3KPH A;  2HOA A;  2XSD C;  1I6X A;  3U9G A;  3BG7 A;  4YFX F;  4J01 A;  1UST A;  1EV7 A;  1MMD A;  3LWF A;  2KHM A;  4UVB A;  1GDT A;  3IL2 A;  5FKK A;  3G71 I;  3LOC A;  2GA1 A;  1KGS A;  4ASN A;  1RUN A;  4YRV A;  3A0B C;  3HSR A;  2F4O B;  4P5O A;  2B63 J;  3U1D A;  3H9J A;  2JTV A;  1D8K A;  1ZGW A;  1MDM B;  2VON A;  1BA5 A;  1ETY A;  2VKH A;  4PFO A;  3VYR B;  4U87 A;  2Y0S N;  3FHZ A;  5GAD J;  4FQG A;  5M5X J;  4A0X A;  4BY1 J;  3ABL H;  3IRR A;  2UXN A;  2AQE A;  3FKJ A;  3SFI A;  2MAB A;  2V1N A;  3FX3 A;  2E7X A;  2VOO A;  2HTJ A;  1ZN2 A;  3K6G A;  2KRC A;  5CPR B;  4E7K A;  1R22 A;  4Y13 A;  4M6Y A;  1IO2 A;  1WH7 A;  4L9J A;  3ZMU A;  3BCA A;  5M3F J;  2XKO A;  1FJL A;  2X6Y A;  3B6C A;  3BR0 A;  5FKO A;  3LSR A;  2RGV A;  1JE8 A;  3PM1 A;  2R5Z A;  2M87 A;  1V5F A;  3RJP A;  4BY7 J;  1S72 I;  1JGS A;  5A2Q K;  2HU9 A;  2D45 A;  3BQZ A;  2NS7 A;  1W0U A;  2FE3 A;  1SD6 A;  4WCG A;  2PG4 A;  2IS2 A;  1MH3 A;  3PQJ A;  2K85 A;  5GAH J;  1MSF C;  1OKR A;  2HOE A;  3WTZ A;  1WJB A;  4DZJ A;  3DV8 A;  2H27 A;  3VYS B;  4LG0 B;  3OS0 A;  1XC5 A;  3Q0V A;  1K4T A;  4N9H A;  4XLN F;  2WWY A;  3CC4 I;  3CDL A;  3JRB A;  1L3L A;  5FLX K;  2FQ3 A;  3I9V 2;  3ZQG A;  4XRS G;  4PGH A;  3BCB A;  4BQO A;  1VQL I;  1WJD A;  2X6O A;  2Q2E A;  2NS0 A;  5HDN A;  3FIS A;  2PMZ N;  4BE2 A;  1ODD A;  3F8F A;  3CMY A;  4LIU A;  3BY6 A;  4V19 K;  1UFM A;  4L5J A;  4N0B A;  3CCV I;  3MAJ A;  1J7K A;  5IOY A;  5CYV A;  5DD8 A;  4RMN A; 
#chains in the Genus database with same CATH homology
 3MD2 A;  3DPU A;  4F93 B;  2VQG A;  1BR1 A;  4QPO A;  4C9Y A;  2UV1 A;  2VJ5 A;  4CCN A;  4LG3 A;  4PJJ A;  1X19 A;  1AA7 A;  4EAT A;  3L2V A;  1OR7 C;  2ZXH A;  3BC8 A;  3LSG A;  4Y3O A;  3DKY A;  3L2U A;  4G6T B;  1J09 A;  3H9G A;  4F91 B;  3C2H A;  1YE9 A;  3H35 A;  3HOT A;  1DGW Y;  3VDX A;  2X1E A;  1W36 C;  3DU5 A;  1ERD A;  1BR2 A;  2BVM A;  4CA0 A;  3OYC A;  2KPM A;  3ZGK A;  3KX2 A;  2UWM A;  1YX5 A;  3S3N A;  1N78 A;  4KT6 A;  3IAS 2;  4AVZ A;  3NWT A;  3CJR B;  1EA3 A;  3H5R A;  2JUG A;  3I3L A;  4C2T A;  3V42 A;  3RCO A;  2W00 A;  4HEA 2;  4N4O B;  1SAU A;  3EUH C;  4OAY A;  2LRE A;  4XOR A;  1LFP A;  3PNT A;  3H9Q A;  3UNG C;  2XF5 A;  1W36 D;  3ZRG A;  2Z2S B;  3OWT A;  2CV1 A;  2HVS A;  4BAC A;  2JVH A;  2XSJ C;  4BGD A;  4IQ4 A;  2F6C A;  2CH0 A;  2V6E A;  4F52 A;  2XF7 A;  2R7U A;  3L2R A;  1D1A A;  1HA8 A;  3OYM A;  2M3A A;  4ZJZ A;  4IQJ A;  4CUG A;  1E0E A;  2R7R A;  3SEZ A;  2ZSH B;  3OS1 A;  3IP4 B;  3RQ4 A;  2NOJ B;  3DTK A;  4XLF A;  2PJR B;  1G8X A;  3OYA A;  3D5L A;  4AU7 A;  4II2 A;  3PSI A;  2VJ4 A;  4IKF A;  4F3Q A;  3LSI A;  4BE0 A;  2K5C A;  5CQG A;  3PL8 A;  2IS6 A;  2LY1 A;  3H5N A;  4XKC A;  3OYB A;  4H4K C;  1Z3Y A;  3VYU B;  3DQV C;  3IAM 2;  4XN0 A;  1YX3 A;  3DPL C;  4PJL A;  3BG6 A;  3D5S C;  4XM3 A;  3F9K A;  3LSH A;  4CCO A;  5LFA A;  3L2Q A;  2AQF A;  2HQA A;  1X1A A;  3DU6 A;  4XLE A;  3UR3 C;  3CP2 A;  4HPQ A;  3HOS A;  3PSF A;  4AYB A;  3AL0 C;  1U0J A;  4CCJ A;  4BJT A;  1DGR M;  1UG0 A;  5CQE A;  2L2O A;  3OMY A;  4BEH A;  2WAQ A;  2Z16 A;  2KRH A;  4C30 A;  1MMG A;  1NG7 A;  3OYE A;  4D1Q A;  3ZR8 X;  3K4K A;  3SEQ A;  3OS2 A;  2VQL A;  3AL0 B;  2BW3 A;  2XF6 A;  3M8J A;  3PJR A;  4DBQ A;  3PUB A;  3H5A A;  1WJC A;  3OL3 A;  2WY8 Q;  1ZEL A;  2CW7 A;  4U7B A;  3HUG B;  4BJ6 C;  3MMY B;  4LIV A;  2JA2 A;  1X4O A;  3OYL A;  4DOZ A;  3L2W A;  2DT7 B;  4GRI A;  4F55 A;  2QKL B;  4R79 A;  4CSW A;  3HC7 A;  4HST A;  3OYK A;  4HNU A;  3CF2 A;  2R7V A;  3EUA A;  2CV0 A;  2V9K A;  1R6R A;  2CUZ A;  2QKM B;  4XLH A;  2R7S A;  1TT0 A;  3SDB A;  3N05 A;  5HNH A;  3K70 C;  2K3P A;  4FAS D;  3FBI B;  4CCK A;  4XL9 A;  2IGO A;  2ELJ A;  4BE1 A;  2CV2 A;  2E5Z A;  1T0F C;  3A1Y A;  4NC8 A;  5HNF A;  1X1D A;  2OV7 A;  4XLA A;  4PJM A;  2KQR A;  2MYS A;  1BOB A;  3VSK A;  4E6K G;  4PSX A;  2HPI A;  3K4B A;  2E5N A;  2ZSI B;  2E1M B;  2IS1 A;  4B3X A;  3H0D A;  4ITV A;  1Y56 A;  1DP3 A;  5KCM A;  1NG6 A;  4XN3 A;  3VSL A;  1KON A;  5HVQ C;  3NWS A;  4B47 A;  2KZV A;  4XMY A;  4HG2 A;  1QHH D;  2WAD A;  1N75 A;  2M0M A;  4E7S A;  2R4G A;  2WBM A;  2M7A A;  2XDV A;  3OR2 C;  4XNF A;  4BQN A;  2LBF B;  5FRN A;  4NQW B;  5HOO A;  2Q1Z B;  1SFK A;  2V4J C;  4BDZ A;  4E7I A;  3E0J B;  2R7T A;  1FMW A;  1T95 A;  2X85 A;  2RQQ A;  2PJR A;  2RNG A;  3DWL E;  2W1O A;  1PJR A;  4E7H A;  2KL4 A;  2DOA A;  4XOP A;  1VZ0 A;  1X1C A;  3W2V A;  2KP6 A;  3ZXS A;  3A4C A;  2GOM A;  2MFZ A;  5KNL A;  2CUJ A;  2M4K A;  2IGK A;  2M7B A;  3LSK A;  5HLT A;  2LRD A;  1D0Y A;  2IGN A;  4J00 A;  2JVG A;  4E7J A;  2VJI A;  2WAF A;  2OC6 A;  3S8P A;  4HRI A;  3EPZ A;  2BVL A;  4C2U A;  1MMA A;  4Y4R A;  3HL2 A;  5FRO A;  2VXD A;  4XKW A;  2LC2 A;  3CES A;  3FDY A;  4XKV A;  4LIT A;  3DTE A;  3LSM A;  3TBI A;  3TL4 X;  4BUP A;  2WA0 A;  3E1S A;  4YEJ A;  3QYF A;  2XAU A;  4P1W A;  2VL8 A;  4XR6 A;  2O5R A;  3K4J A;  5FRM A;  3ZCO A;  3K10 A;  4ZDL A;  2LBF A;  3SZG A;  2M4G A;  2K9L A;  3FHN A;  1QHG A;  2LOO A;  4HSR A;  4NUB A;  2E60 A;  2OUM A;  3K4N A;  4NC7 A;  2L9S A;  3SYT A;  3S93 A;  2X1D A;  2BOL A;  2ZXI A;  4B43 A;  2F5V A;  3FBN B;  3DTI A;  2VAS A;  4KJZ A;  4FET A;  4OAZ A;  4RM2 A;  3S3O A;  4XLC A;  3OYG A;  3HPH A;  2DCE A;  2WY7 Q;  2IS4 A;  3G2B A;  5JHF A;  4D9J A;  2L9N A;  2GOX B;  3HXL A;  4CH7 A;  4XOT A;  2VLA A;  3CJQ B;  4HNT A;  3HKZ A;  3OYD A;  2E1M C;  4E7L A;  1Z3X A;  4ZDP A;  2FUG 2;  2RRE A;  2W7N A;  2Q2E B;  2V26 A;  1K6Y A;  4BQQ A;  2L5Q A;  2Z1D A;  2XC7 A;  2HDW A;  2KDO A;  2ZFU A;  3LL7 A;  4RLF A;  2R7O A;  4PFP A;  3MKW B;  4BL0 B;  4Y33 A;  3PFY A;  2HPM A;  3A2K A;  3U21 A;  3K4C A;  3KYL A;  2HNH A;  5KHD A;  1MNE A;  4JOM A;  2LH9 A;  4MLO A;  3RSN A;  2KMU A;  3OIP A;  2L7K A;  4II3 A;  3MKY B;  2HVQ A;  1LKX A;  3C2G A;  3QYE A;  1GLN A;  1IRX A;  2PMZ A;  2VQC A;  4BU2 A;  3OYF A;  1G59 A;  2P0W A;  4CCL A;  4NNJ A;  3ZQQ A;  4B44 A;  2I8D A;  1TZL A;  2VKD A;  2X6W A;  2Y0S A;  3IUO A;  3DKX A;  1DQU A;  2A5W A;  3KEY A;  2A6T A;  4PK4 A;  3QYB A;  2CMP A;  1Z7L A;  1WJF A;  1PYV A;  3OL4 A;  3OOU A;  1JI8 A;  2F4I A;  1D1C A;  3ONQ A;  3OYI A;  1D0X A;  2W82 A;  4BS9 A;  4ZTJ A;  3W3C A;  2WB1 A;  2LY2 A;  1D0Z A;  2VXZ A;  2CW8 A;  2KLO A;  5CKT A;  4E7Z A;  2HVR A;  1MND A;  3OY9 A;  2R7W A;  2VPL A;  3TMO A;  3QOE A;  3DEE A;  3BG7 A;  1V5E A;  4J01 A;  4N4N B;  3W2A A;  2DT6 A;  3BLY A;  1MMN A;  1BR4 A;  3RPU D;  1QU3 A;  1MMD A;  2KHM A;  4YEL A;  2VIX A;  3DPT A;  4JQF A;  4DGW B;  4KIS A;  3W2W A;  2R7Q A;  5TGT A;  4E4H A;  3S3M A;  4ZC3 A;  4PSW A;  3OIQ A;  1LVK A;  1X4P A;  4CZC A;  2K9M A;  1WJ5 A;  2IGM A;  4ZDO A;  4IZZ A;  4YRV A;  4RM3 A;  4P5O A;  2IXS A;  3CZ6 A;  3H9J A;  2MD0 A;  1WJE A;  3K4L A;  2R7X A;  1FMV A;  2VKH A;  3QOD A;  4PFO A;  3VWB A;  3VYR B;  3LFU A;  4U87 A;  4XON A;  3OR1 C;  3K70 D;  1UAA A;  3CMM A;  4PUS A;  3AKZ A;  3CP8 A;  4RLQ A;  1WJA A;  3D5R C;  1V5G A;  2AQE A;  3FKJ A;  2MAB A;  2V1N A;  4QPQ A;  4BDY A;  4IX7 A;  3K6G A;  2KRC A;  5CPR B;  4E7K A;  3RTR A;  4DIQ A;  3HPG A;  3OYJ A;  4OWR B;  4XQF A;  2CS3 A;  2WAE A;  4KIT B;  4XKB A;  2VJJ A;  3BCA A;  3DLA A;  4ZYA A;  2VQH A;  2VB6 A;  4ANJ A;  2X6Y A;  3K4M A;  2X51 A;  4F92 B;  4ZTF A;  1V5F A;  3VYT B;  2HU9 A;  2HZD A;  2CFO A;  4DBR A;  3M1C A;  2IS2 A;  2X6X A;  4BEH B;  2W4S A;  1WJB A;  4CCM A;  3OYN A;  3VYS B;  3PNY A;  3OS0 A;  4BJ5 C;  3GBG A;  4X0G A;  2DXI A;  1OLT A;  4BXF A;  1N77 A;  1Y6I A;  2X1C A;  3I9V 2;  1S9H A;  4DJA A;  3MKZ A;  3HG9 A;  3S32 A;  2BW3 B;  2LG4 A;  1Z21 A;  3AFH A;  1WFX A;  3OYH A;  3BCB A;  4BQO A;  2V7F A;  1WJD A;  1X1B A;  2JSP A;  2LYC A;  3J7A Y;  2MC4 A;  1P9Q C;  3EUK L;  4BE2 A;  1D1B A;  3LMM A;  1UEL B;  4LIU A;  5LD2 C;  1LDK B;  2UUZ A;  4B48 A;  1MW7 A;  2DJI A;  3PNV A;  4PJN A;  4RMN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...