3QOPA

Domain-domain flexibility leads to allostery within the camp receptor protein (crp)
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
200
structure length
200
Chain Sequence
DPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILFYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Domain-Domain Flexibility Leads to Allostery within the Camp Receptor Protein (Crp)
rcsb
source organism Escherichia coli
molecule tags Dna binding protein
molecule keywords Catabolite gene activator
total genus 63
structure length 200
sequence length 200
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3qopA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3qopA01
3OCPA 3FF5A 3WTVC 3EETA 3IHUA 1IN4A 2QCSB 5HOOA 2HJIA 1IPKA 1IXSB 4AVBA 2BNMA 2MA3A 3WTZA 4RB1A 2WFPA 3GZ5A 2N7GA 2JSCA 4UXAA 3PQJA 5LHHA 1YFXA 2QYOA 1UCRA 5KK1A 3WTUC 1FP2A 2VXZA 2FMLA 4EM2A 4EJWA 1YTYA 1LDKB 3LA7A 2UY8A 4G6QA 4Q47A 2FNPA 1GHCA 2A61A 5HS8A 2G7HA 2HKXA 1CAUB 3KP6A 4D0PA 1YFUA 3I58A 3RIRA 2XL7A 2ISYA 1TNSA 5I0TA 2K86A 2P17A 3HT2A 3IWFA 4HLYA 3FHIB 1ZH5A 4YNIA 4P96A 1P2FA 3WTXC 2Q0AA 1U5TA 3BPZA 4IRIA 1LEAA 5I0SA 2HQRA 4RS8A 3FX3A 5H6RA 4FX4A 3TOBA 4PIYA 2P8TA 1B9MA 4A12A 2PAKA 3U9GA 3LWFA 5ILSA 3OOPA 3JAMZ 4NVPA 3MZHA 4DNCA 1DGRA 1DGWA 1S29A 2EA7A 2MH9A 3N97A 2QZ8A 1UIKA 1CGPA 5FO5A 4QM8A 1CAXB 3H9AA 5E16A 3OV8A 3DKWA 5FDBA 2JT1A 1FLIA 2NNNA 3BPXA 5C8WA 3MEXA 1X7NA 3J81K 4UUVA 4KMFA 2VT2A 3G7DA 3GO5A 1H9TA 3IDBB 4CGZA 5JI6A 3L9FA 2Z2SB 3KCCA 1T6SA 1KU2A 5D5UB 5I0RA 1WLTA 3CO7C 2L01A 4GYGA 1YG2A 1ZAOA 4RGXA 3N4MA 2OPKA 3CUQC 2O03A 4B09A 3ZMTA 3S2WA 5BXXA 4K8FA 4ESFA 4KDPA 2O8XA 1W5SA 1Z1DA 3FMRA 3USSA 1ZHFA 3ROUA 2DO7A 5L3GA 2COMA 1SFEA 3RI4A 5LEJA 4ORFA 2LF7A 2X0LA 5BUVA 2QVSB 2D40A 2IA0A 4KU8A 3QRFF 3U1DA 1JHFA 4Q0UA 2V09A 1LNWA 4P9FA 1ULYA 4JQFA 4MEYF 1T0FA 2G7UA 3B73A 5C6CA 5JR3A 2HDCA 1G3TA 3PNAA 2XASA 5CVRA 4KA4A 3J80K 3GUDA 1W7PD 3CUOA 2O61A 4IEWA 1ONVA 1MJ9A 4S05A 4WBBA 2D45A 2RC4A 3IDCB 1ZYRF 2K0GA 4JTOA 4PCQA 1BC8C 2BEOA 1BM9A 2OA4A 1EH6A 4HAMA 1K79A 3NW4A 4EVIA 4GGGA 1OPCA 3JSOA 3E6MA 1R00A 2CO5A 5BY5A 2WV0A 2YX4A 3HTUA 2W57A 4IRGA 1LQ1A 1LVAA 1QGPA 1Z6TA 3FZ3A 3H92A 3C1DA 3ACLA 1XD7A 1BI0A 4LMYA 1BIAA 4XFFA 4OLLA 2MBFA 4WXDA 3GW2A 2HEOA 2FEZA 4YIFA 1WA4A 4L18B 3DFGA 4ZYHA 4RD7A 2EFWA 4M6XA 4MGKE 3RKWA 3KLNA 2H09A 2IXJA 1G3YA 2OA2A 1L3JA 2BNOA 5HVQC 4QMAA 5LRRA 3TDUC 3O14A 1CAVA 2IXKA 2P7CB 3NL1A 5DCMB 1T39A 4WZCA 2HTJA 4NQWA 4UVCA 5BPXA 1Q43A 3R61A 2HFHA 3F8BA 2B0LA 1X3UA 2DFIA 1B59A 1F9NA 2V9VA 2ZO4A 1L0OC 5F6FA 3LFKA 4F7ZA 5KHHA 2QBYA 2KIFA 2Z9OA 3QACA 1KA8A 3WTTC 4AQ2A 1WGPA 1B4AA 2EFPA 2M1BA 4UXNA 2E9QA 4HV6A 4A6EA 1H9GA 1QY4A 3H7JA 1SD4A 1R36A 3RKXA 3ELNA 4U0WA 2KIMA 4HF0A 2ZNZA 4JTNA 3WTSC 3TDZC 2R7DA 1LR5A 3R4KA 3ECOA 3F6OA 4HX7A 1CF7A 4MGIE 3SXWA 1Z91A 3I59B 1ON1A 2NAZA 4IJAA 5K5QA 1Z6RA 4WWCA 5IT9K 1J3RA 1QXJA 4IERA 2RVCA 1WWXA 1MDMA 3FM3A 3RPQA 1XN7A 5FPXA 3VODA 4XFGA 4KWJA 4FHTA 2ESNA 3VHRA 4IHTA 4AIHA 3TOAA 2H0VA 2QUFA 3ZP5A 3W6JB 5FLHA 4ZH4F 1EH7A 4OMYA 2B8MA 1ZZCA 1DPUA 1WKMA 5AONA 1BI1A 2AS5F 4P9GA 1XDUA 1TW2A 4LLGF 2QM3A 3RJPA 1ZLJA 4HLXA 2J5OA 2W25A 4F8AA 4J1XA 4UV9A 4IEOA 1XMAA 2HYGD 2ETEA 3PQKA 1UW8A 2W85A 1WRJA 3HSRA 1LRHA 3K2ZA 3K1NA 1J7KA 4LLLA 3ZDSA 3I7DA 4HN0A 3SFZA 5EEHA 4WCGA 4HZFA 1EYBA 5ICFA 3KP7A 2PA7A 2F5FA 2KXLA 5D4RA 2IW5A 1K6OA 2XAJA 1Y0UA 4LG0A 2GZWA 4LG0B 3F22A 4Z07A 3WGHA 3HSEA 4AQ6A 5KHKA 4U7DA 3LAJA 1ZRRA 3ZQ7A 4GXOA 2OBPA 5JFRA 3KP3A 4NB5A 4G7ZF 3RPUA 4MGRA 1OKRA 2FQ3A 1W7PA 5I93A 3J7AO 1RNLA 1HW2A 4Q0QA 1LB2A 1XSVA 2HTSA 2F5DA 4IRHA 4I3PA 4RGSA 4XETA 5E18F 1Q3EA 3FM5A 4M74A 2HKOA 3CJXA 2PMUA 5IT3A 5BPIA 1F1ZA 4HOBA 4RAYA 2D93A 1YFWA 4ONUA 3ZMVA 2ZKLA 4QXKA 3WW1A 4OIRF 1XE8A 3ECHA 5LHGA 3NQOA 3DF8A 2IPQX 4E2QA 5I8SA 4KNYA 2RGVA 3EYYA 1SEFA 1ODDA 4XLNF 3R6SA 2PHDA 3F6VA 5HDNA 2JZYA 5KBFA 1YIOA 5DD4A 3WG9A 1TQIA 3TNPB 4LK1F 2DU9A 4CO8A 1NYWA 4L9VA 2WWYA 2EV5A 3NJZA 4KIBA 3HYIA 3BU7A 1JE8A 2CAVA 1QPMA 2GH2A 4KICA 3MPBA 3QP6A 1CAWB 4LEJA 2EFNA 3V4GA 4BQAA 4L5IA 3IWZA 2PHLA 5BQTA 2XVCA 4XLPF 1K78A 4XEZA 5AIQA 1RGSA 1QQIA 5BMZA 1NZCA 2RDPA 3OD0A 2RQPA 4IVNA 1X8MA 5FFZA 2QENA 5ICCA 4QM9A 4O3MA 1XRUA 2UY9A 1TBXA 2EFOA 4KL1A 4META 5J8CA 2EVXA 4O6JA 2K4BA 5BPDA 4GULA 2PFBA 2XHKA 6PAXA 3GEZA 1YLLA 5L3CA 4ZZLA 4AIKA 4G7OF 3F3XA 2EJRA 1FYMA 3DPLC 2E7XA 4L9JA 3V7CA 5AVPA 2V1XA 2IJLA 3QU6A 4OIOF 2STWA 1RUOA 3COAC 1GVJA 5D5WB 1BI2A 5D6EA 2J5PA 3KSCA 4RB2C 3EDPA 3VFZA 4XRFA 1Q1HA 2Z5UA 3ZPLA 1O4TA 3BWGA 4KYWA 2QQBA 5HLGA 2IXIA 4D7TA 1UPIA 1JGSA 2VBWA 2R3SA 4U0YA 1KQ8A 1UFMA 5JAXA 2A5YB 1P4AA 1SMYF 1J9IA 2YX7A 2Q4SA 2Q1ZB 3FXRA 2KRFA 1BIBA 4M9XA 2M30A 2ZMEA 5E1XA 3GF2A 4UBGA 1CAVB 2ADUA 5E1ZB 1GQGA 1MJAA 3H7YA 1IN6A 4OFGA 4G8XA 4MNUA 4MEXF 1PUEE 4WVZA 2RNJA 5DYMA 3F8MA 4BHCA 5DUKA 3DV8A 1T38A 1T2KA 3E5UA 2E7WA 4WXCA 1KYZA 2IRFG 1I27A 3I71A 2P5LC 3MQ0A 2VODA 5CVJA 2H6CA 2RKHA 1YWKA 5LGNA 2JPCA 1D5VA 3HQXA 2MD5A 2EA2A 1S7AA 2CV6A 4MGZE 2A6EF 1J59A 1CAWA 4QWQA 4MX3A 4UBHA 2IVMA 1CAUA 3MYXA 2YR2A 2CAUA 2DTRA 2JPBA 2C0ZA 2OZJA 5H20A 1DUXC 3GFJA 4MV2A 1U2WA 2ZMEB 3T8RA 1O7LA 3TGNA 3D5LA 2K02A 1YW7A 4M6YA 3LA2A 4XSZF 2ATFA 3ES4A 2GC0A 4CYDA 1ZRCA 3ETQA 4L0YB 1O3SA 1PP8F 3RTRA 1EPZA 4YYOA 3M9AA 1K78B 1SD7A 5A2QK 4QGNA 1FYLA 3LAGA 1NHAA 3NKTA 3DXJF 4DQ2A 1H1MA 2D5FA 2A6HF 1GXQA 4LFUA 1R22A 3DP7A 3IRRA 4EV0A 1KU3A 1RL3A 3U11A 2L4AA 2OYZA 3MCZA 1IN5A 2QLZA 3FXUA 4A0XA 3FMSA 2Y0OA 2XLFA 5D8LB 1E2XA 1NE4A 4OMZA 4PIZA 5CJ9A 1SD6A 3EBRA 1HKTA 1BBYA 4UVBA 5FLIA 3R0JA 4Y17A 2YU3A 2IA1A 3CO6C 2CYYA 1DDNA 2ET7A 3KEQA 4BIFA 2VBZA 5HLIA 3I0TA 2DPDA 2UYAA 1C0WA 5DEQA 3ULQB 1O3TA 3MWMA 3CO2A 3G3ZA 2NYXA 1ZREA 2BNNA 4EJUA 4Q0SA 2Q0OA 2PI0A 4XSXF 3OTFA 2PQ8A 2VT3A 1X82A 3BOQA 3KETA 1J3PA 2KKOA 2V1UA 1RC6A 2XAFA 4HYEA 1ZRDA 3HT1A 1ZX5A 4IEUA 5FD5A 4XFCA 1IZ1A 2FF4A 4HSLA 3V7RA 1W7PB 1XGSA 5FD6A 4AIJA 4UV8A 2VONA 3IL2A 1YYVA 5H6QA 2Q8KA 4L2NA 5CVIA 5L3FA 4E2SA 4Q5SF 1VP6A 5E8GA 4XF0A 1TTYA 4YFXF 3WW3A 1PM7A 4HDUA 1EV7A 5I91A 3K1PA 1FBUA 1QZZA 5FCCA 3KLOA 5D6FA 3DN7A 3ISPA 2FBHA 2XROA 2LKPA 3BCWA 2A69F 5LBQA 1U6GA 4LB5A 2UWMA 2G9WA 4A0YA 2ET1A 3SZPA 2GU9A 2K9ZA 2IT0A 4IEPA 1Y3TA 3KP4A 5AIPA 2KJBA 2XAGA 2CW0F 2WC2A 3SHRA 2FQPA 5ED4A 1P6RA 4RAZA 3B02A 3IKVA 2XGXA 2P4WA 2HS5A 3S7IA 2DQRA 5ICGA 1XGOA 2K27A 4IEYA 5BOXA 4YSFA 1MGTA 2HYFA 4QX5A 1BOAA 5FFXA 4EGZA 3BJOA 2E1CA 1FP1D 2F5EA 4IPAA 1YFYA 3KP2A 1STZA 2QVOA 2UXXA 4TV7A 4K2EA 2BV6A 2HR3A 3ABTA 4BH9A 2FBKA 1I1SA 1ZARA 5E8IA 3D0SA 2HWVA 4LD5A 1J75A 3V8KA 4QLCU 1PDNC 1RTVA 3BY6A 1OYIA 1S7OA 5CVVA 2BGCA 4A0ZA 2RN7A 4HX8A 3JW4A 4WK8F 4ZU5A 4N0BA 4XFBA 1J0RA 2ZXJA 1SFXA 1SD5A 1O5UA 2LDUA 4KFCA 2R7FA 4U88A 2M45A 5DV5A 1HBXG 1OMIA 3KEOA 5LGUA 3E5XA 2VOPA 2UXNA 5J6XA 3M7GA 4ZU4A 4HA8A 3IBMA 3SCHA 4P5OA 1MD0A 3LWCA 2DW4A 1YUDA 3OGJA 3RKYA 5FQ0A 1TQPA 1RUNA 3EQEA 3ES1A 4XF4A 4ON0A 3LA3A 5DCFA 3I4PA 5J3UA 2LNBA 2OQRA 4LJZF 4XFHA 5KHIA 3BPVA 4ASNA 2BYVE 2DCTA 5JSOA 5TRDA 2XUBA 4B29A 2FOKA 3RYRA 4MGYE 3MAJA 4A5NA 4CDGA 2A3SA 2OZ6A 1JXSA 3LQQA 4EMSA 1FPQA 1U12A 1TNTA 1YW9A 3RNSA 1B1BA 4CHUA 4KN7X 4G7HF 4I2OA 2M5WA 1ZNPA 3L2HA 2W84A 2GIVA 3I54A 5ILVA 5FLXZ 1A04A 1IXRC 1FX7A 3JTGA 3E6DA 2FMYA 2Y48A 5K1YA 1X8EA 2PEXA 5CADA 1F4KA 4JBAA 2OZUA 3SCFA 4HQEA 5HDKA 3BROA 1G3WA 2VE9A 1ZG5A 3L00A 4U0VA 2JRTA 4ENNA 1J2XA 3EHKA 3DL3A 2NS0A 2M87A 4EQQA 4EJTA 3TKYA 1ZRFA 3MDPA 1O3RA 4H7LA 4R52A 1FXZA 4KIFA 1WQ2A 3HSFA 2PFWA 4N9HA 2TDXA 4MTEA 4HN1A 3R0AA 1KYWA 2PQQA 2L4MA 3ZN1A 3GLXA 3FJSA 5KHJA 4M9ZA 1JUHA 2QDRA 5HLHA 3V7SA 2DK5A 4GCVA 2QBYB 2Y0MA 2BBYA 2XAQA 5DUIA 1WSUA 2XIGA 5HS7A 4Z2YA 3L7WA 2EA4A 3JSPA 3H1YA 3IIAA 5L3EA 1U3EM 4KWKA 4PGHA 1HW1A 3WTYC 2B9UA 4O5VA 3VB2A 1TW3A 3O2PE 1SMTA 1G3SA 3V8LA 1XMKA 2O0YA 2MC3A 1EY2A 4YG2F 3F21A 5CYVA 1R58A 3T1BA 1YO5C 1CX4A 1OYYA 3UKVA 4EROA 5FB2A 2PTMA 2K4JA 4H0EA 2MH2A 5A2QZ 3GZ6A 1USSA 3KGZA 5JVTA 1R1UA 1L3LA 1EH8A 1R7JA 4PDKA 2MLKA 1FOKA 1XE7A 1J1LA 3BB6A 3P9KA 4XF1A 2DLLA 2H94A 1USTA 4EJOA 2ZNYA 4EM1A 5ILUA 1HW5A 2P7VB 2A07F 3CDHA 1ZZ8A 2GC3A 3JZVA 4JVAA 2VN2A 1DZRA 2GA2A 4E2GA 2BE5F 3BZ6A 4M73A 3F72A 5JHUA 3GYHX 4Q29A 3QU3A 4RB0A 4LA2A 4MH0E 2IXCA 2OD5A 1UD1A 4IEZA 3M1EA 1ZZ9A 4G94A 1H1IA 4HBLA 3FFQA 3CLOA 3I53A 1PP7U 2EFQA 2O3FA 4U7BA 1I6XA 2GXGA 3H8UA 4RGUA 1QWRA 3ERED 3F8CA 1Q5OA 1R23A 3HRSA 1MZBA 1PMIA 4ZZDA 4A5MA 3HRTA 3T0YA 4M9SA 3BDDA 4OINF 4OIPF 3KMHA 4PGGA 4CXFA 3CEWA 1HSTA 2RV8A 4M71A 4FBFA 5JSPA 2CQKA 3SCGA 5BV6A 1U8RA 3SHFA 3CL1A 3BP8A 3E6BA 2EV0A 4X6QB 3GVAA 3DQVC 4CICA 2ETHA 1SQ4A 2D5HA 3IRQA 4Y15A 3FXQA 1LKNA 2XV4S 1Y9QA 1IAWA 1Z05A 2VPVA 1FI2A 3ZN0A 1UIJA 4BAYA 1SFNA 1LEBA 3F8FA 1KQ0A 1B6AA 1XGNA 2O1QA 2XLGA 2ZJ2A 1WI9A 4L0ZB 4AVPA 1DP7P 4IHSA 4P9UA 1OYWA 4CZZA 3FHZA 3WW2A 2X4HA 1FY7A 1J58A 1VR3A 1MJBA 2V1DA 3JTHA 1O3QA 3IKTA 4YIIA 1E17A 1XCVA 2Y75A 5FGMA 3VEPA 4EGYA 1FZPB 4XF3A 4FAHA 4MQVA 4QGMA 4L9TA 1ZVFA 4KWLA 2P5VA 3TNQA 5LEKA 4UVAA 3M8EA 3LSTA 1VJ2A 1QXRA 4EM0B 4XBFA 3QPHA 1U5TC 1TQMA 1ZZ7A 4IEXA 3FMQA 3AAFA 2FE3A 3RDIA 2DI3A 1J5YA 2PJPA 4I0BA 3GYDA 4LLOA 5LGTA 1D8JA 4LB6B 4ESJA 1XSXA 3IC7A 5FQ0B 4LUMA 1IW7F 1FSEA 1LDJA 1R1TA 3O6BB 4XFAA 3KGLA 3ZMZA 4OIQF 5CVUA 4DINB 1FBSA 5E17F 4O9GA 3H50A 5J48A 2IXLA 2MNGA 1GXPA 2GC2A 3I59A 2Z33A 2GA1A 4P55A 1FWZA 3SMHA 2VECA 1R5GA 2PG4A 1D3YA 1S3JA 5KHGA 5DCMA 2DBBA 1ZN2A 2EAAA 1DPRA 2ZFWA 4LK0F 2P6SA 5JCTA 3C3WA 5E1RA 1V4RA 4YRDA 2EB7A 3TO9A 3VOEA 4MQ9F 4RB3C 1HQCA 2HGCA 4HDVA 5DD8A 3BJAA 3DPTA 1IRFA 4LGWA 1UHMA 5D8KB 4BHPA 1XSDA 2ISZA 1UB9A 4ENMA 3NEUA 1OI6A 1KU9A 1QBJA 3LOIA 3GFMA 3W6KB 2PYTA 4QGLA 4XF9A 4YFNF 5LLQA 4J1WA 5LHIA 4EWDA 1RI7A 1QO0D 3CUQA 3CUQB 2CG4A 3U2RA 2FA5A 3UKNA 2MHFA 2Z3YA 1OFNA 3DEUA 2C6YA 3C3VA 4LTAA 2W24A 1P92A 2VC1A 3RYKA 2EWNA 3P9IA 3I64A 1CF7B 1R1VA 2Q2EA 3M70A 5L3DA 2PLYA 4FX0A 1FNNA 2O8QA 5LRSA 1S8NA 4I02A 3EQLF 2O6GE 4HX4A 2IA2A 3I5UA 5J7MA 5EFUA 2EV6A 3MFKA 1XCBA 4Q0PA 1OD5A 3TQNA 4AVCA 3KP5A 2LSOA 5F1RA 2GAUA 2QNKA 4A2UA 5BS6A 5T3NA 1IN7A 2HOEA 4FT8A 2YSRA 3WE3A 1O57A 2VBXA 1ZZ6A 3PLQA 4Y13A 1YFHA 2GC1A 5K5RA 3WGIA 3LAPA 2D1HA 5CLSA 2IC1A 2DK8A 3REOA 3T5XA 5HI0A 4LULA 2XKOA 2P6TA 2VC0A 2XLAA 3NSTA 4R1HA 4I98B 3GFLA 3MZYA 2STTA 1BN5A 3QPTA 4HVRA 3RYPA 2JTVA 3FZVA 3O3KA 5D4SA 4ZYEA 1V3FA 2F2EA 1J3QA 4MTDA 5F64A 4L11A 2IXHA 5D5VB 5E1WA 4G9YA 2OQGA 4I01A 4PIXA 5DDGA 1Z9CA 2WTEA 1TLHB 4JK1X 3WU0A 4OU0A 3ABUA 4BYYA 4HSJA 2NRAC 5D1IA 5FLJA 5D5XB 5IT9Z 2A68F 2GXBA 1VTNC 1HKQA 4EWEA 1YQAA 2DQLA 4MHGA 2V6CA 2PAMA 4NHJA 2XKPA 4HLTA 5KVRA 2CWEA 4HBNA 2Z99A 1S6LA 3UKTA 5K8SA 2FU4A 4LUKA 1YS6A 4N9IA 2LF8A 1LJ9A 1TQ5A 3E3VA 4XFIA 2HZTA 4KIGA 4GYIA 4UNOA 1JHHA 5FLXK 1P4XA 3KE2A 3J80Z 3GX4X 4IEVA 1O7FA 2QJVA 4R79A 3GWZA 2DT5A 2Z69A 2I45A 3SQNA 2KIUA 1QNTA 3WU1B 1K7AA 3P7NA 2Q30A 3H1WA 3E5QA 3GBFA 4KUMA 4GO1A 1W4MA 2OU2A 2GWRA 4HV5A 3S7EA 3F8NA 3K1MA 2AXLA 4ENJA 1T98A 4I7HA 1IN8A 1IUYA 1AWCA 2MPFA 4IXAA 2FSWA 3BJ6A 1HSJA 5EEGA 1V70A 2V79A 2PBIA 4HW0A 1HXDA 3FWEA 1FYKA 5I8YA 2D1VA 4AD9A 1FT9A 2K7LA 4R8HA 3HOTA 4RGRA 1U5TB 4PZJA 1KU7A 3HOSA 4MUVA 4D7SA 3CLPA 1O5LA 4BHBA 1BC7C 4ZYGA 5HDGA 1IXCA 4B8XA 4BNCA 4Z82A 3T8TA 2OAZA 2NNYA 1I5ZA 3QP5A 3G73A 2CFXA 3BALA 3EO6A 4MZUA 1G6NA 1YS7A 2L02A 2H27A 3E97A 3ZMUA 1XGMA 1BJAA 1EP0A 5FPZA 3R60A 1YW8A 4L9NA 3V8JA 4LLNA 2VQAA 4UHTA 4ENKA 3J81Z 3K9TA 2KJCA 2VBYA 4WF2A 2H6BA 3H3UA 1Z7UA 1H0MA 5TJJA 3NVCA 4O9EA 2L3DA 1YHFA 1I1GA 4TLFA 3QOPA 3CF6E 1FSHA 3ZMSA 3ELKA 4FAGA 2B5HA 5ERIA 2QQAA 1BI3A 3SXYA 2XRNA 3K69A 3D82A 1ZGAA 3M8FA 4YARA 1ON2A 4HVQA 2DPUA 3CTAA 4HF2A 2E1NA 5ICEA 4M72A 1XDSA 2FBIA 4I0AA 2QWWA 2ZCWA 3NRVA 4I09A 4PJYA 2PMHA 3C18A 3SZTA 4LA3A 3C7JA 3KZZA 3PFIA 2PAEA 2FNAA 4S04A 3ZMDA 1G4DA 2EK5A 2CSOA 2YPRA 4IEQA 4OOIA 3CJNA 1NE6A 5JSRA 3Q5FA 2ELHA 3QAHA 3WGGA 4YFKF 1DZTA 1ZZBA 1LDDA 1IPJA 3GFIA 2D2WA 3GXOA 3D0JA 3K0LA 2CGPA 4KT5C 1KGSA 4ETSA 1GQHA 3E6CC 2F5CA 2UZKA 3FE5A 1FBQA 2QQ9A 3L09A 3OF1A 2IP2A 3L2CA 4Q0VA 5L3BA 2F4PA 1D8KA 4BXUA 3F23A 1U78A 1MDMB 5HS9A 1AOYA 1HKSA 1F5TA 3ST7A 3HHHA 2VOOA 3EYIA 1RIOH 5JR7B 1NXMA 4WXHA 4KU7A 1KQ9A 4X6RB 3HHGA 4IESA 4JV4A 4EJVA 3M3IA 1ZGJA 1R5HA 1QZYA 3LZZA 3TO6A 3H1MA 5E20A 4HQMA 4HMZA 3RZZA 1OR7A 3LQRA 2XAHA 2ACJA 2L54A 4ESBA 3S0MA 4L5JA 1SFUA 3H3ZA 1UCXA 4KMUX 1MKMA 3KZYA 1B9NA 4Q4ZF 3JAMK 4KN4X 4E70A 4IETA 4EWAA 3WE2A 2MLGA 5I8TA 3KFWX 1YLFA 2FXAA 2ESHA 3U10A 3WTWC 1IRGA 4AVAA 2ZKZA 4WX9A 1IF1A 5J8FA 2XL9A 2DAOA 1ZG3A 1RZ4A 5I0UA 1SAXA 2P5KA 1ZG1A 4AXOA 3U0ZA 3PVBB 3TO7A 4Q48A 4AWXB 5CU1A 4A6DA 5K5OA 4G6DA 4ZYDA 1CAXA 1XB4A 2ZBKA 2M8EA 3ML6A 2FRHA 2PN6A 4ZU7A 1UHWA 3WW4A 2VE8A 3Q9SA 3HUGA 3HRMA 1REPC 1W5TA 5EZWA 1P4WA 3EJKA 4IF4A 1ZLKA 3HTSB 3EUHA 3HRUA 3HIFA 4HVOA 3P9CA 3Q9VA 3WODF 2UYBA 2GQQA 4HF1A 2HQNA 1FC3A
chains in the Genus database with same CATH superfamily
4UFLA 3L2UA 1R091 1GBGA 2QCSB 3A01A 2R7UA 3U1XA 2BNMA 4Y22A 1VI0A 1HQWA 5FR3A 1X9TA 4RB1A 2WFPA 1LU2A 2JSCA 2LOOA 3PQJA 1YFXA 5IVEA 4XN0A 2FMLA 2CGOA 4Y33A 4EJWA 5GAEJ 3BTAA 1YTYA 3CZJA 1WCUA 1QPIA 2A6YA 1LDKB 2TRTA 3LA7A 2UY8A 5FO7B 3Q9OA 1SC7A 3D5SC 5ABJA 2CUFA 3KP6A 4YVWA 3I58A 4LLFA 1O91A 1TNSA 4AQSA 4ISRA 2P17A 4GQ7A 3A1YA 5LA0A 5H9SA 2DOAA 4C2MJ 2RS53 4HLYA 1GMMA 4YNIA 5FY9A 1P2FA 3NNMA 2WB1N 2FX0A 1LEAA 1VBA1 5H6RA 4A12A 2WLQA 1QZEA 2GBYA 3U9GA 2O7OA 3LWFA 5ILSA 1NCRA 3JAMZ 2A5WA 5B2GB 4JCKA 1WJEA 1HB1A 2BBVA 2XBO2 3CCRI 2EA7A 5GZEA 1OA4A 1PVC1 5B1BH 2I07B 3WDVA 2Z79A 3OV8A 3DKWA 3RSNA 2HYKA 3SEEA 2VPLA 2XPJA 3RWKX 5DMYA 1LFBA 2ZGLA 2ZAHA 1FX5A 3MEXA 1R71A 3THPA 3J81K 3UV9A 2OTJI 5EF6A 3IKWA 3DCQA 2GNDA 1WI3A 4KMFA 1DLLA 4OZOA 3G7DA 4NRMA 3HVDA 3IDBB 1YOVB 4Y4RA 1U9OA 4INDA 4AI8A 2VO5A 2G4IA 1MH3A 4OAYA 3AVSA 3JRDA 2L01A 4RGXA 4LBJA 3JREA 5HXMA 1OCCH 2PXJA 1LPQA 4JRAA 2OC6A 2R7OA 4BLJA 4ESFA 4PFPA 4KDPA 2O8XA 1Z1DA 3RQ4A 4DXZA 4DQAA 2GLOA 3OUIA 3GBWA 4FTHA 1R093 3ROUA 2LF7A 3IMMA 2QVSB 3RS6A 1FNZA 2VQTA 2DOEA 1BJZA 2IA0A 5JVGF 3FLTA 4FPFA 4XQWA 4BWOA 1FPN3 1VMFA 1MMNA 1UQXA 1LNWA 1WCMJ 3K4AA 4JQFA 2P3YA 4AVVA 1QJX2 2ES3A 3H5AA 3G71I 3OYMA 2ZABA 2XASA 3A0HC 3EUKL 3CU7A 9ANTA 2O61A 2DXIA 3LDBA 2RC4A 1ERDA 3AZWA 1LGNA 4JTOA 1GVDA 3ZSMA 4AI1A 4WM8C 2VXRA 2OA4A 1EH6A 2P6CA 3NW4A 4GGGA 3JSOA 4M3CA 2CO5A 4FPOB 1FV3A 5JVVA 3WF1A 4CCEA 4IRGA 2DJIA 3LF7A 3K7AJ 1QGPA 1YQ5A 3FZ3A 4BDZA 1XJAA 3ACGA 4YG6A 4RQPC 4WXDA 2HEOA 4XQDA 1WA4A 3FISA 1F9KA 2K9SA 2VVFA 4R9DA 2GMEA 5DAQA 4NDLA 4P9YA 3AZXA 5A80A 3RKWA 4M3GA 2COBA 2NN8A 4QMAA 3O14A 3ORJA 1PVEA 4UW4A 3NL1A 2HTJA 3FXJA 4QTRA 2ADEA 2R1DA 1Q43A 2AENA 2HFHA 1X1CA 2WSVA 4AEMA 3NV1A 2RVAA 5KXBA 3LSPA 2L7ZA 3LSGA 2RV9A 2JDZA 3OY9A 5F6FA 1QNWA 1Z67A 4AF9A 5DAXA 2KZGA 2A6TA 1KA8A 2Y34A 1JT0A 4BLIA 4AI2A 4XZPA 1BW6A 4RGKA 1GNHA 5K7PA 3BR6A 3A03A 2FMDA 2VZVA 4A6EA 1QY4A 1SD4A 1R36A 3ELNA 2DOFA 1AR71 1PK6C 4D3WA 2EXIA 4HF0A 1LOFC 3WTSC 5JOYA 3FDYA 4QQHA 2R7DA 4F3QA 2FD5A 1Z91A 3I59B 2NAZA 2R1BA 4D6SA 1J3RA 3GJAA 1W28A 4AHZA 1AA7A 1RMU2 4KWJA 1HRV3 3B9CA 2ESNA 3W2WA 5F5QA 3VHRA 2ORZA 1CJDA 5IY5H 3VBHC 4IHTA 1NX9A 3VZLA 2H0VA 1J09A 2VOXA 2QUFA 1Y9GA 4XACA 3VYTB 3OY8A 1UU4A 1IS5A 1EH7A 4OMYA 2B8MA 4E7SA 2KR2A 5AONA 3M4FA 3UGHA 3D3AA 4D69A 1LECA 2QZ3A 3LGRA 3FHAA 1ZLJA 4HLXA 2J5OA 3I97A 4J1XA 4KMQA 2HYGD 3NWTA 2ETEA 4UFJA 1UW8A 2W85A 3LQCA 4M4PA 1LRHA 5FPUA 3K2ZA 3K1NA 3ZDSA 3I7DA 2R7ZJ 4M3CE 3SFZA 4XJWA 3O1UA 4WCGA 1EYBA 2XJQA 2JKBA 2PA7A 5D4RA 2IW5A 2XAJA 3PSFA 2GZWA 2MSYA 5LK7B 5FKLA 3F22A 3HSEA 1NT0A 2TEPA 5KHKA 3RQ0A 3OD4A 1HV0A 4GXOA 1IQDC 2OBPA 3NARA 1WMEA 1G2HA 3KP3A 2C9AA 3AK0A 4G7ZF 4QU1A 2Y6LA 1P8JA 3CD6I 1RNLA 4F3JA 3S3NA 1LB2A 1XSVA 1GV9A 2HTSA 1RHI1 2VI6A 1Q3EA 2CHHA 3OYJA 3FM5A 3AMHA 1GV2A 2PMUA 5IT3A 4JDNA 3N3HA 5J3LA 1ND2B 4C1WA 5A3LA 1YFWA 3WW1A 2VPRA 1ZR2A 3ECHA 3BN6A 1XTAA 3ZDVA 1ZK8A 5M5YJ 2MW8A 5M5WJ 3GTMJ 2DFCA 4AAXA 2RGVA 1MS9A 3ZVXA 1SEFA 1GLHA 5C9AB 3ZRGA 1X50A 1YIOA 1JMUB 4YVWC 2A3XA 1TQIA 2EXHA 1AX2A 3AL0B 3TNPB 4L8QA 3OYCA 2DU9A 1SFPA 1NYWA 4L9VA 2R49A 2O9LA 2IS6A 3HOYJ 1ZRIA 1JE8A 2CAVA 1QPMA 3V4GA 2F48A 1OLME 2HWF1 3JD72 1Z21A 3BG3A 1WCDJ 2PHLA 1KRIA 4XLPF 2R042 3ZYHA 4FCAA 5AIQA 3GTOJ 1RUI2 3PMEA 2MEV2 1NZCA 2RDPA 1X8MA 4XUNA 4SLIA 4QM9A 2UY9A 4KL1A 2QQWA 1W36D 3O0WA 2K4BA 4LO8A 5JLVA 4BUPA 2LS6A 4GULA 2R0HA 1R64A 1OOPA 3TWIA 4EN8B 4ZZLA 4G7OF 4IV1A 4CDWC 2RR13 5IW0A 3TEDA 4PJMA 2V1XA 2IJLA 1I9RA 3QU6A 4DMIA 1RUOA 4NMIA 3WF3A 3PUQA 5D6EA 4HPKA 3DBLB 2J5PA 1COV1 3KSCA 4RB2C 3CJQB 3LSEA 1RMU1 3NV4A 3BWGA 4KYWA 2VG9A 2YPJA 3TP0A 4ITVA 2X9DA 4RM3A 3KZIC 1J9IA 1FMD3 1S0GA 2Q4SA 1FAYA 2Q1ZB 3J7LA 3RZLA 2ZMEA 4AFMA 4HG6B 3GF2A 5J1YA 5A7QA 3BODA 3FUOA 2DA2A 4LO5B 5A7SA 4MNUA 2CRGA 1DU6A 2V9KA 2V5YA 3BTXA 2KA3A 1SVLA 1T38A 2RNGA 2E7WA 1KYZA 1I27A 2P5LC 3I8TA 1TWHJ 3RQIA 2VODA 5CVJA 2VXDA 4HKWA 2P5BA 2RKHA 1YWKA 2VNGA 1Y39A 1UXXX 3HQXA 3WNKA 1O4XA 3PUBA 2R6QA 3VGIA 2XBO3 3GMEA 1VQPI 1RUF1 1QRYA 4K7JA 3MYXA 2VTXJ 5FXWA 3QPSA 2DTRA 1TVGA 1V6KA 5HNFA 2H8WA 1N3OA 2BW3A 2HNHA 1VQKI 4L5EA 3W3CA 3D5LA 4M6YA 4XXPA 2QKMB 4TZDA 4YEJA 4L0YB 3NAPA 1PP8F 3RTRA 5EG0B 1EPZA 3BR5A 2ME6A 5FKCA 4XXAA 1WBFA 4FXKB 2HXIA 3UNGC 1FYLA 2OT7A 3WD5A 4BQ4A 1JBCA 1H1MA 1NUKA 2J1TA 1YJKA 2A6HF 2HWC1 3DP7A 3IRRA 4A3EJ 4EV0A 1ND2A 2QQMA 4P08A 2JA2A 2C24A 5K0UA 3AP6A 3U11A 2G0EA 5IYYA 2OYZA 3RZKA 1ST8A 4B4RA 1PIV3 2D6NA 1VRH2 2R7TA 4OULA 4QU2A 4Q4X1 2EILH 3FMSA 3MKYB 2XLFA 4AQTA 2V1NA 1OLQA 3WZ1A 5D8LB 4XIKA 2GOXB 2DCJA 4E7KA 3CP8A 5F5IA 2VMCA 1YEWA 1ETQA 3E7LA 2HYXA 1DDNA 2VAUA 1A31A 5FYSA 2VBZA 2Y9YA 5HLIA 2UYAA 4UUSB 1BA5A 5DEQA 4QDRA 2UV1A 1DQ6A 3N7MA 1S0EA 2NYXA 1ZREA 4Q0SA 1L7QA 3AZYA 4LBLA 4RR3B 3BOQA 3KETA 1J3PA 4Z2WA 2XAFA 4HYEA 2XF6A 4CDXB 1UYYA 5K9YA 3A4CA 4IEUA 4RL7A 4OUMA 5F27A 3V7RA 1XGSA 5FD6A 4ATEA 4UV8A 3IL2A 1F4AA 4XE9A 3BQYA 1VALA 3PJQA 5FZIA 2YV8A 5H6QA 5FZFA 2Q8KA 3WNPA 3OYIA 1H8VA 5E8GA 4XF0A 1TTYA 3WW3A 5I91A 1EV7A 5EJZB 1P9QC 1K83J 4C3HJ 2ZGUA 2OTLI 1QZZA 5FCCA 3DN7A 3ISPA 1AYM2 3VB9A 2XROA 2LKPA 2IVIB 2HWE2 3S2HJ 3TN93 5LBQA 3KM5A 4D5CA 1QDOA 4Y24A 2ET1A 1AR61 3C2HA 3SZPA 1SBEA 2GU9A 4E4DX 2JKXA 4M0HA 4RAFA 3I2HA 3KP4A 2W9XA 3RJRA 3JCIA 2WC2A 1N1TA 2HWD3 4RAZA 1CWPA 2XGXA 2GALA 4YM0A 2W92A 1MGTA 4H14A 1MBJA 3OOUA 2F4MB 3ENRA 2WKKA 5DDJ2 1H2NA 2RMU2 2E1CA 3ZKYA 4IPAA 1YFYA 2W94A 4FQ4A 3A7QA 4XUOA 2EZKA 2BV6A 2HR3A 3ABTA 2BOIA 2FBKA 3A02A 5E8IA 3D0SA 1B8IB 4LD5A 3V8KA 2WIIB 1RTVA 1N3QA 3BY6A 4PHZA 1LGBA 4NN0A 5FYYA 1S7OA 1AR82 3MLJA 3AKPA 3KZ4C 4A0ZA 1QJEA 4Z8BA 1GZCA 3KD4A 4N0BA 3N36A 2LW8A 2LDUA 4UB6C 5L9RA 5JI7A 1RUG2 1LJ7A 2NVYJ 5LGUA 4BA6A 4DUWA 3VD5A 2UXNA 4XBLA 1O4YA 1A78A 4P5OA 4E7ZA 1MD0A 1HRV1 2DW4A 1YUDA 3OGJA 2F5VA 4BJ5C 1ODNA 3EUHC 3QD6A 3VBFC 5FQ0A 3NMBA 2HZDA 1AYM1 5A3OA 5BNPB 4CUAA 5DCFA 3BPVA 4CE8A 4ASNA 5JSOA 2J42A 4FPGA 1OQDA 2NMNA 2FOKA 4MGYE 1VLNA 2HPMA 2GH8A 2LC2A 1NCRC 4EMSA 2NYYA 1L7LA 4DZGA 3FBNB 1B1BA 5C71A 4CHUA 1RJ7A 4G7HF 3LL7A 1XQNA 2LTNA 2VW1A 4I2OA 2M5WA 4XMYA 1ETOA 1DQ5A 4P9JA 2QTWB 4I0WB 3HPNA 4XRMA 1MACA 2VQGA 5I0DA 1FX7A 3E6DA 2Y48A 1K5MC 3VDCA 1X8EA 4M6VA 1F4KA 4HKOA 2X6XA 4JBAA 2HU9A 3SCFA 1R6RA 2ID3A 4IEJA 3OL3A 5C8CA 5C5UA 1SLTA 5IK7A 3S14J 3BOWA 4ZXKA 1OOPC 1UOBA 4NRPA 5IVCA 1AYN2 1W3XA 3EHKA 1ULPA 1A6IA 3ZQIA 2XVKA 1B09A 4AHYA 1H4HA 1Z0HA 4EQQA 1B8IA 5F9TA 2LYCA 1ZRFA 1O59A 2ZBJA 5FZ3A 3MBWA 3MDPA 1O3RA 2WJSA 1EV12 1VQ8I 1MVQA 4H7LA 3BCBA 1FXZA 4KIFA 5A7WA 3CJIB 4B1RA 1OLMA 2ECCA 5GZFA 5GPCA 5JUVA 4YW1A 2A6VA 1KYWA 3GLXA 5C4XJ 3BR2A 1A35A 3WCSA 1FIAA 3S57A 5KHJA 3WNNA 2OQ7A 3IH2A 4H55A 4RAGA 3CMYA 3CMGA 4LO6B 3WQ7A 1JUHA 3FXLA 5HLHA 1ND2C 4BE3A 4OYUA 5FROA 3BLYA 4Z2YA 5A7NA 2VVEA 3Q8FA 5L3EA 1QU0A 1U3EM 1PGSA 1NQJA 4WM8B 2WZR1 1HW1A 3MZ8A 1ETYA 2ZX0A 4AM3A 3I3BA 2VUMJ 2WS92 5C9AC 1YJNI 4UWDA 4XAEA 1W8NA 1ACCA 4Q4W1 1IDZA 2HVQA 2BRTA 3QWLA 1XMKA 3DLAA 2WQ8A 5FY5A 4N53A 1RUJ1 1EY2A 4YG2F 1DP3A 3E1SA 3W5MA 1YO5C 1OH3A 2PHXA 5J1XA 1VQOI 1KGYA 5F5AA 3PURA 5IVBA 3GZ6A 4Z1VA 3OR1C 3WF0A 4IGPA 3CQOA 4D94A 1VB2A 5JVTA 3G6JB 1R1UA 1L3LA 1R7JA 4PDKA 2MLKA 5EZHA 2W39A 3P9KA 1TZOA 2ZNYA 1Q8QA 1YCIA 4CP2A 5IAXA 3CDHA 2GC3A 3MKWB 1KEXA 3GLLA 5JHUA 1NY72 5EGOA 2DVBA 1EA3A 2OS2A 1MBEA 1S0BA 4LA2A 4NPRA 4G94A 2BXZA 5A6QA 5E6HA 4HBLA 1PP7U 2EFQA 1NLQA 1WJAA 2GXGA 3L2WA 4RGUA 5LCWL 5FY1A 1I3QJ 3F8CA 1R23A 5EIYB 5LBFA 4A5MA 3T0YA 5FJ8J 4M9SA 2VCCA 4OINF 2YYOA 1ORKA 4LBKA 2VC9A 3CEWA 1TWAJ 5LBEA 3AG4H 1WJCA 2KZVA 4TTGA 4PSXA 3SHFA 4NIIA 4QX2A 2YC2A 2EV0A 5GJ6A 5M0TA 4QPGA 2EXKA 3ATGA 4AK3A 1SQ4A 2X6OA 1WCKA 3ZMOA 1NK3P 4Y15A 3N9NA 1Y9QA 3H35A 1IAWA 1APLC 1W9WA 2VPVA 3JQXA 3WP5A 3B7MA 1QHGA 4M3BA 3VKLA 3S1NJ 3F8FA 4DOZA 3TL4X 1XGNA 1WI9A 4AVPA 5CIRA 2X4HA 1FY7A 3JTHA 1O3QA 3IKTA 3MI8A 2AEYA 3WHBA 3VDAA 4RGGA 1U0JA 4A3JJ 4Q1RA 1W6MB 3CDZB 2WNVC 5TISC 1ZVFA 5LEKA 3M8EA 3HOXJ 2AR6A 3QPHA 1Q8VA 1TQMA 4AVTA 2BPA2 1W8TA 5F32A 1J5YA 2PJPA 4I0BA 2MFZA 3HUGB 1S55A 1JJ6C 1D8JA 3JRFA 2AYHA 5LBBA 4LUMA 1LDJA 1TME3 4D7MA 2DMTA 3O6BB 3W58A 2QQUA 2ZC2A 1LAJA 2E36A 1MMDA 3FXOA 1H88C 1FBSA 4O9GA 3H50A 5J48A 5F0CA 1GXPA 4CZCA 4OMCA 1ULOA 2GA1A 1XS9A 1Y9MA 3DYOA 3NO8A 3SMHA 3BGAA 1JUSA 2R7WA 1S3JA 2ZGRA 3RSJA 4A45A 5JIAA 3HDDA 5DCMA 4Z6YA 2A75A 2KRCA 3ZQCA 3GXUA 1OVSA 1D0ZA 5FRAA 2LMDA 3LIGA 2OXBA 5FY8A 2ELJA 1APNA 4MQ9F 2HGCA 5DD8A 2B7EA 3U4XA 4XVHA 5GLTA 4LBOA 3DPTA 1IRFA 3CMMA 4U2AA 3DECA 4DEQA 5D8KB 1TG7A 1A6CA 3IT8A 4S2DA 3OR2C 4ENMA 2DT7B 4M3FA 4MIMA 2L9SA 4RFRB 2G1MA 1LEMA 4J1WA 1WJFA 5LHIA 1QO0D 1T08B 2JDNA 5BNGA 1QJY1 3CUQB 2CG4A 3U2RA 5FPVA 5FKMA 1CQ9A 3M3CA 3UKNA 1OFNA 3DEUA 2C6YA 3WINE 3B93A 2VC1A 3A2KA 1TMF3 3RYKA 3I64A 3M70A 2Q2EB 2YUSA 3K6GA 1LFPA 4FI9A 1GDTA 4HG2A 4YM2A 1X36A 1JYIA 1M06G 4NR1A 2ZAAA 1S8NA 5DG2A 4I02A 2IFWA 3AKRA 1JH5A 1CONA 3MKZA 3A23A 4C90A 1DHKB 1VBA2 1YJ9I 4Y5Z0 1UZVA 1OD5A 3VZMA 3Q8EA 3KP5A 4ZTFA 3LSRA 2E32A 2GAUA 4FO9A 1SDDB 3G4SI 1J84A 1IN7A 2VBDA 2RM21 3WE3A 2BQPA 5L9BA 1E3HA 1O57A 2VBXA 3PLQA 4Y13A 2HH9A 2BVBA 1FTZA 4E4ZA 4CEWC 4D7NA 3LAPA 2I74A 2D1HA 2F17A 2DK8A 3O1MA 4C0HA 2VC0A 2YGMA 5FWEA 2FDJA 2BZTA 1QMJA 3MZYA 3QPTA 1MMSA 4HVRA 3RYPA 1YRNA 5AVAA 1MNEA 3PTYA 3FZVA 4EN6B 3BTIA 2LRPA 3ZFEB 1J3QA 2EXJA 1JODA 1RUG1 2DBNA 2BFUS 2ZX3A 3KB5A 2EBIA 5FTTC 4SBVA 4BYYA 3U4SA 1WJ5A 4XDPA 1JHJA 2VJXA 2CFOA 5IT9Z 4MHUA 4EN7B 5FOBB 2KLOA 1VTNC 3ZQLA 4BS9A 3FBYA 1QJY3 1FMD1 1VBD3 1MBKA 4NHJA 3KS7A 2DMUA 5A7OA 2Z99A 3SITA 3ZN6B 1S6LA 2N8GA 3X2QH 3I49A 4LUKA 1VQLI 3O1PA 1RB8G 1TQ5A 4Y1YA 2X29A 4PF5A 2NS7A 4XFIA 2IGNA 4LIVA 3C7FA 4BE1A 1GSLA 2XPUA 5F3IA 2LD5A 2L7FP 2P2KA 4I30A 2CW7A 1G8WA 1ULFA 4ZY9A 3U14A 3VL9A 1O7FA 2NM1A 1YX5A 2EIMH 3SQNA 5G04L 3WU1B 1QNTA 3U1KA 2B39A 2Q30A 2RS51 2D7FA 4GO1A 5EHDA 3K1MA 4ENJA 4Y1UA 4I7HA 3WDYA 1IN8A 3AJYA 3FK7A 3BJ6A 1AYN3 3VBOB 3V0AB 5ANNA 4FE7A 3CESA 3LEGA 3MW4A 3NQHA 5I8YA 4LE3A 1GP4A 5CG9A 1UZCA 2HWB3 3NNLA 4IZZA 3R0RA 4W65A 3FLRA 2XONA 4LT5A 2VJJA 3CLPA 3HJEA 5FO8B 2WO2A 1SLLA 1BC7C 3J9SA 3DPUA 1IXCA 4B8XA 1W2AX 1JKPC 2R5ZA 2HWB2 4Z82A 1ZBE1 1I5ZA 3PM1A 2ZHLA 5D2AA 5F3CA 3KQRA 3VHPA 5A1AA 3E97A 3QCWA 1EP0A 1H1AA 3NAPB 3RMXA 4Y20A 1YW8A 4LLNA 2KP6A 4R4XA 4CEWA 4QHBA 4UHTA 2DTZA 4WF2A 1OCZH 1DQ2A 2ZXQA 1H0MA 1F36A 3T30A 1YHFA 1F4HA 1FSHA 1QXPA 3LFIA 2W1QA 5F7UA 5E3LA 1LODA 3HKZN 2J1EA 2VQHA 3U37A 2DBIA 1OQEA 1R4NB 5B1AH 1XDSA 4I0AA 5C44J 4DYRA 3T2QA 3ZQFA 4LA3A 4LO7A 5AFBA 3KEYA 3KZZA 3PFIA 1TEIA 4Z2AA 1O8SA 3ZMDA 1NG0A 1V5GA 1W2OA 3A22A 2E51A 5FP9A 2VQUA 5K4LA 3CJNA 4XPVA 2RR12 2ZB9A 4B1MA 3DTEA 5TGTA 4AE2A 4DGWB 4IV3A 4YFKF 2LKXA 1GANA 5CNAA 2JA6J 1HN0A 1GKBA 1NG7A 1KDKA 1V00A 2BOLA 3AMQA 2CGPA 1AX0A 1KGSA 4ETSA 3KVAA 2VB6A 1QJU2 2UZKA 3FE5A 3PNTA 2QQ9A 1ZA4A 5GAGJ 3OF1A 5FMBA 2OCCH 1RUC3 2JUGA 3LEKA 4OAZA 2F4PA 1RC9A 5KR7A 1W2TA 2YFZA 5HS9A 2R32A 1UYZA 3VBUC 1D5YA 3ST7A 3AP5A 5GLUA 1D0YA 3EYIA 1NXMA 4KU7A 1SVOA 2CV0A 1QJU1 1C5IA 1AR93 1X3ZB 2VKDA 1ZGJA 3BR0A 5EQUA 4YW3A 5E20A 4HMZA 5A6YA 4IHVA 4TSVA 4ESBA 1OKOA 1UWWA 3S0MA 3FUQA 2R30A 5GLVA 2IS2A 2Z4FA 4KMUX 2WABA 4TYSA 1B9NA 1N3PA 1W6QA 4BEHA 2VU9A 4IETA 3VKNA 3WE2A 5I8TA 3KFWX 3BTJA 2A3WA 2W48A 3U10A 5A6ZA 1IRGA 2P34A 4FASD 1IF1A 1VF9A 3DWLE 1ZG3A 2TBVA 1SAXA 3JBG3 2P5KA 3TO7A 4Q48A 4AWXB 2Y6HA 5CU1A 1JOJA 5C8CC 2P1BA 4YIRX 1V6NA 4G6DA 4LO4B 4X6AJ 3ZFFC 1XB4A 2VMGA 1UJ8A 1BBT1 1SG3A 1IRXA 1OCOH 5F37A 2PN6A 4BPZA 3DTKA 1UHWA 2E19A 1CESA 2VE8A 4DS0A 1LOAA 3HUGA 1RUJ2 2V5DA 4OHWA 3CHXA 4YFWA 1PGL2 4NO4A 1NXD1 2JE8A 4IF4A 1ZLKA 2EIJH 4YM3A 1RJ8A 1JYWA 5DDJ1 2Y26A 1PMJX 4HVOA 1VIWB 2GM4A 2UYBA 2PX9A 3O1TA 3FF5A 3MIDA 3EETA 3IHUA 2VH9A 4B4PA 5HOOA 4FCYA 1X4PA 3OYAA 4OCTA 2VZPA 1ZTRA 2MA3A 1NCRB 2W4SA 1XYPA 3M8LA 1PGL1 3M07A 4OQ9A 1CPNA 3ACIA 2C9KA 3ACFA 5F6LB 3QBQA 3O1SA 1UCRA 1FP2A 4GIQA 2WNVB 1XNDA 4E8DA 5A3NA 3C8XA 4WM8A 2FNPA 4BXSV 2A61A 2KDOA 2ZSHB 3BQZA 4N7UA 1ETKA 2HKXA 3CQZJ 1CAUB 5FXZA 2VD7A 3RIRA 2XL7A 1LESA 2VNRA 1S2BA 4HPKB 1MNMC 1V9U1 4BQNA 1F35A 5FZOA 3POGA 2V72A 3DKYA 5CKQA 5LB6A 4FX4A 1ASJ3 3TOBA 4MGTA 3PUIA 2RG4A 5DUXA 3S3OA 2YB7A 3LEMA 2QSFX 3ASIA 3DU6A 1DGRA 3CC4I 5FZ9A 3MMYB 5FP3A 2MH9A 2EZLA 1UIKA 3AFHA 1WLDA 4N8MA 2W08A 1SFYA 5KC6A 1POGA 5FYHA 5FDBA 2JA5J 2JT1A 3VBSC 2DWRA 2NNNA 5C8WA 1AYM3 1BYHA 3OBAA 1YQ8A 3K4KA 5IP9J 3TN92 2DMQA 4CGZA 3PFYA 4EZHA 2Z2SB 3CJIA 3POSA 5A7WB 3KCCA 1T6SA 4N43A 5CEHA 5D5UB 2DUPA 1WLTA 4DXRA 4B3NA 2WB1A 4GYGA 2PJRA 2PLV2 1RUH3 1UYPA 4BY1J 4WVMA 4E4HA 1W6NB 3CUQC 3ESWB 4B09A 1Z3XA 1QHDA 3ZMTA 2BJSA 2HPIA 5BXXA 1RPWA 2C1FA 3MHZA 3ZIWA 2V7FA 3FMRA 3USSA 1F43A 1ZHFA 2DO7A 5ACA2 1SFEA 4LJHA 2W68A 2BDRA 5LEJA 5BUVA 3DBHB 3BIEA 3QRFF 3DPRB 2BZDA 3U1DA 2XJSA 1JHFA 4YLZA 3I2JA 3J4UH 4YVWB 2UU8A 4MEYF 1RUD2 5C6CA 5JR3A 4FFGA 4AFAA 2RJ2A 3GUDA 1GNZA 1W7PD 4WBBA 4Q4X2 4C2UA 2D45A 2X5IB 3IDCB 5KCMA 4BISA 2BEOA 4BU2A 4NJ4A 1PVC3 4EVIA 3ABLH 1JYNA 4RA2A 3GF6A 4BQWA 3HC7A 4HNVA 2YX4A 1RUG3 2YC0A 1CZTA 3JRAA 4NC6A 3B5LB 5K0UC 1LVAA 1Z6TA 1XD7A 4R4ZA 2W5FA 4XFFA 1ENHA 3BG9A 1I3HA 4ZYHA 2EFWA 2VQLA 1H9PA 1K42A 3H9JA 4M6XA 4MGKE 3DYPA 2H09A 4BB3A 1G3YA 3IMNA 2OA2A 2M7AA 3H8XA 2HI3A 5HVQC 1AL22 5LRRA 4GDFA 5C33A 1IPSA 2E7AA 2P7CB 4CU8A 1LENA 1WKYA 2E7QA 4NQWA 1N1YA 2WBKA 2VOKA 4UVCA 1GZ9A 2R7VA 2HOTA 1QKQA 1D2QA 1Z7S1 4QX0A 3R61A 2DFHA 4G9SB 2B0LA 2DFIA 3BTCA 4PDWB 3VD3A 3MV11 5JI9A 3RGBA 4W6XA 4QHZA 5KHHA 3UGFA 2KIFA 5IK5A 2KMUA 2Z9OA 3HBZA 1YIJI 1DQ1A 1N1SA 3VD4A 3MIFA 2MABA 3ZCOA 2FCTA 2XQRA 2GNTA 4AIDA 2EFPA 2M1BA 3ZYJB 2E9QA 4DOUA 4HV6A 2DFEA 3H7JA 1QEXA 5FZGA 5FYTA 3MKLA 1J83A 1UY4A 1FNYA 5FYBA 2KIMA 4ZS2A 2ZNZA 2LVSA 3DPRA 3O12A 1H8AC 3R4KA 3F6OA 2R7QA 4QPGC 3PO3J 4FFFA 2EIGA 4IJAA 3VBOC 5K5QA 2I2SA 2RVCA 1MDMA 2Z16A 3INAA 1W1WE 5CG8A 3RPQA 1XN7A 3VODA 1A6QA 2Y38A 4ARYA 4TN7A 3VSKA 3DXUA 3RCOA 2BXYA 3OJBA 3S3MA 2HWC2 1WCSA 5C3OA 3ZP5A 5JOZA 5FLHA 3V0AA 1K45A 5KXEA 4ZH4F 2Y69H 5L9VA 2ZEXA 5FZCA 3I3LA 2QUOA 5BNOC 4P9GA 1RVF3 5EP9A 4LLGF 3BTLA 2QM3A 2YXSA 4HKLA 4F8AA 4CDWA 1XMAA 4RLFA 2VY0A 3VBHB 1WRJA 3HSRA 2JECA 1FMWA 1J7KA 4LLLA 3S17J 1WD3A 3QQAA 4NPMA 1NAEA 1W8ZA 1F5JA 2K9MA 4CCJA 3K4MA 2ZJRF 4P5YA 4RMNA 5EEHA 4HZFA 1NY71 2YMZA 3LSHA 3K4LA 4IHWA 4OVEA 4A42A 2AQFA 4XHBA 3ASOH 4UF0B 1MS8A 3EXUA 1FOD3 4JDMA 2WAFA 3GCWA 1ULEA 3J7NA 1UG0A 2NQYA 4K8RB 3ZSJA 4NB5A 4MGQA 4W6YA 2PQSA 1GOFA 4MGRA 3ZPYA 1YJLA 2R4GA 1OKRA 2FQ3A 4N7IA 1SZBA 4X0GA 4XW3A 4QSHA 2YG0A 4Q0QA 5K7FA 2EQRA 4I3PA 3VBRA 3H0OA 2NOGA 1JUIA 5E18F 5DXDA 1W3VA 1RUF3 3CJXA 3HR9A 4G3YC 2D93A 1YI9A 4YVSA 4B3XA 1W8UA 4OIRF 4FSJA 1X19A 1MZEA 3UNPA 2HVSA 3NQOA 1XNCA 2PMWB 3MV01 2Y6JA 4XLCA 3N35A 4E2QA 5J09A 1OQ1A 5HODA 5CISA 3PUAA 3R6SA 2PHDA 4CU9A 5HDNA 2JZYA 5DD4A 1K61A 3WG9A 3O1VA 3OYLA 1G59A 4LK1F 4CO8A 5IWFA 1ZBA1 1OBNA 2XB0X 3USUB 4PFOA 3M8JA 2WAQN 3NJZA 4KIBA 3HYIA 2GH2A 5JMCA 1FV2A 1GWKA 2IAIA 3TW7A 5L73A 1K78A 1S0FA 4XEZA 2F6CA 3CC7I 1RGSA 1IUFA 3TN91 1QQIA 3JCUC 5BMZA 1VBD2 2GDFA 2FDHA 1JN2P 3OD0A 2RQPA 3S1QJ 2QENA 5ICCA 2YDEA 3AYAA 2HDDA 1Y43B 3HEFA 4META 4DJAA 4WM7B 1Z7LA 2PFBA 4D0QA 2XHKA 6PAXA 5L3CA 2NZ9A 2P81A 1LHWA 3F3XA 2EJRA 2ZXIA 1FYMA 4XKBA 1HLCA 1UY1A 4L9JA 3V7CA 4FQGA 4KI5M 3HPGA 3OYDA 1HJGA 1WW5A 2AREA 3COAC 4QQ2A 2XJTA 1NG6A 3H0DA 4XDOA 1DGRN 4OUEA 1GYKA 2DA3A 1EAH1 4PI2A 2W47A 2YBSA 5IP6A 5FREA 3PNVA 3MD2A 4D7TA 4GWNA 3FIWA 2WR9A 4AAPA 1KQ8A 1SMYF 2CUEA 3WY6A 2YX7A 2YU1A 2LP0A 2KRFA 2R7RA 1AR81 4IKFA 1MS3A 5E89A 5FZLA 2M30A 5EJCA 1AR73 5E1XA 5IVJA 4PJ0C 4UBGA 1CAVB 2ADUA 3LCPA 3IAPA 3H7YA 1IN6A 4C3JJ 2CDPA 1VQ4I 4MEXF 1PUEE 4COYA 4UFHA 5DYMA 3OSGA 1Z7S2 1ODMA 5FLMJ 2VGDA 5DUKA 1QJX1 3OIQA 2VL8A 2IRFG 3I71A 2WZPP 5FZ4A 1GWLA 1PX4A 2DA6A 3GTQJ 3PUFA 3BC8A 1MS1A 4KG0A 1CJPA 3HN3A 1PVXA 3OGVA 4TXWA 3T2TA 1S7AA 5CQGA 2HOSA 3RZOJ 4NAOA 1J59A 3S2DJ 4UBHA 5C9AA 2PHUA 2W1SA 2X1EA 2Y0SA 1BL0A 5F2SA 4IDZA 2DDUA 2ZMEB 3OPWA 1WVRA 3UESA 2K02A 3LA2A 4IE5A 4CYDA 1D4M2 3WG2A 4XRSA 3ZXFA 1O3SA 4PLOA 4DXTA 3K4BA 1OOPB 4YYOA 1ALYA 3PVEA 3HBLA 3PVNA 1AKHA 3VDDC 3GZTB 1KJRA 2C26A 4D8MA 2JB8A 3RI9A 3Q0UA 1VBA3 1GXQA 2M4KA 2VLAA 3CJIC 3TP3A 5F1JA 2NVUB 4LK6A 2BVMA 2YBKA 3AKSA 3MCZA 1IN5A 4IV3C 3FXUA 1C8M3 1AR83 3F2ZA 1UOFA 1C1FA 3IV5A 1E2XA 4JX0A 5LA2A 5CJ9A 4CRQA 2XWBB 3AB0A 4GB31 1HKTA 5FLIA 3R0JA 4QKDA 1RHI3 3CO6C 3M3QA 1S0IA 4IE6A 3IH4A 3IZOA 5HV4A 4E8CA 3WQ0A 1BLZA 2DPDA 1Y8QB 4BQXA 1PO21 3VBSA 3ULQB 5HBAA 3KX2A 4LHKA 3MWMA 3BPSA 3CJRB 4F55A 1XXNA 3T3YA 2IGKA 4Y5TA 2VJ4A 2VT3A 2X8KA 1A8MA 4PI0A 1X82A 2FCUA 2KKOA 3KYDB 3I56I 3OPZA 3AZZA 1AR91 4KISA 3SYTA 1S4CA 5CPRB 5FD5A 4R9AA 2FF4A 1Z78A 1ETVA 4AIJA 2UWBA 2VONA 1SCSA 1IKPA 2LREA 5CB7A 4PLMA 4K20A 3P5JA 1YITI 3SQOA 4E2SA 1BR2A 4Q5SF 1VP6A 5LA9A 2ID4A 4HDUA 2YBPA 4HRIA 2G19A 3ZM8A 5D6FA 5T5PA 2ZGKA 3WG3A 4CDQA 5J1UA 2A69F 1EKEA 4YW4A 3MW2A 2G9WA 3TB0A 3WUDA 1SLCA 2WO3A 1I1EA 2IEKA 1JT6A 2H0BA 3POJA 4GH4A 4IEPA 3UGGA 3GHMA 2ARXA 4FPKA 2CW0F 1IZ3A 3K70C 4NC7A 5FZ7A 3LE0A 4GJZA 2DQRA 3OMYA 4XL9A 5C3PA 1A34A 3KT1A 2YS9A 4YSFA 1T2XA 5L7OB 4GZ9A 1UMQA 5B4XA 3BJOA 3ZFEC 1QH7A 1FP1D 3ZXGA 4DXSA 2EICA 5A6XA 3KP2A 1OC1A 2QVOA 2UXXA 3LDRA 4TV7A 1LE8B 4K2EA 3W2VA 1ONAA 4BH9A 1NZIA 3M7AA 4B4CA 1X2MA 2M9HA 1JXNA 4MXVA 3POEA 3OBRA 5ANQA 1XE0A 1HX6A 1N77A 1SHWB 1IQAA 1RETA 5CVVA 2BGCA 2YFUA 1QJZA 3TMOA 2CU5A 3JW4A 2OIIA 1LFUP 4WK8F 4ZU5A 4XFBA 1SD5A 3MLKA 2ZMKA 4HK8A 4LMFA 5FZEA 2M45A 5DV5A 1KITA 1HBXG 4D1QA 4JX6A 3KEOA 3E5XA 2ENRA 2VOPA 5GLZA 4ZDLA 3M7GA 2DCKA 3B01A 2WNUA 4MXWA 1POV3 1HJFA 4K9SA 3JB8A 3BG7A 4LJZF 1WW7A 4XFHA 5KHIA 1UAAA 1LOFA 4PJJA 2WAQA 3RYRA 2NMOA 3MAJA 4FPYA 4IE0A 2MYSA 4CDGA 2A3SA 4FPLA 3WF4A 1U12A 3O7OA 3ZXLA 1OVPA 2VZOA 4NBQA 3EMRA 2IVJA 1R083 4KN7X 2D6KA 2V6EA 3KT7A 5BNPC 2RHPA 2C5DA 4M01A 2W84A 1WCQA 3PJYA 2GIVA 2JA7J 5FLXZ 1CX1A 2FMYA 4ZZ8A 4BBRJ 5CADA 4DEVA 2OZUA 2BP6A 5FRNA 4Q4Y2 1D1BA 2A6WA 5HDKA 2FHRA 2FZ2A 2FCVA 1MEC2 3L00A 4U0VA 1VBB3 1JZ7A 2CJJA 1XNTA 3DL3A 2M87A 3RI8A 2SLIA 1YQ2A 2ORXA 1JI6A 1WQ2A 2Y64A 2R062 2PFWA 4N9HA 2TDXA 4MTEA 2HWD1 3ZN1A 2D6LX 2D3SA 1YIFA 3ERMA 2DYRH 1XSRA 3J7AY 5DAVA 2NOJB 1RUD1 2JN6A 3V7SA 2Y0MA 3ALQA 2BBYA 1Y4WA 4ATFA 4UUSA 2OCEA 1E5IA 3H1YA 2KL4A 2M4GA 3VZOA 4PGHA 3L2QA 1DQ4A 3VB2A 4XR6A 3FFZA 1TW3A 2ZJPF 2WWUA 2VASA 1IO2A 4NHYA 3V8LA 3H42B 2O0YA 3H9GA 5HNHA 4YVSB 2MC3A 4A3ZA 3DBRB 1LVKA 3IPVB 4CP9A 3T08A 1OYYA 4DO0A 3UKVA 1UZZA 2Y8KA 4XDQA 2QBXA 2JDUA 2K4JA 1MR5A 5T55A 1BW5A 4HT1T 2XC7A 1EH8A 1UPSA 1PIV2 1XE7A 1FOKA 1J1LA 3BB6A 2M34A 4XF1A 4EM1A 1POV0 2J1SA 5ILUA 2XGCA 3Q3SA 5L36A 1ZZ8A 3JZVA 1XYOA 4JVAA 3G2BA 2E53A 4V2FA 4M73A 3F72A 2DURA 4GWJA 3I55I 4Q29A 3QU3A 4Q8LA 1RXGA 2IXCA 3HL2A 1AR72 1JU3A 1UD1A 4LKSA 1GU3A 4BBSJ 5CFDA 2CYFA 1BMV1 3OIPA 2E1MC 1VZ0A 3HRSA 1MZBA 4ZZDA 5JIUA 2J1VA 5CFCB 4PGGA 1PO13 4L0PA 3WR0A 4CEYB 3K75B 3TEZA 4QPWA 4HK9A 1HSTA 2GMPA 4U36A 2WO1A 4FBFA 2CQKA 3S1RJ 3SCGA 4B4QA 1US3A 5EV7A 1UO9A 4ASKA 3E6BA 1LHNA 1V6JA 1O4ZA 1VBE2 2WAEA 2L7MP 4Q5OA 4ASLA 4KITB 5JXIA 2VMHA 1FI2A 1UIJA 3V0BA 4BAYA 1SFNA 3CDLA 1W8FA 3VZKA 4UYBA 2HDWA 2YROA 2ZJ2A 1PO11 1ENQA 1GQPA 1J58A 1E17A 1NLRA 3PDQA 5FGMA 3VEPA 5F0HA 3BR3A 2O14A 5BNPA 4MQVA 1WH7A 2RREA 1D2SA 4QGMA 2P5VA 3OYBA 3HPHA 3CP2A 2RDSA 1RUH2 3AAFA 2X1DA 1TNRA 2VJIA 2DI3A 1GUUA 3I2IA 5G05L 1GZTA 5LGTA 4XJ8A 2E31A 3PSIA 3IC7A 3ZR6A 3LOBA 3H5RA 1IW7F 2RAEA 1H6XA 1R1TA 1RR8C 3WHTA 4JGZB 4XBQA 2ZX1A 1QHHD 5C3EJ 1FJLA 1DYOA 2WNEA 2L2OA 4NWWA 5CVUA 4JX5A 1T0FC 1D1CA 2JMWA 5HPOA 1V0AA 5E17F 1RMU3 1XSQA 2PHFA 1X1PA 2QKLB 3I59A 1RUI1 5FZKA 3ZXAC 1V6OA 4P55A 2WNUB 4MXWB 1R5GA 3AP4A 2PG4A 2VQCA 1D3YA 2WUHA 4COUA 4JC1A 2D98A 2EAAA 1DPRA 4LK0F 5CKTA 2P6SA 4K40A 5E1RA 1V4RA 1UL9A 2D44A 3SC7X 3AYEA 1HRI1 1LGCA 4A44A 4KGGA 1GOGA 2I8DA 2QF7A 4E7JA 3WVJA 2ZHMA 4BHPA 1IGNA 2ISZA 4A4AA 1OI6A 1QBJA 3LOIA 1DU0A 3AM2A 3BU0A 2CQNA 4YFNF 1RI7A 1DGWY 4CH7A 5H9PA 1C5HA 3MW3A 4GAZA 1LNSA 3UETA 2BY0A 2MHFA 5LZ6A 3ZYPA 1RVF1 1P92A 4QT6A 1CF7B 1R1VA 4GMP1 5L3DA 4RDUA 4YZ4A 4FX0A 1JKRC 1FNNA 1MH4A 5LRSA 1ZBE3 5FBJA 2O5RA 1E5RA 3WT3A 3B9IA 5C4WC 2XUEA 3I5UA 4IXLA 3VBRC 2EV6A 3MFKA 1XCBA 1ZQ3P 2OV7A 5LBCA 4AYBN 3MIHA 4AVCA 1HLVA 2LSOA 3NV2A 4Q4Y1 5BS6A 5LK5A 3N7JA 4WM7C 2HOEA 3VV1A 2X5IC 3UT0A 1ZZ6A 1PK6A 1JTYA 3BOPA 5K5RA 2B9SA 2J22A 2ZGQA 5CLSA 3IN9A 2XKOA 3NSTA 4I98B 2JIJA 4LE4A 3GFLA 2STTA 1BN5A 2Q8DA 3TEYA 5EYYA 3O3KA 5C8CB 3AKZA 1V3FA 2F2EA 4AEDA 3ON7A 2E5NA 3MN2A 3WP6A 1CPMA 4N90A 5E1WA 2CS3A 5F6KA 2R071 4AC0A 4PIXA 2WTEA 3WU0A 4OU0A 2EINH 1VQ5I 2W82A 1A8DA 4LKDA 1YRZA 5D1IA 1VAKA 2JA8J 4CP9B 4MHGA 4NROA 3CJTB 2TNFA 5FJHA 3THCA 2FDFA 3HB9A 2ID6A 2Q8EA 3UKTA 2JDPA 4KT6A 5J40A 1BBT2 4A3KJ 1S2EA 1U5IA 4CXYA 2DCYA 3E3VA 3WP3A 2HZTA 2F6BA 4TWTA 4UNOA 5FLXK 3KE2A 3J80Z 2F4OB 2B63J 5FYUA 4DW6A 3EB7A 4CDQC 4PQ9A 4R79A 3TEXA 3GWZA 2Z69A 2I45A 1H8TA 2HWD2 4Q4Y3 1N78A 1R081 3MVPA 3WQBA 2X48A 5FYIA 1BHGA 2E60A 4UOJA 2XVLA 4HV5A 4ES9A 1OD3A 4AEKA 3POYA 2ZMEC 2WDBA 4IXAA 4B43A 2XJVA 1HSJA 3D1NI 1Z3YA 5HV0A 2L9VA 3IAQA 3FWEA 4B47A 4Y4YA 1OR7C 2D1VA 4AD9A 3LB9A 5FK8A 4DY5A 5FWJA 3MF9A 2M0MA 1TMF1 3HOSA 4MUVA 1QNYA 3ZYIB 2BERA 3I3EA 1POV1 4GJYA 4XQFA 2R063 3M3YJ 4RR3A 5HDGA 2K3FA 2A6XA 3T8TA 3UR3C 2OAZA 3ZFGC 2CFXA 1HXS2 3EO6A 1S9HA 4MZUA 5J96B 2KISA 1YS7A 4II2A 2H27A 4H7MA 1XGMA 5FPZA 1OH4A 4L9NA 4BQ3A 1OF4A 2WZ8A 4ENKA 2H6BA 3H3UA 2ZMNA 5D8AC 3BZCA 2QDNA 4XUQA 5APAA 3ZYRA 2LFBA 2L3DA 5JOXA 3TAYA 4J6GA 2LTPA 3QOPA 3ELKA 4IGOA 4A3BJ 2B5HA 3IPVA 4BACA 2QQAA 1BI3A 1HRV2 2XRNA 3K69A 4LHLA 4XCAA 4EYUA 3K4ZA 4YARA 5BYNA 1RKWA 3CTAA 1R5ID 2XQXA 1HQNA 4HF2A 4W8JA 4KGQA 2R7EB 1OPMA 3OBZA 2FBIA 3NRVA 3VD9A 3M1HA 3GTPJ 2PAEA 1G9CA 3I4IA 4ZXEA 4S04A 3AX4A 4IQJA 1G4DA 2GOMA 4P02B 2YPRA 1IOAA 5JSRA 2WY7Q 1V5FA 2WNVA 4AI3A 3GXOA 5C3RA 1X3WB 1SANA 1HF0A 3ILRA 3I9V2 1GQHA 3E6CC 1VBE1 1FBQA 1TME1 2M7BA 4JRLA 2QQIA 1UMIA 2RDRA 4QKFA 2W7NA 1O6UA 5L3BA 2WINB 3FBMA 4BXUA 2CNAA 2DF7A 2DVAA 3CF2A 1U78A 1SACA 1ND3A 1KS5A 1HKSA 3MPPG 4AHWA 2R0QC 1QF3A 1DG6A 5JR7B 4WXHA 3C7GA 3KCXA 1A5JA 3HQUA 4RYDA 3M3IA 4XLAA 1R5HA 3LZZA 2CV2A 4A7YA 2EIBA 4IHXA 3ZSKA 2KFDA 2E26A 5K0UB 2XF5A 1YE9A 3SEPA 4L5JA 5FZ8A 2DODA 4EQVA 4CTEA 4BL0B 4Q4ZF 5C4WA 4KN4X 4E70A 4EWAA 3PIJA 4NIHA 1T6BX 2ZGTA 3ABZA 1H2MA 3IUOA 5HCHA 4QAWA 3JRCA 2XL9A 2ZGOA 2DAOA 1RZ4A 4C3IJ 4XKWA 1KD7A 1ZG1A 4AXOA 4B48A 5B5EC 3QLQA 1CAXA 3O1RA 5SV8A 1N1VA 2M8EA 5E3MA 1RUI3 2OUMA 3UL2A 2FRHA 5DS9A 4ZU7A 2M0CA 4NHXA 3FMGA 4GA9A 3AG1H 3Q9SA 2R5YA 3WP4A 2PLV3 5EZWA 1LOBA 3EUHA 5KXDA 3VZJA 3PHMA 3OBTA 4QDSA 3Q9VA 2JVHA 4BQQA 1FC3A 3OCPA 1WW6A 1PK6B 2DUQA 5FRMA 1VRH1 2NS8A 2HJIA 4LBNA 2B42B 1IPKA 1MZFA 2WL1A 1UHSA 5A3TA 3WTZA 4XAAA 1TNFA 3H3LA 5A33A 5FYCA 1EPWA 1QOSA 1OA3A 5AC91 1ACIA 2BW3B 3NNGA 4UXAA 1JGGA 3THTA 4EZ4A 1ETXA 4IUGA 5KK1A 1W0UA 1U5YA 4LBQB 4CPBA 3VDXA 1CZVA 1OCTC 2NP0A 1PX3A 4G6QA 4Q47A 1GHCA 4CZSA 5HS8A 2JDKA 4J00A 1TWFJ 1OCPA 2RS52 4D0PA 2DMPA 1YFUA 5KAFC 5E3OA 2RJKA 2XVGA 2WYSA 5I0TA 5BNQA 2K86A 3NRUA 3FHNA 3K70D 3IWFA 5IYCJ 2BWAA 1AR92 1ZH5A 1FIPA 3SH5A 3CMEI 1QGLA 1X1DA 2Q0AA 3POFA 1SFOJ 2E5ZA 3BPZA 3GTKJ 3ZKUA 2DTYA 4EN0A 5I0SA 2JG9B 3FX3A 4JGZC 4BXXJ 1AKHB 2PAKA 2CDOA 3WU2C 4NVPA 2ZACA 1W06A 3VDBA 1W0TA 1DGWA 5ACA1 1S29A 1BZWA 3HOUJ 3FC0A 3N97A 2QZ8A 1CGPA 5FO5A 4QM8A 1AL0G 4Y20B 3N9QA 4NIGA 1WUVA 1FLIA 3VN4A 1QQP2 2ZXWH 4UUVA 2VT2A 1S0DA 4QB1A 1H9TA 5JI6A 4BY7J 2Y30A 2XH6A 1KU2A 3AYCA 1BJQA 1F31A 2CQXA 1YG2A 2L9LA 4LR4A 5FIXA 1VMHA 3HEIA 2WA4A 3N4MA 4QX3A 4X1EA 5LD2C 1K6YA 3VBSB 3ZR8X 2CY6A 3AYDA 1TE1B 2XXZA 3K4CA 2LH9A 1C1LA 2GP5A 5A33B 3A0KA 5T5JA 4CU6A 3FBIB 1GICA 1DFQA 2IGMA 5JLXA 1R1A3 3MUZ1 3PMSA 1VRH3 1BMV2 3L2RA 4ORFA 1VB4A 4LBQA 4KU8A 3I2DA 2V09A 4UAPA 4A69C 4AUXA 4M3EA 4P9FA 1T0FA 1I6HJ 4XOTA 1M4WA 4XKVA 1Y0NA 2QSHX 1EUTA 4QX7A 1H2KA 5IATA 2DFBA 5CVRA 3J80K 4KBBA 3CUOA 1RIRA 4RQPB 1JI8A 1ZYRF 2K0GA 4W6WA 4PCQA 2DA5A 2V73A 3Q0WA 5FZMA 1BM9A 1A3KA 4HAMA 4GMP3 4FOWA 2QSGX 3H8RA 4XC9A 1PYVA 3E6MA 3ILFA 1JJ8C 1R00A 5BY5A 4P9XA 2WV0A 3DEWA 3LKJA 4XZUG 5FO9B 1LQ1A 1WJDA 3FHQA 2HBTA 4CDXA 3H92A 2JG8B 4OLLA 2KHMA 3ZFEA 2WS91 3ECQA 4YIFA 3AZVA 1JOPA 3DFGA 2QA4I 1HV1A 1JZ2A 1SAUA 4ZDOA 4Q26A 3I2FA 4YW5A 4XM3A 3Q8CA 2HWE3 1BBT3 3HOVJ 3TDUC 2JD4A 5FZ6A 2IXKA 1T39A 1AHSA 4WZCA 5GLWA 5IVYA 4MFDA 2ERFA 3LFMA 2WFF3 3F8BA 2HXOA 2AH2A 1ZM1A 5J98B 3C2UA 5FP7A 1PMHX 1F9NA 1AU7A 2V9VA 1VMJA 2ZO4A 3DYMA 4E4SA 1CVNA 3LFKA 4F7ZA 5FXVA 5FKKA 4AGGA 2VCBA 2QBYA 3GTLJ 2VOTA 1BK0A 4W1UA 3QACA 3J7ZI 4I6ZA 2BGOA 3WTTC 1EV11 4N43C 4MO3M 1B4AA 4X8NA 2PELA 4UXNA 1R1ZA 1UY2A 1H9GA 5FZHA 3RKXA 2LLKA 4U0WA 1IHMA 3WDWA 2TUNA 4JTNA 2R041 3TDZC 4AU7A 5ABJB 1AJKA 4HX7A 3ECOA 3SXWA 1UYXA 1ULCA 1JKOC 1ON1A 1Z6RA 5IT9K 1PZ9A 1QXJA 4IERA 1WWXA 4M3DA 3FM3A 4DUXA 1RUD3 5FPXA 3SH4A 2G9GA 2X53S 5KHDA 1BXHA 4FHTA 2B7YA 3S15J 5LA1A 3UKGA 3TW6A 1B35C 3TOAA 3ZMNA 3W6JB 2PHWA 3POWA 2V4JC 1YQ6A 3LEIA 3T09A 2NVXJ 1Y7BA 1O8PA 1IG0A 1BI1A 3DCFA 4P1WA 4X8PA 5GP9A 3RJPA 1YYNA 5D8AB 1QJY2 3WHUA 3PQKA 1RYYA 2IWGB 5GALA 1V6MA 3OGSA 2X85A 2HWB1 2VCAA 3QPLA 5H2FC 2VKEA 1HC8A 5IHRA 3GNEA 1VE0A 4AL9A 3KP7A 5CFCA 3CC2I 4AZZA 1K6OA 5FXXA 1Y0UA 4LG0A 4LG0B 3W2AA 4Z07A 3WGHA 5FZ1A 4I76A 5FUNA 3LAJA 3S16J 1ZRRA 3ZQ7A 2LUWA 2XMLA 4LHSA 1WD4A 2OUJA 1AXYA 2VZ3A 3CCSI 2D6MA 5JFRA 5L7OA 1HN1A 4GWMA 1DF0A 1XNKA 1W7PA 2WLPA 3J7AO 5I93A 3BCAA 5JLWA 1HDPA 2ZZQA 3QH6A 1NKGA 4XLHA 3SISA 2D5VA 3G1LA 4IRHA 3VBRB 4RGSA 4UB8C 4LOTA 4YZ3A 1RUE1 4M74A 5FPAA 1RUH1 1NTCA 5BPIA 3BTZA 4RAYA 4ONUA 3ZMVA 1YQCA 2O0OA 1XE8A 1AHDP 4GFBA 2IPQX 5I8SA 1HKDA 1QJFA 3L1PA 1ODDA 3BZKA 4XLNF 1OUXA 3F6VA 1W0OA 1SMVA 5FKNA 2VBPA 1N47A 4AVSA 2ZJQF 4CXXA 4PBOA 1V9U2 1XU2A 2EV5A 1S1AA 3H5NA 1TC3C 2EFNA 4Q4W3 2E35A 4L5IA 3IWZA 3MLLA 2ZZJA 2J1UA 2BTVC 4UF0A 4CDWB 3U07A 3GALA 5JXHA 3POBA 3QYEA 1IV6A 1JZ5A 2B45X 5F0FA 1C8M1 4P5HA 4IVNA 5FFZA 1K5JA 3HQRA 1XRUA 2EALA 1HOMA 3LSIA 2P37A 1TBXA 3NV3A 2W00A 1G86A 2EVXA 1BEV3 4O6JA 2GXAA 4QPIA 5BPDA 1DGRM 1YLLA 4Y1XA 2W1WA 3RZJA 1J1TA 4IGQA 2JXAA 2BBAA 5B4NA 5ACA3 2E7XA 4CP0A 1JKQC 4QXHA 3EPZA 2STWA 4RHV3 1OQYA 5D5WB 2KD7A 4GKXA 1FOYA 4F92B 4A3LJ 5CFCC 3FLPA 3OG2A 3EDPA 1OURA 4XRFA 1JW6A 1Q1HA 2Z5UA 3D8CA 3ZPLA 1O4TA 3QH7A 2D3RA 2QQBA 4YG3A 5HLGA 2IXIA 1UPIA 1JGSA 4U0YA 3VYSB 4CCKA 1UFMA 2A5YB 1P4AA 4H3WA 1DQ0A 5FLVA 2A70A 2R7XA 3FXRA 3RZHA 3AG2H 5F3EA 1VBC3 2VR4A 5FY4A 4UY8I 1GQGA 3D5RC 2DJNA 1MJAA 2ZX2A 5GPAA 4OFGA 4G8XA 1KONA 4RHV1 3NJVA 2KDZA 1QDCA 3A0NA 4BHCA 1T2KA 2HOAA 4WXCA 4QXCA 2WFF1 3ZFGB 2ZX4A 4ZS3A 1D5VA 2FUG2 4QWNA 1ND3C 4GWIA 3UJOA 2EA2A 2CW8A 2CV6A 4MGZE 4QKNA 3OYGA 2ZEYA 4MFEA 4QWQA 4MX3A 3JBG2 2IVMA 2YR2A 1GNYA 1SVMA 1K5MB 2QEXI 1MSEC 3VPRA 3K77A 5H20A 4B3AA 1MW7A 1DUXC 1BR4A 3GFJA 2JE9A 3S6PA 2YU2A 3OY8B 4XTPA 1U2WA 4BQYA 1AZDA 3T8RA 5ERLA 3TGNA 4HOOA 1YW7A 4OHYA 3VUOA 3P5BA 5JZGA 2GC0A 2ZFUA 1ZRCA 3ETQA 4LKFA 1D0GA 3ZGKA 1FATA 4Y1VA 4CP1A 1S2KA 1SD7A 1Q8OA 3C7HA 1WWYA 4Q4V2 4QGNA 2KRHA 3LAGA 1I5PA 3NKTA 1PUFA 4XABA 3DXJF 4LBMA 2D43A 3BTYA 4PJNA 1UU6A 3T4VA 1KU3A 1UMZA 4CA9A 4CUCA 4V2WA 1RL3A 1KFXL 2XWJB 2ZGSA 5A3MA 3OUJA 5FY7A 3ZOIA 1R092 2IZWA 2EIEA 2EPFA 1R1A1 3VDDB 3QYBA 3OPTA 3D5OA 1NE4A 3ZX7A 2ZHKA 1SD6A 4CCMA 4UVBA 1HIXA 4XORA 4Y17A 2YU3A 1BCXA 1D4VB 2CYYA 3PO2J 4BIFA 2VZSA 3I0TA 4BJ0A 2DVDA 1W6NA 4XCBA 1Q1VA 2Q0OA 1JTZX 4P00B 2BHZA 4J19A 2CUJA 1RVF2 2V1UA 5EYXA 3CZ6A 4IOAF 1D0XA 2TCTA 3HT1A 3F9KA 3GTJJ 4QPYA 3DKXA 1ZX5A 1STMA 1IZ1A 4HSLA 3T2PA 2YUEA 4FE4A 3D6EA 4BCUA 2JDAA 1YYVA 3DU5A 3WHCA 4IX7A 4BZ4A 3PIPF 5CVIA 1B35A 1LOCA 5SV5A 2XBO1 3ZXJA 2JDHA 3TOJA 2D97A 5DAPA 1ENSA 2FBHA 3RZGA 4FOQA 1TWCJ 3BCWA 1U6GA 4LB5A 2QQ8A 4MHRA 4LQRA 2PJRB 1UKRA 2C4XA 2IT0A 1F15A 1GLNA 1Y3TA 5AIPA 2KJBA 4QB6A 2R92J 2FQPA 5ED4A 1P6RA 2P4WA 3DEEA 5ICGA 2K27A 4IEYA 5BOXA 3C7EA 4QX5A 3HKZA 1BOAA 1KXGA 2WA0A 2E6VA 1WZ2A 4HSTA 3RRDA 2F5EA 3MIGA 4IL7A 1HCRA 1QQP1 3KIOA 3ZXKA 3SH3A 1I1SA 3AFGA 5DZGA 2JEMA 4DPNA 2HWVA 4HSRA 2KIQA 4QLCU 1PDNC 4XJUA 4CUGA 2L9NA 3P6BA 4Q4X3 1HQLA 3BI3A 1G9BA 4HX8A 1GT0C 4QPIC 2IS1A 3OIOA 1SFXA 5EGOB 2PHRA 1SDWA 1SBDA 4KFCA 4LOSA 4OWRB 1EAH3 1NH3A 5ABJC 3V64A 4ZU4A 4HA8A 1MPXA 3S1MJ 4ZTJA 1D0HA 3SCHA 3ABMH 3LWCA 1CIWA 3RKYA 1TQPA 1RUNA 4CDUC 4XF4A 2WNOA 4IL6C