3QORA

Crystal structure of human nuclear migration protein nudc
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
120
structure length
119
Chain Sequence
GSSSKLKPNLGNGADLPNYRWTQTLSELDLAVPFVNFRLKGKDMVVDIQRRHLRVGLKGQPAIIDGELYNEVKVEESSWLIADGAVVTVHLEKINKMEWWSRLVSSDPEINTKKINPEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Features and Chaperone Activity of the NudC Protein Family.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding, cell cycle
molecule keywords Nuclear migration protein nudC
total genus 28
structure length 119
sequence length 120
ec nomenclature
pdb deposition date 2011-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04969 CS CS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3qorA00
2O30A 2RH0A 3Q9PA 1WH0A 2KLRA 2WJ7A 1SHSA 3AABA 4JUTA 5DS2A 3L1FA 1GMEA 2WJ5A 3QORB 2Y1YA 4YDZA 3J07A 4PCKA 4YL9A 4RZKA 4JUSA 4ELDA 3IGFA 3GLAA 3QORD 1X5MA 4YLBA 3Q9QA 2MNWA 2Y22A 5DS1A 3L1EA 2XCMC 3N3EA 4M5SA 4M5TA 3VQMA 5LUMA 3QORC 2Y1ZA 3QORA 1EJFA 2N0KA 3GUFA 4YLCA 3EUDA 3W1ZA 4PBDA 2BOLA 1WFIA 2K8QA 1RL1A 3VQLA 4ZJ9A 4MJHA 1WGVA 2CG9X 3GT6A 2CR0A 2KMWA 4I88A 3L1GA 3AACA 2JKIS 4YE0A 2N3JA 4FEIA
chains in the Genus database with same CATH superfamily
2WWNA 3DROA 1E43A 1KPUA 4PV1C 3BDYL 2VO8A 3DRQB 4P49A 3OKLA 4PV9A 4M6OH 2R7EA 5E6ID 4ZAKC 5HI3D 3T65A 2EUVA 3QQDA 4FFYA 2BP5M 5L88L 3U7AA 1XGYL 2CO4A 3UJTL 3NA9L 5IT2H 1DBKL 3BVDB 5DZOA 4RISL 4IHBA 1CG9A 2K3HA 3T3ME 4QXGL 2D7QA 4NQSA 4NUMA 1T22B 2DOCA 3DV6B 5D1XD 5DJAB 5KUMA 4KKQA 2X40A 1B4RA 5PCYA 2P49B 4H8HA 4QAMB 4XP4H 3BIAX 1VEPA 4AMKL 2GFBA 4F91B 4J4PA 5IWLC 3KWWB 3LEYH 4Z7OE 4O02A 3ISYA 5BZDA 2XIDA 4P4RB 4CJ0A 5I1EL 1KWGA 3GO1L 3FSVA 4WHYH 3KLAB 3DXAA 1SOKA 3ATBA 4BD4A 4YUEL 1ED3B 3FQUB 1A1NB 3SGEI 3MXWL 3ZKXB 3NIGB 3GMOA 5EUOF 3GM8A 2GIXA 1JFHA 3DV4A 4RZCA 4TLTA 5IQMA 2WO3B 2NX5E 1F4AA 4NNXA 2FJHB 3UYRH 4OIAA 3EO0B 3DX2A 3ZIYA 2DD8L 3CFKA 3WLWD 3KXFB 3L3IB 5E9NA 4AYDC 1DBKH 3RJQB 3RP1A 1MOEA 2R0LL 1N7MH 2XV0A 5IR1A 4TS6A 1NIDA 2CM6A 1S8DA 3H9YA 2EEDA 3HC4H 3UZQA 2J8UF 2PP8A 4GH7B 2ZG2A 1G6RH 3MLRL 2A6JA 2FYVA 5JNYB 2C34A 2APSA 2C1PA 1U8NA 3QI9B 1QLEH 1ZDSA 4B27A 2R2BB 2GTQA 3VFMA 1JGLL 1CGWA 1WWBX 2V0AA 4WTWA 3COOA 4OI7A 2OJZL 3M1CA 1FPTL 5GRXG 2P8LA 4WEEA 2PO6B 2VLKD 3IDIA 3BESR 5ITFB 3PJNA 3V6OE 4B7LA 4EKXA 3GSNA 1RUAL 4MAUL 2O93L 3I6GA 1VFBA 3GXNA 3PWLA 4JQVA 5CLXA 3WSQL 2VOTA 3RX7A 1UA6H 1IAII 1SYVB 3AJ7A 1FGNH 2KS0A 1GGYA 3L3GA 3HE7A 5HHQA 3HZMB 3D4YA 2NXZC 1TZAA 3DVNA 4HIXL 4PLOB 2FZ3B 5D96C 3WLWC 1GA2A 2YMOA 2K6YA 3B9KA 3CDCA 4FXGB 5D1QC 1UOVA 3P3YA 3MCLL 1FL5A 2VXUH 4ZYKB 5JPMC 4LSTL 2OMVB 2G30A 4HJUA 4L8SB 2EDLA 1XBRA 1UFUA 4ELDA 3MRHB 4K9EL 5HDQL 5DEGB 2AFNA 3FK3A 5E6YA 5KBMA 4KI1A 1IFHH 5SWZD 5TE4L 2V5RA 3LCYA 3Q48A 5C0CD 5DJ2A 2W9DH 3V6FA 2BIIA 4XGZA 4PJXA 1JVKA 1KZYA 1HI6A 1JTPA 4D3CH 5IIEA 5D72L 5EUOE 1AAJA 1NJ9B 2GQHA 1IILE 2ARJA 4PLKD 5FA3A 4F7TB 5HDLA 4F57H 4GW1A 4N0UB 2ADFH 3WY1A 1EJOL 4LLVA 3KLHC 1XCWA 1I9IL 3QRGH 1HNGA 4XNDA 4DVRH 4MQSB 1CL7I 1Q9WB 3VG9B 1DLFH 2PW1B 1LO4L 4G9FB 2PPAA 3Q2WA 1SHMA 1T83C 5GGTL 3VFTA 4PJXB 3QUGA 2X4QB 2CUMA 2ENSA 2AI0H 1H19A 3IBEA 4JCMA 2X12A 1LJMA 2YQBA 1N2RB 5EZJA 3T8MA 4GIPD 4ZODA 3EO9H 3BRDA 1E4XI 4GRWF 1D5XA 4MMZC 4BHUI 4Q2ZA 5GS1A 3K2KA 3DGDA 4KJQC 5BOPA 4NJ9L 5ESVB 3CX5J 3W57A 3A22A 1EHNA 4MJIB 5KBPA 3SPJA 3V5KA 4G7YH 4UIMA 3H9HA 3QORD 4AVJA 4NHUB 4K71B 5F7UA 1N5YH 1JPTL 2WGNB 3QO0A 3RTLA 1PG7L 1WT5A 4AYEC 1W80A 1QSFD 1CT8A 1QEWA 2OMYA 3IK2A 4XB8A 2X88A 4CUCA 1MXGA 5F6HJ 1VFBB 1LE9A 2QVFB 3V5KB 1BMZA 8CGTA 3A6OA 3FT4B 5HJDA 1SXCA 3QWOB 1ZT1B 5ESVA 1OT4A 2VR5A 3FH5A 1DQML 5JHLA 1BQLH 3TEUA 2WKOA 4BZ1A 4H1LG 1JRHL 5J9PB 2ZWZA 3VNZA 3H1ZA 3FB6B 1TLKA 4WTQA 3L4UA 3QFGA 4JKNA 3QDGD 3L1EA 3WXVH 4X6CA 2NY6B 3VWKA 3RX5A 2GC4C 5L9DL 1RQ5A 2FGWL 2HJKB 2ICWI 2YUVA 1SBSL 3T4AB 2XXCB 1CFMA 3KPMA 3T8XA 3EZJB 4PRIE 4TQEH 1IL1A 1O9ZA 1JZ4A 4U1HB 5SWSE 5I0WA 5F72S 1QR4A 3FQTB 2WBJB 4OT1H 4KJPD 4ZX3A 4J1UA 4R5TA 2I7SA 3REWA 5A6MA 3B3BA 1JPGB 4BZ2H 3H2PA 3T1FA 4WK4B 1CDYA 3IMRA 2RAMA 1FLRH 4X7CC 5F7KC 2Y6TE 3SBRA 3MRKA 2BWQA 5KJ4A 4FFYL 1A4KA 2YIHA 1N19A 1S9YB 4UMSA 4OLWL 4ZBJA 1BA9A 5J06A 3QRLA 1K6QH 3LZFL 4UTAA 1E4KA 3RVVC 3S3DB 6PAZA 1YMHB 3MLTB 4PUBL 4LMQI 3NH7L 3PNWB 1RZFH 1AS8A 2R1YA 5EF3A 2FATH 5TK2A 1GAFH 4EVNA 1YEHL 4QO1B 3ATAA 3QORB 4NO2B 2B20A 1U42A 3ECBA 2Z7UA 4OD3L 1OP3H 2IAND 3PIQA 1JZ8A 4FQXC 2AQPA 2VSKB 2W0PA 2FEEI 3HUJE 5C09A 2VDRH 4W6YB 2WXPA 2CK2A 4HUKB 4LLMB 1WZ1L 5EZOL 4BGDA 2QR0B 4KX9A 1OWWA 1T22A 3DV6A 4H0GA 5LJYH 4JY5H 2CJUL 4Q6YA 1M42A 3D85D 3HZKA 4I48A 1D2PA 3VRJA 3MBEA 4XPHH 5D4IA 4TVPH 1GVIA 1T4WA 3TBBA 1QR1B 1E4XL 4Y2NA 4PB9L 2GUYA 5DJ6A 5CZVL 5IB3B 4ZTOH 1Q8MA 2GAZB 1YY8B 2NLJB 1AZRA 3B34A 5CLWA 3FU3A 4I3SH 4S1RL 4F8TA 1HXMB 4YXLH 1MCIA 5EEXA 1N67A 1EERB 3O8XB 4H0IA 1C5CH 2R2CA 4PJ9C 3B8SA 2GY5A 2X4OA 5FW7A 3EIFA 4A39A 2F5BL 3IAGC 1AXSB 1BD2D 1BHGA 1QO3B 1NMAL 1RUKL 1KBKA 4JQIH 4X9IA 5FYKL 3PQYE 4WNSA 3BAIA 4UNIA 3BP5A 3DSFH 3VSUA 4BFEA 3HNVH 2OK0H 4FQHA 3MJ7A 4OZIE 1E9OA 2CCVA 3DTXB 3F5WB 4IOFD 4NO3B 1ITCA 4X4MA 2P48B 1LWJA 2WB1A 4OJCA 2ZPKL 3B9KC 4CU8A 4FYSA 1EBAA 4JCWA 4YC2C 3IMWA 1R5VA 3P3TA 2Y07L 5D6CA 4NQCB 1YDPB 1S9VB 1QI5A 3DX8B 2APWA 3OSKA 3S8FB 2E7HA 2JKJA 4JY5L 2YEZA 4DP6X 1N12A 4KZCA 4QRFA 5B22A 1JDCA 1JI1A 4IU2A 4MRCA 5FYJL 2VMCA 4MCYA 4LT7A 3QUZA 2CLZB 3T6XA 3N40F 1KT2B 2JKNA 4KVNH 2NNXA 1G0YR 4I3SL 5SWSA 5D1XE 4I9WD 2IPKB 3FNKA 3P3SA 5ESAB 4I18C 4NGHH 2GK2A 2XG4A 4MZ3A 5DEJA 1J7VR 2F54D 3GXTA 4HUXB 1YNTF 4DGVL 1KYOJ 3CX2A 1E5AA 1C1EL 3NDZE 3O2WH 4IS6B 4O02B 2XPZA 3D1MC 3V5HB 2IDCA 1E2ZA 2OR9L 1KJMB 3QDMD 5DLLA 3UOAB 4DWHA 3MRCA 5AZEH 5GZNC 4X6BB 1Y0LA 2J71A 1TTBA 2OZ4L 3EZ8A 4NUJA 4RFEA 5G4NA 5ICXA 2CMRL 1G7HB 4PJGB 2VZ3A 4Q6IA 1PKQA 5T3XD 1D5IH 3JTTB 2E0PA 2WBWB 5TDNB 1RJCA 3HRZB 2FEDC 2ZWKA 4HF5L 5C86A 1F6AA 1BM3L 3EH2A 4KO6A 4P23D 3SBWC 4FEIA 3MBED 2DH3A 4HLJA 4HXAL 5CEXB 1IU1A 2VO5A 3S35H 4F7CB 2X42A 5FUCE 1GY2A 4CMHC 3NZ8A 1XGPA 4M4RB 4K5LA 2E3VA 2R0ZH 3P30H 2ZUVA 5JUEL 1BZQK 1UFGA 3MREB 4FFZA 4L37A 4P48A 5T33L 1PX4A 1D7DA 5D7JB 1BQUA 1MCFA 3QZOA 4GKZB 3I6SA 1ASQA 3QUYB 2OM5A 4QHKI 3O8XD 3OKKA 3H2WA 2VSMB 2XN1A 3PWJB 2M1KA 4NM4H 3JTBA 4M1CD 4JDTL 3O6KH 1LXMA 4Z7WE 3VU2A 1JXGA 2F2HA 1FCCA 4LBAA 3HG1A 2IXQA 4NWTH 1C12A 4XNYH 3EBHA 3W0WA 2ATPB 4PV8A 4LPWA 4TRPL 5JO5B 1JNNL 2KL6A 1GC1C 3ZDYE 4OGAC 3A67L 2NY2C 1TJGH 2K4WA 1S3KH 1QHQA 3TGXA 4G9DB 3AT9A 5EEZA 1JCKA 3QE5A 5D7SH 4K7PH 4YR6A 5KN5A 4NQCD 5JXEC 5C0BD 5AAWC 4BSVA 3BH8B 2DY2A 3SN6N 5TH2A 2GJ6D 3HBQA 5IFJB 3S88L 4YFLI 2D2CC 3BUIA 3PWVB 1HH9A 1K4CB 3GSUB 3TBSB 2ZOKA 3SO3C 3FT1A 1NSNL 3LKSB 4G8IA 4MMZB 1FC2D 2A1WH 4UM9D 5IB2B 4X7DC 1ZSHA 3AQYA 1J0HA 4Z3HA 4IOIA 1MCWW 3DK0A 4J3OD 2EYTB 5F7YC 3FL7A 4FNLL 5FO2A 3RFRA 2XWBA 1NM9A 1F1DA 4K5NA 5HHOB 3U30B 1NCIA 1EHKB 4X83A 1MXDA 4OLUL 4ETQB 4G82A 4HIQA 3N42B 1WAAE 1VF5C 2G60L 3BN9C 4G5ZL 1HYSD 4W9IC 3WFHB 5K59E 3QG6B 1YYML 2BJML 5HDBB 5HP5A 3CVHH 2Q20A 4J27A 4L3FA 5I30L 5IJKC 1LYQA 2CGRH 1IKOP 1E28B 3HLKA 4Z7NE 1ND0B 4JFTA 2XCMC 3GBDA 4XMZA 4R6UA 3ARDB 1U21A 4JHZA 3WIAA 2RMNA 1XMEB 2Z8SA 2F54A 3V95A 2BNRD 2XFXA 2D9CA 3PGCB 4MA8L 2ESVD 3L2MA 4HX1A 4LCYB 5D4QA 4QD2E 5IJKA 4JANB 5I73B 3TASA 1NSNH 1TQSA 4UQEA 2L04A 3NJJA 4Y5YB 5DUPL 5H37G 1DQQB 4QTIH 3OAYH 5C0CE 4XNMA 3UAJC 5EU5A 3WFDH 3N3EA 2IPUK 5ACLA 5JHAA 1HQ4B 3O3AA 4JY6B 3F7VA 4FG6D 3UTSA 1UB6A 2DWEB 2EZ0D 5ESQB 3QUXA 4NLHA 5B7EA 3GIVA 4L9LB 4ORZC 1L5GB 5J6SA 2MPVA 3K5SA 1UVQB 5B1BB 2ZF9A 2QQLL 4YE4H 4JFYA 4ZPTB 4JZNA 3WKPA 2ZXWB 3VI3B 1I4FA 3TBVA 1TZOA 1XD1A 1JE6A 5IUCA 3IYLW 1AGFA 3DXAE 1T7VA 2AJUL 3UJIH 5HD8C 2YQGA 1U93B 4L1SA 4GXUM 4PY8J 3LRKA 4N90E 3BIKA 2BERA 3TYFA 4GFTB 4XXDB 2XWEA 4NYLB 1LK2B 2NY0D 4X5XA 4XNQB 5ECJE 5FO9A 1K2DB 3KMDA 1TETL 4UQCA 2B15A 2CIIB 5I1GL 2GJ6A 2WK2A 5IW1B 4M3KB 1F90H 3M17A 1PAZA 4MCNA 5GGRY 5IEHA 4OQTH 2AJZB 5I0ZA 4NQDA 4N2DA 3D85A 1FN4A 1JUFA 1BQSA 2NQ3A 5E8DL 4NI6A 1KB3A 5JOPE 2VH5H 1JFQH 1X7SA 5EN2A 2CA4A 5IFAL 4JL2A 5A2BA 1H5BB 2VDOB 3WCYA 4U0QB 3ALPA 1AO7B 5EPMB 4TMPA 3N1MC 1KFAH 1NEPA 3QULA 4GAJL 3TNNA 1ZIBA 4J2QA 1MY5A 4LMQE 4RFOL 3LDBC 1LD9A 2GC7C 3U4EA 4YDKH 3H0TB 4O9HH 2C5DC 1YMMD 4GQ9L 3ZKMD 4YBLC 1KG0A 2OMTB 3PJSB 1G9ML 5E1QA 1WLHA 1GS8A 3V4PB 4UUJA 4YDNA 3L5XL 4AJ0A 1S7WA 5BVJA 1IAIH 1AD0B 1O7DC 2PP9A 4MA1B 3EOAB 4ZW5A 4HJGB 3BDXA 3O0RL 4Y1AA 1GKOA 1P5UB 3QEQD 2LT9A 4IM8A 5J4MA 2X4QA 1UD5A 3OC5A 4E2OA 4PJ8B 5FYKE 25C8L 1KG0B 4IU3B 1U8PA 5LNGA 3VFUA 2QSCH 4AMWA 4FQCL 5HJBA 4J6RH 4HALA 1E3FA 1XH3A 4L3CA 3NZSA 3CE1A 5DD1L 1E6JH 5L88H 1TMQA 5JXAH 4JDVA 4ONGH 1PTZA 3RGHA 1LEKA 1U58A 2EDHA 2SEBB 5A6LA 4AIEA 4HP5A 1N64H 5TPWH 1RSYA 3MODH 4K94C 1ZLUH 3IE4A 4G7SB 3P77A 4MXQD 3VWKD 2L7EA 3MRJA 4HBQA 1KGXA 1KTJA 3CC5B 2BVOB 3I2CH 3LNGA 3THMH 4AGMA 1GL4B 3NCCB 4JRYA 1KC5H 4B3EA 4RWYH 4P06A 4GMTH 4FG0A 3S97C 2R2EA 4KKLD 4KPHH 4PP2A 4M1CC 3KL0A 2DDQH 1D5ZB 3QWRA 4R4ND 3V0FA 4DVBA 4G8FA 4NYLA 4X5XB 3L5XH 4RGNC 1YN7B 1A7RL 1XF3B 3FZUD 1W72L 3TA4D 2XV3A 4E5XA 2H9GA 4L8CB 2QDWA 3QP3A 5E6ZA 2J8HA 4BCYA 4B9GA 1H9DA 1JNJA 2XN9E 4JG1L 2HX7A 3HE7B 3LV3A 3P9MB 3OMZA 1RUMH 5D2LB 3EH3B 4L3EA 3PP4L 1YMMB 3KCPA 3NJHA 4JO5A 2ZXCA 1UEYA 5IMOA 1NEZG 3AREA 2VXTL 2AK4E 5F8QC 2VLMD 4L9LA 4W1TA 2N7BA 1FE8L 4PJCE 4PJBA 1PKQE 4XN9A 4LLUA 2IGFL 3VFUB 4FZ8L 2ZYIA 3GMRB 3QXTA 4YIQA 1NLDL 1G7LA 4PMFA 5IVXF 5CKGA 4R90L 2BIHA 2JE8A 2YK1L 2AW2A 3S3JA 2DS4A 2ZJSL 4JUSA 4Y16B 3PDGA 4WJG3 1FAKT 2UZIH 1UADC 2VRKA 5DD3H 4EI6B 3TBTB 3VCLB 4AK1A 2OMTA 3N1PC 1DTUA 5DSCA 2D0FA 3HFMH 1MWAH 2ZWYA 1FNHA 2Z64C 5JTWA 4WSJA 3C5SB 5C0JA 3AU0A 3MRMB 2XFXB 4N8CH 2OA9A 3EGDB 4LSSH 3TNNB 4WSGA 3ZZLA 1EHLL 2HRPH 3VXMA 4L8BB 2CPCA 3S37X 5HHNA 3TIEB 4UTAH 3I6KB 4DGUA 2QPUA 4BSWA 3VE0A 4OY9A 5B38B 4N3TA 4U3SB 4DW2H 4HIXH 4GP8B 4I0CC 4WHCA 1PCSA 3WO4B 4QY8A 3ZOAA 3WFEH 2V2XA 3Q3GB 1KENL 2BZDA 2NZIA 2SODB 3GMLB 4CN4A 2GT9B 4P5KB 2JQAA 5IKCA 4K3HA 2Q3AA 4HUCA 4PYHA 4BIKA 4HVBA 4APQB 3VXTB 3BT0A 4WW2B 3BAWA 5CGYD 4PJ9D 3QUMA 3KW8A 4H26B 2AK4A 3EO1A 2K6ZA 2VKXA 4OZHE 4QRTB 4FFWD 3SE8L 5FO9B 4CJ1A 1MJUL 5D7KE 5E0QA 4OZIA 4Y7OC 5FKPA 2YGPA 2UZYB 5ISZE 1IARB 1KGCD 4L3EE 1U8IA 4JRYD 5CBAA 2IMNA 1HEZA 2EDYA 2X5PA 5HYJD 1SPDA 1R3IH 3HZVA 3P0VL 3D0VB 3L3KA 5EU6E 5BRZD 3IGUA 1MI5B 3ZJAA 5IBLD 3VTMA 4YSQA 3QCUL 4E42A 4GAYB 1XV8A 5K33A 2HAZA 1OB0A 2RQEA 2BOCA 2GBUA 3QCVL 1MFAH 1KOAA 1LP9B 4M7LT 5AWNL 2A6KA 4HKZB 3VXOB 4KITB 5CR1A 3ROOB 4BFJA 5CUSL 1CGSL 2DJMA 1MQKL 2GCYA 2MJWA 1KENH 3O9WA 4ZXBB 2H1LM 1BFSA 2WXGA 3I3BA 3QG7H 32C2A 5AW4B 3RZCC 4OSUL 3EUUA 4XCYB 3PXJA 1QUNA 4XX1E 1ADQL 3VVWA 4HOWA 1I8LA 2OW6A 4QT5B 2ITFA 4Y5VB 4CSTA 4UI2A 1U6AL 2WN3A 2FB4L 3BYTA 5DT1L 3FUKA 5J8OA 1HZKA 4NN5C 1N6UA 3QQ4B 5EIIG 4B50A 4DUWA 5KTEH 2NXYD 2XXFA 3PWJA 4F2ME 1OPGH 3UBHA 2LVEA 5GIRB 1WC7A 1RJLB 3WJJC 1AGDB 1I75A 1WCBA 2AQ1A 1QSEB 2BSSB 2XQYA 3B7YA 3GF8A 3L1OL 3P54A 3PXHA 1E7VA 4LOVA 4PB0H 3CG8A 4KDWA 4Q89A 1ZV9A 4APXB 4OM0H 4JZJB 5CF3A 3MNZB 1TQUA 1XGPB 4WO4C 2OTWB 2VUYA 1KCBA 3TWCL 3FMGL 2J6EA 3HBPA 1JD9A 2N7SA 4WFHE 3DOHA 2Z8VC 5EC1A 5D7EA 1TCRB 4BXSV 2ARWA 4M02A 1X9RA 3LH2L 4NRYA 3O41A 1OIOA 4YUEH 1RFDL 5H35B 5DRXA 4OB5H 1D7BA 1OVZA 9CGTA 3O6FA 2VDLB 3JV0A 3QG7L 1QSFB 1Z5LA 3E3QC 3RGBA 1Z9LA 3E38A 3OBAA 1HWHB 4XHQA 1AFVH 3HHMA 3L6FA 3G9VA 3ZE0F 3NACL 4N68A 4L2LA 3RAJL 2G3ZA 1FWXA 4IKIA 1Q90A 7FABH 5AAMA 2C9VA 2NY7H 2YJQA 4N26A 4GQPH 2NYYC 4MDIB 5MHSE 5HHOD 5AB2A 4IMLB 3KPSE 5LXGH 3D39E 2DQJH 2V6HA 1DL7H 1SXSA 4M1GH 4XCEB 3C8DA 3VXMD 3P4OB 3P9LA 4K73A 1AIFB 2DJUA 4YHNA 5I8EB 5I6MA 1I1AB 4HGWA 3KYNB 1H5BC 1PY9A 2EDOA 5B21A 1ILSA 4ZMYA 1UXLA 5AENA 3KW7A 5FV2A 3B2DC 2FJSA 4N87A 1H8NA 1IGCH 3BVNA 4F1ZA 4IU2B 2ATPA 2ZKXA 5DVKA 4L4VE 4Z7QF 2GW5A 4D7PA 4XAKD 1MDTA 5T1MA 2G9KA 1YEIH 5A2IH 2FO4A 1ZD6A 4OBRA 1CVRA 1GYUA 4FHJA 1P2CA 2A74B 1ZPLA 1QLEB 3HMXL 1LO5B 3MBXL 4EI5D 1KCVL 4KK5C 3FB5B 2D7MA 1DBJL 3OKYA 1TCMA 1BAFL 3BGAA 5EOCH 1A1OA 3GS0A 2QADC 4RRPG 1G84A 3MV7D 1GZQA 3AGVA 4LCUA 3V0DA 1UWFA 2W65A 2QLYA 1AQKL 5HTSA 4UDTA 4LVNC 5B1JC 3S37H 4PRIB 4UT6A 1YUHA 1HILB 2FEEL 4FQJL 2VRAA 4Z7UA 3QNXA 4H20H 1TTRA 2ICWJ 4HHGA 1F6AB 5ICZA 3ARBA 4Q14A 1PZ2A 4BUQA 1JP5A 1QPKA 2N0KA 2Z31B 4LOFA 4PRHB 4IRJA 4YK4B 2WINA 4O2CA 1JZHA 3KYOA 4JFEE 2FHCA 1DSYA 1IGIL 4MQTB 3BLKA 2Z93B 4UM8B 4DP8X 5JPNA 2HT3C 4Z8FL 2F68X 2BCMA 2E8YA 4FD0A 1G94A 3INOA 5E99H 4Q0XL 4R96B 1BSIA 1WZAA 2E5EA 3TNMB 4TUKH 5EUKA 5CLYA 1B2YA 4YWGH 5CEZD 2ZOLA 3OZ9H 2UY6A 1G6RA 1UJ3C 2D0GA 2I9TB 1ZLSL 1XTMA 3AY4A 5LGJB 2ZQKA 2EE3A 1K5NA 1PLGH 3NSDA 3OAZK 4NO2A 2OXGA 4R5XA 4X8GA 2CJSA 1U3JA 5C3TA 3KNBA 3S98A 5K1NA 2ZAIA 4PJFB 4WW2A 2P5WB 1OGTA 1RVFH 2HRLA 5AAPA 4L4VD 1RJYA 4LCWE 4BWUA 5DZJA 1VENA 4JZOA 4JM4L 5E2VL 4BWWA 2VXVL 4MGXA 2V5SA 3QS3A 2YZ1A 4RMVA 4UQAA 3MVSA 5IVNA 4ZX6A 1DVYA 1BAWA 2WIIA 5D1ZA 2W0LA 3OKDA 1Q0XH 1TENA 2PPFA 3SDCA 3REWB 1OARH 4FQQA 2XKSA 3H2QA 5BMFH 5I8OH 4XCFL 5GGUA 5HHNB 3TIEA 1C1EH 2ZCHH 4MLIA 2BIOA 2ICWA 2P46B 1FO0L 15C8H 2VRQA 2XY1A 3AUVA 3MV7B 3OX8A 1O75A 4NCC1 4AGPA 4NC1E 5IHZA 3KPQB 3BSGA 3DUSB 3MRPB 4O51B 4EIBA 1YN6B 1URIA 4TUKL 1QSED 1U3HC 1XHHA 3PAZA 3UTQB 1XCQB 4IRJD 2OZ4H 4PWFA 4F2MB 4U1KA 4X9BA 3OLGA 1RHHA 4ENEC 2XPGB 1DN2A 5KWYC 1UM4L 4O2EA 3SIKA 5DRNA 1NWOA 4U05A 2Z91A 3WJLA 2JFCA 1W15A 4XO9A 3QUZD 2IPTL 4ZUTB 3ALWA 2Y3NA 3RWDB 1WPCA 3WIFB 2V2WA 1V54B 2DYPD 2K0RA 4IMKA 4Z5RB 1GYAA 4TVUA 5F7EH 35C8H 3V0WL 4ODHL 4MYWB 5DEFB 1WIPA 5L6YH 1P7KB 3OR7B 3D09A 4K5MA 1EANA 4LL4A 4LCWA 3CK0L 1DFBL 1E8ZA 3FSZA 3JTSB 4K23L 3QIUA 5D4HA 4YXHL 1BV8A 4UT9H 5MENA 3IDJA 5C7ZA 3TH2T 4YPGA 5I8CA 4YSTA 3MR9A 4MJIA 2PYEE 3MMEA 1T2XA 1Q9KB 1ZE3C 1BP3B 2YD4A 4JO2H 3T2QA 1VADA 4JO3H 3VGEA 3FTGB 1V10A 2X05A 2DEWX 5K9OB 3NSYA 4MXVE 5KVEH 1BIIA 3FQRA 2FUTA 4I9XA 2D03L 3OGCB 3WXWH 1AHWB 3JBG7 3WJMB 1Z9SA 1BGXH 1U41A 5GGTA 1J5HA 4WTZA 3O3BA 4E9YA 3BZFA 2AK1L 2ZF8A 5ANHA 1XF5B 4JVUA 4W9KC 5DTFB 1AC6A 3C60C 2F8XC 4PJEF 3WG7B 1OCRB 5C0IA 2WN2A 1AE6L 3S3PA 2YAFA 3GRWA 1FYTD 3U48A 3CC5A 4Y1SA 3HC0A 3U82B 1DSWA 2IANB 4WJ5B 1GCYA 3WIIL 3T3MF 3MJ6A 3TPUA 1NAMA 3FCSB 4ZNEE 1IM3A 2XWJB 1G7JA 3R06A 4TTGA 1AP2A 4FJYA 3CXDL 3IJ9A 4KUZL 1PQZA 1K8DB 2O1AA 2VLJE 2VDRL 4KZDH 1F5WA 3O9WD 4JN1L 3ZTCC 3GDCA 1OHZA 4DZ8B 4NN5B 3C2AH 2A1WL 2FECL 4OCLC 2VDQB 4IRSD 4P4KA 1YQVL 5AW0B 1RZKL 3IFNL 4YSOA 4NXSA 3T2PA 4G8FB 1XR9A 2IAMC 1RURL 1OTUD 1DEDA 1V55B 1N26A 1TVHB 4L8SA 3VMNA 3HMWL 2XWCA 4JRYB 2AKRA 4QHNA 3PS6A 2ZCLH 2V7NB 5LQBH 3WKML 4FXGA 2C9PA 5IQ9A 4UAOB 2N59A 3V0IA 5HYSG 5DVLA 1SOXA 5D2NE 5IZ7A 5HVGB 5CBEA 4NZFA 3T8VA 4ANWA 1BEXA 1VGKA 3HS0A 3IVKA 1MFDH 1X9QA 4ZOBA 3GYRA 1WUNT 5ISZB 3GPSA 3UTTE 3R7QA 4ZQTA 2WWKT 1FFNA 1FO0A 2TRHA 3JV6A 4LP4A 4L0PB 2VW4A 3HNSL 3VQMA 3WY2A 4PJ8A 1CGYA 4K9EC 1HAUA 2J2ZA 3NCMA 1F4WL 3FFCB 3FO1B 1EO5A 3QC6X 5GGRA 1GC1L 1HHJA 3B7RL 4S0HA 1TNMA 1PKOA 1RZKH 2C1PB 4QRRB 2DQHH 1ONQA 1FFRA 1ZHNA 3OWEA 1WAAA 1VLXA 4NQEA 3FSWA 4LLUB 1JF6A 4Z7AA 1E9PA 2UVEA 3L17A 5I76A 3V7AG 2OMZB 2X28A 3LAFA 4ADIA 3ARZA 3DK2A 1Z1WA 4NC1C 3ASOB 5JIKA 4AW7A 5CO1A 3FQYA 1IM3B 1BBJB 3OHXC 2UZXA 1IBFA 3BEWB 1U8JA 3ZT5A 3QJHA 4OF0A 1R24A 3CSBA 3VUAA 3BT2H 4A7GF 1KGUA 3GMOB 3ARBD 3VD2A 4JFDA 1TVBB 1L9PA 2ENQA 4G6AD 5INDA 4X4YA 5HGDA 4EI5A 4FFZH 2R2EB 3OGCA 1BZOA 1URLA 4XXDA 4XRCA 4HGKC 1GSMA 3ME0A 1KB9K 5DWPA 2DQHL 4QCIA 1GR7A 3GHBL 3GUFA 2HLAA 2VAJA 3IJEB 3MV9E 4QRSB 3VXRA 4DN3H 4I18B 3NBNA 2W0KA 1RAMA 2VH5L 4K3EH 4QTHA 3O2DA 5JIHA 2BFVL 2F54B 4EN3C 3IMUA 1CICD 2J73A 3KPNA 2DN7A 1NCHA 3ULVL 1SYVA 4UOJA 4P46B 3W38A 2P42B 4LLAA 4V1DA 7PAZA 3GXDA 1QWHA 2B1AH 3KHOA 4PY7A 3LX9A 3APNA 1NCDH 3OVUB 4LDLB 3VFOA 4D8OA 2Y6SD 1GIGH 1X5MA 3GSNB 3RVXC 1FVEB 2DIBA 2A6IB 5FLUA 1KPUB 1PZ3A 2P8LB 1SM3L 2F58H 2VN5A 3OPZL 4MYPA 2XWXA 3L7EA 4J12A 4LL9A 4A7SA 1UJ3B 4M5YL 4J3WA 2WZPA 1WA0X 3GI9L 3VRIB 1X3DA 1S9KC 3MX0B 2IOIA 5DD5H 1RIUH 1J1PL 3CIAA 3DMMD 1CLOH 3QDHA 3KPPA 1KY7A 4Q56A 4N8UA 2H32B 2F1AA 3Q8BA 3QULB 2ICWB 3R8QA 3RVWD 5JIMA 3O2DH 4LSTH 5DZNA 2QV4A 1KBGL 3BWZA 4AV5A 4N24A 4QWWC 2YBGA 3V0GA 3C12A 5IVXA 3VGFA 2Z35B 2GIMA 2AITA 2Z92B 3QG6A 3CDZB 4X4KA 4YFLF 3I2CL 4RZCB 1DE4B 3CX5K 4AZ8A 2VDPL 4EBQL 3TA3C 1GIGL 2X6AA 4XNXH 3IJ7A 4IRSB 1KTDA 4AIXA 1YLBB 1FG2B 3A6CH 3W9EA 1A6ZA 1BJ1H 3BOVA 2W60A 1U8CA 1YQ2A 4FTDA 1MEXL 2DLFH 3VI4F 4QKXB 1AKJA 3L3JB 4A7VA 4OF8A 3BSZH 3TO4C 1A4CA 1KF9B 4GKNA 5T3ZE 3WKNA 2I9TA 4G80A 2P43B 1LK3H 1R3HA 2PN5A 5E8NA 4BV1A 3NCWA 1KCWA 4D0DB 1GXEA 3TYGL 3JTSA 1DVUA 3LIZH 4JPVL 3SDDD 2X4RB 5IMKA 1NBVH 1SDAB 3CVHB 4I4WB 3Q05A 3HHRB 4MX7B 2I9LB 1IVTA 4UM8A 4MDJB 2D0HA 5TDPB 4A2EA 5CP7B 3DMMC 2X41A 5FC9A 5EZLA 5FYJE 4P3DB 3PL6B 2CIKA 3BEVB 1GRWA 3BCFA 3K4DA 3RWDA 1B0GB 2NR6C 4WNJA 2QSVA 4ANUA 4DPAX 1S7XA 3CXHK 4ZMZA 3KBEA 3LHPL 3Q43A 3WAKA 2E86A 4XHJD 5DJDA 4ZMAT 3ZMRA 3PWNA 4YHLL 1UXMA 3DURB 2HB0A 3ETTA 1A6AB 3VGAC 4LCUB 4G1MB 4I85A 4JB9H 1EDYA 1PG7H 4W9EC 1ROCA 5LBSH 4X6EB 3KPRA 1U4FA 1GMEA 4MSWB 4NPJA 1MIML 1Z0MA 3DUSA 4O51A 2ICES 3IDXH 2EVJA 1XZ0B 4YDJA 1EHXA 1MZZA 3ARDD 4NP4L 2M8XA 3UEQA 2EXYC 4B5EA 3WI9A 4RIRA 1FNEA 2R2HB 1Q0YL 1X5FA 4D0CA 2AXWA 3MJ9A 3MUHL 1VZGA 1OK0A 3Q06A 2VC2H 3FU9A 2D7TL 1RMFL 2FX7L 3K0YA 1W0WA 3IRZA 1FVDB 3DX9A 1UM6H 4IBYA 2I69A 2B1HH 4PCKA 1TETH 3OGOE 1KJ3H 4XNUH 4MHHI 4JHUA 4HS3B 3CBKB 4XVSH 1H3PH 5HJGA 5BZZA 1IEBA 1XGUB 5D6CB 5LGKA 4PJAB 2HX8A 3QEHA 3IMTA 3IAQA 4RAVA 4FFTA 5E8NB 2EXWD 5T3XH 1R3IL 3P0VH 2BIPA 2HKHL 5CLTA 5HYIA 2LTQC 2X87A 2M83A 4K3JH 1G9HA 5BNXD 2WXFA 4CA4A 1J9SA 4FQLL 3VSVA 3TS8A 4WI3A 3OHMB 4WFGD 5DJ0B 1QSFA 1SHSA 2JCCA 5EEVA 2OMWB 1TQVA 5ETUB 2PWHA 1XF4A 3W9DB 1QPXA 2IG2L 3KYOB 4XMWA 4CAGA 2AS5M 3QUHA 4ZUUA 4H13C 4XNZB 5KYYA 3SKMA 3UABA 5EC1B 1A1MA 1EXHA 3QNXB 2CLZA 1JVOA 1KLFB 1P4BH 3V9CA 2TAAA 1F4YH 4YHKH 1SLVA 1YUHB 1M9SA 4ZJ9A 5IVXB 1FL6B 2H2SC 1YNLL 4ALAL 3RGVB 4S2SA 4NQDE 3ZO9A 4MMXA 4R8WH 2NXZD 4ACPA 3HZKB 3T0DA 4NQCA 1WEJL 1OSEA 2EE2A 3BAEH 1NOFA 2IANE 3RB7A 2BVTA 4YDJB 1ECZA 1A6PA 1T0MA 2NY3B 4G8GE 4YL9A 4KZEH 4X4ZA 4YLBA 5D7JA 3T6QC 2BSRB 3CLEL 4WW1A 2A74A 3FTYA 5IB4A 4I3GA 1BQHA 1X5HA 4JFDD 4MQ7A 5FYJH 4UT9A 3KWXA 2G4EA 3TT1L 4ADJA 1E8XA 2RBLA 2Y7OA 4N0RA 4F7CA 1NDMB 1OF0A 3MNVB 5FYKH 5KSBA 2XN9B 3BVNB 2Y2WA 3L7EB 1KYOK 4K15A 1PEWA 5JW3H 2W5PA 1KNOA 3PL6A 3SPIA 5F7WC 2RR3A 1O6VA 2OCJA 4KTDH 4YSCA 3SDCD 5K5YA 2JF1A 3FZUC 5AB1A 3RPBA 3VXOA 4G9FE 2WXIA 2BSCA 1S5IL 3MBEB 1MG3C 2FRGP 4X6BA 2HFTA 5DMKA 4M7LL 2QHRH 3PAYA 3QZNA 4Z7UF 5E8EB 1W16A 4F7KA 4R8WL 4KK8D 4XB7A 3POHA 4RLDA 4NQQA 4LGPB 3SPCA 2V17L 1XGZA 3L9EA 4Z3FA 4LSRL 1S78C 1JD7A 1QQDA 3HE7D 1MHHB 2LOEA 2V2TB 3VWKB 1SBBA 2OXHB 3QJFB 3ZRCC 4BQBA 4WHTA 1OALA 1YAZA 1GPOH 4QRTA 2EE0A 4NKIL 4WGKA 1BPVA 3PNWA 2KI6A 3NAAL 4ODXA 2ZX5A 1YECL 3MGOB 1MAJA 4IK7A 3O3EB 2CDFA 4L3AA 4A2HA 4OR1A 4R4FH 3TO4A 1EJFA 2WCPA 3FT4A 2XQBH 3MRGA 3K2IA 5AVZB 5HI5C 1QYGL 1JOIA 2O6CA 3QWNA 3T1FB 3BEWA 4IIQB 2JIXB 4QOKB 5CZXC 5T33H 3VO0A 2EH8H 4Y4FB 2DQEL 5E4AA 1DUZB 4M9PA 4JFQB 1A9BA 4PTTB 1FV1B 2YRZA 3DYPA 1M7IA 1RZIB 3BD4A 4KUCF 1LL1A 3NCJH 1HC1A 1HHGA 3PAUA 3MJ7B 2GI7A 5ITBH 1OSZB 1ZLWK 5DSCB 1ZHNB 5T3ZD 2V17H 3PLYA 2ZKHH 3SBPA 2NY4C 3CSTA 3EJRA 3SPVA 3ELAT 3K72B 3LN5A 2RTTA 1IC1A 4XB3A 3SKOA 1RPQA 4DO4A 3ARFB 1AGEA 4PY8I 4TLSA 1T1XB 1W6WA 2NZ9C 4PP1D 4BH7B 5HGGS 3IKCA 5T1DL 1YECH 4FL4C 4G7VH 1NINA 1IM3D 1PG7X 3NCYP 4HIIB 5AOLA 4WI0A 4WV1A 1ZSDB 3OR6A 5B8CA 3UC2A 2WQVA 3DA0A 4O02H 3V7AE 3O45B 3CZFB 1K4DA 3ZQXA 3N1QC 3U36A 2EKSA 4NQXA 2FAUA 1F3DH 3RWGA 4F7TA 4UIMB 2WO2B 2WQ8A 2LLLA 4H25A 4PWEA 4PJ7E 5E6UB 1KV7A 3JSSA 1MFNA 2NX5D 4P2OD 4Z7VE 3VXPA 3FC8A 4S1SL 5PAZA 3UAJD 1R47A 2LFEA 1D5BA 6CGTA 1CE6A 2IV8A 4X4XB 5GRYA 1WF5A 3II1A 4PJIA 3TBYB 4Y5XC 5DUML 5J6HA 1BZ9A 5KSUA 1QBLH 1CE1L 4CDGC 3BRFA 2VJ0A 1RLBA 4AENA 1MKFA 5I75B 2W92A 5KANI 1A6WH 4GXVH 2ZSWA 1KPVA 2X53A 1ULVA 2OQJB 4MS8D 3C5JB 5DS8A 4TLUA 4FLRA 1P1ZB 4Y9CA 1T7WA 2BK8A 1KXVC 5TQ2H 3K5RA 5FHAL 4JFEA 3S2CA 3UBXB 3QXWA 4NSKA 3PHOB 3HZMA 2E6PA 4PSRA 5C0BA 2IFFH 4U1IA 2JMRA 4DJMA 3IXTB 2UYLB 4U6XB 1HKLH 2DKMA 3GKZA 1MFMA 5AOIA 1V27A 1H0DA 3FH7A 3N40P 4LHUB 3UTTD 3HC0B 5LO7A 5KANG 1W8NA 2BSED 1QSZA 4CADB 2VDNH 1NBYA 2CKBB 3U83A 3MLXL 1I9RH 1YEJH 1BECA 3D7PA 3KVDD 5HGBB 3H42L 3GZKA 4LCWD 1OTUC 5DDHA 5HDBF 4MB4A 1G0DA 3TT3L 1WFIA 1EX0A 3LN5B 1GGUA 1UOLA 2E59A 2GK0A 5T5NF 1MW1A 3B5HA 3VH8G 4BWTA 2VTFA 3BKML 1TJIL 2HT4D 3VG9C 2J2ZB 4PJIF 3R18A 5F9DC 1YEKL 1HK6A 2N3JA 3GMRA 4YIQB 1XF2A 4LHJB 4Y19E 2X7LA 2H3NB 3MPCA 3HC3L 3WN6A 4Q7DA 2R1WA 4ZFZA 1BZ7A 1W72A 2QFPA 3QHFL 2VDKL 5CMAB 1OE2A 2GHWB 3V4UL 3IGAA 3JYBA 1C08B 3NJXA 3ZYIA 4BCZA 3MNMA 4TSBL 1DFBH 1AIZA 1F13A 1G7IB 2OL3B 3K2MC 4ETYA 2XZAL 3P9MA 1TQTA 2AP2A 2EO9A 5B7FA 5AVYB 3K8KA 3BZEA 2FJHA 1I8LC 2A0LD 3BJ91 2KERA 3KPSD 1M05B 1PZ5B 2BXYA 4GAGH 1G1KA 2V2WB 4Z5RA 5ABZA 2KPNA 4HJ1A 1ACXA 4OIFA 1NBCA 3DJTA 5AEAA 2YO3A 2YEQA 2GJ6B 1ZIAA 4N2EA 1DBBL 4DVBB 2XN0A 5DRNB 2G3XA 2AV1B 4AY0A 1JMZA 1DDTA 2GVYA 4ZUWA 1I7TA 3E8UH 1DJXA 4P4RA 2Q2LA 2O6EA 2BSTB 3NRFA 2IMMA 1XEDA 3KWWA 4P9HC 1JN6A 4AUUA 1OSPL 2BHFA 3MV7A 3RRQA 4ZW6A 1UACH 3KXFA 5J7CC 1FFTB 4RAUB 1U58B 2NSXA 1HH6B 3KBFA 4O9HL 1NAMB 2X6CA 5ABDE 2JLLA 5BS0B 3PDOA 1KLUA 1OD7A 5ESQA 1UJTA 3T6VA 1ROWA 4RESB 3RY5A 3O3UN 1WVZA 5AAWA 4DF9A 1XAKA 2PW2B 3QXDB 1TZGL 4P2RB 4H0HB 1ACYH 2WP3T 2H8PA 3US9A 3EOAA 2HTKC 1RP8A 5IM7B 1RXLA 3TOPA 4M61A 4CVXA 1SN2A 4OZGA 4PJIB 4TNVK 5GRVK 5F9OH 2VLRE 5E8OA 4GY4A 4JFVA 3G04B 3KLDA 3FTGA 1TDQA 2YAQA 3SZ6A 3U1SH 1CXIA 4B9PA 1S7RB 3B9KB 3E8UL 2RACA 1KFAL 2Q2EB 1IGIH 3BI9X 1XWVA 3U4AA 2J1XA 4ABWA 2O5XH 2VL5B 4JDEB 4BKLA 2XTJE 5SWZA 2HSIA 4NQVB 5EBWA 3NGBC 4GSUA 4NO5A 3SYCA 5KYXA 4M6AA 3LRHA 4F8LA 4R7XA 5IGXL 3VDBA 3WJJA 5DZLA 4ZNCD 4NKDA 2CG9X 2J1WA 1CICB 1HINH 3JT0A 3T65B 1G7PA 2Z31A 4PS7A 2WNGA 1CFTA 3PWPA 1A1MB 4NCDA 3P0YH 2BNQB 2K4AA 5TE7L 2QQQA 1YPZB 3BKJL 3D69B 4HV8B 4NI3A 4OCRH 4CU6A 1OAKL 4L4TD 4R26H 4MMXC 4PFEA 3CPLB 1HXKA 5H94B 3BE1L 4EOWH 5F7DB 3VW3L 4LLYB 3VSTA 4MXQC 3VWKC 3AY4C 5T1KA 1Z6JT 5DA4A 4NBXB 5IMLB 4Z1PA 4JG1H 5DI8B 2W88A 2XLLA 4PGJA 1MQ8A 4UBDD 3KPRD 5D2NA 1JZ6A 4GO9A 3I6LE 4WI7A 1ERNA 3MJ8A 5EA0H 4P9MH 4KQ3H 1BZDA 1CURA 2V8MA 4ZO7A 1FE8H 2G5BA 2YD8A 4HUMB 4UF7C 2ZXAA 1J87A 3IDYC 1SY6H 4FZ8H 5E51A 3M46A 1I3VA 1BW8A 3D33A 2FVNA 2ORBH 4AW4A 1HN1A 2I7OA 3DARA 3EXJA 5B7MA 3DI2B 2O6DA 1ETB1 1R0AH 1PY0A 3D3VE 4JX0A 4GG8B 1VGEH 1A3RH 4MLSA 3KLHD 1AO7D 4TSAH 4MJHA 3O0LA 4U1NA 3GLEA 1MH5A 4JPWH 3ZDYF 3C8HA 2R4SL 4OU3A 2QKIC 3ULUF 1F11A 5BO1L 4GSQA 2Y0SA 1OCWL 2G0KA 4K3EL 4UQIM 3K81A 4EI5C 2IALB 2WP3O 4ODHH 1QBAA 2X44D 3M88A 1N4XL 4E5XG 2BFGA 3IDNB 4BZ1L 3QDGA 5FDWA 4Z3IA 1WHPA 1EDHA 2UVFA 4YGAB 3O6FB 3RX9A 3MRIA 3UGUA 3PQYD 4WI9A 4G7QB 4X99B 3ARGA 2UWEE 1Q72L 2VQ4A 4CKVX 1PLCA 4KV5E 1N70A 2G3MA 4J8QA 5HHXL 4P3WA 5CD5C 3WEXA 3BMWA 1VERA 4XPBL 3QK0A 4HMDA 4U0RB 2ZUQC 5LCVL 3FU8A 2ORBL 1WITA 2BCKB 4HDIB 1T1ZB 4IKNA 4KVPA 4NNYB 4XO3A 5EZLB 4N0FA 1QLEL 2AXFA 2CUAA 4UDTB 1KB5H 2UX7A 1U3NA 2LU4A 3S5ZA 2VM4A 4TSAL 5C6WH 4JPKH 2LLGA 4FKEA 4MJ4A 3I6LD 2YJLA 5D5MA 3U6RB 1H3XA 2B08A 5C0RH 3LKPB 1T20A 1TQCC 4IKJA 4WCYL 1Z3RA 1DSFL 3EGSA 4IK6A 1MCRA 4RBPK 4G80B 1HE8A 1F11B 1R6VA 2DQDL 1ZLUK 1ZEAL 3FQXB 2Q6WA 1I82A 1X5AA 1F4XL 1F8TH 2LAGB 1XVSA 3DTDA 4B9IA 4U33A 4P5TB 1LM8V 4ZMPA 2RJMA 3D87B 5L0QB 4PRNB 2IJ0C 1J0ZA 1KXQE 1F6LL 3LZRA 3L08A 3RQ3A 3LS5H 3P73B 3RU8H 3SKMB 2VMDA 4M1DL 4YDLB 4AEHL 5JO5A 2R15A 1D3CA 4K2UH 1THAA 5LXVA 4P5TA 2AK4D 3QJVB 1OTTC 1RUAH 1AR2A 2FSEA 5HGHB 1BX2A 2ZYHA 3UTSD 4JFXB 3F65A 1A6VH 2Q86A 2Q76A 2RCSH 5EDXA 3W56A 1PW3A 4P2AA 3WTVA 1BVNP 4JPKL 3QCVH 3MOAL 4JO1L 4XT1C 2P47B 2WKOF 5B38G 3MLWL 3RDTB 3INUH 1DUYB 2WBJD 3LKPA 5DXWA 4Y16D 1DJZA 3JWDL 2ZXGA 4XI5D 4HS3A 1A7NH 5GISL 5FAAA 4YHYB 1IM9B 1IGJB 2BOLA 3QUMB 4H26A 1MRFL 3SYOA 1CK0H 5DRXB 3MUGA 1ADQH 5TF1H 1WYJA 3LXCA 3S36L 4AJWA 4G7RB 3AG1B 3QC5X 4RVBA 2BVUA 4RMTA 5I1DB 3DRTB 1WD9A 1MSPA 1A3LH 3V4VH 2A0LC 3RBGA 4OLXH 5E94B 1B0RB 4TM9A 1U8KA 1N18A 2H2PC 4U3SA 1OP9A 5IROA 4AEHH 1KCKA 1NGZA 1V3LA 2CLVA 3B5TA 5HI5D 4IKLA 3GI8H 4UB0L 5GS0C 1L9MA 3QZBA 4ZW7A 3KPNB 3MRCB 1IC4L 2R27A 4PLKC 1PLAA 1IIKA 3ECQA 3ASWA 3BHBA 4GQRA 2VB5A 3P1VA 3QQ3B 4G7YL 2ITCB 5MHSD 3H6AA 4DESA 1M56B 5T1JA 3V9EA 3VU1A 2WBKA 3BVXA 3KPRB 4AXWB 4Y89A 3Q2NA 3HKFA 4ZUSB 4DO6A 4HUXA 4MAYD 3QDJD 5ERWB 1ZA6B 3K7UA 1ZVSA 3VX0A 4BK5A 2KQNA 2XG4B 4UV4H 3DURA 1E3XA 1DLHB 4N20A 4AVHA 4LRIC 4NZDA 4XXWC 3OAWA 1IGCL 1I1CA 3BWAA 5KJ7E 3T6ZA 3BH9B 4R0LB 5MENE 3KR3H 3FB7A 4ZS6D 4AM0Q 2CE6A 2JJTA 5TTRA 4E68A 2DW5A 4X50A 1EGJA 5FYKD 5LBSA 1V3KA 4P0DA 3TZVC 1T03H 2Y4SA 3V4VL 3KVPA 7FABL 2DWYA 3KH4A 1BBJA 4XHJC 3BO8B 1GOHA 4E41D 1FL3B 3O6LL 4RAUA 1YEFH 5AW2B 4N0CD 3EJSA 4LAJH 3TVMB 3ZMEA 3VD4A 3HLAA 4K7FA 5FPIA 3P3UA 3TEZA 3T3PB 2GYSA 4DKDC 1IC5L 2AABH 3X14B 2HKHH 1OQXA 2ZAHA 4UT7L 4J3BA 4XO5A 3DPBB 5F9AC 1OGAA 4R9HA 1HOEA 1IV8A 2XV6B 5AKVA 3SB3A 3H3BC 1L0PA 3FQ1A 2Z1PA 1A6ZB 2FR4B 3EO1B 3BUDA 3T0EE 2AV1A 2D4FA 1FH5H 1IGMH 3WTWA 2C1OA 1QBMH 1RZ7H 1DZBA 4HETA 1J88A 3FUIA 3ARSA 2MHAA 3TN0C 4QHKJ 1VSCA 3WY4A 4JFOB 4B0MM 3EJPA 5DA0B 2I5YH 4ODSH 1NOAA 4PD4K 5BV7B 2V2XB 3CQFA 4GIOA 1HESA 1XIWD 1YY8A 2NLJA 2X2HA 4N5UA 3KBHE 2COVD 4XP1L 2NDFA 3AT0A 1JERA 4U1SA 4B9JA 4NQVA 2WQRA 2OFQA 5DD5L 3BXNB 3FU7A 4K7PX 1UWXK 4LVHB 1Q1JL 1VGKB 3HS0B 3D5OF 4P5RA 1RUPL 2R23A 2D3LA 5EZOH 4ZUVA 2KLSA 2MEJB 3NPSC 2EEBA 3L4WA 3W81A 4AGQA 4Z77B 3SQOH 5IFHL 1CXLA 2O30A 3HC4L 3UDWA 5C0AD 4G2AA 3RUGF 1D7FA 1NFDA 2WVVB 4M61B 4V33A 5C1MB 3ZDXB 3ARGC 3QJQB 5BV7H 1I8KA 4L5FE 2R4RL 1EAOA 2OP4H 1M53A 3V4PA 4I1NB 2XYBA 1HCFX 4JHAL 2Y1ZA 5BRQA 3V6ZB 3ZKXC 2F8IA 5DEZA 4AL8H 3H4FA 3Q8CA 1Y07A 2Q87A 1FPTH 4G6KH 5KW9H 3G6JF 4QYOA 3QIUD 1PZUB 2LW3A 2GHZA 3ESVF 2V9UA 1NPNA 3GRGA 2XVLA 3ZR6A 3R06B 2C3VA 5C0GA 4HHWA 1A4JA 2FWSA 4KKBD 4J6IA 4H8WC 2XWJA 3WSQH 3NN8B 4KRPD 2IBGA 4BDVB 3UBXA 5G5DB 1LK3L 3WE6B 1J5CA 1N8ZB 2NY0B 1Y6KR 5DWUL 4G83A 1FSKC 2Y07H 2VUOA 1EZSA 1UC6A 3RWEB 3M17B 2XNAB 3KJ4C 4M29A 3WTSA 1HAWA 5L2KB 3TEYA 3SDXA 2CWRA 2ZWNA 3WJMA 3BX7C 4ZSOB 3ZQWA 4I1RA 3LKRB 4JG0H 5HYQA 3VXPB 1U8MB 1GGBL 1M05A 1PZ5A 4DPCX 5IQNA 1N8OE 1Q9LB 1IBGH 3FT9A 4P5SA 4I3RH 1MCSA 2OMYB 2UUDK 3VRLE 4DP7X 4F37K 2SEBA 2FH6A 5GZOA 1P7KA 3OR7A 1BD2E 4RGNB 1KTRL 4XN8A 1ZXKA 2YA0A 3HI5L 1JPEA 4J3OF 1QRKA 2H1XA 5CMAA 4QYOB 4XMVA 3RDJA 4BQ9A 3DOSB 1BWWA 2YGQA 3IWUA 4LSPL 3QRGL 5BZWA 1FZJB 3EFDH 2PO6A 1QLFA 1IGFL 3KPSA 1UURA 3FCBA 2WKGA 5AW9B 5A3ID 2FDBP 2Q10A 2PYED 4GRLD 2XVGA 1M6OB 35C8L 3AAZA 3CUPB 5HHPA 3CCHA 2ITDA 1JNLH 4NZUL 1QTYT 4ERSH 2RFXA 4CADA 3EO9L 1FZKB 4HX1B 2ENYA 1TPXB 3H0TA 2IFGA 3O4LE 1NFIA 2KYIA 4PPTA 4M6MH 3QQ3A 5CJOL 3NIDE 4U6XA 1DQLL 3TPKA 4H8QA 4JFQA 3U9UB 3HBGA 3PGFH 5HHVL 2KZKA 1TTGA 3BP4B 2P24A 4I3RL 4NPYB 5CEYB 3PHOA 1O9WA 3H7BB 2XA8H 3IFLL 3MRGB 1WGOA 3IFNH 5B8CC 4NQDB 5CSGA 1OAZL 5I1DA 3GD1C 2OBGA 1I8UA 4LSPH 3MGOA 3WTXA 1MY7A 1AXTL 1C8QA 1DQDL 3DBSA 1M2VA 1UWEL 4AENB 4YZFF 1P7QA 1R5WA 3QIBA 4KXZI 4YQXH 2NXYC 4JM2B 4G8GB 2ZAGA 3ETBJ 4DFHA 2FR4A 2X9XA 3JYCA 1JTTA 4GXFA 1DZ0A 3SCMB 5T3XE 4LOUC 1AGFB 4NHCH 2E8ZA 2DBLL 2X2YA 4H25B 2R8SH 2ED8A 3E2HC 4PG2A 4ZTPL 1SBSH 3D18A 4U6YA 2OSYA 5C0EA 3OV6A 1QLRA 4P5MB 2NNAB 1K4DB 2UUDH 2R69L 2WXQA 5CZKA 4B9CA 5L2KD 1U36A 3N44F 3VDCA 4PQXA 1PG7W 5TQ0H 4LLQB 2AQTA 1QFHA 4ODBD 2HJFA 1HCVA 1F4WH 4QEGA 5F7AA 2CU9A 2F08A 2VJ8A 4IJ3C 4P2OA 3VH8A 4QKTA 5ITFA 2WXMA 2NTFA 4PJDE 2J56A 2XRAH 1HTYA 2WTPA 5GZOD 1XF5A 1ZK9A 3QIWD 5FO7A 1U91B 5D7JD 1FNGB 2VABA 4G72B 4FULA 3GGWB 1JVLA 3UTTA 1JV5B 4L1BA 5JNYA 1CR9L 2EIDA 2IOOA 4MQ7B 5E9DA 5F0LB 1TVDA 1VADB 2FWOA 1X5ZA 4HH9A 1X9LA 4OGAD 2XBZA 4G9FD 3QHFH 3C5ZA 4NC2B 1HSAB 4RNRA 3DETD 3BC9A 4OIBA 5FGBC 3RZCB 3R0MA 5K9JH 5KJRH 4PJ9B 5HYSA 1S5IH 1P69B 2OYKA 4BKSC 1ZGLA 4ONFH 3MCKA 2R1XA 2OYLA 2WLIA 5TE6H 1TTUA 2QPSA 1MCWM 2WBJC 4DOHB 5DU7A 4D2NA 3LPWA 1JYVA 1U2HA 1MZYA 1P5VB 3CMGA 4J8RB 2WC7A 1BG9A 2J6EH 4FEMA 1MRDL 1FA4A 5JOFA 3ESNA 4KGLA 4XBPB 3AQZA 1E2WA 3HAEG 3HRZA 3UYPA 4OV5A 5MEQB 4OBSA 1JZEA 4I0PA 3UXFA 3X3GL 3CVCA 3V55A 1RHHB 4FQIH 1MF2H 3QRFM 5D7LD 1LWRA 4QHLA 2YOCA 3N5AA 4HS8H 1FVCA 4ILDA 4QXGH 1WH0A 5SX4I 4M6NH 2H6PA 3IFPA 5I28A 1VJSA 4JRXE 3SDAD 3EYUL 3RYMA 2BHYA 3TN0D 5L8KB 2E7LA 2HFFB 4F24A 4K0OA 1SYSA 3LMJH 4JM0A 4NQSB 2BDNH 43C9B 5E4IA 4QHLB 4EUPA 4FQ1L 2HYMA 3MYJA 1QSVA 1T5KA 3NEXA 1XZWA 4U1NB 1DBML 5DC2A 3E6FA 3UH8A 2PTTA 1A47A 1WFNA 3G6DL 2R7EB 5JW4R 1XD0A 2PCPA 5JA9A 4BHUA 5ABAA 2FHBA 3N06B 2WQAA 4M5YH 1OM9A 2H3KA 4RDQF 1RZJC 2E27L 3APDA 5BQ7A 2N01B 1OGTB 2EDTA 3I9GH 3F83A 5FKAB 3BGFB 4ZW8A 5J12B 3EH5B 4FXGC 3HZ3A 3QI9D 4PJHE 1RIHH 5C0DA 4Z7IA 1ZS8B 1Q0EA 4LL1A 4P2QA 3UZVB 1DCEA 4PGDA 1ASOA 3MA7B 2YRBA 2AEQL 1MRCL 2IADA 4LQFL 2ZOLB 2A77H 3CHRA 2ZSVA 1A7PL 4N25A 4TVPE 3F01A 4RRPA 4UV7L 5A16A 4P2QB 3UZVA 1IE5A 3GZPA 2AJUH 4GW4B 3UJIL 2IIJA 4UM9A 4FNPA 4QT5A 2VCOA 5C0DB 5EUOB 3D4ZA 2DM7A 1UD2A 4H8WH 32C2B 4QHMA 4R84A 1EXUB 2WY3B 4WI6A 4HS6B 2GSGB 2ILLA 3GIZH 5AW5B 3WIHH 2N1KA 3TESA 3ZYOA 3W5MA 3LQMA 3GHEL 2IQ9H 3EDDA 4DGYH 4ODTH 3EJZC 5DUMH 4HKZA 1D9KB 1CWVA 5EUOA 1LTXA 3MRIB 4JPSA 4YZWA 3RPKA 3EYSL 3CN3A 4NO5B 5B3JE 1T89A 4AKOA 1Y0LB 4M8UA 4NUJB 4RFEB 4PLJC 5DHVH 3IS1X 1A1OB 4G5AA 1KJMA 1R33A 3D0VA 3U6XA 1OW0C 5B3SB 1B0WA 1JHTB 1TZHA 4IOFC 3SGDI 2V4LA 3PIQB 2AEQH 5HYJA 1I1AD 1IEBB 1XGUA 2EVHA 1G5GA 2H6OA 1N64L 3AY2A 5TPWL 2W60B 4DKTA 3AQDA 1QFUH 4JKWA 1MJ7L 2BNUA 2B8OT 3JT2A 3VXTA 4H2CA 4KBPA 2X3BA 2DQIH 4MJ6B 2H0EA 4PG2C 4MFHA 2PW2A 3QXDA 3UBGA 1J0KA 3O3DA 2PNDA 4KK6D 3KYNA 3L1FA 2OR8A 5DVNA 4AYFB 5FB8B 4L5FL 3STLB 1QNZL 3V7MA 4JRFA 2OX5A 4J1UB 3BP6B 4JRYE 5JW4M 5AD0B 4ZMXA 3L4CA 3WN5B 1QI4A 2ISDA 1NCBL 5D2NB 4Y19D 4PGCB 3QCTL 3QUZC 5DD0H 5DJ8A 3RNKB 3LS4L 3T4AA 3CH8A 5FXCH 2OJEA 4F20A 1NC4D 1R17A 5GSRA 3HZYA 2RQ8A 1N10A 3RWIB 3ECUA 1RMFH 4FRWA 2YMXH 4X98A 5GXBB 1YY9D 2WO4A 4IBTA 2D4DA 3FULA 5I1CL 1YHPA 2DL2A 3UYPB 1CFVH 3ESMA 4P57B 4PWGA 1I1YA 2Z0BA 1FBIL 2Y5TA 2CRMA 2NRDA 4KH2A 2ZJSH 1LE9B 3ARUA 3ARYA 2CZNA 4PJEB 5D4JA 3ZLQC 1LO2H 1JXDA 4UDUB 5DR5L 1UM5L 4YE0A 3CU1A 3MKKA 1S6NA 1OCZB 4OD2A 5C6TL 1FHGA 5IY5B 1VIWA 4LLMA 2YAOA 1MFEH 3IM1A 3VMOA 4L8CA 2R1WB 1TR7A 1WC7B 4AG4H 3MGTA 3LEXB 5DJYB 2XG5A 4UTAL 4KNTA 6TAAA 4J2XA 1W8EA 2ID5A 5F89A 4GRLB 4FP8H 1FAIH 4N8VB 2JQMA 5IBTH 1NOLA 4G6JL 1HE7A 5F70A 3ARRA 4G8GA 3Q44A 4OCMC 3KLQA 5HSFA 3AMLA 1JGDB 1XCTA 4UT6H 1NGXB 4M8RA 1DE4A 2QJDA 4ICXA 2UZIL 1B4LA 1YNLH 4HFUH 3VWJB 3RNQA 1MPAL 4M8VA 1EEYA 5C08A 4EQ3A 3PQYB 4W6XB 4HUVA 1WEJH 3IKKA 4LLWB 5DMYA 5I2IB 1YG9A 1X5XA 2R51A 3RG1C 1U8LB 3BZ5A 3RUGB 1ILUA 5J1AB 2F6AA 3HW7A 1JN6B 3QJSB 5C6TH 5EIQA 4OJDH 2EACA 1QSFE 5ADOL 3LQAC 4U6VH 2YPLE 5D6DA 3JWDH 1YEDA 2DIAA 2BPBA 3N43F 1R1CA 1HXYA 4NDMB 3UTOA 1CXHA 4PTUA 2ENJA 2FX9L 3QYMA 3HC2A 4RGMB 5C0AE 2K3TA 3S4SG 1A3ZA 4PUBH 4F8NA 4YC2B 1NFDB 1ZVYA 2WVVA 3QJUB 3S6CA 3C6LB 3U2IA 1W8OA 1OP3K 2KKQA 2WUCL 3L5WA 3NG5A 1CQYA 1HL5A 3EFOA 2AXHA 1MCKA 4EUPH 3GSVA 2R59A 4P9HH 2IO5A 1OP5K 3H7BA 1LNUB 1WZ1H 3HN8A 5AYQA 5KS9E 5BO0D 2LR4A 3EJZD 3CFBB 2CJUH 2F19L 4XZUB 4X8XA 3OAUL 1ZV5A 4HYTB 1IBDA 4NHUA 2P8PA 4ONHA 4XO4A 2HH0H 3D12B 4WI0B 3GSQA 4WV1B 2EC9U 3C8KA 1FZKA 3NTCL 5E00B 3NGBB 4HWUA 2ZYSA 5I1EH 3FQWB 4XC3H 3UYOD 1JK9B 1DQJA 1T66D 3I9IA 5ENWB 3P2DA 1GZHA 2FX9H 1X44A 3IFOB 2ICEB 3M8OL 1CF1A 5JR1L 4EF3A 3DSFL 3VD5A 2ZG3A 1BEYH 1SEBB 3BZ4A 3UZQB 2XZCH 4UQDA 2L7JA 4JFHE 4GG6A 4OJEH 3UYRL 3EHBD 4JQXC 3FUEA 4MB1A 1TXKA 2DYPA 3L5IA 5C09E 1PQZB 3FTZA 4OLVL 5I1HL 4PH8A 3IT8D 4TTDC 4LSRH 2C3VB 1RZKC 4P2OC 4BE5A 4OKVA 5DUBB 5EC2B 2R0LH 3CVDA 3IAPA 5J12C 4JFEB 3IDMA 4C4KO 5AG9A 1WGVA 3B2PA 4WUKH 3QUXB 4KDTA 5IVZB 3RI5K 1HKFA 3LKRA 3KLKA 3FOMA 3OJMB 4TOYL 4R0LA 3VACA 1XSKA 2GPZA 3QWRD 1OZTG 5IW6A 7CGTA 1NPUA 1ET8A 4QUOA 2EUZA 3VXQA 3PGDB 5L4IA 5L2KA 1C5BL 2HRGA 3OHXB 4XC3L 3KL3A 4HHAB 3CFMA 3QEQE 4DAGH 5LCVH 4OCSL 1KGWA 4GSDH 4MXVF 3M8OH 4O02L 4MAYB 2GBVA 3LQAL 4POZC 2FLMA 3CLFH 4HZ1A 3F3HA 3HG1E 5JW5A 4RCAA 5I8CB 1M1XB 4NXKA 1L0QA 3G5VB 5CCKH 3ABKB 3QIBC 5BJTA 5GS0L 4I1PA 2EKSB 2BNRA 4NQXB 5ITBL 3ARED 1L3NA 1A4JB 3DX4A 1CG9B 5F1SA 5GQBA 4NNPH 3L48A 2J5LB 3B2VL 3TM6A 4KU1A 1OT2A 1HCZA 4LAQH 3WDJA 4C55A 3MV9D 2Y23A 2MNWA 5FM5M 1KNOB 1IE4A 5AOJA 4TSCL 1BM3H 4IGBD 4ZUTA 1S7QA 2HXAA 5JQ6L 3SKOB 2EIZA 3FCGA 3O11B 1FZOA 1KIPB 4JY4B 2C1OB 3HB3B 5FF6B 4Y4KB 3WTUA 1U8NB 1LWHA 3UMNA 2OPCA 4JFFE 2PCFB 4LIQL 1NUNB 1ACZA 1KWKA 1TKWA 3L7FB 3VFRA 2NW2A 4B97A 1HHGB 5JXED 5IOPB 2PXYC 1DYZA 4CKQA 5D72H 4HEPA 4PGCA 3BH4A 3LOWA 5D1XC 3LNFA 1MWAL 1E7UA 4GG6E 2KT6A 3SQBA 4TQPA 3CHXA 3C09C 4W4NA 5IFJA 4ELME 5TDOA 1EAJA 2J72A 1PDKB 4LLWA 1N0XL 4NQED 5I1AA 3FO0H 4S2SB 3LSOA 5HDBE 4IIQA 4X42A 3OKDB 1ZTMA 1ID5I 4JO1H 4OCWL 1T21B 3Q0HA 4KO7A 4ZAKD 4AOFA 1MNUH 2QVTA 2N1TE 1HU8A 3TF4A 1A6WL 1E90A 4GXVL 2AI0L 3WMPA 3FB7B 4MASA 4FQJH 3HVNA 4RX4D 3G08A 2EP6A 4WLCA 1PZAA 3FYIB 3ASNB 4JVPA 2WAHA 3UG5A 3UAAA 5FHAH 1VCAA 3PHQA 4PEEA 1T89C 3VGBA 2VSDA 4LDOB 1RZGB 3STBA 1IFRA 1AOHA 4RMBA 1ZCRA 3REVB 5HYJB 1FFPB 4Z0BL 2P80A 1F3DJ 1TZHB 2FK9A 2QT6A 1L0XA 4AUYA 5E5LA 1LMIA 1MW3A 4WFFD 5DYOB 1MCOL 3FUNA 3EADA 4XCFH 2JK5A 1IC4H 3BGMB 1LO0H 4ZMLA 4PJBE 2Z93A 4ZMWA 4L9LC 1U8KB 3R8BB 3UTPE 3GIVB 4AGOA 1TSRA 3ULSA 2G4GA 2A7BA 5EOQL 3RY6C 4MNQA 4QXWA 4TQ8A 4YDVA 4XCCH 4FI6A 1MVYA 3Q6GL 4YHYC 4S0SD 1U3HD 4ABVA 4EDWL 2BS71 5BXFB 1EUUA 4W9GC 2MKWA 5MEND 4W4OC 5CS7A 4HWZA 5C0ND 2HPOA 2O5ZH 2PF6A 5L9DH 1BVOA 2VM3A 3O6FD 1BMWA 1RLWA 2NX5B 1U6AH 4LSQL 3VX1A 5BMFL 4GO6B 2ZSVB 5I8OL 2Z34A 1FDLH 3K3QA 4NN6C 4DUVA 3HNTH 2HN7B 5E56A 1RK1A 5EORH 4ZFFA 2GBTA 4IBQA 4X6EA 1G0XA 2XACC 4Q9RH 2X1OA 1EIBA 3GNMH 1PIFA 2B4CC 1FNLA 2EVIA 1AZCA 4LEEA 2DM4A 2YAHA 4M4PA 2W8CA 3IFLH 2DQGH 4XNZC 5FKAA 5BW7A 2L8AA 2ZUUA 1GTFA 1ACYL 2H26B 3QUXD 4PS8A 1KT2A 5AAMC 4GAAA 1KCRL 5HXMA 5T1KD 2K1MA 4OZHA 2FO8A 3B2XA 2PABA 3NH7H 3NJMA 5LCVA 4E9SA 5KVGL 3VVVA 2BHZA 1KFGA 4YGVB 1G9NC 3O81A 43C9A 3DGGA 1UUNA 4ODSL 4R5VA 2MCPH 2O5ZL 1FORL 1MLCA 4F9LC 1EO8H 1R3HB 2ZOKB 2J4WL 2JI2A 2X89D 4LCIL 1QBBA 3RURA 4HPYH 2VUKA 2MNUA 3GJFB 4PJAA 4X2UA 1CLYH 5IMLA 2FO1A 1Q94A 2FX8L 3EDJA 1RIVH 5E9DD 3QEGL 4KKNA 5I5MA 4KXAA 4Y7MA 4WEUD 3J27A 4GT7A 4N8PA 1A65A 3BDYH 2YEVB 5CWSA 5EMYA 3ARBB 4D7BA 1MJJB 3SGJA 4KK8C 3K91A 2LTQB 2XRAL 3ZDZF 3GS7A 5MEPA 4HMEA 4A67A 2BNQD 4HOZA 3NA9H 5IT2L 1DBAL 2BMKB 1RURH 2ZWLT 2ZUYA 3CDGB 5FLVA 3S0PA 5AZUA 1FRGH 4PGZA 3QIUC 4AK2A 1MCNA 3VGDA 4FKKA 1D5RA 4AL8L 4YAQB 4NUGH 1OF2B 4NKMB 4PJ9A 1ZVNA 5IB5A 4GIAA 1WA2X 1WBZB 5HJ3B 5DQ9A 4B9YA 1P4IH 4WJKB 1B9ZA 2DMBA 1I1FB 3FW6A 4UAHA 2EYRB 2YKLL 4HSCX 4S1QL 4W9ZA 4NOBA 1QFOA 4JGNA 3HS0C 5EF1A 4M7ZC 1QVOB 1NCNA 5AUMB 1YPZF 5E8OB 4Z7VA 3K6FA 5EOCL 3SKNB 3VRIA 3NZ8B 5FA4A 1FNGA 4AVIA 2MTPA 1T0NB 4OCRL 5JW4N 5BXFA 5DJDB 5I1KH 5BUAA 5HDWA 1V7NH 2IPUG 4KVNL 3LB6D 1NZRA 2R4SH 1BD2B 3KWUA 3ROOA 5C7XH 4HFWA 2E7MA 3ARGB 5EZIH 3HG2A 2F8VA 1E6JL 1WE5A 3FTWA 4UTBL 1JPGA 4JO8A 4OTXL 4V1DB 4QF1A 4MX7A 1FFOB 1EFXA 3HG5A 3ZUCA 5FHBH 4E0RB 4JG0L 5F6IB 3AGWA 4DGVH 3S9DB 5IROD 3SJVA 1S7SB 4I2XA 2JWYA 4BZ1H 4NS0A 3VXRB 5EO9A 4P05A 2WGXA 3NYKA 4NZTL 2JB6B 2HJKA 2OI9C 4KV5F 1G1CA 3SDAC 4W81A 3THML 1XXFC 1Z9OA 2UZYA 1F6FB 1Z5LB 3D4GA 5F7DA 1E4WH 3VXUD 2LFGA 1QRNE 2YKLH 1G9NL 5ELIA 1WD8A 3ARFC 3MRDB 1R5WB 2DDQL 3QIBB 4Y4HB 1YPZA 3QW9A 3NCBB 1TVBA 1TJXA 2Y22A 3RZCD 3TBCA 2H0FA 5JOFB 3MJ9H 1UCBL 2R83A 5D9SB 1W72H 2CALA 5CJXA 3MA9L 3Q3GA 5F1IB 4Z3GA 1A0QH 1R24B 1EMTH 4DKEL 3E6HB 4DP1X 4N6RB 4E41B 4X5RA 3TFKD 4YK4C 2CLRB 4N2BA 2ZNXA 3LIUA 5JUEH 4LE8A 4H8PA 3VXMB 2PTUA 2FD6L 3SQBB 3IU3A 4X7TA 4C56D 1AR1C 5CJOH 4WDIB 15C8L 1EWHA 2OMUA 2C9SA 4HKXA 5HHXH 4K8RL 1BFTA 3LEVH 4NRZB 1OKEA 1AGBA 3UAFA 3CCHB 1XH0A 4G43A 4U4IA 3GGWA 4LHUD 3UTTB 1P9MC 3CSGA 4Y4KA 4JRXB 5I75C 4O5LH 3W82A 1QP1A 3DTUB 1HX0A 1FZMA 1U91A 3KEHA 2VWEE 3WD5H 2I27N 3GWJA 4M1DH 3DUUA 3QARA 1CS6A 3W39B 2JKLA 4H0LC 4ABUA 1PPIA 4J39A 3BIBX 4EE2A 3VFOB 4DGYL 4RGOL 4GI8A 1KJ2L 3RZWA 1Q9WA 2ODHA 2X1PA 3OKEA 2X70B 3EYFA 4R3SA 4AYID 3L13A 1AHWC 3MRRB 3T4AC 3FSAA 2AVFA 4GW1B 4N0UA 5F9JA 2PCXA 5E08L 3NCXA 4P2RE 1G7QB 3INUL 5DVOA 2C7FA 3HZVB 5L8JB 2NR6D 5B3JF 3CSYA 2FCBA 4YHIA 5CBAB 1KTBA 2H4EA 5FGSA 2UZPA 5AL0A 1CF8L 1FNAA 1AR1D 5K39A 4HHAA 1X5GA 5L2JA 4IBWA 3ARGD 2WWKO 2A6DA 4KZ0A 3GLDA 2R1YB 4DP9X 4K2UL 4APQA 2IH3A 1VZHA 2Y36L 3BUTA 5DK0B 4ELMF 2Y24A 1UXWA 2ZXDA 3NJIA 1D5BB 4NFCA 4H1LB 1QA9B 3F7PC 5E5UB 5DQJA 2WXNA 4FXKC 4JQIA 1VEOA 3GMLA 3LNIA 2AVGA 1N5YL 3H9SD 4JREC 1MCPL 3OMNB 4LEXL 3GXFA 1KZQA 1CLOL 2NY6D 4GRWB 5HHQB 2H0PA 1MEXH 2DLFL 3F7YB 3TJEH 1CFSA 3M45A 1P6AB 3ARFD 4F7MB 1XB8A 1EA9C 2IAMB 2OV0A 2Z7YA 3HR5A 5DS2A 3OKEB 5L8LB 4NOFA 5J1TC 1IL1B 1O0VA 3G7TA 4P23C 1CIDA 1MRFH 4OZ4A 3OJDA 1NFIB 2A9MH 4N85A 4Z7NB 4OFQA 1SEBA 3BZ4B 5H2BB 1HVXA 4OUUA 2P7TB 2RFXB 3GB7B 5IHLB 4ZX4A 4ONFL 4OZFA 3GXMA 5C0IB 1ZV2A 5T3ZL 5T5FH 4IBUA 5ID0A 1P5UA 1BM7A 1AGEB 4R2GB 4CSZA 2CRIA 2YQ3A 1ZTXH 1DQJB 3NJVA 4XOEA 3WIHA 1MREL 4OV6F 1GGTA 4HKXB 3GI8L 3GB7A 2KLRA 3QWOA 4CU7A 4GXUN 4OD1H 1S8DB 3F7RA 4NC0B 1HJBC 1HWWA 3L1OH 4XE5B 3IU3B 4X7TB 1OAYH 5EF0A 4Q9QH 3WKMH 1UM5H 2P5WD 1B4TA 1PFOA 2WSDA 4GI6A 4ODWA 4PTTA 3KCPB 4HS8L 5E4EC 5HYJE 4QLRA 4UT7H 1I9EA 4WZ9A 4XN2A 3TH3T 2MQCA 2APTA 5IQOA 1LNUA 1KGCE 5CR8A 1MFEL 4E41A 3RWJB 2HFEA 4X9FA 4OLWH 1Q38A 3H9SA 2F1BA 1S4IA 3GINA 3WEMA 4PLNC 2XTJC 1NFAA 1YN7A 1CN4A 3LJ3A 1GAFL 1S2EA 1TVHA 2EC9T 1EEUA 1D5ZA 5CHNB 4OB5L 1OANA 2K78A 3HMXA 4X4XA 4ODVL 1HXYB 4NDMA 4DIXA 2ADIA 4WU5B 1I9JL 1UM6L 5KZCB 1ID2A 4ORGA 1OGAB 1EBPA 1INDL 2GG1A 3GHPA 4S10A 1J8HE 2V5TA 1WFOA 5D7LB 3RWGB 3K2UL 2E7CA 3JXAA 5CN3A 4BCXA 1GGIH 3SKUD 1SLXA 4MA3B 4EXKA 3WUWG 1DJSA 3FFCE 4FA8A 4F15B 1CICC 1U8OB 4BK5C 2Q8AL 2YD2A 3NFSH 4YDKL 1JBJA 3QR1A 4LCCB 1OAXL 4JJ5A 4XGZB 3AM8A 1JS4A 3F7VB 3VWJD 1T1XA 4LPTA 4N90D 1JGDA 5BV7L 3CFNA 3BWAB 2FX7H 1I8KB 3D3VD 4G8EA 4AVKA 5F96L 3HI1B 2Z31D 5EWIL 3G5YB 1DQQA 3L81A 4U49A 5CKAA 4ZK8A 1G6VK 4XI5C 2B1HL 3WS3B 1AACA 2I85A 1FCGA 4ISVB 2QGDA 5IV2A 2QKIA 1XSJA 1FL5B 4POZD 3NEEA 4ZYKA 3S8GB 4JANA 5BVPL 1AVAA 5E5MA 2ITCA 4IBSA 4OIIL 1INDH 3QZLA 3SJVD 5B3NA 2X6VA 1X6LA 3KD4A 3UL4A 1KELL 2F19H 5I16A 5K9QI 3NCEB 3SQOL 4N2IA 4OKDA 5IBUG 3II3A 2BRRH 4HIIA 4U3HA 5F0PB 3NABH 4MA1C 3IKCB 4BZ2L 4KTEH 2ZXBA 3B6SA 4URKA 2V7HB 3MC0A 4U7MA 4Y4HA 3Q01A 3VFMB 3TVMD 1F00I 1WTGT 4BFIB 3ZZQA 5DHYB 2XPGA 2J7LA 1P53A 1R9FA 1UUSA 2NY1D 3MLUH 1ZJAA 4ZAKB 5C0NC 5E99L 4Q0XH 1U93A 2ITEA 2QKSA 1NICA 1IC7L 1A8JH 2V8LA 1F86A 1MCJA 3MLZH 4Y4HC 3OX8B 3PWVA 4RAVB 3EYOA 4OAWB 1CDGA 1AQ8A 3L3IA 1E67A 1GGCH 4X9HA 1NCCL 5HVWA 5TH2B 2QHRL 3Q9PA 3DX0A 3FPXA 5EZPA 4FQQB 1ZA3B 4XP5H 3ZBMA 2CXGA 2FBOJ 5E03A 4RGND 2I07B 2MTAA 3RWFA 1SZNA 5KYWB 2DTML 1EZLA 3GMPA 1G9MC 3LQZA 1H8SA 4IHOB 3QNYA 2ZD0A 2LABA 5BRZA 1AKPA 5EU5B 3UP6A 4HGWB 3MOBH 4QHPA 3MV7E 3ZGHA 1SFHA 1EEZB 4NQDD 4PJCB 4X8JB 3KNBB 4E9VA 2QBWA 4ERSL 2FNWA 4Z7VB 3CFQA 3N04A 4NCC2 3U9WA 5J13B 2VR8A 1RZJL 2CD0A 2DLGA 4CMMA 4HKJB 2FT7A 2ZUWA 3EG9B 1GS6X 3VRLF 4HAFA 4HJ0D 1L6ZA 2DV6A 4M7LH 4TULH 2JI1A 2J1YA 2JJWA 1SJEA 3LRSA 1CFNB 2MIZA 4M5TA 4QNPF 5AZ2L 5C07A 3WN5C 3H9SE 4YJZL 3MSPA 4OCYL 4EKJA 1WRFA 4F9PC 3LIZL 1BOGA 1L9QA 2XOTA 4OW6A 4HAKA 4PWHA 3PWNB 2J20A 4YPJA 3ZQ9A 2EICA 2KMWA 1S3KL 1KIQA 2FJGB 1GPOL 3ZL1A 2NT0A 1UZ8B 3DROB 2HVKB 3LN4A 1WSST 5M94B 5KYYB 4KXDA 5D7HA 5BPPA 1PY4A 3DYMA 3V0WH 4AIZB 1L3WA 3LD8B 3UROR 1P0SE 1BQRA 1SOQA 1J05B 3UBXG 5CIPH 1KY6A 4MJID 3GXPA 3ZRSA 1VRSA 1U95A 3U0PB 1J9CT 4EIZC 5E4OA 5C2BH 4XPHL 3SYQA 3EFFA 3D08A 2HUHA 1X5IA 2GY7B 2YRPA 4TNEA 4C8XA 1UZ6F 1CUOA 4OGQC 1SEQL 4FTVE 4Q4IA 4D8PA 4OLUH 4KWUA 4QPEA 3JV4B 4JPIB 3EH4B 3G08B 4G9DA 1KLFA 4XMPL 2R0WH 3OTTA 4XOAA 2VC2L 3KS0H 3WO3B 5F6HI 2B0SH 4KXBA 4P46D 3E8VA 1R3JA 4YVNA 3ZHNA 4XPGL 5AB9A 2Y3AA 5FECB 3H55A 5E7FA 3QH3A 4G7VL 3QRBA 1PDKA 2CH8A 4RMSA 5KTEL 2DM3A 2TSBA 4FABH 3UO1H 1S7VB 1T3FA 5GZND 2UV3A 4PJ5A 1S7TA 2HFFA 3NZUA 4YSAA 1G43A 3FT2A 3HCVB 3NIGF 1HEZB 3ZDXE 5TE6L 1J86A 2AQQA 2J5WA 1YY9C 2XQYK 2NY6C 3BP5B 3OQ3B 2DQCH 2ARJQ 2NCEA 3VFPA 5H94A 4P59H 1M71A 3TWCH 4PG9B 1U9KA 3O11A 4JY4A 1T1ZA 4NNYA 4MZRA 4CC1A 5E4EB 4OV5B 3OLEA 1S7QB 1S7UB 2Y2YA 3BPNB 1QFWM 4HCRH 3AABA 1ZJBA 5C07D 2ROXA 3BZDA 1QHOA 2OSLA 4FQXA 3IN0A 3N0PB 4TUUA 5IB1A 3Q8FA 4AV0A 5HBBA 4PRPE 2VDQH 5GJSH 5B38A 2P5PA 1G9EA 3WU1A 5I16B 1N3NB 5SWZB 1ZGLB 1CFNA 1KXTB 5F44A 3F58L 3Q6FB 5DYOA 1CD8A 1FDLL 1VB9A 3BD5A 3GSWA 4K71C 1NDGA 4MD5B 3MJGX 4QR7A 4WO0A 1XMWA 3EG9A 1HL4A 5ALBL 1GSKA 3T0AA 4FNTA 2YAMA 3DJZA 2DMGA 2IWEA 3TL5A 3K4ZA 3P4LA 1BOYA 1QHPA 3OAYK 4HF5H 4XX5A 4PJAF 4EMZA 1QUNB 1RI8A 3CZKA 1GC1H 1YMHA 3UG3A 3U4BL 3CN2A 3V52L 3QUKB 4FQPA 5TD4A 2Q7YB 3BN3B 4AWJC 5A2JH 4LVOB 5IQ7L 2Z7ZA 4KKAD 5TDPA 4J28A 3WGUB 4HZAA 4OKVB 4UZSA 5EC2A 1H3VA 1G5AA 4KTDL 4ZFGL 3QXAB 4JW3A 2NZ1A 4MA3A 1DJWA 2QPEB 1WFUA 4WVRA 3ZTNH 2EXTA 1FQ9C 5D2LA 4R0LC 1A7PH 1MI5A 4G1EB 3CLFL 2KZWA 4FZEL 4NX0A 5JHDD 1A4BA 4YHML 1QASA 1DBMH 2ZX7A 1J9QA 4DN4L 3KPPB 4TQIA 2XWDA 1U8IB 3D06A 4FQXD 4R7VA 4X80L 4ALAC 1NKGA 5J11C 5IG7B 1ZOXA 1DJHA 4DQOL 1KV3A 3QUXC 4PJ5D 5E70A 1S78D 3I9GL 3AMKA 1OB1A 5AQ0A 2QSCL 4DP5X 1J8HD 4JGJA 2GJPA 1VFAA 3RA7H 3QUML 4GO8A 4B5ZA 1M3IA 1UT2A 2RB8A 3R0NA 3KJ6L 1JXFA 1CFTB 3B43A 3A