3QORA

Crystal structure of human nuclear migration protein nudc
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
120
structure length
119
Chain Sequence
GSSSKLKPNLGNGADLPNYRWTQTLSELDLAVPFVNFRLKGKDMVVDIQRRHLRVGLKGQPAIIDGELYNEVKVEESSWLIADGAVVTVHLEKINKMEWWSRLVSSDPEINTKKINPEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Nuclear migration protein nudC
publication title Structural Features and Chaperone Activity of the NudC Protein Family.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding, cell cycle
total genus 28
structure length 119
sequence length 120
ec nomenclature
pdb deposition date 2011-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04969 CS CS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3qorA00
3EUDA 4I88A 1WGVA 3AABA 3QORC 1SHSA 4ELDA 5DS2A 2RH0A 2Y22A 1WH0A 1RL1A 4YE0A 3GUFA 2Y1ZA 4RZKA 2MNWA 3L1FA 2KLRA 4FEIA 4M5SA 2CR0A 3VQLA 2O30A 3J07A 3VQMA 2XCMC 4ZJ9A 4JUTA 3Q9QA 5DS1A 3N3EA 2JKIS 3GT6A 1EJFA 3GLAA 2CG9X 3AACA 4JUSA 3QORA 4MJHA 2WJ7A 3QORB 3W1ZA 1WFIA 4YLBA 3L1EA 4PBDA 3QORD 5LUMA 2N3JA 4YL9A 3Q9PA 4YLCA 2KMWA 2N0KA 2Y1YA 4YDZA 1X5MA 4M5TA 3IGFA 4PCKA 3L1GA 2K8QA 2WJ5A 2BOLA 1GMEA
chains in the Genus database with same CATH superfamily
4IBLT 1KBGH 2P26A 3OWEA 4G1MA 4TPRH 4Z95H 3EOTL 4GRLB 1VRSA 4ZAKB 3MJ7A 1LO3L 3OL2A 4UQ2B 5AKVA 5D4JA 3HZKB 3CDGA 3ULUH 2DQFA 3T1FA 2AV7B 4N0RA 4Q58C 4EN3C 1GVIA 1BVKB 2D3JA 1V3JA 2W9DL 1KCRL 4F1ZA 5HYQA 4MHHG 3RNQA 1ZT1B 4PRIB 1EBPA 1D6VH 5BUPA 5IKCA 1WBZA 3T8VA 1K3IA 3R4RA 4HBCH 5IT2H 2PTUA 3OXSA 4TVPL 2BHFA 1V5JA 3AG3B 3E8VA 1EHKB 1J0KA 1JPEA 1LO0H 5F9JA 4RQQB 4WJ5B 4JB9H 4P0DA 5EU5B 4BCXA 2FX7L 1JGLL 4G1EA 2FQGA 2VDPL 3ZR5A 3H3PH 1OP3K 2CCWA 3F65A 3CDZA 1TU2A 1X9UA 4TOYH 1KBKA 4XN8A 1ZHBB 2KPWA 2OI9C 2R4RH 3D34A 4FGMA 4NN5B 3O0RH 4P2AA 4JY6A 4PV8B 3QIUD 4MKTA 3TTYA 4X9FA 2Y1AA 1JXFA 4MAYA 4KQ4H 1QLEH 1RZIB 5DEGA 4X6CB 2WC7A 4N87A 5CZRA 2J12B 4JDVB 4XGZA 1PZCA 2YK1L 2H0PA 2FSEB 1RUKL 4M1DH 5E94B 5L2KD 3GBNH 2BOCB 4QRTA 3FRPG 4P5KA 1KXQA 1NGWA 4QHUA 1GZHA 4PJHE 4PJIE 4ZXBA 1UUNA 1XCTA 1UURA 3X3GH 4K5OA 3LD8B 4Z78A 3IEAA 1E42A 5J13B 2Y2YA 4OR1A 1HIMH 1CVSC 3PAUA 3WS3B 2BWQA 2IH9A 1SLUA 2WWOA 4KTDH 4CADB 3O3DA 2PCXA 1U8KA 2EXSA 2EQDA 3ZZ1A 2OA9A 4G42B 3T8XA 1DEDA 5CIPB 4XCCH 4QRSB 2VR7A 1PMYA 3HR5B 3S4SA 2Z93B 3DRTB 4P46B 2EIJB 2OMTB 4POUB 5EG6C 4RBPK 1DVFC 4Y4FC 1TITA 4W9KC 5EBWA 2FH6A 4ADGA 4AM0Q 1BZ7A 2NY4D 4BJLA 3NACL 4WY7L 4YHMH 3W2DL 5TE6L 1TTGA 1BLNB 1BJ8A 4MD0A 4PTTB 2NY2D 3T0VA 5J9PA 2BW5A 4B9YA 1XTLA 2ICWI 3AABA 3C5XA 4NHUA 3U9UA 4EI5A 2BDNH 3THML 1DEEB 3O6ML 3UO1H 1B4RA 1VKXA 5B7FA 5D2NC 2E75C 4YR6A 3ZTJG 3ALPA 5E2UL 4NFBA 3DI3B 1RJYB 3L3OA 3LB6C 5F89A 1HHKA 2PR9A 2D7OA 2EE6A 4IEFA 3HS0A 5D6CB 2DM3A 2VDLL 2VXTH 2VC2L 3PDDA 3LS4L 3BAWA 3GEFA 3ILQC 3VVWA 1RZGB 2F8IA 3LZFH 3X3FH 3DRQB 1O5PA 3NGBB 4WTQA 3MA9H 4OUOA 4IK7A 3WLBA 4PRDB 5LQBL 4DZ8A 2MJWA 1A14L 3ZK0A 2NW2A 2AHIA 4LCVA 4EN3D 1T2JA 3V0VA 1A1NB 2R56L 3KPRB 3WUWB 1NWPA 4AGOA 2X3BA 3RNKB 2Y07L 4KROB 3EYVA 2E5EA 1LO5B 1EHNA 4FQ1H 3STZB 4MD5B 4JFDD 4ZX6A 1PNCA 2D7TH 1ROCA 5D70L 5IQLA 4N3UA 3VRJA 3G5XA 1S5HA 2N0KA 2R27A 3GIVA 1I31A 1OW0C 4KI1A 3ZT5A 3SGKC 4PW9A 2ZXGA 4PV1C 4F2FA 2JKNA 3VNYA 4AWJC 4I1RA 1QFWH 1C5CL 3KAAA 1MCOL 1U92A 3GMMA 2BP5M 1UJ3B 1TVBB 1X5GA 2XTLA 3LRSA 5E0FA 4RAUA 3HE7A 5D7LD 4G6FD 3ZHLA 2BSBA 2F1AA 1U93B 1DDHA 3TV3H 5L8KB 1UWEH 4YX2L 1N5YH 4W9CC 5K9QI 3ECVA 2XWDA 5T8IA 5F88A 1YNLH 4JDEA 3TTSA 1KTDB 2WBXA 3PV7A 5IBLD 3BUTA 3RPIA 4KTYA 5JQ6L 1IC4H 1RUQH 1A6ZB 4H7VA 5FKPB 4P59H 4DCQB 3VI3B 5FUOL 1R0AH 3QHFH 2P5EE 1FGVL 4K23H 4L4TA 3C09B 4XNXL 4N2HA 3S2AA 2ZWSA 2H0EA 1BW8A 1OLZA 1AMXA 4JFXA 1KOAA 2WVVB 3LNDA 3MRNA 3P4NB 5E2VL 1HI6A 1ZE3H 3PL6C 2BPBA 4QYAA 5LN8A 1CR9L 2ZUUA 3HRZC 4KHTL 1YPZB 4LEBA 1KCLA 3L17A 3SDAB 1UOLA 2ZCHH 3QO1A 1O0VA 1DJHA 2JKLA 4WNQB 3DPDA 4NQDA 4X4ZA 1UT9A 1D7FA 2E7LC 4Y5XA 2AJUL 3V8CA 2EINB 4HS3B 1DVFD 3PUUA 1WGOA 5B3NA 4IMLA 2I9TA 3HHMA 3JSSA 4Y2DC 3VDAA 4IKNA 3SPJA 4Y5VC 5LAPA 4JRLA 3B2MA 2AJZB 2L7QA 1QO3B 4LRNH 4WU5A 5I6XC 4JPKH 4WTZA 3FHAA 1NCBL 2A4EA 3DUSB 2FQEA 3UC0H 5I1HL 2HG0A 3I3BA 4A2GA 3QWRD 4A2DA 3IJEB 3MRRB 1MJJA 4F58H 1ACCA 3AM8C 4S2SB 3ZL2A 1XCQA 1E4JA 1JRHI 3RY6C 4XVTL 5EIVA 4GAAA 4OCXL 3LB6D 4I3RH 5BNXD 4YE4H 3PWNA 3GJFK 4IRZH 2R1XB 2Z35B 4WHCA 3F7KA 4OZIA 1FCGA 1XGYH 3K2IA 1N64L 2X0VA 3MJ9H 4J8RA 4UILH 1A02N 3ILQD 5JIDA 1EJFA 5SWZD 1IFHL 2EDBA 5ACMA 5TPWL 2IALB 3BAKA 3HI1A 3VRLE 1OF2B 3IJYA 1YNTA 3U83A 5AWNL 5JPNA 4OLYH 2DIEA 4HU2A 4NWUL 3C8HA 4PRHE 2UY7A 4DESA 5D4HA 3U0TA 4X4YB 4TSAH 2VDMB 5DJ6A 3GBMH 4X5LA 2OMXB 4O02L 4CGUB 4CNIB 2VDRH 1II4E 1ASPA 2VR6A 4IRJA 1P6FA 4G8FB 4K7FA 1G7MA 2AAAA 1CGSL 3EAKA 4ISVA 5KSUB 1V3LA 5INCA 4FZ8H 5KOVC 4HK3J 2LE9A 1N12A 4NQEE 4BH7A 2D0HA 5CEZL 1FNLA 5I76B 1C08A 4DPAX 2IAMC 1YEGH 3W1ZA 1U8JB 1G4RA 1OSPL 2Y6TE 5HYJD 3AB0B 4ADIA 2AV1A 3WEXB 1CD1A 3D85A 3NIGE 5DI8B 3QDMB 4U1KB 3MNVB 4AUUA 1J1XH 1PPIA 2WLIA 4J23A 1S7RA 3F2LA 5E8PB 2W38A 4G6JH 2C9AA 1UEYA 1BVZA 4G1MB 1DVTA 3WELA 4UTCA 5D72L 2EDLA 1WQVT 2DLEA 2H4EA 3MJ7B 2VDNL 4JMXA 3QSKB 3I2CL 2DQFB 2NT1A 3T1FB 1G5AA 2W88A 1KEML 3PDGA 3VD3A 4A68A 4DAGH 3CG8A 2Q76A 2VR4A 1TJIL 2XY1A 4G80A 1PD6A 4JFOB 3N40F 1WFJA 5LCVH 1JVLA 3GI9H 3UX9B 3RNQB 5AAMC 1K5NA 1ZT7A 1TF4A 5IKCB 4NERA 1WBZB 3VU2A 1RUPL 3BSZA 3EGSA 2QPEB 4EBQL 1N70A 3OXSB 5CKGA 3SYOA 2VDKL 3IFLL 2ZX9A 3RAJH 2R0KL 3HJEA 5F9JB 1NLBH 3ESMA 3CU7A 5E03A 3ZYZA 4V33A 3FFDA 4HMCA 4G1EB 3ZL1A 1G6VK 3L08A 5AOKA 3UTSA 3PL6D 4GUCA 5F9AC 2G0KA 3P2TA 3HFMH 1DVXA 4ONGH 4XNQA 2JCCF 3QQ3A 3CDZB 1TU2B 4U6VH 4E42B 3HBPA 3TBWA 4M8QA 1MFCL 3DGGA 5HDLA 3FQTA 2ZP0T 3IDXL 4JM0A 5FWQA 4JY6B 1Y7VA 2ICCA 3QPKA 1CDJA 4N1CA 4MAYB 3AAZA 2XJLA 4Z9KB 5DEGB 2KT6A 4Y2DD 5JXAH 2ICEA 2OL3H 3VSUA 4XGZB 3WFEH 1B4JL 2DLGA 4F5CE 4Q6IB 4KFZC 5D8JH 1MOEA 3H7LA 5L4IA 4QRTB 2BVEA 1OSYA 1NGWB 3L5IA 1BF2A 2LLLA 4QHUB 3T6QC 4UV7H 3A23A 4G71B 3F04A 1XCTB 3Q48A 2DL9A 1HQRA 2CQVA 3APCA 4Z78B 4IIQC 4KO6A 4UQ3A 2CBTA 3B2DC 4LSPH 3QZOA 3U2JA 1Y6MR 4HZAA 3ESOA 5CP7A 5BRZD 4C4BA 1W80A 1DBMH 3FRUA 3AC0A 3KR3H 4OKVB 1RFDH 3O3DB 3LNFA 4YSPA 2J4WL 3VFGL 2H47C 2B1HL 1U8KB 1XR8A 4PJFF 2KKQA 2WYTA 3T8XB 5E6IA 1MN4A 1EFXD 4BA8A 2EUWA 3I6SA 3L3HA 1JZHA 3V0DA 5LBSL 1HCZA 1CGWA 2JKSA 5C0IA 3S4SB 1E65A 4ACTA 1MUJA 2WKGA 1N7MH 4G6AC 3D39A 3GM8A 4UCFA 5DFTA 1YAIA 3CK0H 4X9HA 3D3VD 2GUYA 4FNTA 5EBWB 2LFEA 3HNTH 1HYSC 1BZ7B 2UVFA 4PJAA 2D3NA 1A6TA 4K5LA 5AFAA 4MD0B 1ZVYA 1XT5A 3LNIA 3TA3C 1XD0A 2OX5A 2X9XA 3QJFA 4F15B 5J9PB 2GJPA 2Y3NA 2DB8A 5D7IE 3U9UB 1UZ6E 4NHUB 5BV7L 3DSFH 4NO0A 4EI5B 4YOKA 2IAMD 3DDFA 5DHMC 1VKXB 2OXGA 4QRRE 3CXHJ 5GXBB 4YR6B 3US9A 1LO2L 5EEWA 1U91B 3H9YA 5HPOA 4LPWA 5F89B 1HHKB 5DUPL 3L16A 4LOVA 1YQVH 4IEFB 3HS0B 4OGYL 1P7QD 5CR1A 4EI0A 5IQ7H 3W5NA 2EDEA 4Y2LA 4MGXA 2WQ8A 3IFNH 1WCQA 3VXSD 4Z3GA 1OOAA 4MS8C 3M46A 3SIKA 3BWUF 1DBJH 4OSUH 1MAMH 3WLBB 3FQYA 3HLKA 4JEGB 2DYPA 4DZ8B 2NW2B 5JOFA 4JVUA 3V0VB 4HMDA 5EZPA 3KHOA 3QUYC 4L4VD 5IB2A 4O2FA 2WN2A 2PO6B 3N9GL 1JGDA 4Z7AA 5I73B 4UT7H 3WNOA 2K7PA 2AQRA 3EYVB 4K3DH 3HCVA 4ZT1A 4P5SA 4MDIA 4MCYA 2DEWX 3IFPB 4K7PH 5GJTH 2NSMA 3IDYC 2YA2A 1HE7A 3Q9PA 4AUYA 3UG5A 3G5XB 1S5HB 3GIVB 4FCHA 4H1LH 4WI4A 1NFDF 3RTQA 3T6XA 1QZ1A 1DUYA 4GSUA 1I8KA 3BCDA 1V05A 3DX4A 5T3XD 1NC4A 4NI6A 1A4BA 3QORC 4FQCH 1FNGA 1U92B 3GMMB 1CK0H 3LRSB 4RAUB 3HE7B 3KL0A 3MRHA 1DDHB 3F8UB 1TJGL 4DGIH 4EZJA 3MTXA 7CGTA 4LZKA 4PJXE 1LQSR 4IDLA 5J6SA 2F5AH 3MKGA 5EEXA 4RISL 2JKTM 5F88B 4JDEB 2OQJB 4KKAD 2FAUA 2IV9A 5F7EL 2XN9A 2AEQL 4W9IC 1G9ML 3RPIB 2P5WA 1NOAA 4R96A 3ZE2F 4F20A 3E6FA 3C6SA 1WWWX 5T3ZL 3KGSA 1Q9WA 2FBOJ 4PGEA 3KVPA 4L4TB 1ZDQA 6TAAA 2F6AA 4JRFA 5EA0L 2ZYIA 2GC7C 2R29L 3KL5A 2WAQA 3OWRA 3MZGB 4HAFA 1UB6A 5MP6H 2F1EA 3NPSB 1ET7A 4MCNA 5J0BA 1OPGH 3ZOAA 3S8GB 5I23A 3ABLB 3MRNB 3CMGA 4KDTC 2R1YB 1HI6B 3AY2A 2W9EH 2P43B 4MA7H 1BXAA 3NA4A 2CALA 5H37A 1FC1A 1NUGA 4CU8A 3QO1B 4CMHC 1UZGA 4NQDB 1H5BA 1YNKH 4G6AD 4Y5XB 3MLUL 3W57A 1BOYA 2CGRL 4IW4C 4JFZL 3IPBA 2H5UA 3SDXE 4ATTA 4IMLB 3UPRA 1HYSD 2I9TB 1ND0A 2CM6A 1IC7L 3TA3D 3BSGA 1A4JA 2NDGA 4J3VA 3ZYOA 3V5KA 4AITA 4WU5B 3UZVA 1A7RL 1LVEA 5D1XC 1H19A 1TZIA 5IHUH 2N7AA 4Y9BA 3B34A 2H7WA 4K5MA 5M7QA 1MJJB 3CC5A 5B1JA 3Q1EA 1GIGL 3CSFA 4HPHA 1QVOA 3F58H 2R59A 2AP2A 2OMNA 4FLHA 3U4EA 1R6VA 1D9KC 3AJ7A 3PWNB 4LKXA 1JG9A 3E7JA 1CZ8L 2X4SA 1ETA1 4XR8C 4OZIB 2Y7SA 3TBTA 4DQOL 1SUHA 4H88H 1E4KA 4J8RB 3QUXA 3HI6H 4F7TA 1RY7B 2HLEB 4IMKC 4MS8D 3WFCL 5I1EH 1QW8A 3VB8A 3HI1B 3UAAA 5SWQA 3IJYB 1YNTB 4EDWL 2J73A 5JPNB 2YAPA 3L54A 2P80D 3T3MF 3FF8A 3QUYD 2UY7B 1HXKA 3U0TB 4U0RC 4ZW8A 5DJ6B 5JIHA 2A1WH 2WV3A 4IRJB 4LIQE 2MTPA 1NQBA 5ALCL 5L2KA 1PZBA 1G7MB 4KAQL 4U7SA 4PVMA 4Q0XL 4Z3IA 4XVUD 2VDQH 2GIXA 3FBKA 4ISVB 1QATA 2PWHA 4M02A 5INCB 4GRWB 2OMUA 1IZJA 4OZHE 5FYJU 2OCFD 2V9UA 3MMEA 4BH7B 1R4XA 3ARVA 4DF9A 5L4FA 1YUKB 1C08B 2C3XA 4GY4A 3VFRA 4JFDE 3QORD 4HUVA 1E67A 1BQKA 2AV1B 4L8BB 1CD1B 1TQSA 3A22A 3D85B 4OTXH 4TLKA 4LB8A 5G4MA 4YHZH 2WLIB 1W8EA 4A7SA 1S7RB 1EHLH 4W6WB 4Q6KA 4ZW3A 2BRRH 5CXPA 3MHZA 2SODB 1MCSA 5I75C 5FCSH 3FUIA 4LE8A 3S88L 4RWYL 1I7RB 2EH8H 5HTSA 1ZWIA 3TIEA 5JR1L 4FYRA 4X98A 4ZNCD 2YD3A 2EXYC 3WFBH 1MCJA 3OB0K 4TUJA 4B7IA 4G80B 4XCNA 5HDBB 4YSQA 5F1NA 2EO1A 1OAQH 4XMUA 3EOAA 2I5YH 1K5NB 1VFOA 1ZT7B 3K4AA 1FF5A 2OTUA 3EGSB 2BS71 1BVNP 4DKEL 3RIKA 2AXGA 5ESVA 2EE9A 1J0YA 1JZEA 1R3KA 3CTTA 1EFQA 2OM5A 4BKTC 4M7JL 4JFPA 4OLZH 4XPFH 1HAWA 3DX7A 3FFDB 1W0WA 4K8RL 5EMYA 3UTSB 5BVPL 1TR7A 4PEEA 1TTAA 4XNQB 4Z7NB 3GINA 2VERN 3HW7A 1ZIBA 4LFHD 3VG0H 3TBWB 3DGGB 1XXFC 2AGJL 2RBLA 1E0OB 3FQTB 4PGDA 3UBGA 2D03L 4PCKA 3TNMA 1I9RH 5EWIL 4B27A 1Q72H 2IGFH 2EKSA 2VW4A 3AAZB 3DJSA 4EIUA 1YEDA 2V5RA 2ZWKA 1YMME 2VZVA 2DLTA 2ICEB 1W9XA 1SXCA 2WO3B 4J2XA 2QVIA 1EX0A 5ALBH 4DZBA 2O1AA 3PRZA 1A1MA 1CFVL 1P4BL 5D1XD 3ZO0A 2ZOKA 2DQCH 1K85A 3OG6B 3VAEA 2WGXA 4NN7C 3DO7B 4HZLA 4MB1A 1UKSA 4A6YL 5C0GB 1X6NA 4PRBA 3M86A 4XN1A 1BV8A 1HQRB 2WLZA 4WW2C 2BM3A 3MACH 2ENSA 2Y23A 1MJ7L 4UQ3B 4POYA 4BZ1H 3JWOL 1O75A 2QVKA 1N6VA 4JFYA 2DTMH 2DQUL 3FRUB 1FFOA 5D7LA 3OJDA 5CJBA 4TUOA 1MIMH 1XR8B 3ET9F 5MENA 1QSVA 3MODH 2FQFA 2PP9A 4GW4B 5E6IB 1TNMA 4MSWA 2WXPA 1L7IH 1KYOK 3S37H 3P3TA 2AK4D 3WFDL 3L3HB 1HOEA 3LYRA 3V2AR 5F44A 1UTDA 8FABA 2QVFB 1MPAH 5HVFB 5C0IB 5EUOA 5SWZE 2EDDA 2E56A 1MCPL 1MUJB 1O7DE 4IJ3B 3D39B 3GXFA 4L0ZA 4Z7WE 4PJGA 3LPPA 2FO8A 2NSXA 1NLDL 4N0UE 1GYUA 3BX7C 2WLMA 3CN0A 1A6TB 4PJAB 1OE3A 2E7CA 2OX5B 4HXBL 3QJFB 5A2CA 4QRQB 4B0MM 5LDUA 3BZ5A 5IQNA 5HDOA 4NO0B 3EYFA 2DYSB 5GGQL 3LDBB 3I3EA 1UA6H 2Q7YA 1YMHA 2OXGB 1KIRA 3ZDZF 1JF1A 1CD0A 2JKIS 2WOYA 4HIJA 2CHWA 1LK3H 1V7MH 3CFIC 1ILUA 2F18A 2ZG2A 5TF0A 1FFNA 5HYJE 4U4BA 1ADQA 2YLKA 2FJSA 5KZCB 1QEWA 2F15A 4OH2A 1KV3A 4EN2A 5FM8A 1AKJB 4K94H 3VDBA 5GS2D 3BKJL 1JZJA 5K93A 2FB4L 4Y4FA 2DYPB 3VFVA 5KVMC 5JOFB 3LZNA 4X7FC 1F3DJ 2EXYD 5IB2B 1OARL 3IDNA 1QKZL 3N44F 4O2FB 2IDFA 5HGDA 1JGDB 4HULB 1A9VA 1IJNA 4BQBA 4FXKC 4HCIA 3HCVB 3VI4A 3ZE1F 1ZVHA 4MDIB 4MCYB 5FYJL 3QWRA 2GJRA 1OAZL 2CSPA 3AG4B 4TRPL 3LXUX 4JM2F 5D2NA 3PGCA 3KXFD 2QR0A 5HPMA 1RP9A 5E4IA 3S98A 4DKTA 3VYNA 1JWUA 3RTQB 1OLLA 5F2FA 1DUYB 1I8KB 1MF2H 3L4TA 4XBPA 4XT1C 3BCFA 1NC4B 2JELL 1FNGB 1LK2A 2WBJC 1NCOA 2VSMB 4NEHB 2WBKA 1I1YA 3I9GH 4CU7A 1U2CA 5AENA 1OIOA 3MRHB 4QTIH 1YN7A 2P52A 4JGUA 4NZRL 2XBDA 1DN0A 2YGNA 5D4QA 4I2XB 4LEXH 3FQ1A 3MUZ1 2XN9B 3WKML 3ZHDA 4HX1B 3PV6A 1A6UH 4NP9A 3AREC 4YHYC 3NJHA 4R96B 2WQUA 4Z7VE 1NH6A 3E6FB 1PYWA 4OW6A 2DLIA 2D0FA 2HJFA 1X7SA 3C6SB 2IDQA 1PS3A 2XVGA 4N2AA 1B0WA 1QNZL 4NFDA 4PRIE 5DS2A 1Q9WB 1E5CA 4PGEB 4WGKA 4WWNA 1OW0A 2C4FT 2ENJA 2PYFA 4N2OA 4R26H 4MYPA 3SGKA 3U9PH 1ETB1 2CPUA 1KB5A 2OSXA 2QZQA 2AXJA 1NWOA 2J57A 4D8PA 1CF8L 4JDZA 4WV1C 2FWSA 2HKFH 4FMVA 2CO6A 4XMLH 1WCBA 1TEFA 4JRYD 4X4XA 4J27A 1YEWA 5GGVH 3S34L 5G5DA 2EAEA 3F5WA 5A40E 4X5RA 3BIBX 3VXUA 2JI2A 5J1AA 1LNUA 3HLAA 4I88A 1YECL 1QYGH 2VZ1A 1H5BB 3S8WA 4BWUA 3ZDXF 5GZOC 3GHPA 3D2UD 3K4ZA 3UPRB 4YIQA 4LPTA 1JZDC 1ND0B 2FGWL 4GQPH 4MXQC 4N1HB 5DA0B 5GHWH 4ZMPA 1A4JB 3FMGH 3V5KB 1J0JA 2IOOA 4QHLB 3GXPA 4R90H 3MU3A 5H94A 4P2QE 3V4PL 1TZIB 4KRNA 2JQZA 5IB3B 2ARJA 4ODHL 5BQDA 4CSTA 2GY7B 3CC5B 1UH2A 4WO0A 1ZVSB 1GSMA 1QVOB 5GSRB 1EJ6A 3M7FB 3VXTB 2QSVA 4AJ0A 1BJMA 3N41B 2VLLA 4YQXH 3U4EB 4LLWB 5DWUH 4V11A 4I48A 4HWEH 4JKMA 4LKXB 4NZTL 5SV4A 2JIXD 3JBG7 4HZ1A 3PL6A 4LCIH 2VSKB 4UTBH 1DVUA 3B2PA 3TBTB 3HRZA 1TETL 1DJZA 3LKSA 4PD4K 2Q1EA 4M4RA 2XT1B 4NS0A 3QUXB 1AGDB 3MXWL 4F7TB 3O3BA 4X0NA 2E7LA 2RTTA 1X5KA 5SWQB 2CK0H 1EIBA 2QSTA 5T1DL 1KCVH 4RDQG 3V79C 2E7BA 4Y5VA 1EO7A 4MAZA 1UYWL 4AQEA 2E76C 2PPEA 3RU8L 3LZLA 5IUSA 3LIZA 2Y4SA 3AFLA 4L4VE 1LMIA 3AM8A 3FXIC 3NA9H 2G75A 5I0DA 2OMUB 3RY6A 3MMEB 2B1OA 1I1AA 3PWJA 4MBRA 3PWVA 4O4YL 3VFRB 5BRZA 4PJDA 4Z0BL 2WBJD 3QFGA 4D3CH 4HUVB 2VDOH 4LVNC 5EO9A 3LHPH 1JD7A 2D9CA 5CP3H 4DOHB 5DHVH 3QPXH 3SO3C 1DQDL 1ZSHA 3WO4C 1S7TA 2FWLB 2XN2A 1PDKA 5L2JA 2Y69B 1K2DA 1AQMA 3OC8A 4WHYG 4JFED 4UIKH 1NINA 5KAQG 1KTCA 2AI0L 2JI3A 2P8MA 3LQAH 1H8NA 2A6JA 4LSUL 1J1PL 1ZWIB 4NKIL 3TIEB 2AEOA 3ARED 3VRIA 3KPRE 2O6PA 3BGAA 4X98B 3D3VA 3G6DL 4LKCA 4XNMA 5EPMA 1M9WA 1P5UC 4HBQA 3B9DA 1T1YA 4TUJB 4XCNB 5F1NB 4CL7A 3CHXA 3NG5A 3BEWA 3V6BR 3V95A 3EOAB 3POHA 3VSVA 3NPZB 1TTUA 1MJUH 3CPUA 3VTAA 2IAMA 2YEZA 2OTUB 2VXUH 3OZLA 1ORQB 2AXGB 4ZOCA 5ESVB 3FSZA 2Y5TA 4C59B 5TTRA 1R3KB 5KBLA 2O30A 4LGRB 3FS9A 4DVRH 4JFPB 4B9JA 3DX7B 1W0WB 1FORL 4OD2B 3CHRA 3GO1L 4YHNB 4AYBA 5KS9F 2LTQC 3F84A 4URKA 2H6OA 1CLOH 3PWUA 4OFPA 3VXSA 3PJLA 4PGDB 3WUZA 3FQUA 3N1MC 2XHNA 3TNMB 1BD2A 2W9DH 4ES8A 3TCTA 5GZOD 4D9LL 2EKSB 3BDBA 4UYQA 2X3CA 2VRQA 1YEDB 5LG6A 2FECI 4MXQD 3B7TA 1MFUA 4JRXE 4GO8A 3GBEA 1AG0A 4TVPH 4DZBB 1NAMA 1NC2D 3O3EA 5AAMA 1A1MB 3GMNA 4HUWA 2HN7A 2ZOKB 5F96L 4YLQT 2AQ2A 3IFOA 4G7QB 4HZLB 2VDPH 2J8UE 2YFNA 4PRBB 5IB1A 3IU3A 3OD3A 1T4WA 4YDJA 2BIIA 2Q3XA 3KJ6L 4NXSA 3NESA 4JFYB 4D0BA 4TQIA 1FFOB 2HXAA 3OJDB 3OXRA 5D7LB 1JBJA 4TUOB 4TNWF 2WN3A 2GTZA 4WFHD 3UJJH 5MENB 4H8WC 5EEUA 1KF9B 1BZ8A 2XZCH 4MSWB 5D7JA 1H3XA 1OP5K 5EF0A 2VW6A 2DY2A 4GJTB 4KY1H 4OCWL 8FABB 4BXSV 3EYSL 5EUOB 1DO6A 3EZJB 4YSDA 4GG6A 4UOW0 4L29A 4PG2A 2B4CH 3WAKA 4PJGB 1WFOA 3DTXA 2J1YA 2XWRA 3GSNL 1VB9A 1YQ2A 1AJ7H 2L3BA 4RFOL 3WIHL 5C0CE 1GTNA 1BFTA 2XV2A 3EYFB 4M7LL 4IIQA 4NPYA 1U3JA 1YY8A 2V9RA 1HL4A 1YMHB 1BVLA 2G2PA 3ZT6A 1KIRB 3T77A 4KNUA 1JF1B 1WA0X 2VL5B 4N26A 4HIJB 4W9HC 1KFGA 1MWAA 5E8OA 3IGUA 1UKTA 4YL9A 1FFNB 3M17A 1X5MA 1WS7A 3BSZL 4ES9A 2QGDA 1QEWB 2QEJA 3DBXA 3NACH 1KJ2A 4WY7H 5TE6H 1JHTA 4H0GA 3W2DH 3W39A 1F4XL 3ZDYF 3FQNB 1CE1L 2EIZA 4Y4FB 3VFVB 2NY1B 4Q52A 1KV7A 3NRQA 5JA9A 2X7LA 2C9SA 2NXZC 2WO4A 3ZTJH 1XWVA 2JQAA 5FKAB 5L6YL 3TA3A 5F1SA 2DZEA 4QRFA 5E2UH 4TVSa 3VI4B 4UAOC 1QASA 4F8OA 1Z0MA 1SQMA 4DJMA 1IBBA 3ALWA 4OCLC 2VDLH 3ARDC 5D2NB 5D1ZB 3PGCB 4YDZA 1BF8A 2VC2H 3RGBA 5HPMB 3ETBJ 3JTSA 2VW7A 1JWUB 1ZT4A 2AJSL 5D6DC 5D71H 2FT6A 4XBPB 4BCZA 1A7NL 3WTVA 1LK2B 1P4IL 1I1YB 3WNIA 4BFIA 1RLBA 4U7KA 5LQBH 5DJXA 3H42L 1YN7B 4K0OA 3MRJA 1HEZA 1QAWA 2F8XC 2FIKA 5CJQL 1CCZA 1DN0B 1ACXA 1KBBA 4UINL 5IVXE 3VFTB 1T1WB 3RFRA 3AU1A 2MCG1 4KXAA 3QUYA 1OKEA 4LHJB 5D70H 1ZLSL 5KSBA 3CVHA 4UM9A 5GRWA 2KBGA 1WAAE 4NUPA 3W82A 5EZLA 4WSKA 1QP1A 1PYWB 3MRIA 2BWDA 2NQCA 1C5CH 2PYEA 3S36H 2BK8A 4YBLC 5FO8A 2PYFB 3FCBA 3GHEH 1RZPA 4MXVF 4QDGA 1KB5B 1BF5A 3I6GA 5BOJA 3VFPA 4D8PB 3UG4A 4IBSA 3CX5J 4JDZB 3QORA 4L37A 2CO6B 3JWNE 1AIFB 1QI4A 2ITFA 4DO6A 4P49A 1T5WA 4X4XB 2WY3B 5E5RB 5C7ZA 3ABZA 3F5WB 3EKCA 4JAMA 4KUCD 5A1AA 1HZHH 3G9AB 4K9EL 5DQDH 3H0TA 5BMFH 2GSGA 2J71A 3VXUB 3EUDA 1S4IA 1LNUB 3HLAB 4K3GA 1CIUA 1AQHA 3SPIA 2YA0A 1FGVH 4I3SL 4XNXH 5GPRA 5EU7C 4YIQB 4X6DE 3GQFA 4JHAH 4YLBA 1TTFA 4NUQA 1OAKL 3LJ3A 3DJRA 3QQXA 5H94B 5HYIA 5B38G 3QISA 1EA9C 5HBBA 2FX8H 1YAZA 2ARJB 4X9IA 4EUPG 3R06A 3BQUC 5E2VH 2NNRA 1PLAA 1CR9H 1RIHL 3ETSA 5LGHH 4JQVA 2VLLB 5BCAA 3TFKC 3MLPA 4I48B 4X8XA 2Y1ZA 2ENYA 3W81A 5ID0A 1C5DA 4GNKB 2ZNXA 2R2EA 3PL6B 3DIVA 1H6EA 1A7QH 1JYVA 4ENZA 1DJYA 3HRZB 2Q86B 3VXOB 5AOMA 3LKSB 4M4RB 1P7BA 2MQ0A 3DHMA 2M83A 5I8KL 4QMEA 5H4YA 1M7XA 1JV2A 5LUMA 3QQNA 1ZEAL 1FI8C 1W8OA 1XSIA 2YD0A 5I1HH 1EK3A 3OJ2C 5J7CC 1PVHA 2NXZD 1SHWA 1V7NL 3VWJC 2J8OA 2MPAL 4Y5VB 3W38A 1I3RA 5IESL 2V5SA 4AQEB 5I1GL 4N2BA 3SY6A 2YPVA 1KYOJ 5C0BA 5D1XA 1X9RA 4KMQA 3PIQA 1Z5LA 4R7NA 1VEPA 3WTXA 1KXVC 3ARDD 4JGNA 2G75B 1ZLVH 1VDGA 2WP3O 2X1WL 3MO1A 1I1AB 3PWJB 2DLHA 4JFVA 1D9KA 1AR2A 4ABQA 2LR4A 3PWVB 3GSVA 4NNPL 3GJFA 1MCBA 1O6SA 4PJDB 1A5FL 1RU9H 2Y1YA 3GB7A 4XOBA 5TPWH 3GPSA 3QCTL 3X1EA 5EO9B 3PWLA 5GIRA 5EOQL 4KTEL 1FL5A 2CKNA 4H20H 4OY9A 2IG2L 1EBAA 4NWUH 1SXBA 1OT2A 1FO0L 3FFCD 1IFGA 5GS0L 5CSZA 3V5DA 4O02H 2XBZA 1S7TB 2ZG3A 5FUCE 2AK4A 1XGRA 3D5OF 3L2MA 1PDKB 3KWWA 2F19L 1G1KA 3I9PA 3SE4C 1K2DB 5L2JB 1MCFA 5E5MA 5C07E 1CGSH 2P8MB 4PYGA 2A6JB 2EXWC 3MOQA 1XSJA 1WFNA 1IGYB 1WZMA 3VRIB 4XNMB 3D1MC 1CLYL 3D3VB 4LKCB 3OKYA 5EPMB 5IHLB 4YO0A 4Z1PA 4JREC 3AWGA 5TF1H 5A2BA 3WXWL 2Q2LA 4GKZA 2OCJA 3BEWB 3U30C 2MCPL 2NY7H 5C0JA 1E7VA 4BFOA 1C9SA 25C8H 2CHDA 4HOZA 1DQML 2IAMB 2YEZB 3FO2A 3NCXA 3Q2LA 4NPKA 5IOPA 2Y5TB 1QD0A 3K1DA 5D72H 1TO5A 5DZPA 3EG9B 3JZ7A 1Z7JA 3WJLC 2WWKT 4FG4A 3LMJL 2MEJB 4MNHA 3PP4H 1JTOA 1PZAA 4JRYE 4FFTA 3PWUB 1N9PA 3VXSB 3CV5A 3FQUB 4ZZKA 5F9DC 1BD2B 3BESR 35C8H 4PJCF 4UIMA 1T2QL 5KANI 2Q9OA 4UNVA 3TBVB 2JJVA 4P07A 1PY9A 3SGJA 3Q06A 2D3LA 2EIDA 2VDKH 1NAMB 3O3EB 3J7HA 3N43B 3G04A 2Z9TA 4HUWB 2G60L 3SDYH 2HN7B 4TSBL 4OIBA 2JXMA 2F2HA 4NRZA 3IFOB 4LL9A 2VAJA 2Y5EA 3BQUD 5ESAA 1S7SA 5BUAA 3KXFA 4NZUL 1D5RA 2ID5A 5JW3H 5IB1B 3IU3B 3TFKD 4XNZC 4E9RA 3OF6A 1MFCH 5B1AB 1S9WA 2D9QB 3P3YA 1E43A 3IDXH 2VRKA 3DX6A 4A38A 4D0BB 1YYLL 1GMIA 1MDTA 3OXRB 1JFQL 3ORJA 3OKLA 4GUPA 4JVWA 2GTZB 4KXDA 5I5RA 1RJZA 1RXLA 1N0XL 4I9XA 5D7JB 2WINA 4WSJA 1DLFL 2BJML 4H0HB 2ENQA 4G83A 2DLFL 4MJHA 3VWJD 1CL7L 3DNKA 4GG6B 4L29B 4WI0A 1NMAL 4PJBE 2DIBA 5FA4A 4HWBL 1YJDC 5DC0A 3DTXB 4HVBA 2YGQA 3IGAB 1RZQA 2WIIA 1Y6KR 4NCDA 5IJKC 3AGVA 3RUGE 4P2RE 4EMZA 5IJBC 4ETYA 4FJYA 2J4WH 4IIQB 4UT9L 2B1HH 4HUNB 1YY8B 1ZSDA 1BVLB 2EEAA 5FF6A 4WWPA 1ZLWH 5D7SH 2ZKHL 3T77B 2F53E 1I1FA 3D06A 5EZOL 4NB7A 5LBSH 1MWAB 5E8OB 5AVRB 1AFVH 4DGVL 1Z3GH 1XIWC 4TLUA 5EEVA 1ERNA 3AMLA 3M17B 5I0YA 1JI2A 4G5AA 3ES6A 4N2FA 2CJSA 3K2UL 2P24B 4NDMA 1R3HA 1SOSA 3DBXB 1JHTB 1U3HC 4TVUA 3QZBA 1G84A 2EXWD 3W39B 4F92B 4B97A 3V5HA 3NAAL 4Y1SA 5BV7H 2EIZB 1KC5H 3VW3H 2X7LB 4PD4J 3FB8A 3EGXA 4JFEE 1JPSL 3QW9A 1KBPA 4XMPL 3TA3B 5CINH 3S7GA 2VLMD 2D31A 5KVFL 4P5TC 3K6NA 2QMJA 5I2IA 1WFIA 5I0VA 1LD9B 2I25N 5HI4C 4LIQL 3E3QE 3PWPD 4GW1A 2ZP8A 3MLSL 1E3XA 1JGUL 4OF7A 4X5PA 1T21A 3JTSB 5CBAA 1ZT4B 1J12A 4XHQA 4N0CC 2JIXA 5IJCC 4OFDA 5MHSE 4OIFA 2F5BH 4BFIB 2DN7A 5DJXB 4KUZL 1MRFH 5PCYA 3VD1A 3DOHA 3MRJB 5FC9A 4AV5A 3EFOA 3N1PC 2Y7OA 3N9GH 4E9VA 2FEDC 2FIKB 4QLWA 5CMAB 3VCLA 3AU1B 2ADIA 3QUYB 4ONOA 1HINL 5KSBB 3CVHB 3TT1H 4UM9B 2CDFA 3Q0HA 1S9VA 4FXKA 5EZLB 3DVNA 4DO5A 3MRIB 5SX4H 3O6FC 2AABH 3PQYD 2YSSB 3R8BB 2PYEB 3IDYB 4YAQA 2ADJA 2PR4L 2MRYA 5FO8B 1YUHA 4PJHF 5F71A 2WLLB 4ODVL 4PJIF 3I6GB 3VFPB 5C2BH 1TJGH 1UD4A 3LSOA 1PF3A 4AYDC 3QORB 2WBJA 4L37B 2C3WA 1TZHA 2BSRA 1T5WB 4UZUA 4WUKL 1HHJA 1DE4A 2OK0H 1TQTA 3K1KC 5BUGA 4JAMB 3RA7L 2AEQH 4XP9L 1G9MH 3LH9A 3CDFA 3H0TB 2ZKMX 5HVHC 4E9QA 4H40A 4KOCA 2VLRA 4LAQH 4RDQF 2ZCZA 5DO8A 4W81A 5D2LA 4P2OA 3UYRH 3FQ2A 3LKOA 4XCFL 3FJTA 4LK4A 4IHBA 4PJ8C 3K5RA 4PS4L 5G4OA 3KG5A 3MAWA 1PCXA 1OAXL 4OLXH 1FSKC 1UATA 5EA0H 1G7LA 3MNWA 4XTRC 5ERWA 2FO4A 2R29H 2EUXA 4WHDA 2EVGA 3D87B 1E6OH 2VLJD 2OKMA 3V4LA 4CDGC 1O7SA 3QWQB 2SEBA 1G7PA 2Z0UA 1LWJA 3R06B 1EJOH 2AEPL 4MQTB 4G82A 4WV1A 2ZCKL 1OAJA 4FTVE 4HMEA 5JTWA 2R23A 2YUZA 1R3LA 2CRMA 4JCMA 1H8SA 5KVGE 1C5DB 4AG4H 1J9CT 3BWUC 1XIWD 5J89A 2R2EB 3MLUH 4G11A 4JFZH 2DWYA 2BSEA 3FT0A 1FNAA 3INUL 3IS0X 3IETA 2HRPL 1U0QA 1WZLA 3TCXA 5EBGA 1TSRA 3OSVA 4CMHB 4DKDC 1IC7H 1U3HD 4RGNE 4LAJH 1CXEA 1JV2B 3M1CA 2GYSA 4OFKA 3RX8A 4NQCE 5GZOA 1JSYA 1VLXA 2XIBA 2RCSH 2YQ3A 2ADFH 2EDMA 4YFLF 3C8KA 4YC2C 4DFIA 4GG8A 1HILA 1GIGH 1OGPA 3B7UX 1I3RB 3II3A 4HV8A 3CIAA 1NC2A 3QR2A 5EC1A 1T66C 4P5TD 5C0BB 1QACA 1IGCL 3MUY1 3PIQB 1Z5LB 2E74C 4R7NB 4F93B 5HI4D 3VQMA 2E6QA 3H3BC 1OGSA 4GQ9H 4HS8L 4MA1C 5E4OA 1HSBA 3CVDA 2IOMA 1WE5A 3FUEA 4NYLA 4DQOH 5AW8B 3X1GA 3MO1B 3QEQE 5E6YA 4ZS6D 2ARWA 4DP1X 4DTGL 1D9KB 4N0CD 4BH8B 1FCCA 1PEWA 5IFHL 1YLBB 3DJTA 4ZO7A 3GSVB 2VN6A 3GJFB 3UDWC 1O6SB 2V33A 1NMBL 4XWOC 3GB7B 3QDGD 3GSOA 4MQXC 5E6ZA 1KLFA 3PWLB 4UYPA 4EDWH 8PAZA 5GIRB 4GI6A 3UYPB 1EERB 2F0CA 3ZKNC 2WVUA 1MZYA 4JS7A 5CUSL 1A6AA 4LCWE 4E9LA 1P1VA 3MFFA 4FFYL 5CSZB 2FEDD 3V5DB 1HNFA 2AK4B 1QBML 1XGRB 1Z2KA 2ZUXA 2NNAA 2V5YA 3KWWB 4L48A 1MXGA 5BZXA 2CLVA 3KPSD 1KGIA 1KGXA 2DD8L 3G6JE 4Q0XH 5E5MB 2B8OT 3O2WH 1EUTA 3G5VA 2VQ4A 1IEBA 4ILDA 4TNVF 3L95A 3S3BB 4ACPA 1MIEL 5ADOH 1TZGL 4YO0B 3O6FD 3M8OH 3JV5A 1QUPA 4KO9A 1DJXA 3AWEA 3GMLA 4GKZB 1OTUC 15C8L 5C0JB 5ENWA 3LRLA 2X4PA 2P44B 2BHZA 2G2RA 4JQXC 4U1JA 3OZ9L 3ERXA 3FO2B 1JGEA 1RL1A 5TK2A 4NUGL 5IMKA 4CC4C 4E41D 3HVDA 5IOPB 1QABA 1QFUL 2XV0A 3KPMB 3VXPB 3SOTA 1E4WL 3NRPA 5F72S 3S88H 2CRZA 2RMNA 4RWYH 3QAZC 3ULAB 3TYFA 4XP4H 1R46A 3EYOA 5AVXB 5JR1H 1OWRM 1PG7X 1RZFL 4MNHB 5CGMA 5KN5A 3R0NA 5E6RB 2XETA 2L04A 3BUYA 1U8NA 3GBLA 4PJ8D 4I2XE 3U6RA 2YR3A 4UIMB 3MBXH 2GIMA 5JOEA 5HJBA 4TMPA 2ZXBA 4XNBA 1P5UA 3FKUS 4FZEL 4X99A 4XTRD 5GGRA 1HT6A 5GRUH 2EXTA 5D1QE 3ZE0E 2PW2A 5DMIH 2HFGH 3ZKMC 1SFHA 2CUIA 4DKEH 1YVLA 1EWHA 5DVMA 5LGKA 3RWEA 3G04B 4F2MA 5GGUA 5J56B 2LAGB 3KBEA 1FLRL 3GXIA 3HAEG 2X4RA 1FZOA 2JXMB 4M7JH 4NRZB 1PLGL 2ITEA 3TEXA 4YXHL 3BMVA 1S7SB 4K8RH 5ESAB 1CYGA 2X6UA 3ABGA 3B8YA 4OQTH 2D3VA 2QTEA 5CILH 1KULA 1F4YL 4HUUA 1S9WB 5CBEA 4UT6A 2EDXA 2FJHA 2D03H 4HKBA 2TRYA 3DX6B 4KK9C 4AGPA 3HRPA 2ODHA 4ERSH 3AQZA 4ZYKA 1JNLH 2AS5M 4GUPB 3BXNA 4HCGA 1RJZB 1AGCA 1J8RA 3CFBA 2WINB 5D55A 1CFVH 1G7JA 5DMKB 5IY5B 1P4BH 1C5BL 3EJYD 2NUTA 1IKFL 3SQOL 1NPJA 3IMSA 4DETA 4WI0B 2XDHA 2WXIA 1E5AA 3NBNA 3WI9A 5FA4B 1FFPA 4HFWA 4CN4A 2VDMH 1F4WL 1KZQA 2WIIB 2QQQA 1JK8A 4NN7B 3JWOH 4DVBA 5I8CA 4LHUA 2EACA 4YGVA 3FT4A 3P30L 5TQ2H 3K4DA 4JJHA 4G8GB 2BHUA 4AUJA 1NEZB 5FF6B 2WTRA 4MQXD 5E8NA 3L4WA 3WFDH 1CYXA 5IV2A 3ZKND 4XPAL 1ROWA 4TNGA 3NIGF 5KSAC 4W9LC 1XF1A 4TTGA 3P11L 3ES6B 3N42F 3IAGC 5KYUB 2BY2A 2X1OA 1NLDH 1R3HB 1B4TA 3MOAH 3WCYA 1BFVL 4PB0L 2OZNA 4HXBH 5EZJA 3FFCE 3UTTD 3V5HB 3U4BH 5KVEH 1L0QA 4DEUA 1SLXA 4H8PA 4HWNA 3FB8B 4XCYA 3EGXB 2WYIA 2RD0A 3SDCA 2CIKA 1OTUD 2D31B 3MGAA 5I2IB 3GM0A 2A9ML 4JPIB 5ICZA 1BQHA 1DJIA 2O6FA 2UY6A 4GW1B 3KYAA 1CTMA 4TQHA 5D1ZI 1AZNA 1T21B 3OKKB 4NQQA 2FCBA 5ILTL 4PLNC 4MJ6A 1PKQE 4MXWL 1L9NA 2JIXB 2OMZA 4AYEC 1JPGA 3WJJC 4M6OH 2KLRA 4U49A 2N59A 4HUXA 1TXKA 4GLRH 4JGMA 1OARH 5TH2A 1QKZH 5IGXL 3L1OL 1SJEA 2VO8A 1TCRA 3HUJA 4UU9A 1VF5C 3CLFL 4GXFA 3VCLB 3VFOA 2WWNA 1IEAB 2ADIB 2QADC 1OAZH 3X14A 3WNKA 3H4FA 2X89A 3DC0A 4FXGC 5JW4R 3ZKMD 5FLVA 2E6PA 4BIKA 2DOCA 2CDFB 1S9VB 3DVNB 2BO0A 4HH9A 4WKZA 1YEKH 5AEAA 2JELH 3ARDA 4YAQB 4ZO6A 2ADJB 3MXVH 1RUAL 1YUHB 1W2KT 4IOIA 4TNWK 5D6DA 2EICA 2NY0B 3LSOB 2R2CA 2WBJB 3RZCD 3F00A 4M48H 1TZHB 2XY2A 4KK9D 2BSRB 2L4OA 1SQ2N 4I18C 2VN3A 4FQXC 2DQHH 5IMMB 1HHJB 2CO4A 2YWZA 3TA4D 1NANI 1AXTL 1JHLH 5BW7A 1KN2L 3WKMH 4AGNA 3UBXA 5DD0L 1A6VL 2VLRB 3QEGL 5D2LB 4P2OB 1KJVA 3LKOB 3T8MA 1QNZH 5DD3L 1HKLH 1O5DT 4YHYB 2IWEA 4XP6H 5I16A 3RKDC 3V52L 3RTLA 1EPFA 3RVTC 4Z76A 1G7LB 3MNWB 5ERWB 4D0DA 4E9TA 2FO4B 1AYRA 2ZUTA 2FJGA 4I77L 1KXHA 4H1LA 2SEBB 2BMKA 2BY1A 3SO5A 1G7PB 3S34H 4ZW5A 5D7IF 4HCRL 1UZ6F 2BFVH 2JVUA 2XI9A 3GTVA 5CKAA 2NZ1A 1YECH 2IGLA 2R23B 2WLYA 3MZTA 4L1DA 4OT1H 3Q5OA 3K8KA 1GOHA 3NP4A 2HKHL 3VGDA 4XMVA 1SN0A 2HA1A 3N40P 1WPCA 4K4KA 5KSAD 5BO0D 1YSOA 3IETB 2O4EA 4Q56A 2FGWH 2VJ0A 5LKNA 3EO1A 2B16A 4HC1L 1UGKA 5BJTA 1I75A 3WYRA 1FAIL 3IVKA 1QSFE 2C9XA 2NW3A 3V0HA 3C8KB 4JM2C 4GG8B 1HILB 1N3NA 3NIDB 1TG8A 4I7ZC 4HV8B 2OFQA 3MRLA 1NC2B 4K9JA 4LF3A 3ARTA 3EFDL 4LEOA 4TQ8A 5EC1B 3ZRCC 4AC2A 4PS8A 1TJMA 1BMGA 2ZOTA 1ILSA 3ZUCA 3CFMA 4XNUL 3QNFA 3BQUA 4NZTH 1WVZA 1HSBB 4OFVA 4NYLB 5T1JA 2XQBL 3AROA 2VLME 1F8TL 4C83A 4A63A 3S0PA 3WTSA 3A0OA 2F8VA 3TN0C 1SMAA 3V7AE 3W0WD 4ZFFA 1TLKA 4GKNB 4L8SC 3GSOB 5FO7A 4AENA 2RB8A 1KLFB 3BPNC 5B39A 3E80A 1X9LA 4GKLA 3U1QA 3RURA 5AYUL 3L8QA 3CFKA 4FEMA 3ALXA 4NN6B 3MFFB 1R5IA 5BXFA 1F97A 1PGRB 1UYWH 3LPOA 4CSZA 2CWRA 3ZL4L 4OI9A 2NNAB 5IBTL 4PJXF 3F6LA 3OG4B 3IGLA 2QADD 2OMYA 3PAVA 3H6JA 4PFEA 4HD9A 4Q9CA 2C26A 3G5VB 1IEBB 3EYUL 4QXUL 4R7VA 4O4YH 4FN0A 1KXVA 4Z0BH 3GMLB 1RZJH 3H8NA 1IBDA 1NCNA 5ENWB 2E27H 2X4PB 2Y7QA 1WYJA 2G2RB 1PSKH 4WFFD 2Z4QB 4ZNEE 5IMKB 1VSCA 4N8VG 4WHYH 1L3WA 3ULVE 2ED9A 4ORZC 5KTEL 4FQXD 4ZD3H 1L9QA 1ZIAA 2J20A 3K6IA 3SO3B 3TYFB 1MCDA 4ZMNA 4NKIH 2P9RA 1TCMA 3EYOB 4B5ZA 1GRWA 3WO4B 3G6DH 4B95C 5KN5B 2HWZH 3GRBA 5AW6B 3SE4A 3CX2A 4B3VA 2P4AB 1RI8A 3BUYB 1U8NB 3UCQA 1I85C 1A4KA 5ITFA 3U6RB 2QQLL 4ELMF 1MI5B 1GAFH 4FA7B 3RKDD 3L5XH 2MQ3A 2WWKO 1P5UB 1IILE 1EEZA 4X99B 3RVTD 4TULH 5GGRB 3QR1A 2A5UA 1UD2A 2IBGA 2PW2B 3BPOB 4JO1H 2DI9A 3LKPA 2UXTA 1GY2A 4E0RA 3RWEB 4MQ7A 4WWKD 4F2MB 5GGUB 3O3AA 2HLFC 1JZ2A 2X4RB 1FZOB 1UM4L 5GISL 4Z7OB 1BQLL 5HHOD 3PWPA 1M42A 4Y9CA 1FORH 2J1ZA 3GO1H 4NKOA 3L13A 2C1PA 1TYEB 4HUKB 5DTFB 1IAIM 1DQLL 1HHGA 1X4YA 4MA3A 5FUZH 5ISZD 5AB1A 1QHOA 3GSRA 2FK9A 3MLXL 4HUUB 5CBEB 3QJXA 2FJHB 3WJLA 4I8DA 4HKBB 4D9LH 3ECBA 3QUMA 1A25A 5IQMA 4ZYKB 1MKFA 1Z66A 3MCYA 1SVZA 4A1RA 2BY0A 3BXNB 5DZJA 3CFBB 1AGCB 1XBRA 1G7JB 4QKTA 4NAQA 1JZFA 5GJSL 4BFFA 3OQRA 4KQ3L 2BXZA 3P9WB 4G8EA 1DVSA 3CFEA 4JM2D 1K6QL 5A6IA 3AZUA 4FFWC 1E3FA 5LNEA 4TLSA 4HG4K 1KY7A 5JHDD 5KVDH 2YA1A 2HFFA 3QYMA 4BQCA 1FFPB 3CVBA 4HFWB 1A64A 4JO3L 3DYOA 4AEHL 1JK8B 4OAWA 3PQYA 2N1KA 2XN0A 2NX5A 4DVBB 1ZXQA 2P8PA 5F7YC 1P4UA 5I8CB 1EMTL 4LHUB 1MNUL 4R4FL 4R5VA 2KDGA 4YGVB 3FT4B 4GRWH 3TN0D 1C1EL 1QBBA 2J5LC 4OZHF 1SDYA 4MFHA 3BT2L 2VGLM 2WTRB 4HS6A 5E8NB 1U33A 4DK3A 5IV2B 3JWDH 4DHLA 4D9QD 1HL9A 4BGDA 1CDUA 2CH8A 4ZMYA 2QVTA 3W11D 4E36A 1DSFL 3QDGE 4FX5A 4KX9A 1AC0A 1NL0L 1UQSB 1K8DA 4RMSA 2CRYA 5IHHA 1KDJA 3EFFB 4OVUA 1TTCA 1WBYA 5EZJB 2YXMA 3WIHH 2VITA 3EBIA 3KPNA 4ABVA 1XB8A 4M7LH 4ODWA 4XCYB 2Q87A 3SDCB 3ARQA 5I6KA 2DQGL 5IJKA 2CIKB 2AMUA 4EIZC 2VLJA 1S9YA 2Y24A 2VNCA 1H3PH 3Q05A 3VD0A 2H2PC 5ICZB 1C8QA 1TPXC 2YN5A 1BQHB 2UY6B 3BUDA 3K8MA 2OYKA 4BZ1A 1KGCD 3EJRA 3HG1D 1IC5L 4G3YH 3BSZH 4S1QH 1ZANL 3OJMB 1MHPL 3KYKL 4UQ9A 5F6IC 2OMZB 1JPGB 2IOIA 3GRWL 1YCSA 3WEMA 4EQ2A 3GSQA 1CE1H 3B9KC 4HUXB 1TQUA 5CJXC 5ITBL 2OYPA 3A4AA 5TH2B 1U3HA 4H5SA 4ZSOE 4YFEA 5L6YH 1SJEB 1TCRB 3ZGHA 3HUJB 3TVMA 4UU9B 3DSNA 4DP7X 1KIUA 1XHHA 3VFOB 5CEZD 4J8QA 2F7QA 2NXZB 1WAEA 3X14B 5DD1L 4Q9BA 2NY5H 4P5TA 1SYSA 4U2ZA 3FAWA 5DURD 1MW0A 4HH9B 1KLGA 2HLFD 4WKZB 4PB9L 4F9LC 5DVOA 3ARDB 4HAKA 4E41B 2X53A 2JCCA 1BECA 4IOIB 4M7ZB 1AYOA 5F3HA 1AS8A 3FPXA 3H42H 1J48A 1DBBL 2LT9A 3KS0J 1G4MA 5CJQH 2ISDA 4UINH 1R3IL 3NUKA 3KLKA 2BOBA 5IJDC 3ZX1A 3GI8L 5EU6E 4CMMA 4FC3E 3RLSA 3RDTD 2FX9L 4PS3A 3FU9A 4N2MA 1ZLSH 1XH2A 3UBXB 1E30A 1N68A 2XXMB 3IDMA 4GINA 5I8EA 1T7VA 4P3CH 3IAPA 2COVD 1J11A 3KPSA 4P9HC 4FFWD 3FTUA 4PY8J 2FEEI 4QF1A 5I16B 3QRGL 4ZUSA 1KYAA 4NQVB 4ZBJA 4MCZA 3F01A 4Z76B 3O6FA 3VXME 4LQFL 4Z7WF 3CZLA 5DUMH 2R51A 1MFBL 5BS0A 4C55A 4YBLB 2FJGB 1AO7E 2G30A 2NT0A 4GAGL 3Q1SL 2WK2A 4H1LB 2BMKB 4NWTL 4PJFA 1H3TA 2XG4A 3QC5X 3H6AA 1KTLB 4E41A 3QR0A 1EHAA 1KNOA 2LU4A 5I8OH 4MVBD 2XTJD 3CD4A 4Y9GA 1NOFA 3SOBL 2QLYA 2EADA 4I3SH 3DXAE 3IRCA 4G6KL 1VCAA 2EDWA 1JWSB 4R5TA 5DHYA 2YXFA 3FH5A 1AHKA 3EO1B 3WO3B 1WUNT 1ZOXA 3TGXA 1FHNA 4BFBD 5BJTB 3BFOA 4EUPH 1MQ8A 2KHAA 2QGCA 1JWMA 1GL4B 1HDMA 1SN2A 2G9HA 3CFNA 3D08A 3D50A 4J3SA 4Q4IA 4FQLL 1MCWW 5HJ3A 3U0PA 2I9LA 3MV7D 1U2YA 3FDWA 3MRLB 4LF3B 1RIHH 4LEOB 1A0QL 3UTTE 1MW3A 2FJFA 4X7CC 5LHDA 2H2PD 2EEDA 3SPHA 6FABL 3BQUB 3WY3A 4KFMA 2B9AA 4ZMZA 4A2MA 2BFGA 2GSMB 3CPLA 5CU5A 4C83B 2RQ8A 4B9IA 4P99A 3FN0L 2YD6A 5DC4B 1IAKA 1EO5A 4ZFFB 5I8KH 3BP7A 4JFQA 4NRYB 1ZEAH 5JO5A 1FC2D 4AENB 3PAZA 1M56B 4G8IA 1MFDL 2BNUA 3B9KD 4DPCX 5I15H 4MQSB 3NDZE 1GZQA 3CQQA 2OMWA 2MPAH 1KCSH 3CFKB 3QDJA 4KK6C 1R5IB 4DH2A 5BXFB 1D2PA 5I1GH 4WI5A 3LPGA 4FAAB 3FH8A 4J3OF 2OMYB 4ONFL 3MV9A 3O11A 1YEJL 1T7ZA 5HVGB 2DBLL 5IZ7A 1K3ZA 2Q7NA 3SD5A 4L5FE 2QGEA 4Z23A 3F7YA 1NDGA 1U41A 4NNPH 3BLKA 5I6NA 4Z7VF 1A5FH 3MRKA 4ZOBA 1OD7A 1IQWL 3QCTH 4HJJL 4HIXL 2PPAA 4LHQB 4PVLA 2IJ0C 4PRPE 2Y7QB 3SYPA 3FO0H 5I1AB 3FUKA 3EHBB 3WFZA 4PM1A 1ZJBA 1Z9NA 3UDWA 1FO0H 2QHRL 1S7WA 3BZEA 2FIRT 3Q43A 4DN4H 1FN4A 1TZOA 4QD2E 4DW2L 2B2XH 5D9SA 4GIAA 5C86A 3QWNA 1A3RL 5LAXA 1ZRUA 2RALA 1A9BA 4HIIA 2JKRM 2XZAH 1X5YA 1HTYA 2R2HA 3HA0A 3T3ME 4FKEA 2FSDA 4NXKA 3BVVA 1A4KB 1YDPA 2NXYC 4OGZA 5KUMA 5ITFB 3WXWH 5DZNA 4C4KT 4BUQA 4B6ZA 5AW4B 1JNNL 1EEZB 1U58A 2ZOUA 1R17A 4JREB 4RMQA 3BKCL 2VDQB 3U30B 3LKPB 3U0WL 1CIDA 1EEYB 3DUHA 4WUUD 4E0RB 4MQ7B 2YWYA 2VRAA 2AJYL 1LTXA 3O3AB 2GHZA 4JQXA 1U2HA 1OTTC 2B14A 2WZPD 4MJID 2EE2A 3PWPB 3GGWB 4XBGA 4CC4A 4F3FB 5HDQL 1Q1JL 4NKOB 3LMJH 4AW4A 2C1PB 1HHGB 4MA3B 4ADJA 1OCOB 3GSRB 3NFPA 3CHOA 2WM0A 5DHVA 2VM4A 1PJ9A 1T2QH 3POCA 2DKUA 4HEMA 5B8CA 3ECBB 3QUMB 3K0WA 4FQIL 3VA2C 5T3ZD 4O9HL 1MCIA 3I6LD 4UM8A 2EVJA 5I1DA 5DGQA 5LG1A 3OHXA 1S7VA 1DVYA 1A3LL 2G60H 3D33A 3SBWC 1KTJA 2ZZUT 4G8EB 3CFEB 1EZSA 5FPIA 4LRIC 4N8CL 4UNIA 4YK4C 1ORSA 2C4FU 3N06B 4OI7A 2HFFB 2H45A 2YXWA 4FG0A 3U6XA 2FT7A 2Q8BH 2XJKA 4OAWB 3PQYB 5EIIB 1ASOA 2NX5B 2P8PB 4WKXA 1YYLH 3HZYA 2YIHA 4M5YH 5BVJB 4PJ5B 1JFQH 4XNZB 4A7UA 4M93C 1Q4NX 4LVEA 2P46B 2M8XA 5DXWA 3NMEA 4K07A 4QT5A 4HS6B 5I82A 4EI6A 3WN5C 4PHZA 1CL7H 1K9TA 3ASNB 4JG1L 4TNVK 1GGTA 4KK6D 1IGML 5LGYA 5KVGL 4S0TD 5CNHA 2IPUK 1K8DB 2VCOA 4U3CA 1L6ZA 4BGLA 1WBYB 3CE1A 1T20A 2VITB 4S1SH 4APQC 2J6EL 4FYQA 3ARFC 4E68A 3D0VA 4UT9H 1QX1A 5CCKL 4IOFC 3S3DB 3NJJA 2VM3A 4MA8H 4ODBD 4PBXA 4V1DD 3RWFA 5CU9A 4Q9RL 4PJ7E 2ZKHH 3BFQG 5CJ5A 2VLJB 1S9YB 4HIEA 5LWYH 4Y2OA 5EZOH 5C2UB 2VZ3A 3MUJA 5DJ2A 4ZFGL 3RVVD 4PJ9C 2CIIA 2VMDA 1MHCA 4DGVH 4W9GC 2XFXB 3IB4A 1BA9A 1UVQA 3K2UH 1I9IH 2DQJH 2HPOA 5EU4B 5TFSH 2BP3A 4HLJA 5KSAA 2KL6A 2G3MA 3GSQB 3FRPA 1B6UA 2EJ1A 1G6RL 4A7GF 2J5WA 1LEGA 1IE5A 4FQ2L 1PL3A 3AXHA 1JPSH 1U3HB 4H5SB 4XNAA 2NXYD 1MDAA 4A37A 4B3EA 5I30H 2H26B 4OGQC 1N6QH 4JY5L 2CR6A 2LVCA 5KVFH 3TVMB 3DSNB 4G5ZH 1KIUB 3KH3A 5KYNA 1F5WA 4JKPL 4LIQH 5HY9A 3MLSH 1N67A 3IMVA 1W15A 4XZ4A 2F61A 5B1CA 3V7MA 4JO8A 1T03H 4P5TB 1SYSB 4FNQA 4YPGA 5I6MA 1VFMA 1KLGB 1OTTD 1E4XL 1E40A 4XPHH 3ETTA 3R1GL 1NCAL 4ZW6A 3OKDA 3ZHFA 2JCCB 1IM9D 2BVOA 5F3HB 3TURA 3BD4A 3C08L 2I32A 3ISYA 3ZZLA 4PMFA 2J8UF 4MBOA 4Z7UE 1LEIB 3W0WA 2GT9A 3LH2L 4IDJH 5HHOE 1Z9MA 1S78C 4Z7IA 3H3KA 1GGUA 1RMFL 1AD9A 1U30A 5L88L 1M2OA 2BOBB 3C60A 3DBSA 4CMMB 4MMZC 1HINH 3KYMA 1LHZA 5C6TH 4NRXA 3IDMB 2J25A 3TEZA 4OZ4A 2HX8A 2E9GA 4QGYA 3WTUA 1UGNA 3LZPA 3KPSB 2FVNA 2J44A 3BQVA 1ODAA 5HYEA 2PR4H 3MV8E 4URTB 3VQ1C 1V27A 4JY4A 4QF1B 4ZUSB 2ZAGA 1J8HD 1UWGL 4ODVH 4QY8A 4LVHC 3O6FB 4GUQA 2E9JA 1SOKA 2XVLA 3CZSA 3OAZH 3P0GB 5BS0B 1OV8A 2ERJC 3SPGA 3QCVL 3P4MA 2YAQA 4PWFA 3AXLA 4PJFB 4NCC2 2XG4B 5DQ9A 2X38A 3RA7H 2JWYA 3HMWL 4WO4A 2PNDA 1QFWI 2YD1A 4XP9H 3GIZL 2R4SH 1JI1A 4Y19D 3TYGH 1YYML 4ZTEA 4JM4L 4XXWC 2C7FA 3V6OE 4I18A 4FQXA 4OBSA 4X83A 4YDLC 2X9WA 5JW4Q 2HTLC 1X6LA 3GT6A 2VZUA 4PS4H 5HVHB 1G0DA 3UMNA 4JFHD 5HVWA 4WWOA 2FYYA 2HX7A 5DHYB 5FGCB 3L9BA 3KD4A 1ADQH 3VU1A 4BDVB 3AS0A 2L8AA 4APQD 5J11C 3TF4A 3EH3B 3BN9C 5BZWA 3ARFD 1H6TA 1HDMB 1FSKB 2G9HB 3MUHL 5HJ3B 3VSTA 4G9FD 4IOFD 5E00A 3U0PB 2I9LB 4OZGE 4MNGE 2ODIA 2ZCKH 4YBQC 3LVEA 4OZFG 2FJFB 5JHLL 2LGNA 2MOQA 4FLQA 4PJ9D 4X7SH 3F62A 1HH6A 3FTVA 3OLDA 1TMCB 4BEIA 2EIMB 3VDCA 4G8GE 4HG4J 4ICXA 2ZPKL 3GXUB 4HF5L 4QWWC 2HRPH 2VLKE 4CC0A 5ISZA 3P2BA 1IAKB 4AI7A 4JFQB 3T0EE 1HL8A 2WHVA 5JO5B 2BIHA 1G1YA 2QSQA 1G0YR 4G8IB 2BNUB 3DGCR 4XAWH 1SYVA 5DVLA 2FUQA 5TDPA 1YEFH 3T71A 1GZQB 2OMWB 3MYZA 3QDJB 5GQBA 3RJOA 1SRDA 4M1CC 4OF0A 1IGCH 4H13C 1KXTA 1LWRA 4YC2B 3MV9B 5IVXF 1OGAD 4HS8H 5IHWA 3O11B 2RJMA 4LARL 3CFQA 4JFFB 5JHDA 3KNBA 2A6IA 2HX9A 4NZFA 2AJ3A 5IFHH 3L1GA 1NDGB 1J87A 1WAAF 3GLEA 3LXAA 1SMOA 4G72B 3MRKB 1EXUA 4YHPA 5FAAA 5T1KA 1T1ZA 3KM2A 3D48R 2QPSA 3LS5H 5DLLA 3OKOA 5JIQA 5E2JA 3VX0A 2AEWA 4FFYH 4L8SA 1S7WB 1S78D 4R2GC 3RBGA 3BZEB 4J3XA 1QBMH 1FN4B 4ANVA 2X4UB 3CZNA 2J1XA 3FC8A 4QRPE 5D9SB 5GGSA 2JKJA 4FABL 4YUEL 5LAXB 4WVRA 1A9BB 4GXVH 4HIIB 4XWGL 4BCYA 5IBUB 2BY3A 4BFGA 4I1PA 4G9DB 5HHVH 4MLSA 3S35H 3ZE2B 1MIEH 3LRHA 2R2HB 4HLZG 5FYJD 3T2LA 3UZEC 2MQGA 1SXSA 5LN4A 4C8XA 4OJFH 1YDPB 5I74B 2D7MA 2IQAA 4TL4A 3LH8A 4HT1L 3EGDA 4RNRA 1U58B 3ASOB 3OZ9H 2ZAHA 5DD5H 1ZHLA 4NUGH 1ULVA 1QFUH 2K4WA 4OM0L 3QQ4A 3CZKA 3K6OA 4IJTA 2GBUA 1E4WH 4RRPM 1YEHL 1TUPA 5CJOL 4O51A 4XBGB 2ITCA 2K78A 1OCCB 3HG1A 4OIAA 4WK2B 2AW2A 4Q6YA 2X40A 4AV4A 3IE4A 4DT2A 3DX0A 2HTLD 3NFPB 3QAZB 5DHVB 3MLRL 3ZIMA 3ZDWA 5B8CB 4WFGD 4O02A 4PUBL 3MPCA 2UUDH 4GEJA 3KCPA 4UM8B 2XTJE 1I85A 4Y16C 5I1DB 5J5EA 1K72A 3OHXB 1B88A 3HAEH 2DQDH 5AL8A 3BN9D 3APFA 4A2EA 4L4JA 1Z5YD 3KMDA 3R4DA 4KJYA 3SKJL 3V0EA 1ORSB 2BNRD 4YBQD 2NY3D 3H9ZA 5B39G 2OP4L 3JT0A 3PJSA 4BSWA 3MBWB 3HG4A 5F0JB 3EJZC 1KTBA 3VNZA 1DJGA 1WT5C 2IQ9L 1QUNA 3ZMEA 3LIZH 3UERA 3HOGA 4QWWD 3HZYB 1REIA 1Q0XL 5C08A 4NQXA 4F8PA 5AW1B 4ZZFA 1ZGLB 1IAIL 1ONQA 3X17A 4LASH 4EIGB 4QT5B 4EI6B 3JYCA 1SY6L 5E08H 1A3QA 1JZGA 3W37A 3KVDD 2QKIC 4WIQA 4Z0XB 1IKFH 2XA8L 1KCUL 3BH4A 3TO2B 2Z64C 4L1BA 4AL8L 4YSOA 1FL3A 3VXQA 3CSYA 4M1CD 3P02A 4YSTA 1F4WH 2V7HA 3E8UL 3OKNA 1GC1C 3CBRA 4G2AA 1W72L 3M07A 5CHNB 1IM3D 1T20B 5E1IA 1L0XA 1HXMA 3MLTA 2W80C 3NIDE 2YAMA 5SX5H 4OLVL 3P30H 3D0VB 3AS2A 3HN8A 3UAFA 1EJ8A 5IFAL 9CGTA 1JTPA 3RWFB 3A21A 2VDPB 4HIEB 4KNSA 3F7LA 5DWPA 3QUHA 2E7HA 2ZF8A 4Y2OB 1UXLA 5DJ2B 4XPAH 3MYJA 4ALAL 5CD5C 2CIIB 5MI0C 1MHCB 3O4LE 4R2GD 1QFOA 4HXAH 1PZ5A 1UVQB 1EO8H 4MZRA 3WGUB 3WKPA 1CTNA 1LMKA 3MDJA 3OPUA 4HPYL 4AEEA 1F58L 4JKKA 2X05A 1BFVH 4N20A 5KSAB 4WW2F 5K1JA 1A7PH 5DK0B 5AAPA 3IDJA 3SE3A 3FRPB 3MR9A 1RZKC 4WI7A 1LEGB 3V7AG 4NJAL 2ED6A 2JTYA 2DF3A 3O45A 2PLTA 4N0FA 1A7OH 1D5IL 2ARJQ 4E9WA 2D0GA 5IIEA 2J3SA 3EYQC 1EXHA 4AIZA 5IG7A 5HY9B 1T4KA 3CFCL 3MV7A 1QHQA 3BPLC 3H7BB 3E9TA 4YPGB 4IBUA 3PHQA 1URZA 2ZOLA 2IFFH 1NAMH 5C09A 5KS9A 4YVNA 3CDCA 3OKDB 1X5IA 3QRBA 4L3EA 4AGLA 4AV0A 2BVOB 2VXVL 5TD4A 1JZ3A 3L3IA 1QOKA 5GGRY 3W0WB 2GT9B 3BZFA 4MMXB 4LLMA 4N85A 3L1OH 3L9YA 4QPEA 2ESVE 5DHEA 2ZUVA 3C5ZC 3IDIA 4GS7B 3GKZA 4UB0L 1FE8L 1J5HA 4QRUA 5T3XH 1AD9B 5KJ7E 4QOKD 3C60B 3ULVL 3NYKA 5DR5H 3BLBA 5H2BB 4KZEH 2B08A 2VUKA 1OP3H 4Y16D 3KYMB 3GSUA 1F90H 4NRXB 2APFA 4NM4L 3UBXI 2NMSA 3QPQC 4OZ4B 1MI5E 3L2LA 3U1SL 4U1SA 2QADB 4NGHL 3SSGA 4JCLA 3I6LE 2CD0A 4WEBH 3PPSA 3O2DA 4JY4B 4QY8B 2W59A 3TJEL 1MCEA 3KLQA 2E86A 4PJBF 3B2XA 1E5ZA 3EJZD 1LDSA 2VDLB 2ZXWB 4JNXA 3ESNA 1I1CA 3TEWA 2VC2B 2IPTL 4Z7OE 2BOLA 3ATDA 3P4MB 4R7XA 2HUHA 2X0WA 5DQ9B 3REWA 1AXTH 3QHZL 3RUGF 1D7DA 1KN2H 4WO4B 3F85A 1YJDL 3FQRA 2W60A 5DD0H 1RAMA 1KUMA 4I18B 4RMRA 2H6UA 4FQXB 4YNYA 3VVVA 1MFVA 1CDBA 2O72A 3UTZA 1GHFL 5DD3H 3WY4A 5KJRL 3G6AB 3ZTEA 1Q94A 1B3JA 2IVFC 2FYYB 1Q9LA 4M5ZL 2CKBL 4NO5A 1GCYA 4ZMOA 1I8MA 3HR6A 5JMRA 5CZVH 2VABA 4LSQH 2Y06L 4H26A 4NKDA 4YHOL 1XH3A 5M95B 1KJ2H 1RIVL 5BZWB 2BP0A 5D7KD 5J6HA 3ZQXA 5E00B 3U82B 2QGBA 4CRPA 4RBPH 2DDQL 2R0LL 5F3BA 3M6DA 4IU2A 4WUUA 1P0SE 1F11A 2XWJA 3HI5L 1ANUA 5E6SB 5E9DA 5CD5D 1HH6B 2WXFA 4DP0X 2HKHH 2RR3A 1LWHA 4K9EC 5F9WB 3VTMA 5ISZB 1KT2A 1NCDL 4K7PX 1NFIA 5CLWA 3QJZA 4HC1H 3S9DB 3W56A 3EJUA 2X44D 4L9DA 3MLYL 2XWZA 5HI3C 1SYVB 1IEHA 1AHMA 5TDPB 3L9EA 3N44B 1MEXH 5T33H 4PGCA 4KZDL 3LN9A 2I7OA 5IHBA 3EFDH 3EYQD 1PD0A 3FW6A 2ZUQC 1KXTB 4LPCA 4XNUH 2R29A 4JG5A 2F9BT 3KNBB 4H2AA 3QXDA 1OXYA 2A6IB 2AJ3B 3CVHH 3K81A 1DYZA 4MCMA 3VXNA 1TJHL 5HDBF 3PAYA 4ZG1A 4YHPB 1EXUB 5T1KB 2XOTA 3C9NA 1T1ZB 5E7BA 3L9RA 3IN0A 2CO3A 5FR3A 5F7NC 3OKOB 5AYUH 4J6RL 2L7JA 1GSKA 2BXYA 1X5XA 2DBJA 2OJZL 3C5ZD 3L2NA 1D5ZA 3WXVL 1VENA 5EOCJ 5IBTH 1RULL 3HC4L 3SDDC 4ZOAA 4RFNC 1FYTE 1MCQA 1MCHA 4HGKC 1BWWA 4UQEA 2XVKA 1ZS2A 4FXLA 2YRZA 1E5YA 3O6LL 5JDSA 4AMWA 4WZ9A 4PRHD 1KENL 3EYUH 3QPQD 1XB3A 3VD2A 5BOZG 2Y9RT 4Z18A 1BM7A 4KRMB 1T7XA 2LW3A 4JPWH 4IBYA 2IQAB 4RNRB 1VEMA 3HHSA 2X6AA 3MCKB 2H1PH 3BRFA 4X7TA 3VGHA 1KCKA 4XXDA 2Z91A 4UOJA 4B96A 3PABA 2ZYHA 4V1DA 3HNVL 2YARA 2DWEA 4HK0A 1KBWA 1AI1H 3QQ4B 5EEZA 1LLAA 5KTEH 4TSCL 2JSFA 1LYQA 2ICES 3A4EA 3HMXL 2VB5A 4OD3H 3NJVA 4JJ5B 3S3PA 4O51B 2ITCB 3Q5TA 2ATPB 2W91A 5AOLA 5GS0C 3HG1B 1CQKA 4YDNA 3IMBA 3IM1A 5DHDA 5B7MA 3PUCA 3HPLA 4MJ2A 4ZTPH 2QQLH 3ZDXB 3V0JA 4GIPD 4LBAA 4O02B 1DANT 4FULA 4F8TA 5AOJA 1IBHA 2NYZA 3I02A 1G1OA 1PG7W 5FHAH 3KCPB 2EVFA 3NCEB 5J4MA 3OB8A 4X4MA 2ZUSA 4YL4A 3IRZA 2BLFA 3MRPA 1XGTA 2AJXH 4JFHE 5C1MB 4M8RA 5GISH 5FHBL 2LU3A 3UTOA 3W5MA 4P23C 3STBA 5JPMC 2JK5A 5DU7A 1D7BA 5IJVA 1DLHA 3PJSB 3QHTC 4K3JL 1J0IA 3LZRA 4BSWB 5AW0B 1E9OA 1OCZB 2BS9A 4G9FE 1ZPUA 4XNYH 1QUNB 3BYYA 3ZSSA 1IM9A 4RGMB 3NZHL 1Y0LA 3PGFL 5C08B 1KELH 4I0CC 4NQXB 2CK2A 1LDPL 1ONQB 2CUHA 4OCRL 4L8CA 3SJVD 3DWTA 5FYKU 4N2CA 1FA4A 4AKOA 3TNNB 4LU5L 3GJFH 5GJSH 5HI3D 4KQ3H 2WO2B 1S8DA 2NDFA 4CKVX 4MZ2A 1K6QH 4N8UA 1IAMA 4HJIA 1F3DH 1FL3B 3VXQB 3CSYB 1M6OA 1NIBA 4KJWD 2Z31A 3QIUC 1MJ8H 2V7HB 5CN2A 3UOAB 1D6EB 3OKNB 4L05A 4JZNA 2XZZA 3VFNA 2VDKB 1HXMB 1NBVL 1J1OH 1J8HA 1Z1WA 2H3XC 3L6FA 1P4LB 3MLTB 4A7TA 1S9KC 2VZTA 5J06A 1C1EH 4R84A 4PW3A 3RIFF 3OAWA 3BT2H 1OGAE 5FW8A 2D2CC 2JI1A 2NLJA 1N5AA 4DUVA 1FZMA 4UQDA 5C9JA 1FG2A 1OF0A 4AYGA 2Z34A 1WISA 1DSWA 3MYJB 3Q6FA 4BSVA 1AC6A 9PCYA 3MBEB 4Y19A 3BP5A 3KJ4B 1FGNH 1PZ5B 5T5FL 3SDDD 2ZKWA 1XMWA 1OAYL 3NABL 4LPYA 4KVCH 1URLA 2XX1A 3Q6GL 4R83A 3IDJB 2CAKA 3MR9B 3P3RA 4KKBC 4ODXA 4W4OA 3W9EA 4AQ1C 4BV1A 4HD5A 3HG0A 1FNSH 3O45B 2X1PA 4N0FB 4YSRA 2Q6WA 5C0FB 4A6YA 3BVNA 3D12B 5IIEB 3FT3A 4D9RD 4DKAA 3F7VA 3ARFA 5TE4L 1NGQL 3TO4A 3N5AA 5IG7B 5GS2H 2WJ5A 3IJSA 2WSDA 2A6KA 1OTSC 3MV7B 2VKXA 3L3DA 3BZ4B 4DWHA 5I71C 3BI9X 2VXQL 2DJSA 3U4KA 4QRRD 5E5UB 4A66A 3PHQB 2ZOLB 1AY1L 1ZANH 1ZTXL 1DJSA 3KYKH 4F9PA 3FUHA 5C09B 2E8ZA 5KS9B 5GS0D 3GRWH 3HTLX 1R3JA 4L5FL 2DQTH 4L3EB 4KX7A 1AGFA 1QRNA 3L3IB 4RSVA 4Y1AD 5F6IB 1I53A 3BZFB 3I9AA 4LLMB 1BXUA 4PJCA 2IO5A 3IDIB 3CNKA 2BVYA 2Z1PA 4QRUB 4QXGH 5JW5B 3SYQA 1QTYT 5DD1H 4TN9A 1WEJH 3DETC 3GSUB 4FS0A 1RP8A 3FU5A 3PE9A 4UI2A 3TPUA 4WFGE 5BV7B 1BM3L 3GSWA 3NCJH 1OQOA 3GMOA 4PB9H 4U1SB 3V4VL 4PY7A 4Q89A 4P23D 1MQKL 1RCYA 4PI0A 1LEKA 2Y36H 2V4LA 3ESUF 4QJ4B 1JNJA 3O6KL 2QPFA 1TQBB 3UC2A 1L0PA 2UZXA 4F7MA 3H9SA 4PLKC 2PCYA 1DBBH 2NQ3A 2P8LB 4IK6A 1G9NL 2BNRE 1R3IH 2ZQKA 4YDKL 3RILA 5L7XL 3IK2A 2ALWA 4HALA 1W91A 1AH1A 3BVDB 3REWB 1E6JL 1HWWA 4CAGA 3BLPX 3MN8A 4PGZA 2C9RA 4FL4B 4XAKE 3G08A 4XH2A 3FQRB 4U0QB 3ZHNA 2ZE0A 1MAJA 3N41F 4Z3FA 4YNYB 2EDJA 4N1EA 3K0YA 4OCYL 3UTZB 4MMZA 5JORA 1GGBL 3LRKA 4H0LC 1T5XA 1AAJA 2KERA 1Q94B 4LSRL 4GBXC 4AX3A 1GTFA 1Z9LA 1Q9LB 4C4UA 4Y4KC 3EO9H 4NO5B 1SEBB 4HQQL 5F7AA 2PCFA 2QJDA 3UROR 1WFUA 2GAZA 1I8MB 2VABB 3BWAA 4H26B 4NKDB 3GC3A 1XH3B 4N2GA 1HFUA 4GAGH 3Q1SH 1L9TA 3KBHE 5IBLC 4L18A 1PY4A 3OZKA 4LSVL 4XVJH 5TE7L 3TWYA 3WS6C 3A24A 5J6HB 1JZ5A 3K3QA 4ZW7A 3FUDA 3ZHKA 5I6LA 4JDTL 1F02I 4IU2B 1MCRA 4WUUB 4R0LC 2NYYC 1F11B 5FCUL 1M3JA 3FTZA 4F24A 3BD5A 5E9DB 2WTPA 1XCXA 3NCYP 4PJ5E 3SOBH 3P3SA 3RVUC 1J5IA 3GFUA 5GS1A 2C8NA 2WKOF 4XXWA 4H0IA 3KCWA 4TM9A 5IROA 4CVZA 1JZIA 5EHFA 1FIGL 3VMNA 3WNPA 4QHMA 1KT2B 4AJWA 1NFIB 4YPJA 2VERA 4MKMA 4NC1C 1DCLA 1EGJA 2WXMA 3D18A 3WEAA 2X0UA 3DOSA 2HSIA 32C2A 4KKBD 1AR1C 4Z8FH 4M6NL 3P0VL 5ES4B 4PGCB 5IQOA 5I1CH 2VKWA 5I24A 5JIKA 1AD0A 2ZYRA 1I3GH 3NFSH 5I75B 2YBGA 1FJ1A 1F86A 4KVNL 4F27A 2CM5A 4EZMA 3BAEL 1OTSD 12E8L 4GH7B 3RFZC 4DUWA 3RY5A 1F1GA 2JCWA 4X80H 3QXDB 2GPZA 1LE9A 4JRWA 3RWCA 4PS7A 3B37A 4HCFA 3VXNB 5M94B 1G7QA 3GXDA 3UBHA 3KLAB 1QTPA 2EYRA 3L9RB 4QXTA 1MFDH 3BDYH 3MGTA 3KWVA 3BUBA 4FQQA 4HIQA 1GYVA 4Y7MA 4XC3L 1KIQA 2GTWA 4M5SA 4YDIL 2F7IA 4P4KC 1D5ZB 1SVBA 4HFUL 2K1MA 1VA9A 1DQVA 4ONFH 2IANE 1YEJH 3DETD 2ZD0A 3B5HA 2Q0ZX 5JDSB 2DBLH 3PP3K 2H9GA 2J2ZA 5C97A 1O7DC 1FRGL 4QOKE 1JPFA 3U25A 3V4PA 5C0AE 3AW5A 1U8PA 4HYTB 5JXEC 1IM3A 1NAKL 3L81A 3QJUB 4HIXH 4HJJH 2W1NA 4X5WA 3HHSB 4PJHA 3QEHA 4LP5A 3QZWG 3QJQB 4PJIA 4X7TB 4ETQA 2I69A 3AT9A 2Z91B 4LLVA 4PLKD 4XXDB 4DP8X 3BIAX 3PABB 4V1DB 2QHRH 3ME0B 4RZCA 2DWEB 4HK0B 4PJEB 2W0FA 1E2VA 4TTDC 3JV0A 4O5LL 4RH4A 3I85A 4OGAC 4QHKJ 3KWUA 2ZXAA 4LDOB 1DBAH 5HHME 1NCCL 5CGYC 1DP0A 3EBGA 1UACL 1FPTH 4G7YH 3H53A 1SZNA 4GBXD 3QFJB 1ZLDA 2V8LA 1XR9A 3S96A 3ZKXB 4Y4KD 5I19L 3I02B 2Q10A 3BKCH 3VE0A 5GGTL 1JNHA 2VXSH 4Q9QH 1KCWA 1NDTA 1W6LA 3MRPB 2VUYA 1XGTB 3MOBH 1UASA 4PREA 1XL6A 1JN6A 4FG6C 1T0PB 4TL5A 1JD9A 1X5AA 3CLEL 5DT1L 5EUOF 2OSYA 4QLRA 3IJ7A 5HDQH 3NJNA 2A6DA 1RUML 1Q1JH 3ILDA 2V9QA 2JK5B 3NQIA 1OM3H 3GMPA 2NYYD 4B9GA 1DLHB 5HHQA 4R9HA 4LDCA 4YVUA 1DBKH 1DQQA 3F83A 5ANME 5D7KE 1INDL 1E9OB 3I74A 2DMKA 2DQEL 5AVQB 3KZ8A 3B7RL 1ETJA 3FU6A 3RVUD 4WF7A 1IM9B 3U36A 1MRDL 1OAUH 3QBTB 4I3GA 3EADA 4RRPG 1Y0LB 2PXYC 4PCTA 2EDHA 4O9HH 2GJ6B 3RBSA 3CHPA