3QORA

Crystal structure of human nuclear migration protein nudc
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
120
structure length
119
Chain Sequence
GSSSKLKPNLGNGADLPNYRWTQTLSELDLAVPFVNFRLKGKDMVVDIQRRHLRVGLKGQPAIIDGELYNEVKVEESSWLIADGAVVTVHLEKINKMEWWSRLVSSDPEINTKKINPEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Nuclear migration protein nudC
publication title Structural Features and Chaperone Activity of the NudC Protein Family.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding, cell cycle
total genus 28
structure length 119
sequence length 120
ec nomenclature
pdb deposition date 2011-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04969 CS CS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3qorA00
2Y22A 2RH0A 2K8QA 4YLCA 3VQLA 3QORA 1WH0A 2O30A 3IGFA 4MJHA 2BOLA 3GLAA 4YDZA 3VQMA 5LUMA 4PBDA 2N0KA 4RZKA 3QORB 1WFIA 5DS1A 4YL9A 3Q9QA 2Y1ZA 1X5MA 2KLRA 3GT6A 4YE0A 1EJFA 1RL1A 4I88A 2WJ5A 4M5TA 3QORD 3Q9PA 1WGVA 2JKIS 5DS2A 2Y1YA 3GUFA 1SHSA 3J07A 3L1EA 2CG9X 4PCKA 4YLBA 4ZJ9A 2CR0A 2MNWA 3AACA 4M5SA 3QORC 2N3JA 3W1ZA 3AABA 2WJ7A 3L1FA 4ELDA 4JUTA 2XCMC 3N3EA 3L1GA 4FEIA 1GMEA 3EUDA 2KMWA 4JUSA
chains in the Genus database with same CATH superfamily
1CDUA 4DGVH 3ARDD 1JPGB 4EN3B 2IQAB 5J13B 5JHMA 2H6UA 4BA8A 2VLRB 2CE6A 4QRTB 4G80A 3MRMA 1ADWA 3SO3C 2WNKA 4XWGL 3BP6A 5FO2A 2NXZB 5HDOA 1F58H 1FGNH 1XF4B 3N1QC 3OAYK 4FL4B 4NIKB 5TJWK 3B2UD 3L3OA 3SPVA 4L3AA 2QTEA 4TYUA 1T2QH 1FZOA 2A1WL 2XPYA 2DWEA 2N0MA 1M3JA 4UDUA 4NQDE 3UAJC 1BV8A 1RMFL 3I02A 3SKUD 2FATL 4YQXH 5FGCE 1AG0A 4UQ2A 4V11A 3ARUA 3AJ7A 5B1JC 3GSNH 2HKFH 4Y4HD 1IVLA 2AJVH 2F7QA 4YHKH 3S36L 4I7ZC 3ZYOA 1ZEAH 4MXWH 3DRQA 4QT5B 5EU6A 1LO2L 1RLWA 3W57A 5A6LA 4M3JA 2BVTA 4M93B 2JQMA 1L5GB 1MI5A 4ONHA 4F57L 4QI3A 1AR1B 2BP3A 2GABA 3B34A 2RHEA 3L7FB 1RZPA 2CA4A 4KPHH 1QATA 2FO4A 2OL3A 3QFDB 4HBCL 1F6FB 4ZTOH 4E41A 2WVUA 4HK3N 4N2BA 1KPUA 2Z64C 1BZ7A 1PLAA 2QGCA 1JBJA 3SDAC 3ZY7A 2WQAA 3QXAA 4GQQA 3GT6A 2YGQA 3D4GA 2AVFA 1QHOA 5AYTA 4BGDA 5LNEA 3PABB 1ZT4B 5D1ZC 5GS2D 5IJCC 1UH3A 4PJFA 5IGXL 3AG3B 1UB5B 3F7LA 1S9XA 4NO3A 3SGEI 1DCEA 3HRPA 3DGGB 3EFOB 3GSVA 1Z9PA 2Y22A 4Y2DD 1HWGB 1R6VA 3DDFA 1JWMB 5HDQH 3JBG7 2IBBA 5I1IH 3ZPDA 2OMYA 3RU8H 5HHXH 4UNUA 4FGMA 3DV4A 3VU1A 4RSYA 4C59B 5KYYA 5AB0A 4D9RD 4D9LL 5SX4H 5IROD 2BP0B 2XJKA 2OL3L 5I1EL 5ABDE 2DLIA 1PAZA 1E65A 3IMRA 3FT3B 2X88A 4P5TD 3FFOA 5IZ7A 4YLQT 3OMZA 1EIBA 2ERJC 3E80A 4UM9A 3BUQA 1IC7H 5J6GB 5GGRY 4XBMA 4G7QB 1FFRA 1CGYA 1JTPA 4UB0H 1DBAL 1Q0YH 3RIFF 3IDIA 2YPVA 4IDJL 3SBWA 1YPZE 4IRJB 1ZK9A 1DQLL 1UH2A 3LN4A 3TTYA 4LSRH 1BQHB 1EJFA 3ATAA 1T66D 3GSNB 1NCNA 3GZKA 5I6XB 2A77L 5KVEH 4XNXH 1F4AA 1HHIA 4UM8B 3VFNA 1DQVA 1X5ZA 3DX3A 3X11B 4LNVA 5GRJH 4Q9BA 1EEZB 4O9HL 5LCVH 4JFHD 1IMHC 4FULA 2FIKA 2XTJB 2UY6A 1RIUH 4MMXC 5F7KC 1NFIA 5F70A 4WU7B 1S78C 5SWQB 3E3QE 2FH6A 1HESA 2ZUYA 3TONA 2AJUH 2B20A 4OT1L 5D7KD 3EDEA 4ZFZB 3DURA 2H5UA 1JMXA 4F20A 5B7EA 4Y4HA 5HBBA 4PJ6A 4PY7A 4FNPA 4QDGA 3L5WA 1NGZA 4MA1B 1KEMH 4E0RB 4PJIE 2LLLA 4P07A 3LKQB 4X6CF 4WZ9A 5DWUH 3LKNB 4ELME 2Y7NA 2R59A 3WN5A 2FSEB 4UTBH 2YPVL 3VMOA 2ZUUA 1R3KB 5G4MA 3F84A 3C5JA 3IFLL 1ZVYA 3IDYC 3GMNA 5EA0L 1U8OA 1SMOA 3ZOAA 4E42A 2C26A 1NWOA 4LGRB 4BZ2A 1CI5A 1CFNB 4XC1L 3UTOA 3PHSA 4N1EA 1OW0A 4XOAA 3AAZA 1R0AL 2XNAA 4G6JH 2NY7L 3H1ZA 4LOEA 4G6FB 4K4KA 4EI6A 1DANU 4GOSA 1QWHA 4QWWC 4L3EB 3SZKC 2A1WH 3MRBA 5DC4B 3DETD 4ODHL 2LGNA 1CGWA 2VXVH 2QEJA 2VJXA 2P8LB 2WLHA 1PG7H 5I8CB 1MRDL 3MUGA 4YHIB 4Z7WE 1ZGLB 1FORL 1FNLA 3NZHL 2P44B 3ES6B 1WBYA 4UOW1 2J4WH 4WV1B 5I82A 1CLYL 4M1CD 1TZGH 2NW2B 4MGXA 4MJJA 1LO2H 5IROA 1PJWA 1TZHB 5HY9B 2CJUL 3ISYA 4K3JL 3SDXE 4EI5C 3FQRB 4MD0B 4UAOB 4F57H 3FMGL 5JA8B 4KO5A 4MAZA 4PVMA 3AB0B 3M17B 5MI0C 3IE9A 4Y4KB 1MFEL 2B08A 3LIUA 3I75B 4P5TA 4R3SB 1QEXA 3VRJA 4DKDC 4HBCH 4H44C 3MXVL 4PYHA 2R23B 3EFDL 2FWLB 2IO5A 4DEPB 2VABB 3UXFA 1LEGA 5AW6B 4KKZA 3ZDXE 1A6VL 5DGRA 3BQUD 4PRPD 5J5EA 1KV3A 2UYLB 4JDZA 3HG4A 4G8GD 4JANB 2EEFA 3IU3A 2Z93B 3DV6A 4XGZB 1DQJA 4EVNA 2WBWB 5E5UB 5IGXH 4NN6C 3GXMA 3MRJA 1PPIA 1PYWA 1S46A 2EDHA 2D4FA 4ZQKB 2G5RA 4NWUL 3QRGL 4E5XA 3WIHH 2Y24A 2ICEB 3GSOB 5B3JF 3NJVA 2JH2A 1BQRA 2VUKA 2KL6A 3E9TA 3T1FA 3O45A 1E8YA 4LLQA 4KDVA 4MBOA 1FN4A 1IKOP 3BVDB 3E6FA 2D7OA 3TVMD 1LO3L 3T77B 2E7HA 3O3EA 1MW1A 1AQKL 1HZHH 1N5YL 3HA0A 1D5IL 1AGFB 1A3RH 2CDGB 4C4UA 2OL3H 5I1EH 5BZDB 2WINA 3V4VH 1O6VA 3QXUA 2QMKA 2HTLD 3D69A 4I4WB 5A6MA 5JZ7D 2JJVA 4X8GA 4OKVA 3Q8FA 3LPPA 5HI3D 3HUJA 4PJGB 1J1XL 2V9QA 3DX9B 4PG9A 3BXNB 3O81A 1ZWIB 3NCJH 2ZYIA 4Q6KA 4IDJH 3V8OA 1DQLH 3DJZA 1A0QL 1UZ8A 1NMAH 4K7FA 3HZYB 5HSFA 3OKOB 4PW9A 1KXQE 3QR2A 4LHJB 1IGYB 4WI8A 4F3FA 1YEJL 2A77H 2AC0A 4FN0A 2AK4E 3OKMA 1Y07A 2WLLA 3L08A 4LBAA 5IMLB 4O9HH 1OP3K 4K7PY 4LT7A 4ZTPL 4R83A 4A7GA 1NFAA 4JFVA 3RVTC 4GG6A 4UINL 2Z91B 2EECA 1JGVL 4LCIL 4AE1A 5EB9A 2ESVA 3SBQA 3J7HA 3IRCA 1T03L 1JK8A 5I8EB 2WKOF 1LD9A 2VUOA 5ESQA 4G80B 3T2OA 3MRMB 4OT1H 2IXQB 3BP6B 4H88L 3GLAA 1XDTT 2CO2A 1T89C 2XN0A 1YA5A 3RVVD 4CADA 3SPVB 2WO3B 4XBEL 3L3OB 2GHZA 5DMIL 1FZOB 2DWEB 5LXVA 2FJUB 4OZHF 1GW6A 4M29A 4UDUB 4J2QA 4YFEA 1ETA1 2KLTA 3O3AA 3GPSA 3EJZC 3C87A 5HHMB 2YPVH 2X3CA 2K4AA 1AKJD 1LNUA 4NNXB 2IWKA 4G71B 4UQ2B 1RU9L 1BVLA 4OI7A 1KCVL 5EA0H 3VGGA 4KKLC 5D2LE 3DRQB 5EU6B 1BMGA 2OTWA 1AMYA 3BQUA 4F9LA 4PRPA 4YHNA 3HPJB 2ENJA 2W91A 4G8GA 1MI5B 2QV4A 4M7JL 1FC1A 4ONHB 4UUJA 1UEYA 8FABA 2DL2A 3QC6X 3UCQA 4ZNEE 2FO4B 2OL3B 1AHWA 2NY7H 5B1JA 4E41B 2DI7A 3RBGA 4MQXD 3RA7L 3VD5A 5BQ7A 2UVEA 4O58H 1KPUB 2OFQA 4RX4D 3RX8A 4ODHH 1LP9F 1BZ7B 2AVGA 3QULA 1XCTA 1S2EA 1WZMA 2D7MA 3NAAL 2Y1VA 3QXAB 3WFEH 1FORH 1YNTF 2COVD 1PDKA 3OWEA 4QJ4B 4MNQD 2E6PA 1IGCH 5H37H 4DZBA 4PJFB 2A9DA 3T3PE 1CLYH 2BIIA 4U2YA 2DV6A 1S9XB 4LFHD 4NO3B 4DJMA 1G7MA 1PU0A 5D1QC 4G7SB 2E8YA 2M26A 4KROC 2HTKC 1NAMA 4KITB 3FMGH 1OT1A 1RUQL 4X0KA 5DLLA 5C0DA 1MFEH 2OMYB 1MDAA 2JFCA 4CSTA 3DV4B 1CD9B 3MXVH 1WFTA 2DMBA 3EFDH 3QK0A 4L8SA 4NYLA 2Q1EA 2FK9A 4BZ2H 4CILA 4HWBA 2P43B 1WD9A 2PKDA 2YPKA 5DMKA 5GS2H 3K1DA 1LEIA 1LDPL 3S98A 2YAEA 4PBWD 2X9YA 2ARWA 3GBMH 4RFNC 5JW3L 1MWOA 2VM4A 3C60D 1P0SE 4IBWA 1TDQA 4UM9B 3HEIB 3B7UX 3UTSE 4NWUH 4YSAA 3T6XA 2OJ1A 1YMHA 3X17A 4U6TA 2H6PA 1OSZA 3LN4B 2O5XL 1RCYA 3ARDB 2EEBA 3VFMB 5IMMA 1QFWM 2YKKA 4H8HA 2EE6A 1B0WA 4XPBL 2FQGA 1SLXA 1LO3H 4AQZA 4B50A 5HPOA 1A6UL 4OJYA 1HHIB 5HDWA 3VFNB 4UZGA 1NAML 2HWZL 4QXWA 3VYOA 1N5YH 1WT5A 1JXKA 1D5IH 3MUY1 4FQIL 2FIKB 3RBSA 2UY6B 1HQRA 2OR7A 3RB5A 4I1PA 5I2IA 3MRPA 5DD0H 1NFIB 3QIUC 3QORD 3AVEA 4S1DC 1BMWA 4PD4J 4HWBL 1NKOA 4X0NA 1IO4C 4DUXA 1E2VA 1USQA 4XOEA 1ZLWK 1AKJA 1JE6A 3FSVA 1J1XH 3LQZA 3DURB 5D1XE 5AKVA 4KDTC 4Y4HB 4HLEA 1RZJH 4YFDB 2JK5A 4UMGA 3UTZA 1A0QH 3TV3L 4AQEA 4PY7B 2VM9A 3L5WB 3ENEA 1NGZB 3FO0L 3UTTD 1NL0H 1GYAA 1YEJH 4GKOA 3P9MA 2IANE 4X7TA 3ZE0B 3WN5B 2Y6SD 1I1CA 4C58B 1IM9A 2JKXA 4NO5A 2QVIA 1N3NA 1XR9A 3BPCA 1DVFD 3BFWA 4EOWL 3C2AH 1KTCA 3KPRA 1IM3A 2Z8VC 2CRYA 3BVNA 3C5JB 1IBYA 4UINH 4WFED 5H8DA 4OF5A 1JGVH 3GMNB 4E42B 1U8OB 4XMZA 2R0LL 5C7XH 3NTCL 4DUWA 1OLZA 4LU5L 1T03H 4GXUM 1Z5HA 1EVUA 1YRKA 3L3DA 4Y4FA 4Z7NF 3EJRA 4OF6A 3Q43A 3AAZB 4H8UA 2UZPA 3P3RA 2J8UF 3V5DA 2XNAB 4H88H 4YDKL 5SWZD 4XBEH 2PWDA 3SKNA 5DMIH 2EDOA 5TE6L 3MRBB 5AVYB 1G5AA 4M03A 1JG9A 2NY2D 4QNPF 4JHZA 1RURL 4UQEA 1CURA 3KGUA 4GP5B 1OKEA 1N19A 3LNGA 5DEGA 5AB9A 1BQUA 1A1MA 1R33A 4OH2A 3RQ3A 5KWYC 2Y7MA 3ZDYF 1C5CL 4KBPA 4NNPL 4OLZL 1RU9H 1K72A 1NFDE 1WBYB 5HVFB 5L0QB 3QJZA 1U91A 4TVSa 5A7BA 3MX0A 1A3QA 1WUNT 1K9TA 1FVDA 2YEZB 1UYWL 4XVJH 2AS5M 3S36X 4M7JH 4PSPA 1WFUA 3RWDA 5E23A 2MQ3A 3C60A 4P5TB 2WLKA 2XY1A 5KUMA 1UWXH 3HC3H 1WBXA 3VRJB 2K7QA 1OTUC 4PY8J 3PY9A 4NIYE 4U3SB 4DF9A 3K2MC 1LEGB 1A3LL 4M5ZL 4ZW7A 4RA0C 4RSVA 4JDZB 3DI3B 3QJXA 4EI5A 3HVNA 3NSDA 3MU3A 3CBKB 4ZS6C 2PYFA 3KWXA 1EDHA 1Z1WA 3NGBB 3VM5A 4R7XA 3G08A 5DJ2A 3DV6B 3WS6A 1DQJB 4C56E 4EVNB 2XFGB 1F2XK 2X42A 4FLQA 1U21A 3MRJB 1MJJA 5HGBA 1PYWB 2EDTA 4JHAH 3ROLA 1OB0A 3WMQA 5E6RB 3ZKXC 3NZUA 2V3EA 4LPTA 4GAFB 4TLTA 3L95A 2ZD0A 2P1YA 5EBWA 3H9SE 2OZ4A 1RERA 1RUQH 3WNNA 3KLHD 2P47B 3T1FB 3O45B 2VN5A 5D7JD 3O9WC 1FN4B 3E6FB 1JHTA 4H4NA 3TBWA 3QCUL 1HTYA 4LVEA 3HE7C 4LPXA 1D7CA 1AANA 1LDPH 4EKJA 3QPQD 4B9IA 2IPUK 2WINB 3UTTA 4AT6B 5JW3H 1PKQA 2Z7WA 4P48A 4YDVA 1CTMA 5JUEL 4B97A 2MJWA 2E74C 3D69B 5INDA 3KYNA 4OSUH 4OKVB 4WI7A 1O7SA 3HUJB 2AXFA 1YDPA 4PG9B 4UZUA 5IMKA 2J71A 1QSFD 4LIQL 3JVGC 1P5VB 2X89A 1P2CA 4AUUA 1OO2A 1UZ8B 2J6WA 3KPNA 4K7FB 3S3DB 1MAML 1YPZA 5E2UL 4F7PA 4QCIB 5LGKA 4QKTA 4F3FB 2UX7A 3L48A 5FO8A 4PMEA 2BW4A 5BRZD 2C7UA 4ECNA 1J0JA 5JW4R 1X5KA 1BDYA 1A6UH 2OJEB 1KELL 2WLLB 1HH9B 5L4JA 1N18A 4MZIA 5D1XC 1NAMH 2OZ4L 4KZ0A 4NZTL 1JTTA 3II1A 1IBHA 3K8LA 2FEEI 4FQIH 4GG6B 2MHAA 3N43B 3NESA 5LAXB 2YSSA 3VI4E 1RV6X 2AW2A 3QZWG 4OFKA 2G9HB 4FI8A 4HBQA 4JFWA 4PJEE 4LCCA 5BS0E 4HWBH 3DYPA 3PWVA 3B2DC 1LE5A 2ZX5A 3JT0A 1JK8B 2P42B 4N2NA 3L1OL 4CGTA 1Y7VA 2QGDA 5ESQB 4HJEA 4FMFA 4H20L 3GXTA 2XHNA 1QOKA 3ET9F 2E4TA 5CJOL 2CHZA 3TV3H 4WEBL 5T3XE 3OKLA 3MBED 1XB3A 1DJSA 3FO0H 4CBPA 2LU4A 3RWEA 3VQ1C 3TN0C 4L0YA 1P9MA 2UZIL 4PJIA 3VACA 2ORBL 3O3AB 3T5WA 1RY7B 4XNYL 1LNUB 3V4PA 1NCWL 4KHTL 3FO2A 4EOWH 3HZVA 3DPBA 4ISVA 4ZUUA 1BVLB 4M4RA 2NYZA 2V2WA 3K0YA 2F15A 3KBEA 4MXVF 4YBLC 2R0LH 3BZDA 3NTCH 3P0GB 2OTWB 3BQUB 4LU5H 4PRPB 1N6VA 3CFEA 3GJFA 5C0JA 4YHNB 4G8GB 8FABB 4UUJB 1L7IL 3EYUL 1F3JA 5IHZA 5BRPA 2QSCL 3GM0A 1AHWB 2DY2A 2YZ8A 2YD2A 4YDKH 1NGPL 3K6SA 3N5AA 5BQ7B 5TE6H 5BV7C 1NM9A 3CFCL 2KLSA 3DLQR 3N44B 1H3UA 3LRHA 5IOPB 4XCNA 2V0AA 3QULB 2J1KA 1XCTB 3LX9A 1BF2A 5CLZA 5IR1A 3O2DA 5I1GL 4IW4C 2Z4TA 1HI6A 1FG9C 3TEXA 4K3GA 1HE7A 4Z7WA 5D2NE 5D7JA 3M7OA 1C5CH 3FUNA 4DZBB 2FYVA 4KTDL 4HKJA 4NNPH 3TVMB 1QFOA 3MLXL 5HYJE 1AOHA 4LCUA 2ZNXA 5DXWA 3K8MA 3D33A 1NDGA 2CRZA 1SN0A 1G1CA 2O5NA 3U79A 2IQ9L 1UYWH 1EO8L 3V4PL 3WE1A 5HHNA 3QUMA 1NAMB 4X0KB 4UBDD 4WQOA 1SOXA 3W38A 1KTRL 4KUZL 3ZE2B 3JXAA 1OQOA 2NY4C 2G75A 4L8SB 1OSYA 4NYLB 2H2PC 4KXZH 1FLTX 2QQLH 1IFHL 1A3LH 4K2UL 3BRGC 1P4LA 2QPFA 2YPKB 4M5ZH 5TDOA 5DMKB 3EOAA 5I71C 1E4WH 5D1QA 1LEIB 2WB7A 4Y8DC 4MJIE 4OM1L 3BCDA 3V7AG 4GKZB 4OFIA 2CH8A 1EHXA 1IGML 5JIDA 1H6EA 2A83A 4L5FE 1H9DA 4EF3A 1P6WA 5JW4N 1HHGA 2W60A 2HT3D 4B6ZA 3O2DL 4RWYL 1FI8C 3UO1L 1YMHB 4WY7L 2OAAA 1OSZB 5KSAC 2AQ3A 2XQYG 1AXSA 5IMMB 1GC1C 2A9AA 4GKLA 4KUCD 4LCWD 4LHUG 4IQHA 1MW2A 2E9BA 2VL5A 5F1NA 3QCUH 5JORA 2ZWLT 2WNGA 3QUML 3POHA 5MEND 3H4FA 3IB4A 3R19A 3PGDA 3MBEA 1HQRB 5I2IB 5T5NF 1VZGA 3MRPB 4KHXL 2GBUA 1NPUA 3SKJL 1E3XA 5JUEH 2K7PA 5SX4I 3U4BL 4NP4L 5BMFL 1X7TA 4JDEA 5DJZA 1B2WL 1KBPA 3MYZA 1NBCA 1AKJB 1Q1PA 3KE0A 3LQZB 5KN5B 4K5LA 4LIQH 4IIQA 5MHSD 2PTTA 2JK5B 5LG1A 2H1XA 2N1TE 4AQEB 5B4MC 2ZPKL 5E2UH 4P2RE 1T2XA 1UD6A 5EEXA 4FLRA 1QA9A 1H3WM 3OJMB 1KELH 1IM9B 4NO5B 4K8RC 1A6TA 2OZ4H 1H6UA 1XR9B 3BPCB 1JV2A 5EC1A 5I66A 5J06A 1IM3B 3KPMA 3OAZH 4KDTA 3BVNB 3LZLA 4UQDA 5DZ9A 5LUMA 4N0UA 3EW3B 2F7PA 2CNYA 5J6SA 3BP4A 4JJOA 4PJ5E 1GMIA 2CIKA 2Z1PA 4S0HA 4JN2A 2M1KA 1BIIB 1IBBA 3L1OH 5E51A 3MROA 3L3DB 2A9BA 3D5OF 4Y4FB 4H20H 2LT9A 2A74C 4M6AA 4CMHC 3V5DB 1DVTA 1Z3GL 4R2GC 3CZEA 4XMVA 2PTVA 5I24A 4WEBH 3HHSA 5JHDD 1T0MA 3MODL 4NRZA 1E2ZA 3PDOA 4GS7B 1QKZL 3SKNB 5C0CD 5A2LH 2DD8L 1S5HB 4Y9FA 2ORBH 1OGAE 4KXBA 2IWGA 4F5CE 1A1MB 1P4IL 1SJVA 4XNYH 1Q0EA 3KDPB 1NCWH 4KHTH 4AM0Q 5ECGA 4JFEA 4DK5A 1U8PA 2CBPA 4X4KA 5KSUA 1TEFA 2GJZA 1U91B 1IB5A 4LSUL 3MX0B 1GAFL 3RNQB 1FVDB 4HQQL 2UWEF 3STZA 4X6BA 4URTB 1L7IH 3RWDB 3EYUH 1U2CA 3C60B 5D2NC 5CLTA 2QSCH 1WZLA 3M6DA 4LQFL 1NGPH 4HUUA 2OYKA 1M57B 1PD0A 9CGTA 1PD6A 4XN5A 5FW6A 5GIRA 5KSBA 2XA3A 3UIYA 3G04A 3CFCH 4RDBA 4ENED 2MWCA 2JI2A 1BXUA 1MCDA 1AGEA 3FQWA 4PWHA 3IDMA 1DJGA 2HRHA 3A4EA 2F08A 4K73A 4EI5B 5CZVL 5I1GH 4F7KA 2A2QT 2F0CA 2PYFB 3QJSB 4LCWA 3HZMA 4PCKA 3ZKQD 3G08B 5DJ2B 4FG0A 3A24A 3BKJL 1U9KA 3IU4H 3MLXH 1ZE3H 1RKRA 4GMTH 1MJJB 5HGBB 4JPKL 2B5IC 3ROLB 4C4KT 3S9DB 3RFZC 2E7LC 4N8VB 4RRPG 4ZUTA 3SEPA 2IQ9H 1A64A 3L95B 3KPTA 1EO8H 4PB0L 3TIEA 1C5BL 3V4PH 5EBWB 4QHNB 4FA6A 3QORB 2J88L 3D05A 4KUZH 2BSBA 1HC1A 3WEMA 1OF2A 3NUKA 4HCIA 4JFUA 1C9SA 2W0FA 1JHTB 5C86A 3FF7A 5DF0A 3TBWB 1AZVA 1LK2A 3K5RA 3GJFH 3NSCA 1IFHH 2IFGA 2XN9E 3TFKC 4K2UH 2FWUA 6PCYA 1XD1A 5L88L 3MV9D 2XQ0A 2P5EA 1H15A 3FU9A 5E8PA 2IH3B 3EDFA 1XF1A 3UTTB 4OM1H 4KKCC 5C2UB 1DUYA 4JKLA 1PKQB 1IGMH 2GW5A 4YDVB 4YDMA 5INDB 1KCUL 3KYNB 3AXIA 3FU8A 1KT2A 1IAOA 4DN3L 1DVFB 1EHNA 2AXFB 1GYCA 1YDPB 3O2DH 3SE3A 5IMKB 5JPNA 3T3PF 2V5TA 3CCHB 3WNMA 4WY7H 5J8OA 5B8CC 1A9BB 1P2CB 1ZJAA 1N4XL 4F7PB 3QQ3A 1CGTA 4KI1A 2WWMD 5FO8B 4P2OC 1E4KC 2XV2A 3ZLQC 4JCWA 2C7UB 3KYKL 4LEOA 4LSTL 1RZKC 2Q5BA 4KI5D 5CP7A 2ATAA 3GXUB 4HWUA 1KPVA 3QUMH 4L8BA 2VR8A 3BMWA 1TJHL 4I2XA 5JHDA 1N59A 4ZO7A 2NNCA 1G84A 2MHAB 2ZCKL 2Q9OA 3FTGA 1JFQH 1QLFA 3WU1A 3L8QA 4LCCB 2LR4A 2N59A 4TSAL 4ABUA 3PWVB 3U4BH 2C9XA 4NP4H 5BMFH 1LE5B 4NB7A 1KC5L 2J1YA 2F7RA 3NSFA 4KZDL 1UA3A 4J3XA 4F91B 5DO2D 2WNXA 4OGAC 4V1DD 1HE8A 3OKLB 2ZPKH 1BXVA 5F0JB 1TXKA 2CMRL 2FJGA 4F37F 1NPNA 2Q8BL 3KG5A 1XEUA 2IFFH 3RWEB 3Q05A 5C1MB 3HNTL 2B3IA 2HPTA 5GRZA 2B2XL 2QQNL 3UDWC 3MGTA 1AYOA 2ZF9A 4HIEA 5F7LB 1GGYA 3V4PB 2G0KA 3FO2B 1CVSC 3HZVB 3BH4A 3I6GA 2BDNL 2FO8A 2Q3XA 3DPBB 2NNFA 4IOIA 1JD7A 4ISVB 4M4RB 4MRCA 4ZUUB 2V2WB 3S88L 4PTUA 5F7HA 3VD7A 2YWYA 5LO7A 3NVQA 3DX8A 3U82B 4FQCH 1DEEA 3CSBA 3CFEB 3GJFB 1SOSA 4GRWE 3TN0A 5C0JB 4P2AA 4JUSA 4HAKA 4JM2A 4L3FA 3UZVA 1F3JB 5IHZB 5AOMA 1QI3A 1Z3GH 3M8OL 5CHNA 3K6SB 3MODH 4AGMA 1F42A 1QKZH 4DGUA 2Y5TA 3RVXD 1HL5A 2RQEA 3QG6A 4XCNB 1H3TA 3L2LA 3HS9A 5HYEA 2Q86A 4YXHL 5IR1B 1P4IH 3PU7A 1HI6B 1QI5A 5D7JB 3SJVD 3B7SA 4OLYH 3U1QA 4V2BA 3T08A 4LCUB 1R5VA 2YR3A 2MIZA 4LSUH 1EXUA 4E9VA 1NDGB 1GAFH 3SODB 4BD4A 1V7ML 5HHNB 1U8IA 3QUMB 4Y2DC 4XX5A 2ED8A 4HKXA 1E8WA 3LB6D 2Y7SA 3DVNA 4LQFH 2G75B 4JM0A 1HIML 3ARPA 4PP1D 3IS0X 4YZWA 1P4LB 1QSFB 5JW4Q 3ASNB 5TDOB 1MG3C 3EOAB 4QRPE 4U1GC 4N0FA 5MP6L 5CZVH 4KROB 5DD1L 3EDJA 3RRQA 1IGIH 1I7TA 3QISA 3QXDA 3RGVD 2A83B 3OL2A 1HHGB 2YOCA 2W60B 1E5ZA 2Z31D 1T1ZA 3OXSA 4JY6A 4PB0H 1C5BH 2KYIA 3RVUC 5L4MA 5INCA 3F2LA 4BKTC 1AXSB 2JXMA 2XXFA 1TT6A 5F7NC 3BVTA 4S1SH 5B22A 2J88H 5FIEA 5DEZA 3TESA 1NQBA 3K6DA 5GGVL 2EE0A 3A6OA 3AG2B 1GGBL 2VL5B 5F1NB 5IB1A 5BV7L 1A7QH 5JORB 1UZ6F 5JIIA 4H1LG 5L88H 3L7EA 4V1DA 1CWVA 4OM0L 3PGDB 3MBEB 1J18A 3QEQE 4LDOB 5DVLA 4TLSA 1ODUA 3SYOA 2YXFA 1EXGA 1TITA 2DWDA 4W9IC 4NC0B 1LWRA 4Z6AT 3OBAA 4JDEB 5DJZB 1KCUH 1W6WA 4LK4A 1FH2A 1S7QA 4XMPH 2WZPA 2DZEA 3CQFA 4HIHA 3KLSA 2AMGA 3QAQA 3FTWA 4NKDA 3I84A 1G0YR 4IIQB 4AJVA 4F7TA 1LO0L 2PTTB 3JZ7A 5BZWA 1JF1A 1E7UA 1QBMH 4NQVA 4RLDA 4XX1G 4XVUD 3C9NA 5HJ3A 5CEZE 2IPKA 1TSRA 5KS9A 4JO8A 1QA9B 4R97C 4XOCA 4LSTH 2HVBA 4Y16C 1BOYA 1M6UA 1A6TB 1V8HA 4BUQA 1CQYA 1GSKA 1JV2B 1TO4A 1TJHH 4JQIL 1LGVA 4HAGA 4L4JA 4XXDA 4FKKA 1R46A 5EU5B 1FGVL 3KPMB 4W4OA 2DJ4A 3MJ6A 3I9AA 4NZFA 4N0UB 5FV2A 1HCYA 2FB4H 1CDGA 1SXBA 3CVDA 4GG8A 3ULUC 1V3KA 2O72A 3JTBA 2CIKB 3CHPA 1KC5H 3EH4B 1FFPA 1KJ3L 1PY4A 3MROB 5F1OB 3U1PA 4PVBA 2FL5B 1I7UA 4KZDH 1KGCD 1CT8A 4NN5C 3SJVA 3GK8L 5E7FA 2WTPA 1VRSA 1N6UA 3UC0L 4NRZB 3PDOB 4HT1H 3T8MA 2OMTA 4PWEA 2O61A 2Q8BH 3DETC 2ZOWA 3HNTH 3WV0A 3RG1C 1XGPA 2B2XH 2F5AL 2QQNH 4KJPD 4K3DL 1HFUA 4U4BA 4DZ8A 5IHBA 3KPSD 3IGLA 1BFSA 3HN3A 2MCMA 4OZGE 4JFEB 1T4KA 1U8PB 1UFUA 2D9QB 2X6MA 3LAFA 3LXUX 4FYTA 1T7VA 1H0DA 1Y18A 4P06A 5BQDA 1LEKA 3VI3A 4M61A 3PV6A 4EUPG 1AGBB 2GJZB 5KSUB 3BPNC 3I2CL 3MAWA 5CLYA 3S88H 2CA3A 1Y6NR 3C6EA 4PJ7A 1P69B 1E9OA 2UXVA 3LNFA 3STZB 4PJEF 3NJKA 4X6BB 2BXZA 2N7BA 2X4UA 4MQSB 1C08A 5F6HJ 1OAZL 2CJTA 3CN2A 4MNQE 3RGVA 1MRFL 3M8OH 2C1PA 4HUUB 3UPCA 2MQ0A 5GIRB 3STLA 5KSBB 1H8LA 3AQZA 3G04B 4PJGF 2ENYA 2F8IA 3L5JA 3PRZA 5LN4A 1W0VA 1CF1A 4I89A 4M8VA 3CSYA 3FQWB 3IDMB 4OV5A 3ARGC 4UQCA 3QHFL 3GLEA 5GRYA 4LCWB 2QLVB 3HZMB 1QW8A 5GRUL 3HC0A 2WMPA 4R7LA 2EKSA 4JR9L 4BRJA 5JPMC 3CDZB 3QUYC 3HAEA 4A2FA 1SQMA 3ETTA 4I0CC 4HYTB 4Q6IB 1ACCA 1V7MH 3TIEB 5C6PB 1AH1A 1ZV5A 3ML9A 2NY0C 3CLFL 4QPEA 2B9BA 1EK3A 2ZCHL 5FA3A 5I66B 4MNGA 1MHPL 3MLRL 1OF2B 2XWJA 3FFCE 5IW6A 3V7MA 2W0FB 4JPIA 2FT6A 2R1YA 1VA9A 1E9PA 1OT4A 2B77A 1K85A 3IMTA 5FCUL 2E6QA 3ZT5A 3FC8A 1H15B 4P04A 1OP3H 5E8PB 1SBBA 1VB9A 2GEEA 5MP6H 1NBYA 3KJ4B 5F9WC 3IT8D 1A7RL 1DUYB 2D3NA 2D03L 2Z8WC 5DD1H 3IPBA 4MJIA 3TNMA 4CRPA 4MQTB 1J0HA 1WA0X 2VAJA 1KT2B 1IAOB 2JKTM 2AJYH 2XY2A 4QD2E 4YHPA 5JPNB 4NM4H 1VGEL 3PAUA 5C0ND 4AMKL 2WAHA 3VFUA 1BJMA 5KVGL 1RHFA 2YPLD 3QQ3B 4XP4L 5DQJA 3K4AA 4XMUA 1GGBH 5BV7H 4LEOB 1G0DA 4WUUD 1KZYA 4AQ8C 5FXCH 1KPVB 4L8BB 4AYMC 3MLTA 3DSFL 4M43H 3SQRA 1YLBB 5AALA 4K5MA 2R2BA 4I2XB 4OM0H 5JHDB 2NY5C 4TUKL 3WFDH 5A2BA 1UT9A 5AZEL 2DS4A 4HFWA 1QSVA 4FQQA 4JQVC 2OSXA 3FTGB 4P4KC 1QLFB 3NIGB 4KXDA 1KWKA 5JW4M 4PJCE 4AQOA 3PGFH 4F1SA 3WIFA 3ZUCA 1RQ5A 3FQTA 4FXLA 2G30A 4N9GA 1KJ2A 1LO0H 2DTSA 1SBSH 2LFEA 1R34A 1QSED 3JWDC 1JMZA 3UEZA 2MOVA 3O4OB 4NC2B 4Z0XA 2FJGB 4TM9A 3ESUF 4JREC 1ROCA 2NNRA 1UM4H 4FFTA 4MMZA 3MGTB 1QEWB 4HIEB 2MCPL 4QAMB 3AACA 3NCEB 1FSKB 1G7HA 5DZVA 3I6GB 1FGVH 5CJ5A 4IOIB 4NKMA 5SWZE 3BGFC 4WFFE 4PTUB 3IMVA 5I17A 3X13A 3DX8B 5SWSD 1X5XA 1DEEB 4PJ5A 4NHCH 3TN0B 1KJ3H 1T0PB 1M2VA 2HLFD 2ZICA 2ROYA 1L9RA 4KJQD 4JM2B 1OF0A 3UZVB 1OPOA 3GK8H 3UDWA 1KYOK 2EDWA 5AOLA 1JCVA 2AQRA 2XIBA 3UC0H 5CHNB 3SD5A 2YAPA 7PAZA 4LL9A 4LSQH 2AEQL 2CG9X 5ABAA 4ACPA 4G83A 1GC1H 4QHPA 4DP2X 2CKBL 2Y5TB 2FR4A 1GJIA 3QG6B 3TM6A 4CNIA 1HNFA 2BS9A 2RGSA 3OLDA 3LZOA 2DWSA 2Q86B 2ITCB 4FQHA 1Q0XL 2W9DH 4D2NA 2LV4A 4TQEL 3DDGA 3EYSL 4ZNCD 1X9RA 4LVNB 4DP0X 5F7EL 3PGCA 4Q6YA 1L9PA 4K55A 4NLHA 4X83A 2VZ3A 1S7UA 1ZGLM 3BPOB 2AK1H 2E9GA 1R5VB 1YY9D 3GXFA 4FXGA 4PBVC 1NOAA 3I2CH 5C0BE 4XPFH 4UT6A 1EXUB 1VESA 3DWTA 1UT2A 2KZBA 3O8XC 1EA9C 4OF3A 5BV7B 1EXHA 3BC9A 1FCCA 2QHRL 1U8IB 2V2XA 2IOOA 3CZJA 1FDLL 4HKXB 3OLEA 2X6CA 2EP6A 2VLJE 3TFBA 4JKMA 3DVNB 3HKFA 5JDJA 4CU6A 2EEXA 3CAFA 4QJ3B 4DKAA 5IVXB 3ZSSA 1AXTL 1CDBA 2DKUA 5F9OL 3RWFA 1LO5A 3HC4L 4X7EC 1ZVSA 4JQXC 1N68A 1KN4L 1WDAA 2OMUA 4YGAB 1I1AC 5IT2H 5KBDA 2GEQA 2I9TA 2DQDL 2VZTA 2WWKO 2P26A 4K8RH 4HH9B 1NUGA 4N0FB 2B8OT 1UTDA 1YG9A 3QHFH 3ARZA 5DQDL 3KR3L 1U3HC 2NPLX 1N12A 5KYUA 3WELA 1I7TB 3FB8A 2WLMA 2EXWD 4JR9H 2ICCA 1IKFH 3RX9A 5E99L 2NY4B 3CE1A 3O6LL 4NO0D 1ZLWH 1T1ZB 3OXSB 4JY6B 3KXFA 1CDHA 4MKTA 1OY3B 4PR5B 1XF2A 5INCB 1GMEA 1LM8V 4HEPA 3CLFH 1V05A 2JXMB 3JSSA 4KGLA 4M1GL 1MHPH 1TTGA 3HBPA 5IB1B 5ERWA 3B9KD 3ECUA 3V0DA 4PM1A 2Y3AA 3ULVD 3CZUB 3I3BA 5FCUH 3L7EB 1VLXA 4OFPA 2XN9A 2XT1B 3GHEH 4V1DB 5B1KA 2HKHL 1HX0A 3HJ0A 1BYOA 1FFQA 1QSFE 5FOJA 3HHRB 4PHZA 3NCBB 4BQBA 2NRDA 1A7RH 2D03H 2P5WD 2DWDB 1D7DA 2H47C 2Z0UA 4XCFL 5H37G 4JDTL 5BRZE 1S7QB 4JFDD 5LAPA 4IK6A 2LW3A 1HXKA 3U30C 4U49A 1WZKA 2V9UA 4JO2H 4NKDB 3CSGA 4G5ZH 4XO3A 4F7TB 3T3MB 1DEDA 4ICWA 1VGEH 5BZWB 5IQMA 4AMKH 1JF1B 2XWCA 4NQVB 5DFVC 5EUOE 2Q20A 4XP4H 3C9NB 3FQNA 5HJ3B 1JI2A 1JJUA 4EIBA 1KCBA 3AQYA 4WKXA 1L0YA 4IOFC 4UTAA 4ZW5A 3UYOD 4XXDB 4HGMA 5AB1A 4Z8FL 4TUKH 4KDWA 1NEZG 2HMIC 1YNLL 5AZEH 3ABKB 2F74A 2UUDK 4MSWA 4GG8B 4KKBC 3OSKA 2JJSC 5EO9A 4YK4C 1I7UB 5E5RB 1CT8B 3P11H 3SJVB 2DEXX 1CO1A 1VACA 2J56A 3BN9C 1LVEA 3BPLB 2OMTB 3VX0A 2O61B 1EBAA 1TSHA 1VF5C 1Z9OA 2C4FT 1M9SA 4L5FH 2NY2C 3D4ZA 3NFPA 1XGPB 4XCYA 4JO4L 2MCPH 1B9KA 4MA7H 4DZ8B 5DSCB 2QVTA 1IAMA 3ZDZB 1T4KB 3Q2WA 4MYWB 3VI3B 1H0DB 3WKPA 1LEKB 2DJUA 4M61B 2W0LA 4R4BB 5ESAA 1Z0NA 2CWRA 3NACH 1E9OB 3ZMEA 2Q6WA 4HUVA 4UTAL 4L4TD 4OCSL 4KZEL 5DEJA 1DL7H 2JKNA 2DBLL 2Q10A 3EUUA 5IWLC 3KWTA 2X4UB 5FYLE 1C08B 1OZTG 3RGVB 4ANKA 2VOTA 2C1PB 3L3GA 1MZYA 2IIJA 3STLB 2AEQH 1ZJBA 3HUJF 2XRAH 3U4EA 1AZBA 3CSYB 3V6FA 1KB3A 4OV5B 5E2VL 3EXJA 1Q0XH 4TNWK 1KJ2H 4TQEH 2X53A 4E5XG 3EYSH 4PPTA 4JZNA 4S0SD 4HJGA 5EU3A 5F7EH 5EDSA 2DEYX 3HC0B 2WMPB 2TRHA 4J8RA 2EKSB 2L7EA 4WEMB 3ULUL 3GUTA 3QG7L 3HAEB 1YECL 3P1VA 4G6AC 1OP5K 1OVZA 3WAKA 3A4DA 3L54A 5CMAA 4A7GF 3INUH 3WNPA 3VXME 4GG6F 2QHRH 2RH0A 3N43F 4I0PC 2P5WA 1L9TA 1FDLH 5FA3B 1CMOA 3S97C 4MNGB 4ATTA 2V3FA 4YBHA 2XWJB 5IW6B 1KTBA 1X4XA 4PBDA 2ENPA 3E2HB 4JFDA 4JPIB 2R1YB 2B14A 1AXTH 4YXLL 2XG5A 3W5MA 4LSVH 4P46A 1KN4H 4BGLA 1TTBA 2Z35A 1NBYB 3Q2VA 5EF3A 1FNAA 1KTJA 5DQDH 1AZNA 4IMLA 5F96H 1Z5LA 3TNMB 5K9QG 3RZCD 3KGSA 2V37A 4QYAA 1KGWA 2VO5A 5E99H 6TAAA 3MCYA 2OXHA 1DQTA 2CALA 4YHPB 1D6VL 5MENE 1K5WA 4X5RA 1XGTA 3KW8A 3N9GL 4YPGA 5BO0D 2VZVA 3TYGH 3VFUB 3PFUA 4Q9RH 2GI7A 4M1GH 3CLEH 5DQJB 3QUZD 3B7TA 4A7QA 4EEEA 4XN7A 4LGSB 3ULVL 4UT6H 3TJEL 3H3PL 3NQKA 3OF6A 3I50L 3D4CA 4KXAA 1DFBL 3MLTB 2Q0ZX 2HKHH 4OJEH 2R2BB 4KQ0A 3EJSA 1TVDA 4QLRA 1RZIA 3LNIA 2VMJA 4FQQB 2DQUL 3D4YA 3N44F 1WG3A 1BEYH 2WLJA 4ES9A 1UCBL 4XCFH 4JDTH 3QDJD 3JVFC 2CKBB 3WHE0 3KPSB 3WSQL 3WIFB 4KVCL 4ACTA 3FQTB 4AGNA 2FO1A 2WXRA 3T0ED 5K9KA 3IK2A 2Y5QA 3AY4C 3ABLB 4N9GB 1KJ2B 3T0WA 1JL8A 1WPCA 2VERA 1W80A 2VDOL 5J4MA 3P0YL 3VNZA 1BG9A 4P4KA 4JQVA 3TBCA 4CC4A 4L4TA 2J8HA 2KHAA 3AXLA 4KJWC 5GGTA 2H32H 1CZ8L 1DJYA 4MMZB 5E4EC 1P6AB 3IGAB 2OR9L 2WO2B 4WFGD 1IQWH 1XTMA 5ADOH 2OQJA 3ZE2F 4B53A 1R24B 1G7HB 1I9EA 4Z8FH 4NKMB 4HHWA 1L6ZA 4LZKA 2DLTA 1XCWA 4WO0A 5C0CE 1XQ4A 2M83A 3S3JA 3X13B 5I17B 2GG1A 3EHBB 1AQ8A 2QR0A 4RMWA 5B3SB 4G42A 1M2VB 1QRND 3QI9C 2APTA 1HHKA 4U0QB 2JCCA 1BX2A 1HHJB 1FBIL 4W4NA 3SCMD 4Y5XA 2CJ3A 2GC4C 5DA0B 4BFFA 1I8KA 2GBAA 3WTYA 4F7EB 4D7BA 4PJHE 1TTFA 3BMVA 3RILA 4IBUA 2FR4B 3RIAF 4CNIB 5EIIA 5C97A 5L2JA 4X9BA 4OF0A 1OEZW 4XXWC 3LRSA 4JO4H 2A3TA 5E8NA 2R2CA 3RUGA 5F3BA 1ZT1A 2D31A 3BFQG 2NY5L 3PGCB 1S7UB 3D2UD 5DCCA 3LKPA 5DR5L 4FXGB 3W1ZA 2BOCA 5GGTL 5CJXC 2CCVA 1AD9A 2OI9C 1M9WA 3EH2A 1QYGH 5B38A 5CKGA 4UTAH 1X9QA 2IDQA 4RMBA 4KZEH 2V2XB 1DBKL 2P8MB 2DBLH 1A1OA 3RGBA 5JQIB 3RZCA 4FFYH 5KVFH 2A4EA 2A9NH 3C6LD 5FYJD 3D39E 4NUJA 3RKDD 4LOUC 3RWFB 3U83A 1LO5B 4N28A 2PR4L 1MELA 1ZVSB 3RZWA 2OMUB 2I9TB 1AIFA 2AJ3A 3O8XA 2X2YA 1PAMA 3QUZA 4ZRGA 4YSUA 3M07A 4XMKL 4YNYA 4UZSA 5KYUB 4U2ZA 3FB8B 4PI2A 3ULUH 2BS71 3QG7H 2XKSA 2X70A 1YECH 2ZXEB 1A5FL 3KXFB 2D7TH 1GGTA 5KANG 3MV9E 4JQXA 3RTQC 4OD1L 4XI5D 4NHUA 5K39A 2NX5E 3MREA 2B16A 3QDJA 4GMSH 3VCLA 5J56B 3PLYA 3N40P 2QT6A 2NUTA 4ES8A 2Z6FA 4YXLH 3DECA 5CCKL 3T0EA 3VFRA 2Q3ZA 4R90L 1INEL 5CSBA 4BFOA 1QSEB 1BF5A 2WYTA 2ZX7A 2I7OA 3DK2A 1QPXA 2BOBA 2WW8A 4YGVA 2DMCA 3BIAX 3S2CA 2OP4L 3QYCA 1TTCA 4L2LA 2DMGA 1E6JH 3O4LE 4TUUA 1WIOA 1G6RA 4KI5E 1NOLA 3N06B 5IEHA 1AGDA 2YMTA 2QSVA 2X4TA 1YEGL 1OSPL 2DLGA 2OMNA 4PS7A 1SY6A 3GBDA 3TJEH 1QRNA 4BQ6A 3H3PH 5AUMA 4ODVL 1E3ZA 3I50H 3W11D 1YO4A 3SCMA 2O5YL 1CYWA 1DFBH 2X3AA 3B1UA 5ID0A 2F7IA 3RP1A 4H8WC 4LKCA 2VXQA 4WNJA 5LJYH 1NCOA 4JM4L 2IOMA 5IVNA 3I74A 1EGJH 1GZPA 2EJ1A 2F74B 5K59F 1JFHA 4Z7UE 2DQUH 1ASQA 4MSWB 4CKQA 3UADA 4GIAA 1UCBH 3TZVC 3LRGA 3M1OA 5EO9B 4PJCA 1DBJL 4GO6B 1SXNA 3UC2A 3I6KA 3QRBA 4L48A 3NPSC 4Q8BA 3WSQH 5IKCA 3BVUA 4KVCH 4W9JC 3HFFA 3JTTA 1VACB 3D2UA 4BXVA 3ESVF 1CICD 1INQA 3ZHDA 3CFMA 1FE8L 2X6BA 2ZXAA 3DOHA 4NGHL 1PZDA 3T6QC 3QHTC 4GUOA 2XFXA 3NQIA 2AV7A 3P0YH 2WLZA 1G6RL 2WHVA 3NFPB 2XQYK 4IMKC 1CZ8H 4XCYB 1BREA 2OR9H 3DMMC 4Q89A 5J11B 2NYYC 1S7TA 2QHLA 3MKGA 5IIEA 2H9GA 5DS8A 1SRDA 4YEFA 1SY6L 1M7IA 4U1SB 3C6LA 4ODTH 2YD1A 2WBJC 4ELDA 3IFOA 3P02A 5ESAB 2G4GA 1AACA 2I5YH 4ZBJA 2Q6WB 4HUVB 3RL2A 4Q14A 1XIWD 2VXQL 1SYSA 3L5XL 1MJ7L 2OR8A 3UYPA 2X4NB 3D85D 1Q90A 4EBQL 4IBVA 4HSQA 3NA9L 4N8PA 2K9UA 3SGJA 4YSCA 3FRPA 3LXCA 1JZ4A 1ITCA 3NRPA 1P84K 4X6DA 3PG2A 1BAFH 5KYWA 4QLWA 5GS1A 1OHZA 5HHOD 4UNIA 3V6FB 1CC3A 3WKNA 2QPSA 5E4OA 3EJCA 2R7EA 4JZNB 4EN2A 4NQED 3DJ9A 4GQZA 2QLYA 4HJGB 2NY5H 4WO4D 2PO6D 5EU3B 1E9QA 3RVWC 1HEJC 3B6SA 4J8RB 1YEHL 2YRPA 4M6NH 3IDGA 3P9LA 4WU5A 1KYOJ 5DR5H 1R9FA 3BO8A 2EUZA 5GGTH 1TVHA 3RTLA 5CMAB 5HDBB 2IBZX 4R8WL 1PG7W 1XD0A 2FHFA 1GOGA 4WCYL 3A21A 2P5WB 1TEYA 5C0EA 5GJTL 2ENSA 3BZEA 4JFDB 3MRIA 1A7BA 1CLOL 2XG5B 3AABA 4KY1L 2WV3A 1MIEH 2P80D 4PRID 4LDEB 3ZVVA 1KCLA 1O7VA 4LVOC 5CJQL 2PR4H 4DFIA 4P46B 1IAIH 1NCJA 3L3KA 5DJDA 4KWUA 4WJG3 1IJ9A 4P4RA 2Z35B 4RQQA 4V33A 1DYZA 5BZXA 4QXVA 2HRLA 2EZ0D 4M00A 4B96A 4I0PA 4IMLB 4XMXA 3QJVB 3VRLF 2O1AA 1NCBL 1KXVA 1HH6A 4LL1A 5A2JH 2VDOB 3R18A 1BQLH 2AEWA 3BRDA 4DKEL 3RJOA 2OXHB 1KG0B 5AVTB 1I75A 4FCHA 1A5FH 1XHHA 2ZOOA 4YS4A 2P28B 4YPGB 1XGTB 4KTEL 5E95B 5GS0C 4OD1H 3C5ZA 4GAAA 3SKMA 3AGVA 4B9YA 5IQNA 2XUWA 1U30A 4KFZC 3HHMA 5D72L 3MR9A 5CCKH 1TU2A 3UYRH 1CJYA 3I85A 4KI5C 1T0NA 4UF7C 1CICA 1JXGA 4JHUA 4XRCA 1RZIB 2V9RA 1IU1A 4FNSA 4PLKC 1TMQA 4WUKH 2VISA 5I5IA 1H9VA 3CSPA 2OP4H 4HETA 2AJSL 4LSPH 3T0AA 4L8CA 4Z7VA 4N8CH 3GMRA 1GXEA 1MF2L 3ZL1A 1JGIA 2V17H 3TJHD 4FG6C 1QHPA 3B2VL 4M02A 1E28A 4PJ9D 1OSPH 2C9AA 4H25B 1G7QA 5EUOA 1NGYA 3LPFA 4P4KB 3E8VA 4L4TB 3AXLB 1XIWA 2EYRA 1HL8A 4ODVH 5I30H 1RP8A 4F8QA 2O5YH 1ICTA 2VRKA 1X5FA 1WYJA 2OQJB 3HZKA 2PF6A 1K3IA 1VADA 3H0TB 1PZAA 4JM4H 4NI3A 1OARH 1QO3A 1DQDL 5JIQA 2FYYA 5FGSA 5IESH 2MQCA 2DKSA 4OJDH 1S6NA 3BD4A 3F83A 1UD4A 3V0EA 5HHOA 3ZTDC 1R5IA 3QWQB 2QR0B 5C08D 1DBJH 2QJDA 2AAAA 3M7FB 4G42B 4EQ3A 1HHKB 5TD4A 1BX2B 2JCCB 5DUML 3FTXA 2BOLA 4NQEA 1LYQA 1WVZA 4WO4A 4Y5XB 1L6XA 2PO6A 5EBGA 1KFGA 5GZNC 1I8KB 4KO7A 3K8KA 5KW9H 5LXGL 2HP4A 3BWUF 2PYED 3Q5TA 3P40A 4NGHH 4QHKJ 1TJGL 1H6FA 2E3VA 4RFEA 1KWGA 4WW2F 4LPVA 5I0XA 3RVXC 4JK0D 3NCMA 1G6RH 2BNRD 3PUCA 3CFIC 3FHQA 3LRSB 1XSOA 5E8NB 3RUGB 1YJDL 5F3BB 1AP2A 2D31B 2EVFA 5DK2A 1NMCC 1SY6H 2R2HA 3LKPB 5JO5B 1KLFA 4PRIA 3HJEA 5I1HL 1KTLA 2BOCB 3SO5A 5CCHE 1AD9B 3VH8G 2WXMA 2MNJB 4NPKA 5B38B 2X9ZA 4DFHA 4OCRL 2VXQH 4R26H 3ZBMA 1XMWA 3D25A 1MJ7H 1A1OB 4QRUA 5CCJA 1LHZA 3RZCB 3TPKA 3NA9H 3U1SL 3WJLA 1RHHB 5TFSL 4GJTB 2MOGA 3ZL4H 3W0WD 4A2GA 1ZHNB 2H0EA 4NUJB 3RL1A 5AAPA 1XH0A 1ET7A 2HT4C 1AIFB 1DN0A 2ED9A 2IBZY 5IBUB 2AJ3B 4ODUA 2OXGA 2C8NA 1NCCL 2XA8L 3VD0A 3QUZB 5E00A 3WJJC 4YNYB 1EWHA 4JRWA 4PB9L 3M86A 5FDWA 2CGZA 2MRYA 2NSQA 2YXWA 2NTFA 4IRSD 5HD8D 1CGUA 3K6FA 2X70B 5DC0A 2Z31C 2J1WA 3IWUA 1I8LC 2H3NA 4G5AA 5I26A 5TDNA 1M7UA 3NABL 4R8WH 3FB5B 4WCYH 1PKOA 1SLVA 1NGXA 4NHUB 4XN1A 5FUZL 5K9JL 3MREB 4PJBB 3QDJB 3VCLB 4PJDA 4UIKL 3MYJA 2NUTB 2AZAA 4ZK8A 1UOVA 3AROA 1CLOH 4KY1H 4OCWL 3T0EB 3CZSA 3VFRB 2ZSVA 4YSPA 2DQTL 1R3HA 4Y19A 2HFTA 4PJ9A 2H2SD 3RWHA 1X5IA 3B9EA 1QACA 3GYRA 3RTQA 3GXIA 2YPLE 2BOBB 3EDKA 4KK9D 3DC0A 4UI2A 4YGVB 1NCBH 4UAHA 5LDUA 5FLVA 5I1KL 3J27A 4FZ8L 2EDJA 3F7PC 4D9QD 4DKEH 4WUUE 1G6RB 1MFCL 2PCXA 2EXYC 3UJTL 1YEDA 5IEHB 1K2DA 4WI4A 2DQFA 1AGDB 1ASPA 2Y1AA 4MKMA 2X4TB 3GJEA 3U7AA 5CD5D 3DUHA 4AQ1A 4OLUL 5T1DL 1G9MC 1KBKA 1PD1A 2HYMA 4E36A 3NJIA 4ODWA 5C08A 1YZZA 1QRNB 5L4FA 5D72H 5AUMB 1UJ3C 3CZFA 3VXRA 3SCMB 4MXQD 4NKOA 4ZX5A 5IHLB 5ID0B 4POZD 4LKCB 2AHIA 4XN2A 2BIQA 3OJDA 5KSBF 1GZPB 3BI9X 1J10A 3MBWA 4FNQA 1ZLDA 2BNRA 4TSCH 2DQIL 1H3VA 4DP5X 2VW7A 2AJSH 2YHGA 5IUCA 2PPDA 3MV8E 4K07A 5TQ2H 5IKCB 1PLBA 4GI6A 1K4DA 3IETA 2WUBH 4KUCF 4PEEA 3JTTB 5A2KH 2W9EL 3QSKB 1HINL 3D2UB 4JPQA 2HLAA 1INQB 2QKIA 4WI5A 2BC4A 2IAMA 4L1BA 1NIDA 5J3HC 3B2VH 2F53E 2XFXB 3Q2NA 2ZXCA 2AV7B 4MX7A 4HPHA 2ADYA 3IRZA 1GGCL 2EH7L 2VXSL 1RSYA 4NUGL 5SWSE 5CFAA 1J9QA 4KRLB 4P5RA 1PEWA 4Z7QE 2WWNA 2YXVA 4GYBA 1HWHB 2MPAL 3VWKC 2H0JA 5KEZA 1A1NA 2CIIA 5I73C 1S7TB 3IDXL 4NZDA 5IIEB 5DS8B 2EABA 1DE4A 2JTYA 5HJDA 1F1AA 2WVSA 4PWJA 1DQDH 1M7IB 3W0WA 4XPHH 3C6LB 1MLCA 5BCAA 1NCAL 1RJZA 3UBGA 3IFOB 3BW9A 2AEIT 5D7LA 1PFCA 5E6SB 3RL2B 3POCA 4QOKE 1SYSB 5DUMH 4IMKA 3UYPB 2CR6A 3UBXG 3MRQA 4N86A 5HGGS 4APQD 3FRPB 4IRSA 3DVIA 1TJGH 3FH7A 1GYWA 2BVYA 3LIZL 1MY5A 3QZPA 4X6DB 5GS1B 3BHBA 2CBOA 3P0VL 1CBJA 1F6AA 4K15A 2W9LA 4W9KC 1IJNA 1YJDH 2R7EB 2NY1D 3MV11 3QYNA 3A5VA 4J5VA 1I31A 4OFYD 5EH1A 1E9QB 3B6SB 3IDGB 3P9LB 4WU5B 5DT1L 1RIHH 4NN7C 3G6AA 4BZ1A 5F0LB 2Z7ZA 4MLIA 1KCRL 1W72A 1IE4A 1XBDA 1TVHB 5CBAA 3EGSA 4TVPE 3JWOC 1HS6A 3NJFA 3QO1A 4OCRH 4B9CA 3DX4A 2WZAA 1ML0A 4FFWC 3QA3A 5EORH 5LG6A 3HI5H 3X3GL 3F05A 5IJKA 1T7XA 3FNKA 3ABZA 3NIGF 4QUOA 5CXPA 5C0EB 4LKXA 3U1SH 5DVPA 3VXSD 3BZEB 5B21A 5TFSH 3MRIB 4GEIA 1MZZA 3VQMA 5JOPE 2ARJQ 3BWAB 3UABA 4JFFD 3BLBA 4PVLA 5DJDB 1UQSB 3B5TA 4PJHF 4X99A 4P4RB 4FTVD 5I6NA 1U92A 4RQQB 1NCCH 4W9ZA 5HI5C 3TO2A 4DN4L 1L7TH 1AS8A 2OMXA 4M7KL 4PB9H 1HH6B 4HXAL 2QBWA 5DTFA 2NZIA 3QP3A 3WHXB 4HV8A 2ZXBA 5AAMC 1F4YL 3P54A 3OX8B 4N90D 1JV5A 1HOCA 3MACL 5EZIH 1MCOH 1BPLB 3RE0A 2VW6A 4R7VA 1XWVA 3KZ8A 5K9JH 3C5ZB 5C8JB 3SKMB 3LPGA 1RLBA 3FQUA 4UIKH 4BRVA 1W72L 3T6WA 1CB4A 1J9SA 3MR9B 1TU2B 3NH7L 5DD5H 2DQTH 3VFWB 1CICB 1OCWL 4E9WA 1E7VA 4XRCB 4F8TA 2Y5EA 4MVBD 1KCSL 4NBZB 2VISB 3P2BA 4GEJA 1MCNA 4HALA 3TLRA 4WJKB 4HIJA 2B3RA 2AABL 5AOJA 4L8CB 5I1KH 4LARL 4XBPB 4JFZH 3S3CB 4Z7VB 1HKLL 1XZ0A 3PL6D 1MCWM 3TBVA 4W6YB 4F80A 5IJBC 3QQ9D 1E28B 4LNRA 2RJMA 1BF8A 4OLUH 3VFTA 4G8IA 4MB1A 4WHTB 1G7QB 1NGYB 4PRBA 3WE6A 3WJMA 3GWJA 1LQBC 1XIWB 1H5BC 2EYRB 5C7ZA 4OLWL 3D85B 1BFVL 5FA4A 3WIAA 3W39A 3HZKB 4APQA 1VADB 1CXEA 2AQQA 5IVXF 1QO3B 2YN5A 2FYYB 3KVPA 1TNMA 5F6HI 4I18A 4ZSOA 2XYCA 2JIXA 1GZHA 4HDIA 2DQIH 5HHOB 1R5IB 5CS7A 4MHHI 5ITFA 3DGDA 5E08L 2R27A 4NQEB 4KJQC 5IFAH 4WO4B 4JGJA 2W9EH 4LL4A 1NIEA 1ZT7A 1HINH 2PO6B 5GS0L 4M5SA 4ANUA 4KI5F 3CDYA 4RFEB 3W9DA 3DX2A 4NC1E 1GGCH 2EH7H 3B5GA 2VXSH 2BRQA 4NUGH 3ZMRA 2VE6A 4XNZC 5H35A 4XN9A 3CK0L 2MPAH 1AP2B 2AJZA 3G5YB 1WISA 5DK2B 3VXSA 4XT1C 2AEOA 2XQBL 2NR6C 2RR3A 3L17A 2EDDA 2HVJA 32C2A 1ROWA 5FW7A 4BK4A 2R2HB 4A6YA 1KLFB 2XV3A 4PRIB 4JKPL 3K91A 4ADIA 1KTLB 2SODB 5ALCL 4O2CA 2GYSA 2V33A 3GINA 4AK1A 3IDNA 1X7QA 1SVCP 3BP5A 4FYRA 3D25B 3LS5L 4OZ4A 4QRUB 3GMQA 3TPUA 3SE4A 4FX5A 3NFNA 1GIGH 4JDVB 5IG7B 5AD0A 3WFHA 3I9PA 3FSOA 4DTGL 3FN9A 4AJWA 3ALWA 3BT0A 4HJ0C 2VXTL 1ZLUK 4Z3FA 2DIAA 3VAEA 3A6BH 3RL1B 3OXRA 1GYUA 5DEFA 1DN0B 3BGMA 3T3MF 5KVDE 3C09C 2WK2A 2OXGB 4ODUB 3BVWA 3KH4A 1MCJA 4H8WH 3MFFB 1Z66A 3CC5A 3QAZC 3I6SA 3WTSA 1KACB 3WLWC 1OK0A 5FDWB 2JE8A 2C5DC 4EZKA 3V6OA 2NTFB 5DUJA 3DUSA 1KCRH 2XETA 3AGWA 1P84J 1SQ2N 3D18A 2H3NB 5TDNB 3IM1A 4YDNA 4XNDA 3OQRA 4LHQB 2DYPA 1NGXB 3X3GH 4A6YL 3ARXA 3MA7A 4PJDB 2NUPA 3MYJB 4MJ5A 2X1QA 1KULA 3IBEA 5GQBA 3K6IA 3ARBD 2PABA 2BRRL 2OMZA 1FF5A 2ZSVB 4WWKC 3ZHFA 1M7DA 3S4SA 5ISZA 1X9LA 3QZWA 2BZDA 4Y19B 5GS3A 4PJ9B 3RWHB 4X9GA 1MIMH 2QQQA 2YJLA 4N25A 4D0BA 1I8IA 3OTTA 3RTQB 4M7KH 1BAWA 4AW7A 4DN4H 4NCDA 2UUDH 2BVQA 1QRKA 1IRAY 4HXAH 5J89A 5F7DA 3VG0L 5J9PA 1D3CA 2X7LA 3VNYA 1KYFA 1HNYA 5GGUA 2AQ1A 3OPZL 1YEDB 2ZWZA 1F4YH 1AZRA 2GSMB 3MACH 3LNDA 3WY4A 4PW4A 3VI3F 3QZOA 1JNLL 3X14A 2H8PA 2XWZA 3GJEB 1H8SA 5DC9B 1RI8A 3CG8A 2XVBA 4P9ML 4AQ1B 4FFVC 1CQKA 3FCSA 4BZ1H 4PRNA 2NXYD 3AS2A 2AGJL 4ODWB 5D96C 5C08B 1W72H 3ZR6A 4LAQL 4TTDD 3CZFB 2OM5A 1P7BA 3NH7H 4NKOB 5G2NA 4OY9A 1JNHA 4YHOL 2VKWA 1GY2A 1OCWH 3DNKA 1RZ7L 2GI0A 4N0CD 3PXLA 4ALAL 1NKGA 4HUXB 3V0VA 1D9KD 1WFNA 1KCSH 3CX5K 3WMSA 3THML 1BZOA 2XDHA 2ZXDA 3MBWB 2BNRB 3P77A 2KKQA 3Q6FA 4ORGA 4TQIA 4BXSV 3VA6A 4JHWL 1SXCA 3ZRSA 2FGWL 4BK5C 1K4DB 3E1ZA 3IETB 1HKLH 4WFGE 2HLAB 3NDZE 2QKIB 1AFVL 1DSFH 1V5JA 2IAMB 5HI4D 2CHXA 4LCVA 3KJ6L 4MS8C 2KMWA 2NY6C 4MX7B 3BN3B 3ZIMA 5ACZA 5ICZA 4N68A 5KS9E 4PRHE 3IJ7A 1S7WA 1W8EA 4Y8AA 1CI3M 3V52L 1BFVH 2WOYA 2X1OA 4Y1AD 1U58A 2R4RL 1A1NB 2CIIB 3ILEA 2DDQL 4B5EA 1UKTA 1NC2A 2Y1ZA 1QVOA 2K78A 1DE4B 2KZ1B 1YNKL 4YE4L 3W0WB 1MLCB 2HZHA 1BM3L 2CHNA 3FN3A 5MERA 5KBMA 1RJZB 4F8OA 4OLVH 4AEIH 2FJSA 2JF1A 3BW9B 4NC1C 2AITA 5FPIA 5KBKA 4QRRE 2FT8A 3FTYA 3LZNA 1O0VA 3QIBD 2AAVA 5E08H 1O7DE 5CZRA 4DKTA 3MRQB 3VWKA 3SYPA 5ICYA 4FQ1L 1HCVA 4NS0A 1JTOA 3ARFD 5FO7A 5GS0H 2ZUSA 1U4FA 3FULA 1W8OA 4IRSB 1JVOA 4Y5VA 2JKRM 4Y7MA 5AZUA 2A0LD 3B8SA 1OALA 3BHBB 2HJLA 5IOKA 3B8YA 2R1XA 1F6AB 3CK0H 2GTZA 3KBHE 1HYSC 1MNUL 2XQBH 4CC1A 1PSKL 3BKYL 5EMYA 3VG9B 5EZOL 4U7SA 1AI1L 1RFDL 3MNWA 2JCWA 1OPGL 1B0GA 1RZQA 4GUPB 4JKPH 4L4VE 4ODXA 3G6AB 4W9FC 1MCPL 3VX1A 1WTLA 2OSWA 1NANH 1W72B 5FYJE 5ALCH 1QQDB 5CBAB 3EGSB 1AO7A 1BHGA 2XQYA 2ZP0T 4U0RB 1R3JA 4A68A 2VDQL 3QO1B 3QA3B 4Y0GA 1BYPA 2CDFA 3Q1SL 3NK3A 4LHUA 5C0AE 3ETSA 4LKXB 4K71C 4AJYV 4YN3A 4JN1L 1A7OH 4LPWA 4DTGH 1JZ7A 1JZ8A 4WI9A 4UV4H 5E0QA 2Z65C 4N6RA 4MZ3A 3U9PL 4J3BA 1FNEA 1U92B 3TO2B 1L0QA 2OMXB 4AX3A 3QDGD 3EDDA 2UXTA 4NFDA 3VXOB 2JB6B 3OKKA 2J55A 4F9PA 1Q9LA 1OP9A 1SJEA 4IRZA 4NQCD 2V7HB 4J3OD 2OTUA 2B1AL 5DTFB 5DVNA 4KC3B 3NIDE 4HV8B 5FGRA 5I5RA 4BFNA 1CXHA 1JV5B 1FJ1A 4JHVA 1HOCB 4UYPA 3H42L 1FPTL 4W9LC 3EJYD 3WOVA 4XZUA 3DARA 5L7XL 3VGAC 4A6YH 5I74C 4PLJC 1JRHL 3FQUB 1AKPA 1HAWA 3CHSA 4OCNC 3QHZH 2VERN 4JFQA 4XTRC 4E68A 4MBRA 3CFQA 1WP6A 2B4CC 5DFWH 3VWJD 3H9ZA 3HCVA 1ID5I 4OFVA 3COOA 3S37X 2ATPA 3HN8A 1ACXA 1MFUA 2GAZA 3UG3A 3MRGA 1S7SA 3H9HA 4IHOA 4HIJB 1DDTA 5BUAA 4FFZA 3VG0H 3OB8A 2FGZA 3WL9A 3T2NL 4Y1AA 4A67A 3BKMH 2JKLA 4I77L 5EN3A 3F8UB 3OPZH 2BVEA 4JG1H 3TBVB 2EQDA 3G3LA 5CZXC 1JNLH 1JF5A 4ZFOL 4LNRB 4P9MH 4N5EC 4YUEL 4IRZL 3VFTB 4G8IB 5JMRA 3HMXA 1CF8L 4Y5YC 3QYMA 4RAVA 4PG2A 4PRBB 4RMUA 3WE6B 3WJMB 4HG4K 1AG6A 1KY6A 2YKLH 1SLWA 2RMNA 5FA4B 1TVBA 4YHOH 3T4AC 4M6MH 3W39B 1S9YA 2VLKE 3ARFA 1RZ7H 4APQB 5AOZA 4B9FA 1OTSD 1XTLA 5GJSH 3CXFA 2E8ZA 3NJGA 4XPAH 1TR7A 3KL0A 4BWUA 4NBYB 1HHHA 3HS0B 4QXGL 2HJFA 4I18B 4OUUA 4AEEA 4ZSOB 3THMH 4I9WD 4AL8C 4HDIB 1NWPA 4M3HA 3ZKMC 3X1FA 4NAQA 3DX7A 2E9WA 2DJMA 4JHWH 3SBRA 2R2EA 2FGWH 4L1LA 4QXUL 3PWLA 2NY1B 4OLEA 3ALXA 4IJ3C 3GKWL 1ZT7B 2DTML 2FLRT 4KNTA 4LXFA 3PQYA 4HVBA 4AM0A 4WDIA 2DH2A 2ZZUT 2EC9T 3W9DB 2E59A 3CVHA 2B7DT 4C83A 5HYIA 1YMME 1FUNA 4ZYKA 1YYLL 2O93L 4TPRH 5F1SA 5AW4B 1E5BA 4X6CE 2OYMA 2VE6B 5H35B 2ZOUA 3V52H 5HYQA 3MDJA 1BG1A 1O7DC 2K6ZA 4JVPA 2R4RH 1MW3A 2AJZB 4N20A 3ARTA 3VXSB 2DDQH 2IH8A 2PWEA 2HVJB 1OAYL 32C2B 1YNKH 2ZWKA 4YE4H 3HMXL 3RB7A 2LAAA 4A6YB 4JNXA 4RRPA 2XIIA 1S9WB 4JFFB 4XNQB 2VDLL 1LJMA 5I6KA 5K9OA 1I8MA 1NCTA 1ZTXL 2YK1H 4O2CB 3H4HA 3MJGX 3B2MA 1EDQA 3IDNB 4M7ZB 3VFSA 3BP5B 4FA8A 3B83A 4OZ4B 2IV9A 3QDGA 3GMQB 4IGBC 3TPUB 1JCKA 5AW9B 4PJ8C 3NFNB 4FQ1H 3CHQA 3QJQB 4NQCA 3T65A 1KTDA 4LVHC 3VSUA 5AD0B 3WFHB 4MYPA 1F00I 1E4HA 1VHPA 3BP7A 1WCQA 4HOZA 1DLFH 3OXRB 1JIBA 4UV7L 5DEFB 3QZBA 3UZQA 4F2ME 2EYSA 3LRKA 43C9A 2VR7A 4NM8L 1N8ZA 3AT8A 4ZDHA 4U7MA 3KBFA 3CC5B 3OC8A 1MNUH 2H1LM 2MKWA 4ANWA 4WTWA 5EZOH 3CVHL 3DA0A 1I9JL 1AI1H 3F7QA 1NGQH 3SQOL 1MCPH 2EKJA 2DL9A 1N10A 2PLTA 3BZ4A 3DUSB 3G9AB 4I48A 1MCWW 2WLNA 4FKHA 5ALBL 3V0WL 1FC2D 3D18B 1IBGH 1EFXD 2VDQH 2DF3A 2PXYA 2WQXA 4QAWA 1XEDA 3PWPE 3Q1SH 3E6HA 4IYKA 3MA7B 5T5FA 4PJXA 2NUPB 4JN1H 1NPJA 3ZE1B 2BS8A 4CGUB 1QW9A 3MC0A 2OKMA 5DLML 3PL6B 2WN2A 5E6ID 2OMZB 5DMGC 1DQML 4OTXH 2KPNA 4AVJA 2HX8A 3S4SB 3KLKA 5ISZB 3U9PH 2C9RA 3QZWB 3P30L 3CVBA 3PHQA 3P4LA 4D0BB 1NBQA 1I8IB 2EXTA 1TCMA 2F54A 4LE8A 3UO8B 2BVQB 5E8EA 3TT3L 3K80A 4DHLA 4YSEA 5F7DB 4Z7IA 5J9PB 4PRAB 2DICA 5D7EA 5EU4A 4DT2A 2B1AH 2X7LB 3G5WA 1JOIA 4BA0A 5GGUB 2H6OA 4YXKL 5J6HA 1U8CA 4PVNA 1I9RL 1TQBC 1Y6MR 3UH8A 3X14B 3FT9A 3M1CA 2E7CA 1MNNA 4FQXC 5L7XH 4CW1A 5CJ8A 4OGZA 4CSZA 5B3JE 1EPFA 3FCSB 4PRNB 1JRHH 4BFGA 2WLYA 4ZS7L 2DQJH 5HHVL 4APXA 3EF7A 2VXUL 5ABZA 2P49B 4JZJC 1IC4L 1JNHB 5DI8A 4ZZKA 4QR7A 1AQMA 3QEHA 1QLEL 1UATA 4WK2B 4QF1A 3V0VB 2GITA 2X2IA 1SDDA 2QKSA 5T5FL 4J6RL 1E3FA 4KX9A 3P77B 3SKOA 3AG4B 3Q6FB 2N7AA 5B1AB 3T2NH 1E40A 5T33L 3NYKA 1I9IL 3APMA 4G43A 4I77H 3D50A 2FQEA 4PV9A 4FHBD 3JWOH 5ILTL 1CFQA 5ICXB 5L8KB 1MH5A 2XIDA 1KEGL 2KZKA 4G6FD 1J8SA 4OIIL 4QRSA 3K0WA 3ULVF 1AZCA 3E7JA 3H3BC 4J4PD 3MTRA 4GQ9L 4AZUA 3W9EA 1NUNB 5B3NA 1F1DA 2A6DA 3A3YB 3HG3A 3Q3GA 5ACZB 5ICZB 1KJVA 3LDBB 4K9EC 5HDBF 4ZAKC 3S35X 3TTSA 4FE9A 1S7WB 2JKIS 2V2TA 3MCLL 4HMEA 1U58B 5JIMA 1BJ8A 2VDQB 2FUQA 4JE0A 4PSRA 1A3ZA 3NRQA 3WNLA 1P6FA 3PREA 3SN6N 5MERB 2PYEE 4QXGH 4RGOL 2XOTA 4HJTA 3A67L 3OHXC 4G9DB 4KRPD 3WMPA 2YBRA 3UIZA 1IC5L 2YQBA 3F58H 3A0OA 3EYQC 3OZ9L 4QXUH 2YARA 2FCBA 3UOAB 2CNZA 5ICYB 5FO7B 1J05A 4GO9A 4TTGA 1F02I 4ZMAT 5EDXA 4FFZH 4Y5VB 3KPOA 1CFTA 2WYHA 5FM4A 1CXFA 1EFXA 3SB3A 5KYNA 1ASOA 1YYLH 5MEQA 1VFMA 4XODA 5HDRA 1WC7A 1E5UI 1X4YA 2R1XB 4OZHE 3K2UL 2GTZB 3DHMA 2CR3A 3VXUE 5D5MB 4PJAE 3OM3B 4FC3E 2X4QB 4AITA 1E5CA 3HMXH 3MNWB 3EIFA 5EUKA 1B0GB 2Y7QA 3G5XA 3MLVL 4HIQA 4ILDA 4ODXB 1BQ5A 5J7CC 1I1YA 2CBQA 2VDLH 3D2TA 5E6IA 1RUKL 2HJKA 3VQ2C 1I7ZA 3SSGA 1HEZB 1ZTXH 4XC3H 4MAYD 1AO7B 2IBGA 4XAKD 3UTPE 1QPPA 2HH0L 3GB7A 3OKEA 2ZT9C 5ES4B 2WPGA 1D5ZA 1B9ZA 4ODBD 3VW3L 2Y2TA 1R5WA 4JJ5A 2CDFB 4LHUB 4DGVL 2GUYA 4XCEA 4L0ZA 4W93A 4FERA 5DHYA 1G1KA 3F12A 1R3IL 2J57A 4H1LA 3SDCC 2G3NA 4JL2A 4N0YH 3D3VD 2Z1KA 2FECL 4N6RB 4JO5A 5DRXB 1KDJA 4UV7H 3EJQA 1F58L 4NT6A 1LP9E 1FNEB 4NM8H 5I0VA 4NZRL 2L04A 2VC2L 3PV7A 1T2QL 2X4SA 3IJEA 3IXTB 4IEFA 2NXYB 4HUCA 4A7VA 4XB8A 3OKKB 4KRMB 3CVHH 4ZFOB 3KLLA 1FYTD 1I9JH 1Q9LB 1HOEA 1SJEB 3HI1A 2OTUB 1CE1L 3FU7A 3SQOH 3EADA 3ORJA 1YY8B 4MAUH 3UROR 4YQXL 3NMEA 1HSAA 5ALBH 3V0WH 4ENZA 4AIEA 1FJ1B 2HKFL 4GBXC 5F21B 2R8SL 2AJVL 5CEYA 2ZKXA 4XZUB 2XC8A 3S6CA 4MXWL 3R06A 1AHMA 3FQ1A 4FP8L 4HEMA 1QZ1A 5F72S 5G4NA 5BW7C 3QH3A 4X7CC 2Z92A 2JCCF 3S34L 4NSKA 3C8DA 4JFQB 1DQMH 3QDMD 1S9VA 3OSVA 4N2FA 3HCVB 4S11A 3ZYIA 3P30H 4ZTOL 2ATPB 4JFYA 4W9GC 1TPXC 3SDDA 3STBA 2GAZB 2CXKA 3MRGB 4K94C 1VCAA 3H9HB 4IHOB 2DB8A 3PWUA 2W81C 3KD4A 2PWHA 3TT3H 3WN6A 4OCYL 4P23D 5MEPA 2X40A 3KYAA 3WL9B 3OKDA 1BGXL 4Y1AB 3RUGF 3I6LE 1NEUA 2HXAA 2YAOA 5EPMA 1T7YA 4P3DA 1FHGA 1I9RH 5DUBA 2P8PA 3WDIA 5AAWA 5DC2A 5HYFA 3B1TA 3HG1A 4YHYC 2CRIA 2BWDA 3DIFB 3MQIA 2D3VA 1ONQA 3W5NA 4XO4A 2HN7A 3GIZH 5DD6A 4ZS7H 3FYIB 3PHOB 5HHVH 3ZZ1A 2VDLB 4WFHD 2H0FA 4F15C 5C9JA 1IC4H 1TVBB 4TVPH 3MCG1 1IAKA 4EUPA 1S9YB 2ADIB 3ARFB 4CW1B 3CQQA 2GSIA 4Y2OA 2C3GA 2IDCA 1DVUA 3GIVB 1FNSH 1HHHB 5E56A 5T5FH 2HJFB 4J6RH 4OUUB 5FGBA 3Q2CA 1NTDA 2Z8SA 3O3BA 1ULVA 1MY7A 2NZ9D 3DX7B 1SJXA 1QSZA 4PI0A 1EEQA 1WCBA 2CPUA 2R2EB 5T33H 5EIIG 1I9IH 3PWLB 2SEBA 2YD6A 3AWFA 2KLRA 2F1AA 5ILTH 3CHRA 3CD4A 3PQYB 4AM0B 4WDIB 4R7NA 1KEGH 5A3ID 1IC7L 2WTRA 3KYMB 3QUXC 5CILH 4GQ9H 4E41D 3CVHB 5AG8A 4MAYA 3L3JB 4C83B 4R6UA 1ZAGA 1Q0YL 2A5UA 3CX5J 4LP4A 4ZYKB 1QLRB 4DP7X 3F6LA 3H55A 2MH4A 4RIRA 1E8XA 2K6WA 2FEJA 1E5YA 3G5VA 3MCLH 4FXKC 2B4CL 4LSRL 5B38G 4XHJD 2VMCA 4PJBF 2N7SA 3FT0A 1PY0A 3FB7A 3QJHA 5KVEL 4OZIA 5FV1L 4RGNE 1KGIA 3RHWK 3LSOA 4XAWL 1GOHA 2Y06L 3D3VA 2WQWA 4DOHE 4XNAA 1EHLH 1CFVL 5K9OB 2YAHA 1I8MB 2OZNA 3RY6C 5LKNA 2K6YA 3AQDA 4MQ7A 1IC5H 3OZ9H 3ARQA 2VB5A 3OGCA 2X28A 1OAJA 4TUJA 2FIRT 3QDGB 4EAEA 2Y4SA 5FHAL 5KBLA 5AVUB 1FYTA 1MCIA 3L6FA 4NQCB 3T65B 1KTDB 4D0DA 3EFFA 1N2RA 3U36A 1SJHB 2I26N 3LD8C 1CR9L 2R9HC 3BP7B 2QV2A 2VN7A 1XAUA 5JQHC 1B4TA 3UZQB 2EYSB 4QNPE 1Z2KA 3K2UH 3CMOL 43C9B 1N8ZB 4ZDHB 2LTQC 4GPVA 2CD0A 3LS4L 4UQ9A 5DWUL 1UUSA 4IGBA 1MQ8A 4HX1A 4PJ8A 3KAAA 3MLVH 3IJSA 2RA1A 3BZ4B 4I48B 1RUKH 1JZ5A 1URIA 4HXBL 1Q9KA 1TTAA 4KK5C 4JKWA 2HH0H 3C12A 4JRYE 5D6DA 2PXYB 1GGIH 3VW3H 2PP8A 3RX5A 4FTVE 4N2CA 3C09B 3E6HB 1QLEB 1R19A 1MW0A 4P23A 2YUXA 2VMFA 4KKRA 4PJXB 3LQAL 1R3IH 4LSDA 3QXTA 4FCAA 1MFNA 4YC2C 3QIWC 1ZPLA 4G6JL 5H94B 3N2JA 4NP9A 2QDVA 1U4EA 4ZJ9A 3PHQB 4NZRH 2VC2H 2F54B 4GW5A 2VXVL 5E9DA 5IMOA 7FABL 1PG7L 5EU4B 1NBVH 1CE1H 3GZOA 5CLWA 5GGQL 3ZMNA 3WEBA 3WIHA 3QVAA 4JGNA 1U8CB 4JY4A 1Y1DA 1J0KA 5JXEC 2R8SH 1HN1A 4UANA 2J4WL 4JY5L 5I9QC 5GGSA 1TZGL 4KKAD 1QPKA 4ZXBD 4FP8H 3GDBA 1CFMA 1TJIH 1HKFA 2YRLA 3S34H 1O6SA 4XWOC 3H54A 4MB4A 5DI8B 4RH4A 3IFNH 4JUTA 1ERNA 3QEHB 5BZZA 4E9SA 4OCXL 3V4VA 4QF1B 1Y1UA 2GITB 1SDDB 2VH5H 4GXFA 4X6DF 4H1LH 3UMNA 4FQXA 3SKOB 4OCYH 4JFSA 3US1A 1BGXH 1MKFA 3L81A 4G43B 4KX7A 4PV9B 3RWCA 4G3YH 1RUPH 3K74B 1CFQB 4C47A 1MH5B 3AQXA 1RPUA 3NIDF 3IXAB 4QRSB 4QIRA 4PWGA 1BBJA 1EUTA 2EO7A 2CHDA 2A6DB 3Q3GB 3II3A 3R8QA 1KJVB 1M4KA 3NDYE 3OPUA 3WIHL 3F62A 3SGKA 2QPDB 4WI6A 2V2TB 3V9CA 2H1PL 5D7IA 3O6FD 4X9YA 2KH2B 2Y0SA 4MD5A 4EIUA 3VD3A 4ZMNA 4N1HB 4XR8C 5D93B 1GYVA 3FRPG 5HVHB 1HZHL 2YBRB 1ED3B 4EKXA 2RFXA 5JXAH 1A3RL 5IF0A 1G4RA 4BQCA 4EMZA 4ZAKA 2IGLA 2BHZA 4CVUA 3KEDA 3V4VL 4HG4J 4WGWB 3PCYA 2VC2B 1IAIM 1J8HE 5C09E 4RGNC 1BZ9A 4JRXE 2XXCB 1M3IA 2APFA 3KPOB 1CFTB 2CK2A 2GBTA 4F8NA 1UA7A 1E0OB 4U1JA 1EFXB 4AC2A 3NCJL 2MCAA 5MEQB 1OTTC 4GRLD 2CK0H 1WC7B 2J6EA 1YMMA 4Z18A 1NMAL 2B4CH 1KUMA 2Y7OA 4NQSA 1GA2A 4CVXA 3VD9A 1N0LA 5FKPA 2AKRA 4HWZA 3QCTL 5DJYA 2E46A 5EUKB 3OD3A 5J1SC 2Y7QB 3G5XB 4XAWH 4BE6A 2Y06H 3AS1A 3GS0A 1I1YB 5E6IB 2HJKB 5E1IA 1CFVH 1I7ZB 2WJ7A 4IKLA 1E6OH 3UX9B 4MXVE 5ITFB 3OKEB 3GB7B 1D5ZB 1TCRA 4EUPH 5DJAA 4FS0A 3ABGA 3K71A 4G6ML 1R5WB 3AZUA 2YEVB 4JJ5B 5CGYC 1UD3A 2IMMA 2R29A 4XCEB 5FHAH 5DHYB 2G60H 2ITDA 4Q74A 1PZ3A 3F12B 1VJSA 3FCGA 1WFIA 4A7UA 4H1LB 1FIGL 1PMYA 3HB3C 4Z7VF 5C07D 3RDTD 2HAZA 1CR9H 1NUFA 3CN3A 5HGHA 1KB9K 4K7PX 4R84A 3TIDA 3CMOH 4N2AA 3ZTCC 1CG9A 5H37A 3IJEB 3LS4H 2OJZL 4IEFB 4ZXBA 3NN8A 5BOJA 1QUNA 1CE6A 3EUDA 4PP2A 3HI1B 1J8RA 4Z3GA 3CX2A 3GMPA 2J6EL 4HXBH 3A6CL 1HSAB 1L0PA 4L1DA 5ANME 4RA3A 5D8JL 3WY3A 1BD2D 1ETZA 5KOVC 2Z34A 1A66A 5CEYB 5F9AC 2AQTA 2O4EA 4NFCA 3QFJD 3CC1A 3R06B 4G9FE 3MRRA 1G94A 3LQAH 4HS6A 2OMBA 3GUFA 3QH3B 4NSKB 3WFZA 5E1GA 4M8QA 3DBXA 1HJCA 1NEZA 1S9VB 1EAOA 3TH3T 2R29L 3TEWA 3T2LA 4J3UA 3SDDB 4JFYB 5CAYB 2V9TA 3WTWA 4GBXA 4OLXH 1T7ZA 4N2MA 3SOTA 1KIQA 4O58L 3AREC 2X0VA 5IREA 3PWUB 1S7VA 3CZNA 3GMMA 2ESVD 4RDQG 5MEPB 1MCHA 1T22B 1JHLL 5I74B 3RFRA 3T71A 7FABH 2AI0H