3QORA

Crystal structure of human nuclear migration protein nudc
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
120
structure length
119
Chain Sequence
GSSSKLKPNLGNGADLPNYRWTQTLSELDLAVPFVNFRLKGKDMVVDIQRRHLRVGLKGQPAIIDGELYNEVKVEESSWLIADGAVVTVHLEKINKMEWWSRLVSSDPEINTKKINPEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Features and Chaperone Activity of the NudC Protein Family.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding, cell cycle
molecule keywords Nuclear migration protein nudC
total genus 28
structure length 119
sequence length 120
ec nomenclature
pdb deposition date 2011-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04969 CS CS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3qorA00
4I88A 4FEIA 4ZJ9A 4YE0A 3N3EA 3L1EA 4PCKA 4M5TA 3L1FA 3EUDA 3J07A 3GT6A 2WJ7A 2Y22A 2WJ5A 3IGFA 3VQMA 2CG9X 2RH0A 1X5MA 2KMWA 2O30A 3Q9QA 2Y1YA 5DS1A 4YLBA 3VQLA 1EJFA 2N3JA 2KLRA 2BOLA 2N0KA 1SHSA 4M5SA 3QORA 4MJHA 3GUFA 4YLCA 5LUMA 2K8QA 3AABA 4PBDA 2MNWA 4RZKA 4ELDA 1WGVA 1WFIA 3Q9PA 4YL9A 2XCMC 3GLAA 1RL1A 3L1GA 1GMEA 4YDZA 2CR0A 1WH0A 3AACA 2JKIS 4JUTA 5DS2A 3W1ZA 2Y1ZA 3QORD 3QORB 3QORC 4JUSA
chains in the Genus database with same CATH superfamily
25C8L 4XX5A 4OCNC 1HQ4B 2RBLA 5KBKA 1EZUA 1YMMD 4PRPA 3EADA 5DD5H 4HU2A 1RZ8B 5HYJB 3N42B 3ARBD 1B4JL 3HG1A 2AKRA 3PIQB 1H9DA 3RL1B 4LK4A 4ODTH 4JFHE 3EZ8A 1EHKB 1CFQB 3LZOA 4RQQB 4HKZB 2ICCA 4UQ2B 1AXSA 4FNQA 4PJDA 5ECJE 3MV9E 4F3FA 1F6AA 1FL3B 1TCRB 4BHUI 1KDJA 1HXMB 1PIFA 3GDBA 4MBOA 2PP9A 1FFQA 1YVLA 2A74B 3EXJA 1PJWA 5IB1A 2A6JA 1E9OA 2KZKA 5GS2D 1MCCA 5DEGA 5GGQH 3WMSA 4KQ4L 3NABH 2X70A 3FFCB 4WUKH 1KULA 4MCNA 3CX5K 3FN9A 2WCPA 1WIUA 1T7XA 3DARA 4PWGA 3E2HC 4GQ9H 5F8QC 5JOFB 2GJJA 4J27A 3QR0A 4M48L 1TJHL 3LKQB 5EOQH 4NSKA 5DJXB 3PP3H 3BZEB 1AANA 3X1BA 1TJGL 4FYRA 4KKCD 1ZGLA 3KVDD 3C2AL 4BFOA 2JVUA 2F18A 4UILH 2HX9A 5DWUH 3FQNB 5TDPB 1F97A 3GSXB 2GIXA 3QUZC 2FIKB 4LEXH 5IHHA 2YQ3A 1E0OB 4HALA 2YMXL 3WEBA 5IB2B 4Z7VE 4PVBA 1NBZB 2HXAA 5ISZD 1KXTA 1SJVA 1DBKH 5BOPA 1LO4L 4WGVB 5IF0B 1KB3A 4JN1L 2VMCA 4K3GA 2NXYD 3D51A 4M5ZL 1JD7A 4B7LA 2G5BA 3BVNA 3PJSB 3VFMB 1WD8A 2P43B 2ZTBA 4G8IB 5B8CA 1MI5A 1RP9A 1IFHH 2Z93B 5F9WB 1BSIA 4RIRB 5TPWL 2CDEB 1JF6A 5D7IB 2J4WH 3EDEA 3UEZA 3LHPL 4J23A 4PPTA 3DJRA 5E9DD 3RGVD 3MBXH 4KHTH 3QUXD 5JR1L 5CLYA 4FQLL 3HAEB 4HIJB 1L9TA 1RIUL 3GTNA 4NO5B 4P2RE 4BZ1A 1M7XA 2YA0A 1PD0A 1OAXH 4U6HA 3MJ9H 5FYKH 4QXWA 3ULSB 3BKCH 4JO8A 4P4RB 1RD6A 2YMOA 3B8YA 2QR0B 1I9EA 1G7LB 3FF7A 5C0BD 1HHGB 3HZMB 3UCQA 4JJHA 1I9JH 2DYPD 4HCRA 1CGWA 2X1OA 3EO1A 2B2XL 4HSQA 2WLYA 4KDVA 4OF8A 3BP5A 2WQRA 4KKLC 2Q6WA 1GC1C 1M05B 1VLXA 3C9NB 4XMUA 1EZSA 2QQNH 3G6JF 3MDJA 1VHPA 3VI4E 1IEAB 3K4ZA 2K3HA 2PYED 4QRUB 1MCIA 4OAWB 4F7EB 4N2LA 4N2EA 1FLTX 2DMHA 4A67A 3WEXB 1H8OA 3MRKB 4Z7NB 3JV5A 2XBTA 1QA9A 1HVXA 3CXFA 3H9HA 2H6OA 4G6FD 1A25A 1OP4A 3QJUB 4OCRH 4D8OA 2VQ1B 2EJ1A 1TJIL 2WVVA 1TENA 2VDLL 1ET7A 2X6AA 3I6KA 5MEOB 1EJFA 4QI3A 2HLAA 5F1OB 2Z35B 1GPOH 2XXMB 4YOKA 3P11H 1KXHA 4RISL 1EHXA 1GW0A 1P4IL 4DUVA 1FRGL 4QXUL 1XGQB 4S0TD 1UCTA 4NZRL 3WMPA 4PJGF 3FCTA 2K3TA 2VITB 4NNPL 2WUBL 2N1KA 2WAQA 3QORD 4C8XA 2D2CC 3VFUB 1KPVA 1A66A 2AXJA 3DVIA 4MB1A 5CILH 3PXLA 2VH5L 3I9PA 4RZCB 3VX0A 1G7IB 1FNFA 2ZG1A 5HDRA 5FGSA 1BVLA 5DRNA 3UTSD 2W0LA 3E1ZA 3QJRB 3RZWA 4EI5B 3D18A 4AQAA 1LJMA 3L3GA 5C2BH 3QUYA 4JRYB 4WSJA 2YSTA 4HCRL 2K6ZA 1QHPA 2GUOA 3D39B 4ODUA 3LKPB 2VXTL 4X5LA 5HDWA 5IKCA 3TX4A 4MX7A 3NN8B 2CO6A 1ZT4B 3A6CH 5FWRA 4QRTB 3ZUNC 1IE5A 5KS9B 2ZICA 5EC1A 3QNYA 1WCBB 1YEJH 4NCDA 5D5ME 5IG7A 2GJ6E 1U41A 1S9KC 1DQTA 1KOAA 3EGSB 3GI8L 3I85A 5FYJH 5DK2A 5TDOA 1U3YA 1L7TH 3S4SA 3GJEA 2V6HA 3RVUC 1QHOA 3FBKA 2AFNA 1AP2A 2G3MA 2WCGA 3K2UL 1UZ8A 2LTQC 1JFQL 1I8IA 3MODH 3Q6FB 4TSCL 2FNBA 4CMHC 4FFWC 2Y7SA 3LQAC 5DMIL 4FI8A 2YGVA 3TJEL 5EMYA 1UATA 4OFDA 2FUTA 4A63A 1J0ZA 4XXCC 3LPPA 3WIHA 2A7BA 1AH1A 2FGWH 5EFIB 3V6ZB 3CFKA 1GCFA 4BM7A 4Z95L 1N0XL 3P1VA 4MDJB 2FDBP 1NICA 1B90A 2XTJD 4MSWA 4NPJA 1JXFA 4UU9B 3SYPA 4ADJA 1FGVL 5E8PA 3MQIA 4Z7NF 3P3YA 3WN5B 3N6YA 4ANWA 4MXVF 1JGUH 2DQTL 2VLKD 3AT0A 4RAUB 4DF9A 4HOWA 3CZJA 5DFWH 2Q87A 1GYCA 1PKQB 4J4PC 1BBJA 1TQCC 2P4AB 1MW0A 4RETB 1W80A 3T0EC 2CGYA 4FRWA 4FFYH 2Q7NA 5ACZB 1ERNA 3WY4A 4R3SA 5D7LA 3NH7L 2VN5A 1UG9A 5I15L 4OU3A 5E4OA 5FK9A 1NIEA 4NIYE 1ACYL 2FJHA 4K7PH 3VWJC 1XR9B 1N5YH 1T1YA 4ANVA 4PGZA 2Y4SA 2UUDK 5BQ7A 3V6FA 5D6CB 1EMTL 3RGVA 5IB4B 1UACH 4NO0A 5HVHB 2F61A 5TGBB 2YKLH 1JF1B 2BNUA 5CSZB 1MAML 3B4NA 3O11B 3P73B 1VPOL 3FTGB 1T0MB 2E3VA 5JO5B 2CO1A 1DJXA 3G7TA 1BMWA 1VGKB 3AQXA 2F19H 4D9QD 1TETL 2A73B 2VJ8A 1T7VA 2A0LD 4BH7B 5DYFA 3BUYA 1XIWA 3PG2A 3VFSB 4PRID 2ZOKB 3A6OA 3ZIYA 1MJUH 1THCA 4KRPC 2DH3A 1HWGB 1ZY9A 1MQKH 2X2JA 4HIXL 4YAQA 4M6AA 3P3UA 3HAEH 2BSSB 4YC2B 4LKXA 3ML8A 1R3LA 1NDGA 2YAPA 2DBLH 2OMWA 2PW1A 1R5IB 2A9BA 3RL2B 3GBMH 1Z7JA 4QHUB 4X99A 4ZMOA 4WI3A 5GJTL 2UWEA 1MCBA 2W5PA 3C60D 2HJFA 1GC1H 4PI2A 4PJEF 1J11A 2OXGA 3OMAB 4YPGA 5I8EB 3CG8A 1BVOA 1WIOA 1OSZA 4PS8A 1ND0A 4JREB 3T8VA 5FKPB 3IRPX 2VLJA 4NQEB 1O9VA 3DXAA 4GFXA 1BLIA 1LEGA 2IH3B 3D06A 1ZV2A 2CDFA 1G7QB 5J56B 1IGYA 3QXDA 5FDYA 1E8WA 2XHNA 4NLHA 1P4LB 3GSQA 4L37B 2CO2A 2JV6A 4XP6H 3U48A 5FGRA 1NCWL 3C5XA 4WRLA 4WO4B 2BNQA 5CCKL 3QAZC 1D6EA 3HC0B 1QTYT 3K2IA 4N2FA 4PB0H 3ZHFA 3RWCA 1JPGA 3QUMA 1ETJA 3WKMH 4PG2A 3S88L 3VB9A 3NSCA 4J3TA 1DQMH 2DQCH 3M1BA 3IETB 5GIRA 2PP7A 2YWZA 4WWNA 1LYQA 2ESVB 2JI3A 1G43A 3FSWA 1NKGA 5HHQB 4YWGL 4ELME 4WW1B 2OSLA 1G0DA 2O5ZH 1F90L 3BIKB 2PR4L 4QRPE 4F58L 4CRPA 1HZLA 3U2JA 3GO1L 2UYLB 2V2TA 1TKWA 3JSSA 3LN5A 3HVDA 3PNRB 3T3PE 3HBZA 1NCHA 1Z9LA 2ODHA 2DI9A 3Q5OA 2WBJB 4BWUA 4GG6B 1QSVA 1BZDA 2ZYSA 4P2OC 4XPGH 4YSAA 5D1QB 3BLKA 3APFA 3W9DB 2IMNA 3SO3C 1FWXA 3JWNH 5ANME 1RH8A 4ABWA 2FEEL 2L7QA 4CMMA 3L45A 1VACA 3MJ7A 4S10A 3M1CA 4NNYA 3H6AA 5IJCC 1P5UB 3BQVA 4JRXB 1EGJL 1FGNL 4GUQA 3EYFA 4UCFA 3WTTA 4FHKA 1OSPL 2CIIB 3HHMA 2ERJB 3HIZA 3EGDA 4KXDA 3CFEB 5H2BA 5IVXF 2WKOF 3MLYH 4E5XB 2A6KB 5CZRA 5FYLE 5MHSE 3QIUD 1KCUH 2R1WA 2LU7A 3WJMB 2DKSA 3C6LA 2H6PB 2K7QA 3MLTB 2R1XB 2Y5TA 5E6UB 1YDPB 3HMXH 4Q14A 2WVUA 5DRXB 3LZNA 3VWJA 1UM4H 2EO1A 2VR8A 2Q2EB 1KGYE 5GSRA 3WFDL 4PJ8B 4XNZB 1QNZL 3ISYA 4H0GA 4ZXBD 1K5NA 5ID1B 2F8XC 3S34L 4U3SB 4XP9H 3QZMA 4X80H 3NCBB 3ZIMA 3DX8B 4NP9A 1KFGA 1ZE3H 1CD0A 4LCUB 1ETA1 4PWIA 3WHE0 1AZRA 2DQUL 2VM4A 5F89B 3VRJB 4L8DA 3SPCA 1UKTA 3H85A 3APNA 4GJTB 4PRPE 3WD5H 4AGQA 1F4XL 4ZFZA 5CIPA 3N1QC 4GIOA 1HQ4A 2BNRD 3MHZA 3RPBA 2R2BB 3H3PL 1W8OA 4HS8H 3SCMD 5T8IA 3IRZA 4YDVA 3RWJA 1DUZA 1TVDA 1WUNT 1JP5A 4M5YH 3MUJA 3U36B 1CDBA 1G94A 3BCFA 1WS8A 4U2YA 4TNVK 4YHYB 2GITB 2VRKA 3LKOB 3BKYL 3IJSB 3PWPD 1G6RA 1YMME 2AJXL 3PL6B 2PTUA 4OFYD 3FH8A 3WNIA 1ED3A 4FQCH 4DJMA 4MDIB 3V2AR 3L4ZA 3ZVVA 4GKSB 4F7TA 3REWA 4MCZA 1E27A 3VVVA 1J1XH 2A74A 2I07A 1S9WB 1HOEA 2XVGA 4G1EA 4LSQH 4U7KA 2ZUTA 3ESOA 4YNYB 3QEQA 4YSOA 3S37X 3V8OA 2DWEB 1AQ8A 3LRGA 3DC0A 3PHOB 4UV7L 1JNLL 4N2OA 4EKXA 1G9MH 1JV2A 2EYRA 2OMTB 4J3UA 4CVXA 1QFWL 4ZXBC 4IMKC 5B3JF 1Q94A 3IDYB 4FZEL 4G7VH 3OXSB 4KK6D 2IXQA 1NAML 3KS0J 4HULB 3MA9L 4EVNA 7FABH 2WTOA 5BQDA 2XWJB 4IIQA 2EE0A 4BCYA 1SVCP 1S6NA 1S2EA 3OKYA 4P48A 4RAVB 1QLFA 2CG9X 4NRXB 5DMGD 5JW5A 2AGJL 3RWGB 4U0QB 3C6SB 1WBZB 1A3LL 1U8NA 1GY1A 1TNNA 3GPSA 3LAFA 3QUZA 3VU2A 4E42A 2R23A 5AW0B 5EO9B 5IB2A 1E2WA 2O26U 3EJYD 4KO9A 3DV6B 2AJUH 2YA1A 4JZNA 4PJHE 3SBWC 3UAJA 3MLWL 2B77A 4OF3A 1K3IA 1TOXA 2NTFB 5DTFA 3O3EB 4XN5A 3ET9F 4L8CA 4OQTH 3GHBH 2XRAH 2V8LA 1U91A 4Z7QF 2BDNL 5BZWA 1OGTA 1SYSA 5EBGA 3GJFB 5K93A 3VE0A 4M00A 5ICXA 3IMRA 3WXWH 4GXVH 4DTGH 5DJ6B 4N87A 3A6BL 4GW1B 4JZJA 1M56B 2BMKA 3LH2H 2VL4A 2WXJA 3QR1A 4CADA 4DKFL 4ZMLA 2VIRB 3PWNB 1ODUA 3ULVL 5LBSL 2VLRD 1A65A 2YBRB 4IOIB 4OM0L 4DKDC 2X9YA 1E6JH 1IQWH 1DQJB 2BRRH 3KYNB 4RRPG 4S1QL 4HFUH 5C3IA 4WI5A 1DBAL 1IKFL 3FONA 3IFNH 4HMCA 3MI6A 5AKTA 3KPTA 4K8RC 1YNLL 2E86A 2Y7LA 1SF3A 4Q2ZB 5EUOB 4M1CD 1BD2D 1KYDA 5GS0D 1I1AB 3OLIA 4ZZFA 5L7XL 2CM5A 3O4OC 4YVNA 5DEJA 1Q72L 1RZJH 2OTWA 3D0LB 5BOJA 3L1OH 3WE6A 1WA0X 2JELL 1YMHB 2KH2B 1RFDH 2PO6C 4QHKJ 4JVWA 3RTQD 1JPSL 1UKQA 4GSDH 4RGOL 5DGQA 4XPBL 5DRWA 5FUCC 4M4RB 1SXSA 2VL5A 2ZOUA 4QO1A 3BP6A 5DT1L 2YARA 2BFGA 3QEQE 4IGBC 4X0KB 5D7JD 4EF3A 2O61B 2I5YH 2OPCA 1XGYH 2F54D 4S0SD 3MRKA 3ROLB 1WFMA 4XCYA 1I8UA 5I1GL 1E28B 3T0EE 3K8KA 4KV5E 4AEIH 2EDJA 3DECA 3HPJA 4U3XA 2R27A 4TVSa 4NKMA 3FBQA 3F85A 3IE9A 3O3AA 4XP1H 4PRHA 1EHLH 4KPHL 4U2ZA 3C87A 5DWPA 1A1OA 3O0RL 1B0WA 4OD3H 4HC1A 3FT2B 2QSTA 1EANA 4Q6IC 1HXYA 3ZE1F 5FM5M 3V4PH 4LP4A 3L13A 3VO0A 2Y1VA 3V6OA 4UINH 2WXNA 1AC0A 2HRLA 2B4CH 5KBDA 1YY9C 2CO4A 1B3IA 3QE5A 4OIIL 1B0GB 2DQJH 3BMVA 4XCCL 4NN5C 3IDJA 4PRNB 5AVXB 4HUUA 1LE5B 1MELA 1N7ML 4OI8A 5GGUA 1XSIA 2FQEA 1KEGH 4GUCA 1GL4B 3N40F 4I1RA 1XH0A 5TJWK 2Z4TA 3PUUA 2G0LA 3SO3B 4H8WC 4KKQA 3HE6D 3UJTL 1FL6B 2H2SC 1PLGH 1NC2A 4PG9B 1HK6A 4B3EA 2VZ1A 4JMNA 1PEZA 4TVPD 3QH3B 4N0FB 1KIQB 2GK2A 1DTUA 3W0WA 5GJSH 3MXWL 4PWEA 3TNMB 1NGPL 3CDZB 3ZGIA 1WCBA 2LAGB 2OQJA 1X5LA 2XVLA 2YLHA 3L3HB 3BSZL 3I2CL 1HNGA 3TEYA 2X4RA 3NA9L 2YK1L 3D3VB 1MWAL 1SM3L 1GYVA 1SOQA 1Z2KA 3MRGB 1FVDB 1MCFA 5F0PB 3AWGA 2BIHA 3P77B 4PRDA 2A4EA 3LXCA 1I8IB 4JCMA 3D39E 3Q6FA 1ZHKA 1ES0B 4FX5A 3BZDA 3LV3B 5J12C 3SKOB 3UJJH 3X3GH 4M7KH 1E5ZA 1A5FL 2ICWA 5LCVL 3VWKC 3FQXA 4N8PA 4U1SB 4Q7DA 4NQCB 3VFWB 2BIOA 4CDGC 3K91A 2EDYA 3SDDA 3UPCA 2EABA 3HC3L 1A6VL 2Y5QA 4ONOA 1FUNA 5IB5A 4U7MA 3KCWA 3L3IA 2WLMA 2CHXA 1J86A 1X5ZA 3HKFA 2OI9B 4RMRA 5EFIA 2YXFA 5DR5L 3IVKB 1IAOB 4HWEL 1L9NA 4PJIA 4F2FA 1AZCA 4PRHE 4YHKL 3LXBA 1FL5B 3GS0A 3RHWK 3HE7A 3BAKA 3UTSA 2DDQL 1FVEB 1YN7A 1E40A 4JY5L 1EPFA 1MF2L 4WTWA 1U3NA 3MREA 5I19H 3G6JB 1YEDB 4KKPA 1WAPA 4DEPB 3AROA 5D4JA 1KGUA 1MLCB 3OAZK 4BCXA 2B8OT 4JY4A 3NPSB 4LOVA 3S36H 4C57C 1MOEA 3GRWL 2YD9A 5FKAA 4OI7A 2BVPA 3G5YB 3KW8A 3AU1B 2OZ4A 4L1BA 3RUGA 1CF8H 1OOWA 5DVLA 2FB4L 3FHQA 1Y0LA 2YJLA 3HC4L 3D25A 2QTVA 4LSSL 4PP1C 4B7IA 2B1HL 1EBAA 1MNUL 3BN9C 4C54A 3AM8C 5HXMA 4MJIE 3KPLA 3V10A 3O6FA 1S46A 2LU3A 1RXLA 4L23A 5JIHA 3GSVA 4GI6A 4IRZH 3HLAB 1TTFA 5E2TH 4FXKB 3QQNA 4XC1H 4NQQA 3MLZH 2GI0A 3L4UA 1MHCB 2JB5L 5T3XE 1R5VB 2VSCA 3H56A 5EU5B 2QZQA 3L3JA 5C0GB 1KJ3H 4U1GC 2K6WA 2IG2L 3WFZA 4HZLA 3ASNB 4KDTC 5L8KB 1YAIA 2XPZA 1J8KA 2E7HA 3AB0C 4LOFA 3RNQB 3L4WA 4OZ4B 3CSPA 3VD9A 3L3DA 1OAJA 2FLMA 4JO3L 5HSFA 2YXVA 1MCLA 4OZHB 3QZOA 1BQSA 4M3JA 1J0KA 4H8VA 4U0RC 3DVGB 2VN7A 5KYYA 1AKJB 4M43H 3QAZB 5I28A 2LU5A 1OLLA 2AANA 2PXYA 5HHPB 1MJJB 2A6DB 2IOOA 3DXAE 5K9JL 1QYGL 4M29A 1U8KB 1KNOA 3T0VA 1RSFA 1LEKB 4H8WH 1PEWA 3E80A 3O4LA 1AYOA 2Z6FA 3HG0A 4Z0BL 5LHDA 3VFNA 1CJYA 2UX7A 1O7DC 4OIFA 5C9JB 3WIHH 1TYJA 3CDGB 3O2WH 4ENZA 4NO3A 4IM8A 5ETUB 2PTTB 4H4NA 1YEFH 2WNKA 1Z9MA 4OIAA 5FECA 2FT6A 3S5LB 2DKUA 2MPVA 1T5WB 2APSA 3KLDA 4MA7L 1U30A 1SFDA 3VB8A 1JOIA 4KGLA 3QQ4A 4OJAA 4YBLB 3IETA 1AOHA 1TQSA 4FFYA 4LCCC 4LCYA 3PCYA 4PYHA 5ADOL 2ZKWA 1JYNA 1JHTB 2QDVA 4MAYD 3V5KB 5G4OA 1BJ1H 1CLOH 3VXUB 1OAQL 3MNWB 3QUML 3B6SB 3TTYA 4YDIH 2ZUSA 5E51A 2DD8L 3GLEA 3O8XD 3TIEB 4EQ2A 4UTAH 5B39G 1N3NB 1J1PL 3II1A 3D8MA 4U1LB 3WL9B 4JB9L 3R8BB 3RUGE 5ANHA 3D2UA 3G5VA 3KJ4B 5HGDB 3CXHJ 4NFDA 3F7VB 4OLUH 4JPIA 5IB3A 4PR5A 2BC4B 2PETA 5HVHC 1X7QA 3MBEB 3O45A 4HEPA 1DQLH 2HVJA 2X0WA 2L04A 1ZPUA 4OCYL 1VACB 1MFUA 2NY5H 4AEEA 1SJMA 2NZ9D 3IKCA 2GUYA 4Y7MA 1N26A 4LLVB 3T6ZA 4HXBL 5K9OA 5EORL 2M8XA 1XH3A 3GBLA 3HRPA 2YPVA 3DV4B 3BMWA 3HR5A 3MACH 4JRXA 3PV6B 3M88A 3KPPA 4P2RB 1E4WH 2IAMC 3ZTJH 3CVDA 1LM8V 2ZXWB 1FNGA 4YDMA 4JREC 4Y2DB 4Y4FA 3E8UH 5DJCB 1DUYA 1FZKA 4X0NA 4G7YH 2IALB 2WK2A 4RNRA 3UC0H 4JRYD 1GGIL 4OJEH 3VD2A 3NIDB 1SFHA 1MVYA 2C5DC 4R2GC 4TNVF 4A7TA 4MAYC 2Q76A 4ESKA 2WLJA 5FUOH 2GPZA 1H8LA 1OAXL 3DIFB 4KK8C 1JTPA 2EH8L 5F3FA 1N0LA 4LVNB 3SYQA 2VCOA 5EO1A 3WNPA 2C7FA 1TU2A 3TCLB 8CGTA 4HJEA 5F72S 2X9XA 2X4QA 4LCCA 4N8VA 4R4FH 4WFHD 3AY2A 2WXRA 4A68A 1VFBB 2A99A 3GEFA 2XTLA 2YJQA 3IAQA 4HAGA 3QA3A 3HN8A 4S1SL 4Z7NE 3VRJA 1QEWA 1A7OL 5IGXL 5CKAA 3GMPB 1XF5B 3GMMB 1T20A 4F8OA 4L4VB 4ODSL 4ZOEA 2W9LA 5I75B 3L7EB 2COVD 3B9KB 4JFZL 4Z7VF 4ANXA 1H8SA 2AK4E 3LN9A 4NPKA 4AVIA 3EF4A 1H0DA 4HGKC 3IDNB 3SSGA 3RDTC 5KYWA 2PPCA 3FYEB 5DMYA 1G7HA 2FQGA 2ZXDA 3PL6A 1H3TA 1RJZA 3OR7A 2OMVB 1O0VA 4APXB 2V5TA 2AERT 3K5SA 4ZQKA 4LO9A 1X44A 2X1WL 3V8CA 4PJXB 1P0SE 3S48A 5A43C 3OMNB 4UNUA 3RWDA 1IZJA 1P5VA 3VXNB 5J06A 4CC1A 1WCQA 3ZQWA 1YAZA 2J6EA 1S9WA 3KLHC 1RUMH 2XZAH 1JCKA 2ICWJ 4NUGH 2WB7A 4XMLL 3V0EA 3NZUA 3NPSC 3F00A 4M02A 4GRMB 2FO4A 1WAAA 4PJ5A 3VTAA 2EVHA 1S7QA 4GINA 4XE0A 4AZ8A 1WYJA 1D5MA 3TZVD 4KGJA 4F7KA 5B38G 3VG9B 4OGYH 1XV8A 3WS6A 2WLIA 3BQUD 4MGXA 4YR6A 1JGVL 2I7OA 2MKWA 4L2YA 5F88A 2OR7A 2ZAHA 4LARH 2YUZA 4MS6A 3FYIB 5JW5B 3HNSH 4OFVA 1RU9L 1LXMA 4DGVL 2J21A 5D5MB 4L5FH 3OL2A 4OLYH 3ZW3A 3KW7A 1UENA 4U31A 3MNMA 4H1LA 3T3MF 4JFQA 1E2VA 5F3HB 1H15B 2LQRA 4I4WA 2Z64C 2VQTA 4BZ2A 1DO6A 4X4ME 5HY9A 3ZRCC 1PKOA 2IPTL 3VQMA 2PCPA 5SWZD 4ELKA 2EXYC 3DIDA 1E8YA 3BEVB 3HI1B 5T5FA 4HPOL 3NFNB 5ISZB 1F4YH 1UM5H 2X5PA 1T7YA 1XEDA 4R7NB 4ANUA 1NEZG 2C1PA 4HFWA 3ULVC 3GS7A 2ZSWA 4TPRL 2ZWZA 3T65A 3KPQA 1XF3B 3BFQG 4KXZH 4AJVA 5DVMA 4M61B 2A1WL 3VG9C 5EIQA 4NO2A 5CSBA 2JCWA 5EOTA 1XO8A 3J8F7 1XB6A 4IBVA 2GIYA 2D03L 4L0PB 5ILTL 3OV6A 4JEGB 4Z78B 2UXGA 3D4CA 4WFGE 5F7BA 4HK3J 1VIWA 4UQ2A 3PFUA 1AXSB 2PKDA 2RALA 5IMLB 3QZWA 3BH8B 3QWOB 4NENB 3D48R 3FUDA 1HNFA 2LLLA 5KWYC 4XB7A 5IJVB 1XGUB 5CLTA 4QOKA 4NYLA 5HD8C 3K3QA 4MYWB 3NAAL 4YZFF 1CPUA 1XH2A 4KFZC 4DAGL 5KVDH 4M6MH 4N2HA 3VSQA 2VM3A 5E5UB 1H3PH 3C5ZC 1YY9D 2R69A 2W9EH 1KN4L 3N5AA 3U9PL 4RA0C 2TRYA 4RMBA 2BPBA 1SPDA 3JTSB 1EA9C 4NSKB 3ML9A 1QBLL 1WWWX 1R24B 1WAAE 4NM8H 4A7VA 5AAMC 3CX2A 2XA8H 3D30A 2JF1A 2E8ZA 1JN6B 1NJ9B 3MLPA 1TR7A 4LVHB 3U46B 4C59B 2CBOA 3NIGB 4Y8AA 2F54E 5CUSH 1B88A 2OMUB 1UFGA 4LLQA 5KSBF 4BSVB 3V9FA 3SJVD 5KG9B 3DX6A 2ZG3A 1MFBH 3V0GA 5HGHA 2F9BT 4MB3A 4WHTB 1TZ8A 2BRQA 3TWCH 4HJIA 5IVNA 3ZMRA 4WK2B 4JDVA 3FRPA 8FABA 2D73A 3OPUA 5L6YH 4Y2NA 3CVHA 4N9GB 1DEEA 4JHZA 4PRPD 3ZTNL 4XVSH 4HGWB 5CNHA 3RY5A 2P5WA 5DCCA 3FU8A 4IU2A 4K5PA 4K71B 3FT0A 4WI9A 5KYXB 3V0WH 4GBXA 1HOCA 4EZKA 1QOKA 3MV7D 3V5DA 4ZUSA 3MZTA 4JO5A 4XCNB 2XQYK 5K1NA 3FQRB 4K3JH 4P4KD 3Q06A 4RIRA 4Z7WE 2CDEA 1TPXC 4RH4A 1FFPB 3LB6D 1AHWB 5J4MA 2IBGA 2NW3B 3KDMB 1A1MA 2JB6B 4AE1A 1CGUA 4HX1B 3T09A 5INDA 4Y2OA 4BBWA 4F57H 3DX1A 3U7YH 3VXTB 4CC4A 1UWXH 4Y4KC 4OJCA 4KK9D 5GRUH 4YXKL 3TBTB 4U6VL 1U8JB 2BCKB 3MRFB 3RB5A 3VWKD 4ZFGH 1A2YA 4P9HH 3PDOB 1AQHA 3GMNA 5D7KD 3Q01A 5E9NA 3KBHE 4E9RA 4XMZA 2XN0A 5L9DL 3SKNA 2C34A 1XR8A 4UIKH 3UERA 5T1MA 5IEKB 2OQJB 4G6ML 5JW4Q 1E50A 1NFAA 1VB9A 3AXLB 1YECL 2Y1ZA 4XMPL 1I7RB 1ZLWK 4G42A 3SOBL 3OKDA 5EEVA 5DD6A 4A7SA 3SBRA 2OTUA 3PJLA 4B9GA 3TBWB 5E0FA 5DLML 3ZDYE 5EU4B 1F6LL 2E4TA 3QQ3B 4AV4A 1FCGA 3D85D 3X1FA 2F1BA 2DL2A 3MNVA 4LRIA 4R4BB 2YD3A 1L9QA 3HPLB 2DWDA 4OAWA 5CU9A 3DSNB 1QRNE 2FJGB 3RG1C 2CRMA 2MTAA 3FB5A 1A3RH 3AS1A 4PJ7A 4JO4L 4GG6F 4XAKD 4R26L 4YBLC 5IB5B 2AJ3B 5A6MA 3Q3GA 3VG0H 3T0EB 2EDDA 2EC8A 3WFCH 1F4WL 5EF0A 1AQDA 3BN9D 2DTSA 4JM2A 1G84A 5EOCH 1B2YA 4I18A 4PLKC 1TUPA 4AMKL 2HLAB 1FZMB 2NR6C 1OM3H 4HJGB 4ADGA 3W2DL 1SJHB 3BZFB 1S7XA 2YPVH 1UUSA 4AV5A 2DY2A 2CLZA 4QWWD 4NOBA 3ZRSA 2VDML 3D4ZA 4NQCE 2FJFA 2AEWA 5KVDE 2E7LC 3FK3A 2PUQT 2E27H 2H4EA 4FZ8L 3GKWH 4PJ8D 5BW7C 4PJCA 1JZ3A 3FUIA 5C08B 1EGJH 4U1JB 4P23D 3EGXA 1CI3M 2WYIA 1MFAL 2XC8A 4XN4A 3F3HA 3LMJH 5FPIA 2E6JA 2OKMA 4NQDA 4U1MA 1ONQA 2DWSA 1QBMH 3FULA 2X1PA 1MIML 2BVEA 3NN8A 3FB7B 1C5CH 1JZDC 4K55A 5KTEL 1T6BX 4WUUB 5B1AB 3KJ6H 3SDYL 4IBLT 3OAZH 3STZA 1HL4A 5A2KH 4W6YB 3VFPB 3UYOD 3DO7B 3TV3L 4YHIA 3D0VA 4ZUVA 3RJQB 3IN2A 3NCMA 1T83A 2EKJA 3DX7B 4EN3A 2HRPL 4TQHA 1UWXK 2Q86B 4ELMF 5BRZA 1RIVH 3V4VL 3O6LH 3SDDD 3MXVL 1RIHL 2VN3A 3QUKB 3UMNA 4MNQB 1H8NA 3K6NA 4KKAC 2WSDA 2FL5B 4YHZH 3CDYA 3PQYB 1NMBL 4NZUL 5EUOE 1OPGH 1AKJA 4S2SA 3EYVB 3DBXB 4WO4C 1U8KA 2WUCH 1GS7A 2UXFA 1ZVNA 5EC2A 5HVGB 4GMSH 1YNTA 3F6LA 5CINH 5IWLA 3H2PA 2KZBA 5E5MA 4PRAA 1F58H 3U4EB 3U1QA 3K2KA 1B4TA 2FHCA 1S9VB 5BV7L 2EH7L 4MXQD 1XGPB 5CZXC 2G2PA 1D5IL 2C9RA 3KH4A 4PREB 4WJG3 4PWHA 4NM4H 4Q58C 1PLAA 3EOTH 2R59A 2XIIA 2NX5E 2DQFA 1U8PB 1TIUA 2WXQA 4HUWA 4KFMA 3WDJA 4DQAA 5EWIH 3HBQA 1UJ3C 4HPYL 4M1DH 3ZE0B 1Z5LA 3BKJH 3AMLA 4AG4H 2B5IC 3MLRH 2DQEH 2JIXB 2ORBH 4AIEA 2YKKA 1JZ5A 3KPRD 4AEHL 3FUEA 3FQUB 3I6GA 5DD3H 5AVUB 5HJDA 4L18A 1ZHBA 2BOBA 2ZYIA 4N28A 3LRKA 5IB4A 1H6FA 1MREL 2NRDA 2CK2A 3QXWA 4M7JH 5K9QI 3IEAA 4LLWB 3S6CA 3T9WA 4O51A 4KZ0A 2AHIA 1OP3K 1Q0XH 4OJFH 5DZAA 2JKJA 1OCRB 1T6VN 3RKPA 3U7WL 4J12A 3AY4C 2RD0A 3QPQD 3W57A 2EEDA 5CJQL 3K4DA 3WAJA 3MBEA 3O45B 3U9UB 1AQKH 2B0SL 3CIQA 1IAIL 2UY6A 4HYTB 5C6TL 3ARPA 3L95B 2F6AA 4N3TA 1K85A 3QIWC 2VXUL 1NLBH 4LCWA 3S35X 4YAQB 4MMXC 5DU7A 2GBAA 5H4YA 5ACMA 1EDQA 4WW2C 1NDGB 4JHVA 2A83B 2IO5A 4DOHB 3G04B 2VW6A 2WWKO 2EC9U 1QUNB 5DI8A 2XRAL 3SYAA 5HYSA 5IIEB 4HIQA 1M6OA 1J05A 4IOSD 4LU5H 5FA3B 2VDRL 1KYAA 1Z0NA 4YPGB 5I8EA 4DK6A 1VEMA 3CMGA 4NKQB 2C3GA 4FABH 4LAQH 4U4BA 1S9YA 5DMKB 2APVA 3EYQD 5LXGL 3CFTA 4XO4A 2N0MA 2XWEA 4X5QA 4LP8A 5JDSB 3QDGD 2H8PA 4P5KA 1MPAH 4LHQB 1JHKH 3QEUA 4L1HA 4ZUUA 1W91A 3Q1SL 4MKMA 4ZOBA 4HXAH 1GZPB 1BM3H 5AVQB 5SWQB 5IQ7H 1KENH 1TU2B 2EIMB 3TCLA 1ZHLA 3RTQB 2BNQB 1N6QL 1AI1L 4WI0A 3SDCB 3OXRA 4X6FA 4BZYA 3RKDC 3UAFA 1MJ7L 4D0BA 5J6HB 1NBVH 3MRCA 4K71C 2R2EB 1E2ZA 4JFXB 2BX5A 3BH4A 1G5AA 1OP9A 3TVMB 4YFLF 3QNXB 2ADYA 1I9IH 3DLQR 4KI5C 1FVCA 3LSOA 1HT6A 1PG7H 2TAAA 4L4VA 1JV5A 5E8DH 2QHLA 3RHWF 5AAMA 4G7QB 4BK8A 2NY1C 5FLVA 1V5JA 4HS6B 1ADQA 4PRIA 4PS3A 3ARFC 5F9AC 2R0KL 4IGBB 3STLA 2FYYB 4X8GA 1YNKL 2WLLB 5AZEH 1YQVL 1EBPA 2UYLA 5DHMC 1P69B 1D5BB 4J1UB 2V2TB 2BSED 3DX3A 3AVEA 4L5FE 1FFTB 3BUBA 3EFOA 2ZP9A 3O9WC 1D2OA 3TO2B 2AW2A 5FHBL 4XPFL 3ULUL 5I1JH 4DUXA 4MA8H 4R0LC 2CD0A 1DJSA 2Y07L 3MR9A 4KPHH 1BXAA 3VW3H 5ADPL 3T1FA 3OKKB 3TH3T 3J2PA 3QJOA 2QADD 2WXLA 4RBPH 1UXWA 4LF3B 2XTJE 1E4XI 2P8LA 4X9FA 1MFCH 5E8OB 3WLBA 4OZIE 3FOLA 2EXWD 2NW2B 5F96H 2IANA 4NJAH 5KBNC 3BSHA 3SDAA 4FNUA 3EYOA 4PW9A 4P5TC 1BAGA 4YR6B 1KEGL 4XRCA 3CSBA 1MH5A 1Z32X 4P2QA 3P3TA 5JR1H 2WZPA 4NHCL 3MJ6A 3OZ9L 4JM0A 3NCWA 4CL7A 5JORB 3KWWB 5F1SA 5TK4A 1DLHA 4XXCA 1VCAA 2PYFB 4WHYH 3TIDA 1FJ1A 1S7RB 2J71A 5KJRL 3LNEA 4QRRB 4DGIH 7PAZA 4P2CG 3ATAA 4B5ZA 1IAKA 4RZKA 3ZL4H 2VDQL 3LD8C 5T3XL 3BZ4B 5I8OL 1SJXA 3BEVA 3HI1A 2NY3C 4J4PA 2GJ6B 2FD6H 4DCQB 3B2UC 1QFUH 3I9GH 5KW9L 1VKXB 2A4ZA 3D12B 3DUSB 5EU3B 2CGRH 2NYKA 3D5OF 2KUTA 4I48A 1A9EB 4KAQH 1R3KB 1OCWH 1RHHB 4M1GH 1BP3B 2GAZB 4G9FD 1J8HD 3T08A 1MWAB 4Q52A 5DVKA 5IM7B 4LSTH 3WS6C 4J8RA 4XMTA 2ZXCA 5DEFB 5IQMA 1GZHA 4M7ZC 4JR9L 5ALBH 4FXTA 1Z9SB 1YEEH 5F7HA 2VE6B 3IFLH 3ULAB 3IDMA 4JQVC 3WJLA 1R3IL 1DEDA 5JHDE 1C1EL 4QOKE 6PCYA 4YHPA 3MBWB 4L9DA 3PGFL 4XO5A 1X5IA 1A0QH 1U3HD 2VDQB 4WI7A 2I07B 4G1MB 4BKLB 4LVHC 3HMWL 2E9GA 2YD6A 3L3KA 2CZNA 4FP8H 2YGPA 4LCWD 3ZKNC 3F83A 3DRQA 3KPNA 1IBFA 1AE6L 5DUPH 4I0PD 2QQQA 3PF2A 5C0BB 3ZL1A 4DESA 2B59B 3EOBA 4IKNA 5BPPA 3TEUA 4P4KC 3UJIH 5BRPA 5FO7A 3HS9A 3VCLA 1UD4A 1JTOA 2DM2A 2HWZL 1MHPH 3P4LA 4E2OA 2Y7QA 2H9GB 1KCSL 1KBVA 5EZPA 4DQOH 4ZUTA 2BOCA 2Z7UA 3LOWA 4Q97A 1R0AH 4OKDA 2ZG2A 2XVBA 5KJ4A 43C9B 1INDL 1U8NB 3MLXL 3ZK0A 1CYXA 1KJVB 1HI6A 3IDUA 4JFDA 4YHLH 2J8UE 2MQCA 1I9RH 2CBQA 4FQ2L 1I7UA 5D72L 1KELH 4Y9FA 4UIMB 1MCWM 4IRJB 3Q2VA 3IFPB 5J3HC 4AYMC 1FP5A 1KFAH 2NXYB 4P59L 5DTFB 3VGAB 1TZOA 1LK3H 2Q3XA 3D4GA 3FPXA 5F7DB 5IVZB 2O5YH 3EYUH 4GSXA 2RIKA 2R1YA 2DYPB 1U8IB 2GKIA 1I1AD 1ZMYA 3MRMB 2HT2D 3KDMA 4IIZA 4AW4A 1X4YA 4LVEA 3MODL 4HK0B 4TSCH 1BMZA 3VUAA 2IQ9L 1A14H 2ZX5A 1WZ1L 2HT3D 3TBSB 1HCFX 4I7ZC 2VWEC 3VGAC 5A2FA 5BMFH 5HHMB 5F7MC 3PIQA 1UB5A 3SYCA 2VMJA 5F3BB 3AREC 5EU6E 4YXLL 5C2UB 4S1DD 2BVQB 2ZX6A 1E42A 1WFUA 3N41F 5E4IA 1FO0A 1YG9A 1PZSA 4KRNA 3WIHL 1FYTD 4JFOA 3LH9A 2G2RB 2GTWA 4GUPA 4X6BA 2E9JA 1MHHA 4M3HA 4M8QA 3RZCC 1KWKA 2CH8A 3RE0A 1BVKA 5EU6D 4X7TB 1OGSA 3PP3K 3LQMA 4CAGA 1E9OB 1W6WA 1SXCA 5DEGB 2V17H 4TQPA 2VR4A 1KPUB 3GTTA 3SE8H 1FNHA 5CEZL 1JCVA 2PF6A 4MDRA 4Z77B 4LLYA 2DWDB 4JO1H 4MJ5B 2H26B 1EEZA 3LTVA 1G7PA 3QULA 4UANA 4L8SB 1KTRL 3ZHKA 1U8OA 5I6KA 5MHSD 1NL0L 5GZNA 5BO1L 2AV1B 4TSBL 1E28A 4GP5B 1OB1A 4F1ZA 1D9KB 1J7VR 2FNWA 1T4WA 2Q0ZX 4NKMB 4GRWH 2QELA 4KOCA 3CFJA 4MD4B 5F1NA 3U7AA 2YS4A 2R7EA 4XR8C 2NTSP 1VPOH 5C0JA 3QDJD 3ARGB 3VGGA 2F54B 1OCOB 1U2HA 1L4IA 1RUPL 3V6OE 1FZMA 3HBPA 3UL4A 4KOBA 4KJWD 2ZWNA 5FO9A 2NDGA 4OCSH 1EFXB 1E4XL 1QZ1A 1CCZA 1Q9KB 3TJPA 3NESA 1VGEL 2HVKA 2WXIA 4F8TA 1T22A 4JPKL 2XLLA 5GS0H 2G0KA 3LXAA 1NDTA 2IQAA 3QRGL 1UVQB 3ERXA 4IEFB 2VUOA 3T2NH 1RUKH 2XFXB 3ZZQA 1ETZA 1XH1A 3P3RA 5EORH 3UG5A 2UZYB 3PY9A 2K7PA 4KX7A 1QZNA 3LNDA 2UY7B 4H1LH 4HH8A 5GJTH 1SYVB 4EQ3A 2I26N 4WU7B 1V27A 4XHJD 3TO4A 2Q2LA 4YC2C 2OBGA 4XWOD 3B2VL 3FAXA 5AAWC 2WXFA 5GZOC 3N55A 4HUMB 2V2XB 2XY1A 3M8OL 2YAFA 2YMTA 1UZGA 3FCUB 4X6CB 3UTTA 5IHBA 1V7ML 2WZ0A 3K80A 2X7LA 4ZMZA 1L0YA 4JG0H 4LDCA 1LMKA 5MEQB 4FQJL 1PZUB 5BVPH 3RWEA 5HHXL 3IJ8A 1YEKL 3PWVA 3FO2B 5KOMC 3OX8A 3H1ZA 5BV7B 1NZRA 4PW3A 1A1NB 1ES0A 3IFOB 4YDZA 3UZEC 4MAUH 1T21B 4F20A 3SQBA 1PD1A 2VXTH 1OT2A 1VAHA 5AUMB 1XVSA 4PJ9A 1H3UA 5GGVL 2YQ2A 3KLAA 5JPNB 5JA8B 3J27A 3TCXA 2V5SA 2A9DA 3Q05A 1OIOA 2GBTA 4LT7A 4G7RB 1SQMA 1ZPLA 2X0UA 1N64L 4I5BA 3VJ6B 4OFQA 4UZUA 4Y16C 1KJMA 4R96B 1DVFD 2FTAA 3CDFA 3VTTA 4C4BA 4YQXL 2XETA 3BZ5A 4ZMAT 2CCWA 1GKOA 5KYUB 1MW2A 2WC7A 3SE4A 3NJGA 4UNVA 2LFEA 5KSBB 3PAYA 2IDUA 1DSFL 5IHLB 5T1KB 2WOYA 3F8UB 3GGWB 2QEJA 3MRRB 2VQ4A 4P9MH 2MQ3A 3ARXA 3BGAA 4JGNA 4LZKA 3VFGH 3MROB 4X4YA 1JNNH 1G7IA 1W0WB 4MJIA 1YEHL 1UQSA 2P5EB 5I1HH 5EDSA 5IR1A 2XCMC 1E5CA 1OE1A 4O5LL 3VRLF 4KHXL 1KT2B 1XCQA 3T0ED 1JGUL 2JK5B 4UM8B 1ESOA 2IFFH 4Y9CA 3P0VH 1V7NH 1TQWA 4YGVB 2ZCLH 1T7WA 1CDJA 5C0GA 1MFDL 3E2HB 3WUWG 4OVUA 3BAWA 4WNQB 1OY3B 3AS0A 3OHXA 5FF6A 3LN4B 5AZ2H 4LVOB 3T2PA 1QQDB 1NFIA 5FOBA 1ZA6B 4J2QA 4NZ8A 1XL4A 3HNTH 5FUCE 4PP2B 5AAWA 2HKHH 1AGDB 2ZOOA 5GZOA 1KMGA 3X13A 1PZAA 4BXSV 5DZOA 2YSSA 3RAJH 1ZWIB 3AG4B 2VXQL 3L2MA 1W72L 3CHSA 2XKSA 1J8RA 4ZD3H 2QBWA 4AGPA 4WWKD 3CBKB 2HMIC 3MLVH 3W11D 5F1IB 4J3SA 1OHZA 5C0FA 2OK0H 2W07A 3D9AL 5EEUA 1A6WL 2NT1A 5BCAA 1MEXL 5IZ7A 2ZYHA 1CR9H 5JZ7D 4DN3H 1B6DA 1T0NA 5LN4A 3CSFA 4QDGA 4IRZA 3SE3C 4G5AA 3UYPA 1QFPA 3MV8D 4BWWA 5J13B 2JSFA 4RFNB 3QZWG 2H2PC 1PIGA 2GTQA 2JH2A 2O6PA 3C60C 2YAEA 3M46A 4XN8A 3UAJC 3WN5A 1UEYA 2VDKB 4G8GA 2VQUA 2GSGA 4V1DB 3K8LA 4WU5B 4BFIA 5MENB 1I1CA 3I6LD 3QYCA 2FX9L 3WBDA 5IREA 1QSFA 3SJVB 4X83A 2E6QA 3RX9A 2EUZA 1S78C 2OCCB 4PJ7F 3IJHB 3ZYIA 4JM4H 1W15A 4FXGA 1DVSA 4WI4A 5EV7A 4G9FA 4JHWL 1JZ2A 3EH1A 2YA2A 4G43B 4G6AD 4KNQA 3VSVA 2VW7A 4X98B 3VXSD 4UDTB 5E6IC 2BY3A 4HIEA 5ESAB 1UJ3B 2EECA 4IRSB 4P5TD 1MVUB 4TVPE 4OT1L 4PGEA 3RGVB 1CI5A 4U1HA 4FFVC 4ZPVB 4GT7A 2XWBA 1AJ7H 4Y4KB 1AS8A 1F3DH 2ATKA 2DLTA 5EBMB 4MNGB 3FTGA 3P9LB 4YSEA 5I9QB 4YX2H 3F7VA 1DZBA 1F0LA 1LTXA 1A3LH 1ZLEA 1D9KD 1KB5B 3CGTA 5TE6L 3ZT6A 3MR9B 2YGNA 1U6AL 2ENSA 5DURD 3IDIA 1AD0A 1JK9B 4O58H 1CTNA 3OQRA 2ISDA 1T03H 4XPAL 5D71H 2FR4A 3ARBC 1UEMA 5E1AA 3MNZB 2V9UA 2YAQA 4E9WA 1ZVSB 5DZNA 2N7AA 5EUKB 3KL5A 4N6RB 4YWGH 4G9DA 2YUXA 2DJMA 1VFUA 3QJFB 2BWQA 3UZQA 4PBWD 3L5HA 4OQTL 3TLRA 3E6FB 4CNIB 3UZEA 4WV1B 1AIFB 3B56A 2QSQA 4ERSH 3D6GA 4JFSA 3RY4A 1MRCL 1A6TB 5BVJB 2P1YA 2AK4B 3RU8H 1MRDH 1BZ9B 2LGNA 3BAEH 1I3GL 4QHMB 3MUGA 3RDTA 3BUQA 4M8VA 2NNCA 4DGYH 4CJ1A 3KWWA 2GW5A 1AMXA 5E6ID 1MHEB 1QPXA 1MCSA 1YJDH 2CR3A 2XG5B 3Q0HA 5DJ0A 4FFZH 2IPKB 3BGFB 3GSQB 4MAYA 1OQXA 4JFFE 3SKJH 4YK4C 2BERA 3CSYB 3MCYA 1FGNH 3EFDL 1BXUA 3E3QC 2KDGA 1J48A 4WGKA 2QPEB 1Q72H 1RZJL 3QJXA 4X7DC 5KEZA 1OAUL 4PGBA 1D5XA 1RFDL 3SO5A 2B9BA 2XN2A 3A4AA 3UMTA 2DQIH 3VXRB 32C2A 3HFMH 2DW5A 4PY7B 3OAYH 3PFQA 4XPBH 1TTBA 2B15A 1QSFE 1NCJA 2AAVA 2ESVA 2RCSH 4G8EB 3DPBB 1NM9A 4TUKH 1UKSA 5HYJD 4NQXA 4M6OH 1BF8A 1A6AB 2QKSA 3OHMB 1GMEA 5E9DB 3MRQA 4MRBA 5C71A 5TDNA 4F2MA 3CZNA 4R84A 4DERA 5CEZE 5IV2A 1F02I 1MCDA 2AEPL 4IDJH 5FC9A 2ITCA 2F74B 3FU9A 3O6MH 5D8JH 4KTYA 1JVKA 4HOMA 1JPST 3BWSA 4LRNH 5GGSA 1A7PL 4L9LA 3RWDB 5FCUH 3P0YH 4XN9A 4M93C 1C8PA 1EHLL 4D0CB 1KPRB 2Y6SC 4AMKH 3NIGF 3O0RH 4OD3L 3WD5L 1M1XB 15C8H 4N0YH 2XPGB 1IIKA 4PB9H 4P2QD 1AIZA 2H0PA 1FNSH 4M03A 4GRLB 3VYOA 4XBGA 1NBZA 4ORGB 4DVBA 3KVQA 5MEND 2NUTB 1RLBA 5D9SA 1IU1A 2LLNA 3CLWA 4XNQB 1JYXA 1U4FA 1ORQB 1E9QB 4KITB 5FO7B 3VCLB 3JTBA 3FO9A 3U83A 2FZ3B 1INEH 1CZ8L 5IP4A 3EGDB 4E5XA 5CD3B 4H26B 4EAEA 2HT2C 5GXBB 2ZCHH 5SWZA 3WO3B 3VXPA 4L4TB 2QVTA 1SOKA 2EXTA 3RFRA 1CYWA 4MMYB 4OTXH 1I1YB 1O9WA 3H55A 4U3CA 5HHNB 4OZGF 5BZDA 2XY2A 1KXVC 2GY7B 4KZDH 4XNYL 4JY6A 4N3UA 4H1LB 3MJ8A 1YN6A 2W1NA 4LQ1A 1IT9L 3T1WA 1RULL 4JAMA 5SX5H 3SDYH 1TQBC 2HFGL 2EXSA 3QS3A 3EFFA 1TJHH 4H25A 3OWEA 2F5BH 2SODB 4KUZL 2X87A 4PJAF 4PLNC 1IC4H 2NY2C 4XVTH 5TK2A 2BHZA 3MRPA 4R7DB 5DQDL 3MXVH 4D9LL 2ZSWB 3PL6D 4BZ2L 6FABH 3R06B 3AXIA 4HUXB 1UA6L 4E9TA 5HBBA 1OE2A 1TYEB 4LIQH 1S7SA 1LO5B 4LSRH 2J8UB 4M61A 1JZ4A 4QHPA 4QRRD 3DYPA 3P9MB 4KVCH 3MCKB 4KY1H 3OJVC 3WLWC 3UBHA 5LCVH 4F7EA 4APQC 2XU9A 1OAKL 5C07B 1ZT1B 4P5TA 2BP0A 2WUCL 5H94A 1UB5B 1LLAA 4JN1H 5E4EC 1BECA 2YD1A 5CINL 5I1LA 2Y36L 2C3WA 2VLJD 4F2ME 3P69A 2DH2A 3ILPA 1BWMA 4MDIA 1HJCA 3SGKA 4QRQA 1A8ZA 3DVFA 3QDGE 2W0PA 1IGFL 4HWEH 1TYRA 2N7SA 2J4WL 5IMMB 1KIRA 1E4HA 2HH0H 1EVUA 4BD4A 4ODVL 1W72B 3CC1A 3KXFA 4JDZB 1JYVA 5GSVB 3S98A 5H8DA 3IBOA 3X14A 1LDPL 2COQA 5J89A 5C0IB 1IGTA 3GMRB 4X5WB 3O3DB 4NQVA 4YE4H 1DVFB 2CJUL 4AKOA 2VLKE 5LJYH 2AQNA 1RI8A 1G7PB 2EZ0C 4K8RD 4S1QH 2FBOJ 3OKOB 4OGXH 3PU7A 1B0RB 4ODXA 2AQSA 3QNZA 4ORZC 3RGVC 4OZIF 4FG6D 1YA5A 2DTMH 2QQKH 3GLDA 3HE7C 4WDIB 4O2CB 1S7UA 4L3AA 4Y16B 3U79A 1RZFL 4NHUA 3U2IA 3BOVA 3OKNA 5D7IE 4RFEA 1NUFA 3E3QE 2JELH 2ADIB 1G7MB 1EUUA 1WBXA 2R0LL 5HGGS 2R23B 3UACA 5E6IA 4DP4X 4APQD 4WW2B 4IRZL 3AWEA 2DLEA 2LU4A 1PZBA 1M9WA 1WG3A 1FN4B 2JB5H 3DI2B 2VKXA 4N22A 3VWKA 4ABQA 3IPFA 4NRZA 2JJTA 4HH9B 4LASH 1Q9LA 1RK7A 1G5GA 3CZUB 3KGTA 3UIZA 1KTDA 4FOMA 3F7RA 4FULA 4N1CA 5KANG 4GPVA 1KG0B 4XP1L 2IMMA 5IMOB 1PJ9A 4YDKH 1U95A 3FUHA 1NWPA 3EO0B 5HYJA 3JZYA 4M3KB 5IEHA 1I8MA 5D5MF 1AR2A 4QT5B 4K3EH 2XWTA 2AI0L 5DXWA 4K2UL 3VWJD 1RURH 1NCIA 3BSGA 1L5GA 5HDQH 4ETQA 3TVMC 3N1FC 2KQNA 1TCRA 4Q6YA 3IRCA 1BZ7A 1J1OL 1YEGH 4PRBB 5JW3L 2ATPB 1UZ6E 4QKXB 3WI9A 3OG4B 2R39A 5E2UL 4DPCX 3RURA 1YUHB 4JJ5A 3O2DL 3PWVB 1J5DA 5A16A 3QORC 4JO2L 4DW2L 2C9QA 1HIMH 2Y2TA 3RIFK 3T77B 2VL5B 1BBDH 1UWGH 5T33H 4TOYL 2A0LC 4PEEA 2CDGA 1WT5C 4HF5L 4NRYB 4ONGH 4PJ7E 1X3DA 4ES8A 1GHFH 1PZCA 2P80A 2EO9A 2NT0A 1KBGL 1ZV9A 1F13A 2VLME 3D7PA 5E8DL 4FQHB 5D7LB 3UABA 1MCWW 3ZE0F 4H20L 1IKOP 2CA3A 3ARWA 4EIUA 1MIEH 1UB6B 4NUJB 3TNNA 3NPZB 3VXMB 5BS0B 1FBIL 2X0VA 2XPYA 4HV8B 1J8HE 1K5WA 4TV3A 1J1PH 4N0RA 1AQDB 1HWHB 4JM2B 1SDDA 2HAZA 2BP8B 2MPAL 3N41B 1T66C 3QXAA 4WHCA 2GFBB 4EPSA 1QKZL 1FLRH 2GK0A 5JXEC 1MWAH 4XAWH 5JOPD 4TVPL 5GRXG 3K2UH 1IL1A 3IDXL 1FV1A 1KGCE 3FT2A 3N06B 3DGGA 3BXNB 2EEAA 2OJ1A 3TPKA 4FTVD 2B3RA 4HJJH 5FUZL 4DN4L 4ALAH 3MGOA 3G08A 5IVXA 5MEPB 2ZOKA 5T1KA 3TURA 1AXIB 2CK0L 2UZIL 4OF5A 3C5ZB 5CBEA 4GAFB 3CN3A 3BP4A 3HG1B 1JNHB 4HZAA 4B95C 2AKRB 1SLUA 1ZLVH 3K81A 4ONHA 1WZAA 4ZPTB 1MN4A 4TULH 5F7AA 1SY6A 4NO5A 2JKTM 4JE0A 3SGDH 4PYGA 1KT2A 4XX1G 4V2BA 5FO8A 3FH7A 2VRQA 2OL3L 3DOSB 4G72B 4UZGA 5JMRA 2DJSA 4TQIA 1M2VA 1MF2H 2JCCE 3WNKA 1Q0YH 1DR9A 2GG1A 2SEBA 4Q9RL 3K72B 2FX7H 4HBCH 5BRZE 4DZBB 4W9KC 4FMFA 4KMTL 2EYSB 4IKJA 1XSOA 4X6CE 2PMZA 1FG2B 3UAJD 1RZ7H 4PP1D 1NBYB 5ESQB 3E6HB 5EB9A 3C9NA 1XWVA 3F7KA 3X11A 1IVLA 4D7BA 4L1DA 1U8MA 3I9GL 4P2OD 4X6DB 3JXAA 3DX9B 1I1RA 3RVWD 1ZGLB 1L7IH 2VLMD 1X5HA 4R4NC 5D2NE 3CZKA 1K8DB 3CH1A 1R3HA 2EKSB 4DUWA 1I8LA 4ZO6A 1ID2A 4IRJC 4PJXF 4XC1L 2DQMA 5CZKA 5J1TC 1XZ0B 4C55A 4PW4A 1UWFA 5CHNA 1A4CA 1CFVL 1A6ZB 1U8LA 3FT4B 5D2LF 4XXWC 3X1NA 5D7KE 3F01A 4PJFB 5HVWA 2EACA 1AS7A 5C0AD 1NEZA 1Y6NR 4LSVH 1WLHA 1FORH 3B7YA 5GGRA 5C8JA 4HUWB 5I0ZA 3GDCA 2C9VA 1EEYB 5I1DA 4M5SA 1CXFA 4UB0L 3QPXH 1IM3A 1UT9A 5E8EA 3B2DC 4HIJA 5ABZA 1MY7A 1RZJC 4MZ2A 1R3JB 4WI2A 1NFDA 3FTXA 3LHAA 4QTHA 5FKAB 1NCTA 1KIUB 2LV4A 1V3LA 1UJ3A 4OCWL 4FNLL 4JN2A 2WLHA 4AJ0A 4EUPH 1JWUB 1KDIA 1QRND 1QWHA 2XWBB 1N0XH 4PJBA 5TH2B 1AGEB 2J6EH 3CFEA 1RZIA 3QUGA 2GSIA 3CE1A 1QR4A 2DJ4A 2X4UB 3MBXL 1TZHA 4KHTL 4N26A 5I66A 3GM0A 4R7XA 1D7DA 3IMSA 1HQRB 6CGTA 5DRXA 4L1SA 2Y06H 2BSRB 1XF2A 5HGBA 4P46D 1WH0A 4HQQL 4LCWB 2OXHB 2CUAA 4KY2A 2CPUA 1HYSC 2P24B 4Q9QH 3NIFE 3P2TA 1BAWA 5CSGA 4RGMB 3IU3A 1SLXA 2WQXA 3LQZA 4YSDA 3VTMA 5B39B 4TKWA 2X42A 4N24A 4UTAL 5LNDA 1KJ2L 1CICB 4G59C 4QF1B 5GRWA 4QKTA 2FH8A 1NCOA 1IILE 2G4GA 3DVGA 5HHME 4HC1H 3IMWA 4A6YH 3ZYOA 5IBLC 5EBLA 2CO7A 3DURA 3A67L 4YVUA 2L7JA 5MI0C 3CN4A 5L8LB 4Q89A 1QD0A 2F19L 4W81A 3KYMB 1MQ8A 4BQ8A 1SN0A 4AW7A 2C9PA 4HETA 3ZKXC 1HTYA 3SD2A 4XBEL 1X9RA 2NZ9C 2QQLH 3OM3B 1CFBA 1MJUL 3B37A 3FSZA 4YHOH 4P57A 2X2YA 2EDEA 2VXSL 1M57B 2IDCA 3J07A 4K9EH 4N2GA 4WFED 5FHAH 4GY4A 2A9MH 1WAEA 3KPSA 3QWRD 2DQDL 4LPWA 4MQ7B 3VFRB 3V9EA 2QV4A 5KJ7E 3ELQA 1UD6A 4R2GD 2XA3A 2I32A 2ESVE 2IAMB 4JM2C 3KGRA 1PSKH 1XCTA 4N8VG 1NCGA 4E0RA 1QSEA 3S37H 1KEML 4BGLA 4MJ4A 3ZDYB 3PHOA 3HZYB 5FK9B 4JKMA 4QXUH 2FE0A 2BVUA 3EJRA 1M3JA 3QIUC 2XZZA 1QNZH 3QIBB 4XBPA 4XCEB 3UZVB 5EC1B 3C09C 1KGWA 4ZAKC 2ITCB 1OF0A 1ZT7A 4Y88A 5DVOA 4IHBA 4N8CH 1N18A 5LVEA 3IXTB 1VENA 1OP5K 1SY6H 1G6RL 3KPOA 1QR1B 3NJJA 3MUZ1 4XVJL 4IS6B 3RI5K 4BH7A 1ZTXE 3GSOB 2XKUA 4Y9GA 3MN8A 2OMYB 4JANA 3M86A 1M6UA 1NLDH 4OCSL 5C0AB 2XXGA 4KVNH 3BAYA 1CD1A 3RDTD 3ZE1E 1OHQA 3GMQA 1IQDB 2CJTA 3GQFA 4DZ8B 3RZCA 3BT2H 1ANUA 3U6XS 1H6EA 4AYGA 1KB9K 2MCPH 3HS0C 1GTFA 2CBMA 4P2OA 3N1GC 1YYLH 1QI5A 3MLUL 4BRJA 1AO7B 2R69L 1GYAA 1G1OA 4Y5XA 1JJUA 1LQSR 2WIIA 5GISL 4C47A 1WBYA 1USZA 2V7NB 1BX2B 1D2PA 1NAMA 2EE6A 4PJAA 4E41A 2O93L 5F7KC 3L3OC 2F7RA 5I1KL 1PLCA 3AAZB 4HIPA 4MDJA 1TEFA 1CF1A 3H9SE 3LEVL 1JI1A 4BK4A 1UYWL 4K5OA 3EO9H 3QFGA 4R9HA 3BVNB 2BW5A 3FT1A 3KGUA 2VR6A 3TBVB 2GJZA 5CN3A 5E2VH 1P4LA 4YUEL 3WOVA 5I76A 2L4OA 1CDUA 1V7MH 2WANA 2VC2H 9CGTA 7TAAA 5IUCA 5IFHL 4LNRB 3PRZA 4FE9A 5L2JB 4PBXA 3QT2A 4LPYA 2HVBA 3F58H 2O5NA 4R90H 3MC0A 1F6FB 5HGAB 3TYFA 5HHOB 1KBPA 4AK2A 2WTPA 4A2HA 3MVSA 1IM3D 1A4JA 1QVOB 4JDEA 5ID0B 1P9MC 1IC7L 2H1PL 5GGTA 3HHSA 5FS5A 5F9OH 1OVZA 4EZJA 4NWUH 3EJZD 4RSVA 4ZDHB 4Z7IA 3FMGL 1K8IA 5JHLA 1UUNA 5CEXA 2WZ6A 1NCAL 5K1JA 2NSQA 2Y25A 1NANI 2FSDA 5I0YA 1S5IL 1TVHB 4ZMWA 3S34H 3UIYA 1QNIA 3INUH 5FDWA 1H6UA 2V7HB 3R7QA 2HN7B 3T2QA 2GIMA 2X2IA 3O3AB 4FN0A 5A1AA 4LOEA 4TSAL 4A6YA 5HYFA 2E59A 3F12B 5TFSH 5B7EA 4I3RH 4JPVL 1OF2A 1UD5A 3HS0B 3NSXA 1UC6A 5IY5B 1F11B 3GUTB 1U36A 4GRMA 3JV6A 4PJ5B 4UOQA 4NPYA 1RPKA 2D03H 1EJOH 5FAAA 1OAYH 2Z91B 4OD2A 2FBJL 5FWQA 2E27L 3LEYH 4ZS6D 3ZN6A 1DBAH 2XV3A 4FI6A 4B53A 4NN6B 3FAWA 1MQKL 4UTBH 1RQ5A 4NGHH 1MAJA 3VH8G 5L2KA 2R51A 1JMZA 1OKEA 4JFDE 4BQBA 2CNYA 2FEEI 1WZLA 3NJKA 4IHOA 3T8XB 4NJ9L 4BEIA 4Y8DC 1LL1A 4KI5E 3EJZC 3LEXA 1QFWI 4Y5YB 4D3CH 3RPIB 5GSRB 1JXGA 2IFFL 1ZS8A 3EJPA 3ZZSA 2G9KA 1KIQA 1Q4NX 2D31A 3JVFC 5J0BA 1CE1L 3ULSA 2YC1B 4NWTH 2OZNA 5CLXA 4PBDA 5D6DA 1HHGA 4YHYC 1XAKA 4EI5A 4M7LH 4I3SL 4NM8L 3HB3C 5AYUH 4XNBA 3CN0A 1QFWM 5DUBA 1YC7A 2ICES 1FAIH 1YYMH 4GKZB 2BW4A 2G5UA 1NIFA 2NUPB 2ZX9A 2YMXH 1X5MA 5EU6A 4QRUA 1FNAA 5CS7A 5C9KA 5CCJA 1BMGA 2DQCL 4WK0B 4H5SA 2HTKC 3G5XA 3LKOA 5D1QA 4UQBA 2XTJC 4PS4L 2QDWA 4B3VA 1A6WH 1V55B 4HP5A 2UZXB 3BN3B 1SBBA 3FSAA 2YEQA 4K23L 3U4AA 1AP2B 5E94B 5KVMC 4NZJA 1L5GB 5CFHA 4P05A 1NPJA 2CIKA 2JCCF 3JWNG 2PABA 5CJOH 1BZ7B 3AWFA 2PLTA 2UZPA 3LHPH 5EUOF 3QFDA 3UGUA 2HFEB 4JKNA 1XGUA 4YS4A 5EU7C 3RI5F 2E56A 2W92A 3W56A 1ASQA 1P84J 1A9BA 5TQ2H 4QRSA 1RJYA 1B6UA 5D7SL 3UTZB 2CLRB 2R1WB 2E6PA 1NBQA 3CNKA 4Y5VA 5G5DB 4UOW1 1PX3A 5E00A 4OIBA 2NZIA 4APQA 1IBZA 2ORBL 5FM8A 4BDVA 2QZ5A 2XTSA 5EF2A 2C1OB 2APWA 1FPTL 3B7SA 3GLAA 4EDXB 3A4FA 5D1XC 2IV9A 4I9WD 4MVBD 2KYIA 3KYOB 4F9LC 3U46A 2QPSA 2Q8AH 4JRFA 5DVNA 1RVFH 5IW1B 4CMHB 4K94H 2OX5B 3DSFL 3ARFA 5T3XD 1TTCA 3L1OL 2X6VA 1CD8A 4XPHL 4PGJA 1CLYH 1SN5A 2H3NB 1DYZA 1IBBA 4E9QA 1KACB 3DV6A 3S0PA 3V7AE 3UJJL 3GSVB 5CJXC 3CTTA 5LO7A 3LYRA 4L4TE 1FSKB 5KSAA 1Q1JL 4U1GB 3TBYA 4GP4B 3MCLH 3V7AG 2FLRT 2W95A 3MUUA 3L3JB 1X9LA 3V5DB 1X9UA 1NMAL 4X8JB 4B97A 5CSZA 1CK0L 5A6IA 4PV1C 2YRPA 2WVTA 4LQFH 2D3JA 3GJEB 1R4XA 4AQ8C 3L7FB 5E8NA 4GNKB 4B9YA 5JDJA 3O3UN 5AVWB 3MGTB 2CMRL 3CFCH 4OGZA 5IQ9A 2N0KA 5C3TA 1IJ9A 2B39A 2WYHA 5J6GA 2R4RH 2MWCA 2PCYA 3PDOA 5FYLD 2XQBH 2X4OA 1NCDH 3TF7C 4JMXA 4IU3B 3U4BL 4BUHA 2JKNA 2VABA 5D1XD 4Q2ZA 3V0FA 1ZKAA 5A7BA 2X7LB 3A4DA 3LDBC 3VXQB 5JHBA 5ABAA 4XODA 5I8KL 4X9IA 5C6PB 1N6QH 4HD9A 4R6UA 4CSZA 4EOWL 3ALWA 2D9QB 4GIPD 1OSZB 3LKSB 3MUY1 1JL8A 4HCRH 1L9SA 2VLJB 4NQEA 3SGJC 4DO4A 1F3JA 4PWJA 3D07A 5DUML 4QCIB 3PNWA 3TEXA 2JCCB 1AXTL 3D05A 4KV5F 4PS7A 3ZUCA 4XCYB 4PSRA 3I02A 4PWKA 1PZ5A 1RZGB 3O6KL 4PJ7B 4UMSA 2Q9OA 5GJSL 1X5GA 5JPNA 3HPJB 3PJNA 5FGBC 2AV7A 2IDQA 3TFBA 1I3UA 1L7TL 4NERA 1N3NA 1N8ZB 3O6LL 3OF6A 4IMLB 4L9LC 5FHBH 1BD2A 4PJFA 4NCC1 4R96A 3RWFB 1JF5A 2BVOB 3H42H 3IMUA 3Q7JA 3L9BA 4YHZL 2GQHA 3SB3A 4AQ8A 5GGRB 2DLIA 3EG9B 4ZO7A 3RFZB 1OD7A 2XACC 4X6EB 4WY7L 1RL1A 2KERA 3TONA 5AG8A 4KK8D 4YGAB 4IBWA 3WIFB 3D33A 4PRPB 4LDOB 4TL4A 2IADA 3KPMA 4O9HH 5GGTL 3F2LA 2NY4B 2YBRA 1WZKA 2W88A 3NVQA 4NZDA 3FU7B 2G3ZA 3L9EA 3NJXA 4LLVA 5A2BA 5K9OB 3P4OB 4I8DA 4JFYB 1GOFA 2P5EA 1UXSA 3FO1A 2APBA 2E8YA 5EZOH 4X99B 2BOLA 1TQCB 2YO3A 1IGCL 3W9DA 3BC9A 4XZ4A 2X1QA 1QLEH 4G7SB 3U0TA 2W59A 4U6XB 2QGCA 3SGDI 1ND0B 1HQRA 1QRKA 2Z8WC 4HKJB 4EDWL 3WNNA 5F9JB 1MFEL 4JL1A 1YZZA 4WHDA 4A66A 4UZSA 1GGTA 2BRRL 4PV8A 1WS7A 2RJMA 4DGIL 1MCOL 3HB3B 4JFWA 2DMBA 5FF6B 3S3SA 3EKCA 3X3FH 4K7PL 3LX9A 4V11A 5BRZB 4GMTL 3SY0A 4BE5A 3EH2A 3LKQA 1SJEB 3SCMC 4XC3L 1G87A 3QG7H 2E4FA 4PGDB 2YKLL 4QYAA 4MJHA 4JCLA 5F7EH 5EO0B 1TDQA 2VAAA 3VDBA 3U0PA 4D9LH 1SLWA 1DQKA 4HWBH 1JZ8A 3KLHD 3MOBH 1SEQH 1SDAB 4E41D 1HSAA 3C8KA 1RPUA 1I8KA 1L0QA 3PWPB 5E1IA 1K4CA 4ZSOA 1NUNB 3BVVA 4IDLA 4ZJ9A 1K5NB 2XG4B 3GSWB 4E36A 1AY1H 3V55A 3H0TA 5C0EA 4TUOB 4JQXA 4I3GA 5EZIH 3DROB 1AQKL 2ADJA 5SWSA 4FQ1H 1Z3RA 1UM6L 4CW1B 4LFHD 2NY5L 2VLRE 1YEEL 2ADFL 3BQUB 3FT9A 1IAOA 1DDTA 1A21A 1NGXA 4Y2LA 4ADIA 4RLDA 1G7HB 2ZQKA 2OYMA 1LE5A 1P84K 2JQAA 2VLKB 4HUNB 5B8CC 4X5XA 4NZTH 1Q90A 1P5VB 3FC8A 4PJFE 3S5LG 3COOA 3C09B 4ZAKB 4GSUA 3ARVA 1SLVA 1UADC 4TVUA 2I9TA 4HJ0C 1GPOL 1BYOA 1Z5LB 4ZXBB 5I1EH 1OL0A 5E0QA 4BKSC 3AW5A 2PYEA 3D85A 4UOW0 2BSDA 5DMGC 2YQBA 5FV2A 1MCRA 2EXYD 2NY6B 1EK3A 2IGFH 1S7VB 4OGAC 3BD4A 1KCWA 4KJYB 4RWYH 4F92B 2AP2A 2VLLA 3KL0A 4XH2A 5TPWH 4DQOL 4HS3B 5AALA 2JLPA 3KS0H 3AXHA 4EIZC 5LGKA 4XXDA 1MWOA 2OZ4L 4DKEH 5DDHA 3SYOA 5DK3A 4LGRB 4XNMB 5DC9B 1T1ZA 1IX2A 3AU0A 4LPUA 3T0XA 4ZNEA 2QT6A 3BH9B 2BFVH 2P5PA 4YIQB 3P77A 3HI5H 4PRDB 2OMYA 1PF3A 4NC0B 2J8HA 1P2CA 5J6SA 4HVBA 4PSPA 5MERB 3FZUD 3WEXA 2FAUA 3BO8A 3TTSA 1UURA 1I9JL 2IBZY 2E47A 4FTVE 1J0IA 4FA6A 3GIVA 1AO7A 1DVQA 2ALWA 4PV9A 4DP7X 2HX7A 4BSWB 1GGCL 5GS2H 1RV6X 1Y18B 3FXIC 3MV8E 2UVFA 5F97E 3UO1H 2ID5A 2YLKA 1FL5A 1ZLWH 4Z3JA 1AGFA 1BZOA 5C0AE 5DFAA 1RKRA 4CC4C 4K3EL 4YBHA 4L4VD 3DOHA 3WFHA 1BXVA 5D70H 4U1KA 2QMJA 4I13B 3GXPA 3GSNL 3ECBA 3QPKA 1JNJA 2CKBH 4HAKA 1A22B 4X6FB 4OCXL 5BS0D 2C7UA 5ICYB 4WEEA 3MRCB 1SUJA 3B5HA 1ETB1 4YDJA 1IBGH 3PWNA 4F7TB 4X7EC 4L4VE 4GO6B 4BHUA 3VGFA 4IKKA 1FGVH 1BVLB 4I0CC 4OD1L 2ED8A 2XN9B 5DRNB 4YZWA 1WPCA 1ZAGA 3FN3A 1ZJBA 4NYLB 4AC4A 3KAAA 2F53E 4K07A 4JM2F 3BFOA 4PVMA 3KWUA 5LGHL 3O41B 1JGEB 1CUOA 1QW8A 4FXKA 1YUKB 4TSBH 3STLB 3LIUA 5A2IH 1MKFA 4UYPA 1QBBA 4LMQE 4S1RH 1R24A 1T0OA 5HGDA 3V95A 3SGJA 3B9KD 1URZA 4IMKA 2D7TL 2V7HA 1WFOA 2XSKA 3F7LA 3CZFA 2GJRA 2EIKB 4P5MB 3BRDA 4NFBA 4X0KA 3S96A 1TTRA 3QUZB 4XCFL 4UNTA 1CLVA 3UH8A 3IJYA 1NFDF 1IE4A 4XMKL 4GKNA 1WV7T 4XTRC 5JIMA 2FX8L 4PJGB 3NABL 4WUKL 4WF7A 3RP1A 2CUIA 1L9RA 4DFHA 3QW9A 3HE6C 3PV6A 4PJBF 2XXFA 3D69B 3QI9D 3GJFK 4G6KL 3VU1A 3FO9B 4N2DA 1D7FA 1M7DB 2JJSA 1F8TH 3WTWA 4PJ6A 4WNSA 1ZLSL 2J73A 1P7QA 5J1AA 1J9TA 2DICA 4CVZB 1UZ6F 2NYZA 4HKBA 1M9SA 4WVRA 4AGOA 5F6IB 5DHVB 1DBMH 1Z9PA 4B6ZA 4MD5A 2OW7A 1NQBA 4LEXL 4M43L 3O6FD 3NAAH 2G5BB 4PJHB 5KVEL 3BVXA 5FM4A 3C08L 1A02N 3TT3L 4KNUA 4LEOA 4AQEA 3RBSA 4O4YL 4LCYB 4BZ1H 3RPKA 3TL5A 4KI1A 4MD0B 3V5KA 2N4IA 5CR1A 3MRPB 4JZJC 5DZPA 3KZ8A 3GMPA 3GXTA 1A4KB 2EVIA 3EYSL 1E5UI 3EHBB 3RQ3A 1YMHA 4MWFA 3R06A 4BWTA 2NNRA 3EW3B 1LD9B 2GEEA 4Y19D 3W0WB 4QWWC 1U3HA 5JO5A 2O61A 3SQOL 5FW6A 5JA9A 4JFTA 4JRLA 3KE0A 3HZKA 3QHFL 1OE3A 3FU3A 1I3RB 1JUFA 1ZDQA 5T5NF 4AZUA 4HD5A 4Y19E 4HUVA 1M7UA 4Y9BA 2JTDA 1DN2A 1FZJA 3ZJAA 3ZX1A 3VXOB 2MTPA 2I60L 5A6LA 5I0DA 2LE9A 1VDGA 3AJ7A 5CJ8A 5FGBA 5C07D 3WKYA 4WIQA 4TQEL 1CWVA 1S7WB 2HT3C 2HJFB 3W5NA 5D1ZA 3N91A 2O4EA 4FLHA 3RVTD 4JKLA 1F2QA 2B3IA 4OF7A 3FFOA 1DQLL 2WQWA 2VXVL 3DO4A 4F80A 4G8IA 3DXAB 2W60A 3NIGE 1N68A 2Y7QB 4QTIH 3CPUA 5I16B 2NLJB 5JOEA 1EUTA 2W65B 3DIFA 5D7IA 3QRLA 4UTBA 4K8RL 5BZZA 4MJ6B 3UYRL 1D5ZA 4DEWA 1E4WL 5MI0B 2MOVA 3OAUL 2X38A 5DJ2A 4JFEA 2A3TA 3AITA 3FW6A 3DVNA 1KCUL 2P9RA 3JYBA 4WSKA 3WTUA 3NIFB 3GMOA 4ENEC 4WQOA 4DAGH 4DPRA 4WO4D 1GGIH 1NSNH 3MO1A 1HILB 1BLNB 3OTTA 4ZTPH 4AX3A 5KVFH 3ORJA 5D6DC 5T1LA 4ZOCA 4N0UE 4H2AA 2FQFA 3CQFA 2YD4A 2V2WA 3ZKSD 2RR3A 3P30L 1O5PA 2ENQA 4J5VA 5BO1H 2DIBA 2P48B 3O2VL 3QZNA 2A5UA 4QY8B 4R7NA 4XVOA 4AEIL 1WE5A 2YOCA 4U6TA 3UTQA 3WNJA 3FTUA 3RA7L 1E7VA 4MTMA 2HRHA 4L4TD 3S7GA 4TTGA 5M94B 3W38A 5I5MA 1G1KA 3KYKL 3SDXE 4ZQKB 5AB1A 5D7LE 1VEPA 5C09B 5DHXB 1X5JA 4L05A 2J5LC 1ZOXA 1D3CA 3M6DA 4OF6A 1XAUA 3QCUL 4IU3A 2KC0A 3A6CL 2FECL 4PLKD 2V9TA 5GS0L 4TNEA 2NX5D 4AGNA 4AYFB 2YAOA 4LLDA 2V3EA 3RUGF 3CUPB 4F58H 3BKYH 3S3DB 4KZEL 2GTWB 4GUPB 4Y89A 4PRBA 2ZZUT 3CWGA 2BS71 1KWGA 2YRBA 4YLCA 3BP7A 5FA4A 3MRDA 3IJEB 3R18A 4H88L 1CICD 1ZVYA 2EIZB 2WGNB 3VRLE 3TPUB 2KPNA 3QJZA 5B3SB 1DDHB 1C5CL 3JTTA 1PDKA 3NK4A 1KLUB 2IC2A 3ULUD 3S97C 1T4KA 5GS3A 1J8HA 1KTLA 2ZUUA 4NT6B 1CDIA 4FD0A 2KMWA 1G4RA 3LIZL 1XIWD 3S36X 4NNXA 3E8VA 1EAPA 2B1AL 3IU4H 2DIAA 3L5JA 5DHYB 1N70A 4GW5B 3T4YA 2CHZA 3H54A 3DETC 3GNML 3GBNH 5CWSA 5FYKU 2YWYA 1T2QH 1FHGA 4Y1AA 3FUMA 3S2AA 5E03A 3QBTB 4HEPG 3DX2A 3A21A 2WBWB 1EO8L 2XV2A 4PTTB 1FZOA 4U1NB 4N2NA 2BS9A 3NFNA 2GUOB 2H0FA 2VLJE 4ODUB 5L0QC 3EYQC 3HNSL 1XT5A 5A2LH 2P49B 2NY7H 2FJHB 4M7KL 4PLJC 3L5XH 2XZQH 4FQIL 1S3KH 1ZK5A 1PNCA 4FTDA 1KLFA 2XWZA 4JFPB 4MJJA 3V0DA 1V10A 1KBWA 1Z66A 5DLLA 4CSPA 3N40P 43CAB 5B3NA 1NGWA 4J3OD 5EN2B 1A1MB 2JB6A 1CU4H 2UY7A 5GRJH 4F8LA 1TTGA 5D2NB 5AOMA 4Y16D 3PHQB 2X6BA 5I6XB 1COBA 4B9IA 2BDNH 4X8CA 4EI5C 4PMEA 2NCMA 3OG6B 3VH8B 1OM3L 2H32A 3AQYA 2DRUA 4NUQA 4A38A 1UYWH 3RX7A 1S9YB 5DMKA 2N56A 1CN4A 2BZ7A 4B27A 4HMEA 5LBSH 4JFDD 5J9PA 3V4PB 4GRWB 4PY8J 2X4TA 1E6JL 4K4KA 1R5IA 1OEZW 2ZUQC 3TN0D 4LCIH 1LNUA 3DETD 5A2JH 3Q5YA 3OXSA 4WEBL 3B1UA 1BQHG 3ENEA 3PABB 3VFGL 3MRNA 2VDOL 1B2WL 3B3IA 1MREH 2WBXA 3MFFB 1E43A 4O02H 2HB0A 4QXTB 5I1HL 5AVVB 4L4JA 4HJ0D 4HT1L 4DP8X 1AFVH 2D2OA 5C1MB 1T21A 4ZSOE 4IBQA 1I7ZB 4PLJD 1HWWA 4IKLA 4KWUA 2NX5B 2J12B 4GUOA 2FH6A 2XFGB 1ITCA 2OYKA 3CFQA 3X1GA 3EBIA 3GK8H 2CALA 3K6FA 1OW0C 5HHVH 1N5AA 2DV6A 3F64A 3U9WA 1EMTH 4ODWB 1T1YB 1QTPA 4HOXA 1MW3A 1L0XA 3MA7B 1MCPL 1BQLL 4NCC2 3JWDH 1QW9A 3OSKA 3QP3A 3DRTB 5TGBA 3QPQC 1IEBA 1RIHH 1C08A 4Z3FA 1KJMB 2VR7A 3K6DA 1KB9J 3EXLA 3O9WA 1D6VH 5DHDA 4LLMA 4KC3B 3THML 3UPRA 1O6SA 1O5DT 4A1RA 5I30L 1MG3C 3BWAB 5LQBL 5LBVA 5HHOD 5KN5A 2I9TB 3TZVC 3VE0B 2VMDA 1FNSL 1X7QB 5C92A 2EDFA 3VXUE 2APXA 4YHNA 2Z4QB 2DBLL 2CXKA 1FFRA 2BSTB 4HXAL 3L3OA 4P46A 3B9AA 3H7BA 5DS2A 3N50A 4RDBA 4XCCH 1JGDA 1FQ9C 4RBPK 3EH3B 1CE6A 3VXUD 4OF0A 4ZRGA 1BVZA 1NC4D 4DTGL 3BUPA 5AB2A 1FFOA 2PWFA 2X44D 1FO0H 2CSPA 3P02A 1OTUC 1HHHB 1W9XA 3WIAA 2BIQA 1OT1A 4QO1B 3PHSA 1JE6A 1YMMA 4YDLC 1W16A 1JSYA 1VFAB 2DOCA 4HFUL 5J5EA 3GBEA 5MERA 4ONFL 4ZTEA 1CE1H 3G9AB 1CVSC 2ZKHL 1HFUA 4F93B 2A6KA 2ARWA 1S9XB 1D6EB 3WV0A 1CICA 4O2EA 4KTEL 1F42A 1UD8A 3I2CH 2ODIA 3MV8A 1BREA 5DQDH 5AKSA 4XMPH 1XHHA 2AJ3A 1U8QB 4HCIA 1H3GA 5AW5B 4Z5RB 3KPSD 1UOWA 3ULUH 3EYVA 1W8NA 3DBXA 1U58B 1H15A 1TMQA 3ZZ1A 4DIXA 3V5HB 4M62H 4MMXA 1CDHA 2Q1EA 2EDMA 2ZJSL 4ZBJA 4QR7A 2G9HA 4FERA 4HUCA 3UXFA 1ILSA 5D1XB 3X3GL 2B0SH 4BK5A 1WGVA 1P1VA 2WW8A 4JHAL 3DTUB 2J20A 3LZPA 3KPSE 3AY4A 5AEAA 2XQ0A 5I1GH 1KGCD 4G8GE 4M93B 5ENWB 3F7PC 4KUCF 4B0MB 4YBQD 2FJFB 3LN5B 1NUGA 2PWEA 3FDWA 1N2RB 5CIPB 1DO5A 1IGFH 1I85A 4N9OB 3RNKB 1MRFL 4GRLC 1HESA 1XFPA 3IDGB 4FXLA 4XXWA 4C83B 3MRBA 3P11L 3GMLA 3HG2A 5IWLC 3L4VA 3PUCA 3DRQB 4X98A 1CFMA 1E6OL 4YHML 2FO4B 4UV4H 3O41A 3VM7A 2WINA 4YSRA 4R4FL 3I74A 3QXVA 4BUQA 4NKIH 1YLBB 1CBVL 1ZT7B 1T1XB 1TQVA 1WTGT 2H9GA 3EO1B 2AXGA 4FL4B 5DA0B 3VA2C 3ZR6A 3IGAB 4PUBL 1TT6A 1EDYA 1JV2B 1NBVL 4L0YA 3C6LB 4AI7A 2BM3A 3PXHA 1DLFH 3K2MC 3DDGA 4LSPL 5LB1A 1Q94B 5LAXB 1PZDA 1AZBA 2R4SL 2FL5A 1BQHA 5LGYA 1YPZB 5CZVL 3KNBA 4ZS7L 3ETSA 1ASPA 3E1F1 3KM1A 4JG1L 4Y0GA 1Q1JH 3ZLQC 3GMQB 5E9AA 4DZ8A 3BGMB 2C8NA 2J1KA 4H0IA 1YEJL 3E7JA 1Z3GL 2ARJB 3QC5X 2GEQA 4ELKB 1BOGA 2DQUH 3QO0B 4LLQB 3T