3QORB

Crystal structure of human nuclear migration protein nudc
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
119
structure length
118
Chain Sequence
SSSKLKPNLGNGADLPNYRWTQTLSELDLAVPFVNFRLKGKDMVVDIQRRHLRVGLKGQPAIIDGELYNEVKVEESSWLIADGAVVTVHLEKINKMEWWSRLVSSDPEINTKKINPEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Features and Chaperone Activity of the NudC Protein Family.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding, cell cycle
molecule keywords Nuclear migration protein nudC
total genus 28
structure length 118
sequence length 119
ec nomenclature
pdb deposition date 2011-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04969 CS CS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3qorB00
4PCKA 4PBDA 4YDZA 3AACA 4M5SA 3GT6A 2N3JA 2WJ7A 2Y1YA 3L1FA 4YL9A 1RL1A 3IGFA 2CG9X 3Q9PA 3VQMA 1WGVA 2CR0A 2O30A 1X5MA 2Y22A 3GLAA 3QORC 2Y1ZA 4M5TA 4ZJ9A 4JUSA 3VQLA 3L1GA 4MJHA 5DS2A 5LUMA 1EJFA 2JKIS 1WFIA 4JUTA 5DS1A 4YLBA 2MNWA 2WJ5A 3Q9QA 3EUDA 3N3EA 2XCMC 3AABA 3GUFA 4FEIA 2RH0A 4YE0A 3W1ZA 2KLRA 4YLCA 3QORD 2N0KA 4ELDA 3QORB 4RZKA 3QORA 2K8QA 2BOLA 2KMWA 1WH0A 3J07A 4I88A 3L1EA 1SHSA 1GMEA
chains in the Genus database with same CATH superfamily
3IK2A 5FV2A 1D6VL 4Y4HD 5EIIB 3VX0A 3V4VL 5I1GH 2VN7A 3NFNB 1LP9F 4MCNA 3DX6A 3ORJA 3TCTA 2XN9D 4QJ5B 1NC2D 5T5NG 1RZIB 3GKZA 4F7KA 3V9CA 4XP1H 3QDME 1XWVA 3V6OA 4RBPK 1VFAA 1QTYT 1CXLA 1HE8A 1WBYA 3VMPA 4AQOA 2FZ3A 3WELA 5IHHA 1SOKA 3Q1SH 2EUWA 3ZDXF 1JZEA 3O6KL 4YXLL 1NGXB 3MNZB 3DX7A 3LKPB 1SOSA 5J1AB 4GG6F 4GKZA 5EBMA 5DUPH 1UG9A 3LQAC 2BNRA 2JNZA 3WIAA 2ADJA 5JHBA 2Q87A 4OJCA 3HKFA 1AR1B 4JQVA 4QXWA 3V0AC 4U6XB 4YHOL 1U36A 2R23A 4FQXC 3QG7H 1QTPA 4H13C 4PHXA 4H8QA 3ULVC 3DUSB 2YJLA 3VXRD 3B6SA 5EU6A 5HVFB 1ZV9A 1A7PH 1YN7A 2Q8AL 1TDQA 5TDPB 3IAPA 1NAKL 2AXGB 1BF5A 5TE7H 2IH9A 2R51A 1EANA 1LK2A 2HJLA 2WLIA 1KYOK 2XXGA 3S36X 3MRMA 3ARXA 2RTTA 3KW7A 4Z77A 1KB9K 2XWEA 3GKWH 1HYSD 5EIIA 1KG0B 2JIXB 5FB8A 1LO4L 3CFIC 3UG3A 4HBCL 2XZAL 2C9RA 3AU0A 5HD8C 1J11A 4LEOA 1KN4H 4XNXL 4O5LH 1KWGA 3X12A 4YUEH 1CDIA 2EXYC 2R9HC 1W6LA 4LLVB 3W3BA 4K71C 1AKJB 1SYVA 3EYOB 3AAZB 5K9KA 1AR2A 3F7KA 2RCSH 1N0LB 4MMYB 4HV8A 2ICWJ 2CDGA 4AQ1C 4OIAA 3DSFL 1NANI 1DVXA 1QZ1A 2VGLM 1PLBA 2MQ0A 1U3NA 3NCFB 4HAKA 4Y5XB 4G8FA 1M9WA 3LS5L 4PLJC 2DPKA 1PY4A 4G7RB 3KR3H 4UMGA 3T4YA 3G5XA 2Y1VA 5LHDA 4FNPA 1SBBA 3OB0H 5BZZA 4KXZI 3FQNB 2VC2L 4LPTA 1QFUH 2VH5H 4UMSA 4CNIB 1XQ4A 5KBDA 4B0MM 1T22B 4FQLH 3VXSB 1TTAA 5I1GL 3FCBA 3OKLB 1AQKL 3SN6N 4M6OH 5ID1B 3KVDD 4X6DB 5KSBE 2AJSL 2GSMB 2WZ6A 1KG0A 1DEEA 1FZOA 3VXPB 5JW4R 1E9PB 5GRZA 4YE4L 4AIXA 4Q14A 1SDDB 5IK3A 1DLFL 5J56B 4XXCC 2MTAA 4ORGA 1CCZA 2AI0H 4L18A 1PG7H 2W60A 2X28A 2OR9H 3ZKXC 2FYYA 3IFLH 4Q56A 5E8PA 1XTLA 4FQIH 3RJOA 3U4AA 2HCZX 4J4PD 4M43L 4TVUA 2WINA 3ESMA 1D5BB 3OKMA 3NZ8A 1JF6A 1BPVA 3GSRA 5LBGA 5KYXA 1FZMA 3EJYC 3EJZC 2OMTA 3D3VE 5F1NB 4HW6A 1ED3A 2WV3A 4JFYA 4HS8L 1HZKA 1XGYH 1ZANH 3BN9D 3HJ0A 4IGBB 2Q10A 5IIEA 4YNYA 1HESA 4W4OC 4KVNL 4OCNC 2YEZB 4AUYA 1I75A 4IGBD 1T0NA 3OJMB 3MRCB 4PREB 5A6IA 3WJMB 3DUSA 2JLPA 3UC0L 4KTDH 4NAJA 4HUNB 4O58L 2GUYA 4F7MA 3EGXA 3CHOA 2FR4A 2XIBA 4X6DF 2IOMA 3MGAA 1NWPA 2YPLB 4J3VA 4WI6A 5EUOA 4P8QA 4ODVH 4TPRL 2EIMB 2HLAA 3F5WB 3P9WB 4IU2A 5GRJL 5CAYB 3ETSA 5TDNA 3BD3A 2V5MA 4IMLB 5A16A 3TH3T 5I23A 2V0AA 4G6KH 1ZA6B 4IU3A 1DBJL 3ZIYA 1A8ZA 3LYRA 4UWQB 1FRGH 3ASNB 3IDNA 3WDJA 1P0SE 3WGVB 5C86A 3W2DH 1HXYB 4PP1D 1S46A 3S0PA 1GAFH 3SE4C 3DXAD 3V5HA 1QD0A 4PV9B 2VJ0A 3I85A 6FABH 4IBWA 4GSDH 3TN0B 3MRPB 3BAYA 4HHAA 5D4QA 7PAZA 4FQLL 4L2LA 5EU4B 2COVD 4G6AD 1ADQH 1WTLA 3C60A 4JE4B 3NQIA 5HI4D 4BSJA 1OCCB 3I3BA 1O7SA 1ZXQA 1FG2B 4X9HA 4FFZA 2FQFA 1XB6A 5DFWH 2YAHA 1BVLB 4FKKA 4JKKA 1G7LB 3KYMA 4XNUH 1OARL 1YLBB 2YAOA 4HHWA 3IS1X 3C9NA 3FT2B 4LKXB 4L2YA 4NGHL 4PRDB 5E6ID 1CB4A 3E3QE 5IVZB 4B9CA 1D7FA 1XAKA 1NEPA 3QJHB 4N8CH 1KPVB 4D0BA 4HWNA 1OB1B 3U7WL 4Y1TA 5CLXA 1UZ8B 1U8NA 4NQEA 3JZYA 2ZSWA 3UBXA 4JJOA 3RJDA 4BA0A 1ETZA 1UM4L 2Z92A 3CFQA 3H7LA 1DYZA 5L0QC 4XB8A 3VYPA 1NKGA 1FPTL 1MHEB 4PY8J 3DVNA 4K2UL 3HS0C 2DYRB 4AZ8A 4G2AA 2UUDH 1OD9A 4M1DL 2CO3A 4GMSH 3Q3GA 5BRZB 1JPSH 4Z7QE 4MLSA 3BH9B 3GQFA 3ET9F 3IB4A 3NIFB 3SKNB 4EAEA 3FONA 2AV1A 3CFDA 4N0CC 4MXVE 1J1OL 3W5NA 4YDVA 4P9HC 2H26A 2QLYA 2G0LA 1MCDA 1EZVY 1P1ZB 2BNRD 4NUMA 5CIPA 4PRAB 3QHZH 3KVPA 4DGIH 3DX4A 3QFDB 4KO6A 4AV5A 3O81A 1OQXA 2VW6A 4KJYB 4X6BA 5LDSA 3VXSE 3A6BH 2YQBA 5IBLC 4P59H 5C09B 4I18A 1NBCA 1JGUL 2BZDA 2Z7UA 3VD2A 3OX8B 5DC2A 2WUBH 2GCYB 5C09D 3WEMA 4I0PB 2Z1KA 2XN9A 3MODL 1JL8A 3VXME 4UUJA 1IC4L 2FJHA 2JCCF 5DC0A 4Z3FA 5EF3A 5IB5B 4MHHG 2ZZUT 4G9FE 4OZHF 1J5OH 3DIDA 4NT6A 4CVXB 2VDLL 1E50A 4BQBA 3QXAA 2XWXA 4UTBL 1IAOA 3I6SA 1CDBA 1UXSB 4AYMC 4HIPA 2NY6D 3T0XA 1INDL 5FYJH 4HZLB 3BQUC 4KTGA 2RR3A 4LLUB 2BWDA 5F0PB 1FVEA 4DSYA 5AB2A 2VLKD 3BW9B 1EFXB 4YO0A 3OR6B 3ZZSA 2R2EB 3QQ4B 1ZD6A 2F7IA 1GYWA 3BUBA 4LIQH 4AW7A 4JE0A 3IFNH 3N43B 4HK0A 4LSRL 3Q9PA 1OGPA 1DFXA 2N59A 5A7BA 4KFZC 1H5BA 2CRZA 2IPUG 1ID2A 1MI5B 2QQNL 4GEIA 3NRQA 4GKNB 1R6VA 1CXKA 1G0XA 4BFGA 4HJJL 5F9AC 4XAKE 3H8NA 3B37A 4R3SA 1TTFA 1OAXH 2KQMA 3U7WH 3WG7B 1ASPA 3FZUD 5CGYC 1J87A 5I17B 1S7QB 2V5TA 5CUSH 1U91A 2H8PA 1PFCA 1W16A 1X5ZA 3CD4A 4G80A 4WW2C 5DT1L 5EF1A 4PG2C 4N2OA 3RWGA 3AG1B 5J57B 1CS6A 3IYLW 1QLEH 4Z7NF 5FK9A 3HPJB 4X5XB 2OTPA 3MX0A 5GGRY 3PWVA 3W81A 2ZSWB 3BAEH 3SZ6A 8CGTA 3WFEH 3TYGH 1D5XA 4L8SB 4N0YL 1JXDA 2NW2B 4UU9B 1F1AA 3B2UC 1ETB1 1MCIA 3NOIA 3UXFA 5DTFA 5ID0B 1SXBA 1T04B 2FH6A 4KMTH 4QT5A 3TCLA 4M7LT 5AW9B 3KM1A 1J1OH 2E7CA 1OP3H 3JWDC 4C4BA 3CN3A 4R7NA 3NCCB 3ROOA 3VWKA 1RUKL 3VX1A 3OL2A 5C92A 3PHSA 1IGCH 2E9GA 3A4DA 2E9WA 1Z2KA 2IDUA 3N42F 4Y4FC 5AW1B 3TL5A 4DKEL 4F1SA 1ZE3C 4DP9X 2A3TA 3RNQB 2ADFL 3WTYA 3ABGA 2NLJB 2EIJB 3FAXA 5AAPA 3HZ3A 5CJOH 2ZUWA 3ZYIA 3ULVL 3FB5B 2OBGA 3NT0A 2JJSC 3ZDXE 4HWBH 3BSZH 2AQTA 2WLKA 3KPRD 1R75A 4MQ7A 4RFNC 4DO4A 2EC8A 1SJEB 4NN6C 3K8MA 4XBGA 4ELMF 3H9SB 3K5RA 1A0QL 3LKRB 4WJKB 4ZUUB 4F20A 1GGCL 1UD4A 4OQTL 4POUB 5DK0B 2AANA 4FYQA 4H25A 2ZWYA 3ZRFC 1ZT1A 4PRPA 1MCEA 5HJGA 4DN4H 1NBYB 2NZIA 3HC4L 5I73C 1F56A 2GEQA 1M56B 2GJRA 2X87A 4D0CB 1TQWA 1X7QA 1HL5A 4N87A 4Q4IA 3ECWA 4O9HL 4PRIB 5I6MA 2EAEA 4J3UA 4GW5A 4W81A 3TT1L 1HEJC 5L4MA 5IFJB 4YIQB 1S7SB 4LSRH 3FN0L 2Y4SA 4UYQA 3NZ8B 4NCDA 2A4EA 4DQOH 3BP5B 1GYUA 1FZOB 3FT0A 4PJGB 4P5KB 2DQFB 4X8CA 5MERA 1K3ZA 2BNQB 3QRGH 1S4IA 3GJFH 2ROXA 3BPNB 3MRGB 5CO1A 3VCLA 4HULB 1RMFL 2DQHH 4IGBA 1Z3RA 4KX7A 2EEDA 4CSZA 4Z7QB 1YC7A 5LQBL 5JQ6L 4TSBH 3R7RA 4YHMH 2NCEA 1NAMA 4X9GA 2YD2A 3C8DA 1NGZA 3IKCB 4RGNE 5T3XD 2FGWH 4XP9L 1LM8V 1QLEL 4PJFB 1FIGL 2DH3A 1CFTB 3MVSA 3QEQB 2PWHA 3UERA 3I9IA 4ZFOA 1AC6A 4ZMYA 1ZAGA 2FATL 4OVVA 5F9DC 1E43A 2QADC 3KEDA 5D6DA 2W1NA 3GSOB 1MUJA 1UURA 2G0KA 2QL1A 3D9AH 1T6BX 4WEUD 3V9FA 4B7IA 3K2UL 1WZ1L 3L9RB 3L4ZA 4NUGH 2P5WB 4P23D 5DS2A 3O6KH 3S5LG 4WUUE 4OLUH 1PIFA 2MSPA 2WYZA 3MLZL 2WZPD 3GMPB 3QJVB 1NCBL 1I7RB 1WEJH 2VUYA 4NZ8A 1M7UA 2EDFA 3UJIH 2PCPA 1BIIA 4WWKC 4JFFB 1DQQB 1NCAL 2XQYA 3G9AB 1CG9A 1I31A 2FZ3B 1ZPLA 3RFZB 3M1CA 1UH4A 1H5BC 3BP5A 3QIUD 5GJSH 1D5IL 2B8OT 4KUCD 4XPBL 3FHEA 5HPMA 3TS8A 5IBUB 1E4HA 4LGRB 2E74C 3BDYL 3SPJA 4P2AA 4NENB 3BRFA 3QO0A 2XQYK 4ZFFB 1LWHA 4HHAB 3GS0A 4I3SL 3CQPA 5AW7B 1JWSB 2F7QA 3SGKA 1I8LA 4WW2A 1F6AA 3AT9A 4RGOH 4E9LA 3O4LE 1PZSA 3MV8D 4YSDA 1QUNA 2VMCA 5F9OL 3T71A 3OJDA 1NBZA 1OY3B 3WKPA 5T3ZL 1EAPB 4JN1L 3N41F 4YK4B 3C5ZC 3KGSA 3SPHA 3T0WA 4Q8BA 5I9QC 5MI0C 2X0UA 3KWXA 3PQYD 5JHDB 1G1KA 1NICA 2XBDA 1C5CL 3B4NA 3X3GL 1IM3A 4WIQA 4BZ1H 3VDAA 3F05A 4Y5YB 5DFVD 4YPJA 3K0YA 1NEZG 4TVPL 5F6IC 1ZS2A 2BP3A 3VI4F 5KJ7E 4PIRF 2AK1L 3A4EA 4N8VG 1IAOB 5CM1A 3V8CA 2L7EA 4GB9A 1G9EA 1U21A 2JKTM 2OJEA 3V0FA 4YXHH 4R0LA 3BIBX 3HE7B 2NY2C 2O6FA 4C4KT 1AE6L 3SGEI 3VJ6A 5E9NA 2B14A 3VTMA 2X4PB 2YAEA 3AJ7A 4PGJA 4RMUA 3DA0A 5MHSD 4P06A 1B2WH 4HWZB 2GBAA 3F2LA 3G6DH 5IVXE 2BJMH 1S9YB 1WFTA 5H2BB 5GIRA 3ZZLA 1BX2A 2YFOA 2E9BA 4XNBA 1P5VB 2FSDA 3J2PA 3BPCA 2IDCA 1UJTA 5BVPL 1NFKA 1W0YT 3C08L 1QFWL 4MNQA 2ORBH 2NSXA 1CE1H 3GNMH 3LZOA 3UZVB 1FBIH 4R4BA 5I8KH 2XKNB 3BKCL 5GRWA 1FRGL 5IHZB 1QI3A 2DTML 2IIJA 4MXWL 5JHDA 3DUUB 5FF6B 1FO0L 5C09A 3OKDB 4M5YL 3HI5H 1RZJC 1ZHNB 4E9YA 1MF2L 3QRBA 4TL4A 3VI4A 1GYVA 5DJXA 1WAEA 2X6AA 3BDBA 1P1ZA 5I1AB 1J12A 1KJVB 3FYIB 2VQUA 4BFFA 4PGDA 3OKYA 2VSMB 3LRMA 4HK3J 4IHOB 4O2FB 3CLEL 4JFFA 3AT8A 1P69B 3CFNA 4MX7A 2JQAA 4GSQA 4QWWD 4XPHH 3OLGA 4UM8A 5KYYB 4JDTH 4Z0XA 5HHOA 1QR1A 3P3UA 4M8UA 2XUWA 2MWCA 4A37A 3RX5A 1ZV5A 5I66A 5FFOA 1JXFA 4IBZA 4J4PC 3DI3B 4ZTPL 5I1KL 1OALA 1PZBA 1UA6L 3LY6A 2H2SC 2X4SA 4IEFB 3IS0X 4ANXA 3NCXA 3CFUA 1NUNB 2LABA 2EEBA 3ROLA 1VGEH 4O02A 1U2CA 4UQIM 3VXUA 2EKSB 1ZLVH 5I71B 2BZCA 3JV5A 4PR5B 3EUUA 4Y2OB 5F3HB 1FYTB 5CEYB 2YZ8A 5HGAA 3K2KA 1PYWA 4Z7OE 2VDMB 1WHPA 4KRMB 1GOFA 5F88B 4JPKH 2P8LA 5EORL 4YZWA 4KNTA 5IQNA 3Q06A 4FNLL 1HHKA 1KXHA 2X0WA 4LCCB 4PBXA 4LEOB 4TQ8A 3S7GA 4L9DA 1V3MA 4ODUB 2ITDA 1XIWA 2B1OA 4FFYH 3ZDXB 4FF9A 3FFDB 2GJ6E 1RUPL 1HYRC 2H26B 4GT7A 1FGVL 3DETD 5T1KA 4NQCD 2DJUA 2YPKB 3CFJB 5DD6A 4OIIH 2OL3H 4XPAL 1OLLA 3DJ9A 4P5KA 1K4CB 4DCQA 3PDDA 5EF2A 3TONA 5DUBA 3T4AC 3RPBA 3TWYA 3L6FA 2ZG2A 2CPCA 2CDEB 2APVA 3T0EA 3OAYH 4RMBA 3U9WA 3C6SB 2Z8SA 3TBBA 5LNGA 1DQKA 4QI3A 3S8WA 3IGUA 1SM3L 2J43A 4J2XA 1QUPA 1I85A 3DX8A 2O6DA 1EZVX 4MXWH 3QZWG 2PYEA 4HOWA 1IVTA 1EEQA 5D1XA 2P1YA 1I3RA 3DO7A 3H3PH 4GRMA 3WNPA 2QQQA 1U3YA 4MAYB 3AXHA 4JFEB 3AADB 5IW6A 3UROR 3LD8B 3ZGHA 3LH2H 5T3XE 3RB5A 3MRHB 1RZJL 5DQ9A 4RRPM 1UACH 3MRDA 1JHKL 1RIVH 3DRQA 3IETA 5G4OA 3BYYA 3BUIA 4JPQA 1KBKA 1QNIA 4Z0BH 3WKNA 15C8L 5IEKB 4PAZA 4PH8A 1TO4A 4XN9A 1NFIA 2HT4C 3ATBA 1CMOA 4N8VA 5HI5D 1AAJA 2PWFA 3NJGA 3NDZE 2CE6A 1P4IL 2P43B 4D9LH 2V7HB 5E2VL 3ARFD 3SGJC 1D9KD 1MRCL 1NCJA 2BIIA 2LR4A 4HMDA 4GUCA 3CU1A 1KLUA 3S9DB 3BP6B 3QJSB 4XCCL 1IGIL 1MCOH 2NQDA 4HKJB 4S1SL 5FK9B 2RAMA 4HDIA 1UKQA 3PDOA 1EFXD 3ZQ9A 1D5XB 2NNFA 3HTLX 4TLUA 3VTAA 4JY5L 6CGTA 1QBLH 4JG1H 5AVXB 4PJ7E 5BZWB 3WY1A 3FH8A 3NCYP 1JWUB 3GB7B 5DO2C 3FUHA 2CUHA 4H1LB 2IAMD 4YBQD 2FCBA 5CP7A 5D7JD 1BXVA 3DI2B 2VE6A 4Z3HA 5EWIL 3MPCA 3OXRB 3RWDB 2ZCLH 2OQJB 3HNSH 5JW3L 1K6QH 4KGLA 3VGAC 4PIBA 1INEH 2JH2A 4WI5A 2F58L 2YRBA 4KHTH 1TJGL 3L3JA 2F1EA 3T0BA 4UV7L 4OIFA 3W0WB 1HN1A 4TUJB 3VH8A 3UC2A 1QEWA 2CPUA 2FNWA 2NCMA 5E6YA 3UADA 4PJ9D 3QR2A 1T5WB 2WUCL 5FYJD 3S5LA 1RUQH 4HLJA 2F8IA 4MJ6A 1V5JA 2NSMA 5CLYA 3BSZL 2PABA 5JZ7D 1ZTXH 1UVQB 5HDBB 1V7ML 5CEZH 2ZJSL 3L4UA 3N42B 1QI4A 3L6FB 3HE7D 4G6MH 2KPWA 1YEFH 2QHRH 4HPOL 2HMID 4WU7A 5CZRA 4PJEB 2B5IC 1E5ZA 4HJEA 3QI9C 5AAMA 4JO4H 1MCBA 4H0GA 3ZT7A 4Y2LA 3RPIB 2FWSA 3QQXA 2GB2A 1CXEA 2X3AA 4X4YA 3SPVB 1LD9A 3NIGF 2BNUB 4WY7L 2ZOKA 4BSWB 4L3CB 3QZLA 1IBGH 3SJVD 2KT6A 3HFFA 4JZOB 4NFBA 1JHKH 3ECBA 1WZKA 3RAJH 4L23A 1NOLA 4QGYA 4EDWL 3REVB 1MWAB 1VADA 4JM2F 2YUXA 2VR8A 1IC7H 3C5ZD 1JTPA 2OW6A 4NP9A 3ZZQA 2PYFA 1IARB 5CP3H 5FUCE 4G8GE 3QNYB 1QP1A 2YA2A 4ZMWA 2ICWB 3ARPA 1YEJL 1DZ0A 1V55B 4JFHD 4F9LC 3FTGA 3TWCH 3RGVA 1YRKA 1QNZH 2EACA 1VFMA 1YMMA 3EH1A 4HC1H 3LB6D 4GUPB 3P4MB 1CC3A 4AMXA 2IAND 4OF5A 3S8FB 3QK0A 4HFUL 2GTWA 4L3EB 4QRPB 4WUKL 5AG9A 1TTBA 4LARL 1Q38A 2JKNA 5HHNA 2E7LC 3C8KA 4JFXB 1ADQA 2IGFH 5IHBA 3CVHL 5C6TH 4I0PA 1TZAA 1LWRA 3FU6A 4PJBF 4IBYA 1P5VA 1NPUA 2CBPA 2B4CH 4TM9A 3K2IA 1NUFA 4GRLD 4WU5B 5DR5L 5IB3B 5JPMA 3P3SA 3QPKA 2CM5A 3R4RA 4PG9B 3V2AR 3WMSA 5IJVB 5MEQA 3I6LD 4PGEB 4YHLH 5EA0H 1CUOA 4OD3H 2Y1YA 4Y4HA 3VD5A 1INQA 5FM5M 3OKNA 2APTA 2HG0A 3LQMA 3Q8BA 4MB4A 2A6KB 2X70A 3BP4B 4XBPA 4HJ0D 1VFUA 3TTSA 2VLRB 3W39B 3HZMA 4TTDD 1MCPL 4MNQB 1FNSL 2QBWA 4NO5B 4MDIB 1NCWH 4GXVL 4FL4B 2H3NA 4XTRD 1HHJA 3X14B 5L2KE 1Y1UA 3QUYC 5ILTL 1V7MH 2XC8A 5CEZL 2ZICA 2GY7B 5F7HA 5I2IB 4A2MA 4TNGA 2IV9A 3ZDYB 3JBG7 3MV9E 4Z76B 3O11B 5BO1L 1W0VA 2XTJD 1H8NA 2AEIT 2JWYA 2W0KA 3B2PA 3IFPB 3DROA 3O2DH 5HSFA 1M9SA 2O6EA 3G04B 1RZKL 2QELA 3WLBB 2Q3ZA 4DK3A 2Y5TA 4G6FB 1UB6A 1GIGH 2YC1B 4HX1B 4YEFA 1FFOB 4M7KL 4DVBA 3I2CL 3S3DB 1G87A 2VITA 2XBTA 4FA8A 1HILA 3LV3B 4LP5A 5DZLA 2VDPL 3NCWA 3X12B 1H3VA 1A6VH 1HNFA 4KQ3H 5L6YL 2R4RL 3EUDA 1IM3D 4WK4B 5E5MB 3V52L 3M45A 5BZXA 2ITFA 2R29H 1NGZB 3IKCA 3QSKB 5AQ0A 1ZVSA 1EHNA 3MBEB 9CGTA 2VR5A 3ULVE 1EO8L 2YMTA 3UAJD 1PY0A 5C0BA 1QPPA 1O7DC 3MLZH 4LCIH 1U6AH 3WS6A 2W95A 1Q0YH 4XN7A 3O2VH 2ZNXA 2FLRT 4OGZA 4I89A 4X80L 1PDKB 3SQOH 2MNUA 4HC1L 1PEWA 3HB3D 2ZX7A 3Q2VA 2ICES 2P5WA 2RFXB 1OT4A 3QUYD 4NM4H 2ZOOA 2HRGA 5ESQA 1HH6B 2OMXB 2PPAA 3HBGA 1CIDA 3QIBA 5CWSA 2YBRA 4CKVX 1KLGB 1SOQA 2CK2A 4FQQB 4LARH 4WV1A 3N9GL 3O45B 4YFEA 3V79C 2ZKMX 3RG1C 4JQIA 3R4DA 3SCMD 3IDYC 4X5LA 3P73A 4P46B 1JHLH 4DUWA 2HT2C 4M62L 4IRZL 2ICWI 5BQ7A 2AP2A 4FA6A 1MHHA 3JT2A 2AS5M 5CCHE 1VKXA 3IVKB 4JRLA 2WKOA 1XX9C 4LAJH 4BK5A 1KCRL 4OB5L 3X1BA 4ZS7H 3HCVB 2R2HA 3MLTB 4AG4L 1N5YL 4P2OC 2F5BH 2CJTA 3MLUH 1MI5E 4RDQG 2H4EA 3VD7A 2EVGA 4BH7A 1XR9B 4L9LC 5DFAA 4XCYA 1UCBH 4QTIL 1Y1DA 4K8RC 5H35B 1NMBH 3SB3A 4UIMB 2X4OB 4WHTA 2DJ4A 5ANHA 4C56D 4L05A 3UPRA 4S1QH 4OD1H 2VLJE 5D96B 2E7MA 3KJ4C 1IGYA 1JPSL 1JPGB 3IU3A 2GQHA 2LAGB 3I50H 3G6DL 3GSQB 3O2DL 1BAWA 3CX2A 3GBLA 3FSVA 4XB7A 2WKGA 4X5WA 5DFVC 3IMTA 2NYYD 3OWEA 3ARVA 1CICB 5F96L 4ZD3L 4ANKA 4DP0X 3TASA 3GZKA 2WQRA 5BRZD 1F58L 3N1QC 2F7RA 1XFPA 2R4SL 2J8UE 1F4WH 3LDBC 4PJIB 1IEAA 3C08H 3VXMB 4PY7A 1QMUA 5SWSB 2VISB 4YZFE 3WNIA 1FBIL 1G7MB 3TEYA 2Y06L 2DM4A 5IHWA 4PJBE 4QRRD 4DFIA 1QSVA 3CVIL 3KVQA 4PRPD 4ABQA 3MACL 1C08B 2IH1B 3VJ6B 4V1DE 5AWNH 3HOGA 1KWKA 1M1SA 1DJZA 1YECL 4ETQA 1VERA 2VDLH 4WK2B 5JNYA 3UTOA 5BRQA 3A4AA 2P8LB 5T1JA 1U3HA 2GG1A 5F89A 2MPVA 1J8SA 1WITA 1INDH 5I0DA 2WJ7A 5CJBA 3GLDA 4QCIB 2CLRA 3EXLA 2Z65C 1V8HA 3PCYA 3ARDA 1X5LA 1TEYA 1I8KA 4XMUA 2G9KA 2E4TA 3C5ZA 1XF1A 5E8OB 2IWFA 4NQDB 4Y9EA 4YDJB 1N0XL 3B6SB 5AW2B 5AZ2L 3ZTJG 1CD1A 2XLLA 1YPZE 4F9LA 2LLLA 1EJOL 5A2KH 4N2MA 2BRQA 3P4MA 5DHEA 1MRDH 5HPOA 4OZHE 5LBSH 4J1UA 2NY0D 4ZPVB 1SM3H 5KYWA 4XO8A 5DRXA 5LAXA 4OF6A 4JHAH 1C5DB 1YDPA 2IADB 4KI5F 4X5QA 1L3NA 3SDDC 4LOUD 1EGJH 1O9ZA 2WOYA 3WN5C 3GSWB 2R39A 3C8KB 3LX9A 5ERWA 3FT3B 5FO2A 3TU6A 1PG7X 5A2AA 5T3ZD 2UWEB 1G6RB 5HD8D 4G3YL 1DJHA 4N2HA 3TZVC 3ZRSA 5EDSA 1RIUH 4R96B 3QG6A 3L45A 5JXEA 3BUTA 4MA1C 2VWEC 2DL9A 1U92B 1CG9B 3PGDB 4AEHH 3LH2L 4ZPTA 4UF7C 3H2WA 1HH9B 2C26A 1KOAA 3FB7A 4OLWL 2Q1EA 3QORD 4P5TD 4ES8A 3TYGL 3NSJA 5JR1L 2AV7B 3WEXA 1JF1B 1MHCA 1KSRA 3RWGB 2AK4D 2GITA 1MHPH 2R0ZH 2XHNA 3JV4B 3MOBH 3WKML 4L5FE 5JMRA 4L1SA 2CIIA 5LCVA 3MUY1 4X0KB 4IRJD 3RX8A 3REVA 2E6PA 5D7IF 1EFQA 3AWEA 1DVFD 2AQPA 3D85A 3WS3A 1C7TA 3JZ7A 2CH8A 3KDMB 5D55A 1S7QA 1DBKL 2BC4A 2X3BA 3LKNB 4PS4H 2JVUA 5IWLA 4U1LB 3EJJX 4WEBH 2YPVL 3KDPB 3WN5B 2HFGH 2ICWA 5F0MB 2HSIA 3LN4B 4JFTA 1DCEA 5ANME 3IWUA 5L9DL 1U8LB 4W9FC 2OMYA 1CD0A 4C57C 2DLHA 3P3RA 3L3OC 2YEVB 1CFVL 2VSCA 4ZX4A 5C0FA 4H26A 1ETA1 1IKNA 1YHPA 4KY2A 1VADB 4UT7L 3MKKA 2CRIA 4BQCA 3WV0A 5HI3D 3SE8L 4LPVA 4XP5H 3JVGA 1LYQA 1Y0LB 2UZIH 3VI3E 2G2RA 3CSYB 1L9NA 1WIOA 4PRBB 2I32A 3GDBA 1CTMA 2PW1B 2EO7A 4PI2A 2UZYA 3RP1A 3ARFA 4MCYA 2ED8A 1BOGB 1HWWA 3L3HA 1XB3A 3JTBA 4A2GA 5ICZA 4R4BB 3ESUF 4NLHA 3HN3A 4U0RB 3PWPE 4NZDA 4Y5YC 4YOKA 3KCWA 2ITCA 2VCOA 3HE6C 1S9WB 4N2AA 1NC4D 3KYOA 4P5MA 2EDEA 3LNGA 5JDJA 4Z0BL 4A63A 1CI5A 2X40A 4GRLC 4OT1L 3FF7A 4OCXH 3OLIA 1E5YA 1S78C 1SVBA 4BUQA 1KELL 2IXQB 1GZQA 3ZX1A 4QHMB 1DQLH 3KLSA 4TMPA 1B3JA 2RD0A 3W0WA 3QIWA 3PAZA 4YDJA 2QPSA 4G8GB 4POZD 3X11B 4D9LL 5K1JA 1KB5A 1FZJA 3BX7C 1F90L 4PRHE 3LS4L 3PE9A 4G1MB 3BAKA 3O6FC 1SBSH 3RVUD 3B7SA 3HG1B 3EYUH 3FTSA 1J86A 2MPAL 2PYED 1PIGA 3U0PA 3B9DA 1CDCA 4U1KA 4WU7B 1B0IA 1YEKH 1ND0A 3PWPD 4N22A 1CZ8L 4NQSB 2IGTA 1IAIL 4QHLB 1HXMA 3X1GA 3QC6X 4HU2A 2OYLA 1UOLA 2J6EH 2YGVA 5FM4A 2OZ4H 4Z7VE 5KBKA 4U1SA 2BVPA 2D0HA 2ZUXA 3RDTA 1U8KA 3ARFC 1L5GB 1FH5L 2KS0A 4DPRA 1H9VA 1CLYL 2VJXA 3Q43A 4HZAA 5E6IA 5HHVH 1KTBA 3RWHB 4ABUA 4QD2E 5F7KC 5DA4A 3LQZA 4GRWE 3RTLA 1G7JA 1ZT7A 3I6GB 2W07A 1S7UA 4WTWA 3BP6A 1HZLA 4TXVB 4XN5A 4YLQT 1MQKL 4B9PA 2B3IA 1I8UA 1KGXA 2XVKA 3PP3K 4H40A 3DXAE 2AJYL 2X89A 4IOFC 4YBLC 4H4NA 5DJZB 2R7EB 2AJSH 2WXNA 3WO3B 3VFUA 2VDRH 4B9ZA 3P40A 2XVGA 4UOJA 1J8HD 4ODHL 1R46A 1BIIB 2B08A 3H6AA 4CC4C 4NPKA 5D7HA 4WWKA 3SY0A 2NNXA 1Q9OA 4QJ3B 4M1CC 1HOEA 4QTHA 2DRUA 3OAZK 1AG6A 2C5DC 2HB0A 4FD0A 2V2WB 3L9RA 2IMMA 4U2ZA 1XXDC 4L4VE 4NRXB 2CDEA 4I2XA 2H32A 1YN6B 2E86A 4KAQL 1QHOA 4S0TD 5DHVA 1XCXA 1FC2D 5I16B 4ZOAA 3GMQB 5E94A 2ICCA 4WGWB 2BS8A 1NAMH 2ATKB 1QWNA 5EU5A 4GG6E 3E9UA 5AKRA 5L4FA 4OZFA 5C0CB 3STLB 1QRNE 2N56A 2VB5A 2ZCHH 5BV7B 5EHFA 3W0WD 2VIRB 1JVOA 4WJ5B 5I1LB 3NEXA 4PG2A 4G8FB 1QG3A 4XCYB 1NCDH 4LE8A 3ARRA 1LO5B 1N2RB 2DN7A 3UEZA 4BKTC 3F01A 2HJFA 3ZR6A 1RZ8B 3ZTEA 4HSQA 4N85A 4BINA 4M00A 5LDUA 4A2EA 3PUUA 2R0LH 1HYSC 1M42A 3ZW3A 1TNMA 3IAQA 4DGYH 1I3RB 3DO7B 4X6BB 3ZXAC 3D52A 3BZEB 5EOQH 3SY0B 2Q7YA 5GGUB 1K4DA 1PX4A 3P3TA 3MBXL 4ISVB 1YY9C 4C4KO 5C6TL 5IB1B 5GZNA 3SKJH 3MREB 1ZVSB 2XNAB 1XCQA 3VI3F 1R5WA 2DQ6A 3EZ8A 1A6TB 1L6PA 7FABH 5C0ND 4H1LH 1UT9A 4PUBH 5SWSA 1E7VA 4WW2F 4GQ9H 2DOCA 1SFHA 5F3BB 4X83A 4ELME 4GQZA 2HPTA 4M93B 1XGZA 4DEWA 5HXMA 4JDEA 1BZQK 5KJRH 4FYRA 5GSVB 3UOAB 2XN9E 2ZXAA 5AOKA 4FL4C 3QCVL 3VG0L 3JTTB 4FHBD 3IDYB 5HHXH 4OLVH 3QAQA 4G9DA 5E8EA 5CFHA 3TO4C 4XMLL 2VDRL 1NCWL 1MI5D 1UZ8A 4NQEB 5FUZL 4G1EA 5F70A 5ITFA 3FTUA 3PV6B 3Q6FB 3KDMA 3HUJE 4JDTL 2COQA 4RGMC 1PZDA 2G3NA 4N2EA 1JV5A 3BJLA 5ETUA 3UTSD 4APQC 1TSHA 2DDQH 2M2DA 3HA0A 2BRRL 2J88H 2CUAA 4LPUA 5T33H 4JM4L 3U6XS 1Y6KR 3QZOA 4H26B 3BSZA 3ESNA 4ESKA 2FX8H 4NZRH 3QDGE 4NXSA 3ZDZB 2XTLA 1NAML 4F2EA 1O0VA 2JXMA 5E4EC 1I1AC 4GKLA 2HXAA 2D7TH 5AAWA 4ONFH 4K3EH 1N0LA 5LG1A 4PPTA 5DJ2B 2PLTA 3N44B 3HW7A 4KXCA 1NFDB 2O6PA 3EIFA 2CHWA 1OF2A 2VLRD 1AYOA 1ERNA 1TO5A 4KH2A 4AK2A 1N6VA 3P4LA 4IKIA 4CSPA 1HH9A 1NCTA 1QSFB 3DTUB 5CXPA 3MUGA 1S7VB 4YC2C 1RZGB 1JVKA 2WNWA 3PREA 4OZFG 4BFIB 3BH8B 4X4XB 1VCBC 3PJLA 2APBA 4YZFF 4FG6D 2FH8A 3FSAA 4U4IA 3RDTD 2CRYA 1WRFA 1BX2B 4KFMA 3VQLA 3HS0A 3K74B 1HNYA 2VMFA 4P59L 3PNWB 3V4VH 2X10A 3MUJA 4JFXA 5CMAB 3RVXC 3M8OL 4APQA 2NX5A 5JHLH 3FQUA 3REWB 4PJGF 4NQCB 2HH0H 1Y6MR 5KS9E 5DEGB 2K70A 4LOEA 1QRKA 2Z3FA 3CQFA 1IC4H 4J8RA 2IH1A 4PUBL 1AD0B 5HHME 4UOW0 1OP3K 4UQ2A 5D1QB 2WLYA 4AG4H 1RJLB 1M6OB 4H88L 1CGUA 2DJMA 1JZGA 1L7TL 5IIEB 3M86A 4ODWA 1U93B 3FCTA 2DF3A 4JO1L 5IMKA 3WUWG 4QCIA 1P5UB 4UANA 3VG0H 4YC2B 1HWHB 2CKBH 2JF1A 1KT2A 2OKMA 3N44F 4R2GC 5DK2B 5H4ZA 4PTTB 3LNDA 5E8OA 5SWZA 4HIXH 4K94C 4F24A 1ZT4B 5CN3A 4NHCL 4MWFB 1WCQA 3MXWH 3R0NA 7TAAA 2XTJB 5DURD 3HRPA 4B9FA 2HUHA 1N0XH 3II3A 4DW2L 2H3NB 2OR8A 4IQHA 3DJZA 3K46A 3WIHA 2IOOA 3D06A 4JDVA 2R0WH 5E7BA 3S88L 4MJ6B 4GAJH 4MJ2A 4PJBB 3AB0B 2IFGA 3SD2A 4AIOA 3C2AL 4EN3B 2B3RA 3UG5A 3ZK0A 3CHRA 1H8SA 5TD4A 4HUKB 2X4OA 1EWHA 2XV6B 4K7PH 2H41A 2ZP9A 1ZS8B 4FEIA 4F3FB 2XACC 4OFYA 5LAXB 3MR9A 1KIQB 2ZP0T 5CEXB 2WIIA 3CFCL 5F7MC 1L0XA 3U7YH 5EZOH 1LQSR 2AJZA 4NN5B 1NGWA 3APNA 3HMXL 4G9FB 2SEBB 1CICA 1KMGA 4KVCH 3S36L 1MUJB 4DP4X 3L17A 2FO4B 1VPOH 4KMTL 5D2NC 4CU7A 3UP6A 4HIIB 2X1OA 3QJHA 4WZ9A 4DUVA 5KTEL 3D3VD 3F58L 4AC4A 5F7AA 1IZJA 4I5BB 2PYFB 4LLQB 4XCEA 4E42B 5JOPE 5B8CB 1IGCL 2JI1A 4NKDA 1BZEA 4NRZA 4QXUH 4W9CC 4WWKD 5FAAA 2PKDA 5FS5A 5C2BL 2XDHA 3J27A 4LCWB 5T1DL 1H19A 4J3OF 3UTPD 1XH3B 2AJVH 4EZKA 5ICXB 2CO7B 2YXMA 4ZFZA 3KMDA 4U3SA 5C1MB 1AMYA 2B9BA 1AJ7H 1Z5LB 1NBYA 5FCUL 1P7QB 4PJGA 1XB8A 4X5RA 4Q0XL 4XN2A 1YNLL 4BSVA 3EHBC 2WLMA 1NMAH 4Z95H 3ME0A 4AMWA 5HJDA 4GW5B 1JP5A 3TNMA 1KLGA 2R8SL 2A6JA 3I84A 2NY7H 5F7EL 3RTQA 3TBTA 4CSSA 3CVCA 3MLXH 3HAEH 3U30C 3T3PE 1TVDA 3ZKNC 4GRMB 2CCVA 4JY4B 4MNGE 1AO7E 1R3IH 3VFRB 4LF3A 2G3XA 4F7TA 2HLAB 3F5WA 1RP8A 2H1LM 3MRGA 3QR1A 4PP2A 5D7LD 3V7MA 3KG5A 5D4JA 3SDAB 1NUGA 3RKPA 4FMVA 1RZQA 4S1DD 1XZ0B 1ZANL 2BVQB 2X1XR 3ENEA 4CL7A 5D7IE 4NP4L 2DMBA 4Z3GA 4OCXL 4KROC 4R26L 5IQ7H 4JPIB 3C2AH 4BH7B 4TUKL 1NPJA 3JWDL 1DQLL 2VSKB 1AR1C 2VLKA 1DHKA 3HPLA 2D03H 4RFEA 4HH9B 5DZ9A 2BOLA 5F9WC 4E9SA 1QQDA 3MUZ1 4ZUTB 1SPDA 1XH3A 5T1LB 3DBXB 3DHJA 3RWCB 2XZCH 5IESH 3C5JA 5C07E 3BSGA 3OGOE 4HISA 3RNQA 4PS4L 5F7UA 3FT1A 1WC7A 3QH3B 2YC1A 1U8PB 1XV8A 2X1QA 1FQ9C 3BVXA 4ORZC 1URLA 3QUXA 5TPWH 4QRRA 2MPAH 4XCFL 5EZOL 5KBMA 4MAZA 3V6OE 1MFAH 4LLWA 5IVOA 4ZMZA 4JVWA 3X1NA 2X53A 5KYUB 5C8JA 1SJEA 4NWTH 2IGFL 1A1OB 2Z0UA 2I27N 1RURL 4PWHA 1U58A 2EE0A 1XH2A 1ROWA 4KJWD 4H8VA 5TE6H 1YJDL 1WPCA 2GW5A 2UZIL 5IROA 2NUPA 2BNRE 2BP8A 3ATDA 4KXBA 3L8QA 4B9KC 3ULSA 4NT6B 3VD3A 4CVXA 2JLLA 5LCVH 1AXTH 2Y22A 4FG2A 3Q8FA 3MFGB 5E5UB 5HHVL 3P54A 5LGHL 4W68A 1MOEA 1IAMA 1YEGH 4QXUL 4EVNA 3D18B 2M8XA 4OD3L 2OSLB 4Y19E 1VGKB 3RL2A 5I5RA 5C09E 2EVHA 4W6WB 2W59A 4YK4C 3VGAB 2AABL 3I6KA 2EXWC 3CBJB 2VABB 1SXZA 1BVNT 3VVVA 1K8IA 3ARFB 3VI4E 4JQXC 4FTDA 12E8H 2N7BA 4HK0B 3TVMC 4J39A 1S7UB 3UBXG 5FA4B 3DYMA 1CGWA 4NNYA 5KSBF 2DQCH 4WEMB 1YVLA 3MDJA 3K8KA 3NCEB 4JO5A 1VACA 2NZ9D 4YDKL 3TBWA 4KO9A 4UV4H 4JRWA 1WSST 4JFFE 2YRLA 1XGPA 4K3JH 3BZ4B 2TRHA 3KL0A 4NZUH 5CD3A 2NY7L 5F7EH 3ROLB 1CBVL 3QNZB 4XNYH 5B38A 1YZZA 2F54A 4MD4B 1GZQB 3WDIA 3JWNG 1A6AA 3RX9A 3UCQA 3JTSA 4CGTA 3GPSA 3KGTA 4AQ1B 1MH5B 2DLTA 5I2IA 4ERSH 1XF2A 3B5TA 4X4YB 1DSFH 4PJXA 1Y7VA 2XFXA 3V4PA 1EH9A 1H3UA 3INOA 1X3DA 3S3BB 3NH7H 4HGWA 5IF0A 5EBMB 4GBXB 1E9QA 4YL9A 1DJYA 3PGFH 4XBEL 3UDWA 3KGRA 2YK1H 3KLAB 4HCIA 4JBSA 5EU7E 3MJ9A 3BC9A 5E1QA 4LRIA 2AAVA 2QVTA 2L7JA 2VDKL 3MN8A 4JPWL 1XMWA 3NJMA 4ONGL 4PRAA 1HZHH 1AY1H 3WJLA 2ZX6A 3BD4A 3C5XA 4FQ1H 1PVHA 3AC0A 3RUGE 1AXSB 1ORSA 4BK8A 2DQIH 4CMMB 2FIKA 4EKXA 4X50A 1JYWA 4J3WA 1OSPL 2GJ6A 3LZQA 1HEHC 4XAKD 1UTDA 4I85A 5GGUA 3M1BA 1UQSA 2NOYA 1VACB 3DOHA 3GLAA 1FVCA 4FXKC 5HYEA 3FQWB 5D72L 2Y36H 1IM9D 3FKUS 3DIFB 3CN0A 3EJZD 1MAJA 3OPUA 1TIUA 2O26U 3KPSD 4HIJA 4HP5A 2UZPA 4JKPL 3EDKA 1MXGA 2V5SA 4FFWD 4NQVB 2UUDK 1GS8A 2BCKA 5DVOA 3VFNB 4KJPD 5EF0A 4AJVA 1DQJB 4AQ1A 1C16B 3OHXB 4PY8I 3BD5A 5GRUL 2WAQA 4KXDA 1MHEA 3OLDA 3NABH 4KK5D 4QXTB 1M7DA 4P23C 3AVEA 5TE4H 3ZTNL 4E5XB 2RGSA 3ALWA 3ML9A 1TVBA 4FZEL 1QSED 5I1JH 2VDPB 3UEQA 2WSDA 1D9KA 3L16A 5BOPA 5D5MA 4HKZB 2X4SB 4NHUA 3S37H 3RZCD 1PNDA 1U8QB 3FHQA 3GBDA 4XXDB 2BNQD 1KJ2B 3QO1B 2PW1A 3Q01A 2WBWB 4XPHL 4BQ6A 5KG9B 1WE5A 4KBPA 3P4NB 3EGXB 2GT9B 2YD8A 4LCCC 2QQNH 5L2JA 4L1DA 5FA3B 3KPSE 3CV5A 4YDNA 4G9DB 5C0AE 3PQYB 2V2WA 3FQ1A 3TO2B 5CZVH 2D8KA 4GW4A 1NFAA 2VLME 4G5ZH 4JR9H 5I1HH 1T03H 1QSFD 2XWTB 3TZVB 5A16B 2FRGP 1BYNA 3CCHB 3LSOA 4CVWA 5IJDC 1L3WA 4AI7A 5FECA 2K4AA 1OAUL 3Q44A 4C56B 4WDIB 5EU4A 1JN6B 2WIMA 1DBAH 3WBDA 3K6SB 3RIKA 2YAPA 4EUPB 4OZIF 5DQJB 1FP5A 5DXWA 3QGVA 2VTFA 5GGVY 3B5HA 3GZOA 2E4FA 5FKPA 1ODAA 3BQUA 5DVMA 1ACXA 5TDOB 2IPKA 1PGRB 5J4MA 2BNQE 4I3RH 4G7YH 4OLZL 1SMOA 5JLZB 1SEQH 1MHCB 1IKNC 3NAAL 4HGWB 3Q1SL 4ZMPA 1YYML 2HX7A 4FYTA 2WVVB 4YXLH 3A5VA 5CFAA 2FX9H 3RY5A 1T83C 1FVDB 1P9MC 3DDFA 1OP5H 5K9OB 4E41D 1ZSDA 2Q2LA 2AQ1A 3PWJB 2OK0H 2WYHA 4XN1A 1AS8A 2VUOA 4FFZH 1M2OA 3D5OF 4D0DB 4N3UA 4LCYA 4U1KB 3RY4A 2PW2A 5AZ2H 1SJHA 4JANA 2X5PA 2GK2A 3EYSL 1ZGLM 2YWZA 1Q9KA 1UKTA 4S1RH 4JAMA 3AU1B 4DHLA 1A6TA 3LZRA 3I74A 3EDJA 1T2JA 4XMPL 2DDQL 1TNNA 4XO3A 3VSVA 3T77A 3RBSA 1X7QB 1GCFA 1E5UI 2KZKA 5CUSL 3CDYA 4DN4L 3CDZB 3DJSA 4N0CD 4NN6B 4P4RB 5D1ZB 3ZSSA 1OW0C 4UTAH 1W0WB 4U05A 1I82A 1JK9B 4XVTH 4AQAA 1TZHA 3QPXL 1ECYA 2CLRB 1BFOA 2YUVA 5DVNA 4AVJA 3ULSB 3QQDB 1PQZA 4GG8B 4ETYA 3W9DA 4BKLA 5L88H 3T6ZA 1O6VA 3H9SE 3MRIB 4G6JH 4K5MA 3S35H 3TBCA 3V4PH 4ODUA 2YKLL 1N70A 1PKOA 4AMKL 5IBLD 2WBJC 1LO5A 1N2RA 1BGXH 1P4LA 4JDZB 1P7KB 4L9LA 5T1MA 1F1GA 4UDTB 4N9OB 2ENSA 2KI6A 5C0EB 3ZKND 3VMNA 4CNIA 5DUML 5E51A 4CUCA 1S2EA 1E0OB 1BVNP 2ZOTA 3G5YB 3SYQA 3W1ZA 2DLGA 2EIBA 2G75B 4WI8A 4WTXA 3TGXA 1I1RA 5KN5A 2NYYC 3BI9X 2TSAA 3CDGB 2NY6B 5F0JB 4UOW1 4WW1B 8PAZA 3MGOB 5JORB 1WTGT 2EDJA 3D6GA 2Y6SC 4XBGB 1RH8A 3CMOH 4HJGB 3T8VA 2Q0ZX 5IR1A 1SDDA 2A0LC 1T4KA 1YMME 1I1FB 3FB5A 4G9FA 5I66B 2FQGA 1ASOA 4OGXH 4OH2A 4MBOA 4XVJH 1QSEA 3QNXB 1AKJA 3TO4A 2JB6A 4URKA 1KIQA 3G5ZA 4DKFH 3NJLA 5I0YA 3SE8H 1E4JA 3L1OH 2E27L 2NY4D 4O2FA 1BJ8A 5AYUL 3S5ZA 5E1IA 3BZFB 1MDAA 4DN3L 4FLRA 3NDYE 5F1IA 1Y6NR 3DSNA 1SGKA 1RULH 2H8PB 4G80B 4MDRA 3EBHA 1Z9MA 2R29A 4FQJL 1F3DH 3GJEA 4OJFL 3TXAA 5EEUA 1F3DJ 1R5WB 5GGQH 5HHQB 3EFFB 4E5XG 3T4YB 5E2UL 3TT1H 3GHBL 2ED6A 3RZWA 1TSRA 4NNXB 3LDBB 3L81A 4PGDB 3FUFA 5E1AA 5FPIA 4OCSH 4P9ML 4KHXH 3VE0A 2Q7YB 1YA5A 4FCHA 5F72S 1RFDH 2D0GA 5J89A 3QULA 2ZUQB 5D7LE 4Q0XH 4X4ME 3P2DA 1RU9H 1TEFA 1OM3H 1QAWA 1MWOA 4OCWH 4WVRA 4MA7H 3MCLH 4W9GC 3ESPA 1YG9A 4R2GD 1WLHA 1G7QB 1OD7A 1X5HA 4P5TA 5GIRB 3N0PB 3MLXL 2DW5A 3WJJA 5DDHA 4B27A 4PMEA 2XSKA 4P3DB 3QIWC 2ZKWA 4XGZB 4Z7WF 4PJ7B 4JL1A 5PCYA 2ATAA 3FHAA 1TFPA 4DK6A 1URIA 3MBED 2CXGA 2FATH 4E9TA 1LK3L 3PJSB 2JKJA 3CZEA 3J8F7 4OCYH 4CU8A 3R18A 3EKCA 5CLTA 4P2QA 1UWYA 1T7XA 3FO2A 4X98A 4PJDA 5IREA 1Q72L 3FU9A 4HUUB 1E4KA 3Q1EA 5CSBA 5BO0D 5MEQB 3TF4A 1KBGL 3CFTA 4XPTL 3MUGB 1R3LA 1SXCA 4K55A 4KY1H 5DJ6A 2WXJA 4AYBA 3ZKSD 2AJ3B 3QQ3B 4A7VA 1B2WL 1BJ1J 3SY6A 3HR5A 5FYKE 5HI5C 4Y89A 5AW4B 5L7XL 4IRSC 5D70H 1MQKH 3FU5A 5GSRB 1I9JH 3EFOB 3MRRA 4PJ9B 4OZ4B 1JFQH 4HF5H 3F83A 1Z9OA 2KL6A 4I48B 1KB5H 4UZSA 5FYKH 4B95C 5I1DB 4DESA 2QZ5A 1PLGH 2OP4H 1CGSH 5AVSB 5I8KL 3GSVB 4B5ZA 1AIFA 2CG9X 3LHPL 4NQXB 3ILQD 1YEDB 5DR5H 2CGYA 4KJQC 3HC0A 2KDYA 1XVSA 4FX5A 3VAEA 2UV3A 1YEHH 2CO6B 5JW5A 2IAMA 3MBEC 4KI5E 2BSED 5LCVL 4MJ5B 2OMUA 2WCGA 4UCFA 4F7CA 4BWUA 1N3NA 4FQJH 3PJNA 4OI8A 1WFNA 2IJ0C 4K3DL 2OJ1A 4CAGA 4DP8X 5BRZA 2Q8BL 1NKRA 4UQ2B 4YGVA 5IJBC 2VDKB 3MA7B 1AZZC 3ARGB 1D6EB 3FQWA 4FN0A 1CPUA 2P8MB 4PJ9C 3PL6B 4OSUH 3S5YA 3V0GA 3L7FA 4IRSD 4MZIA 1TMQA 4BWWA 1NAMB 1D9KB 2B1AH 4OUOA 4S2SB 4APQB 3HNTH 4BK5C 1SYSA 1OP4A 4N20A 2P42B 4JJHA 4PJ5D 5E08L 1TF4A 4QO1B 4AGOA 4IRSB 4ZTPH 3JWNH 1E4WL 3RVWC 2W8CA 2XCMC 1UB5A 2X05A 2VJ8A 1EXHA 4LFHG 4KQ0A 2Z31A 4GUOA 3QULB 1J5CA 3RZCA 3SBRA 3O3BB 5I8CB 3UAEA 2YPLE 3FT2A 4LKXA 3S34H 1RJCA 4YSOA 4KC3B 1PSKH 1DSFL 5BS0B 2V5RA 5HVGB 4NWTL 1JGUH 1DQDL 1Q94B 1RK7A 1S8DA 3D51A 5E56A 1UFUA 5E7FA 4CW1B 3ZPDA 1I7ZA 2VDQB 4GSUA 3HI5L 1TZHB 2YK1L 3R7QA 3RFZA 7FABL 3BGAA 5HGDB 1QHPA 2MQ3A 4DKTA 4OUUA 5DJYA 3P77A 5BV7H 2G5BB 5IF0B 2HJFB 2YXWA 3V6FA 3IJEA 4NPYA 5I15H 3TBYB 5EEWA 1NEUA 2CLVB 4Z1PA 4HPYL 1VSCA 1TTRA 1WGVA 3QIBD 5HJ3A 3IXTB 4IGBC 1I9JL 2ZCZA 3FRPA 1AGDA 4NUJA 1UXWA 3N9GH 3L5XH 2CK0L 3MRCA 3GIVA 3U46A 4L1TA 2MNWA 3WI9A 5K9OA 3QUMA 1FJ1A 1JMZA 4JG9A 3IGLA 1IGYB 4AYEC 4N2IA 3FH7A 3QORA 5D1ZC 1IAIM 3I6KB 3WD5L 4U33A 3DBSA 1A3RL 4NZUL 3MC0A 4PI0A 4R90H 2AI0L 1KCRH 3GHEH 4OB5H 5DHDA 3I9GH 5JXED 1EDHA 1DUYB 2ZYHA 4MYPA 3Q6GH 1BQHG 1FC1A 1BBDL 3OXSA 5DD5H 1NIAA 4W9EC 4L4TD 5EO9A 4XE0A 1UFGA 3QUMH 5CD3B 1ECZA 1PJ9A 2H5UA 3BCDA 1BWWA 4ZG1A 1Z9SB 2L0DA 2R69H 2Q7NA 1CN4A 1YAIA 4QRBA 2Y7QA 1HQ4B 3L08A 4CN4A 4OZFB 5C0CA 5KVFH 1XGQA 4A7TA 1OGAE 1SLUA 3RDJA 1TQBC 4A7QA 3LRLA 3ATAA 1JWUA 3GB7A 5MENE 4LSVH 4H44C 2P49B 3EXJA 1FNEB 3A6CL 2YJQA 1OHQA 3KJ6H 4PWKA 1KTJA 4HVBA 3C5JB 1LP9E 2FBOJ 3TZVA 4DP1X 4B9JA 4JR9L 4UZUA 3MLYH 4F8PA 3MRLB 5IEHB 2A9DA 4MNQE 1XF3B 2R69A 4LSQH 5EBWA 1DQIA 3HMWL 3FO0L 5KVEL 3RY6C 5E6IC 3MSPA 3AS2A 3RL1A 2GTWB 4G6KL 1I8IB 2YD1A 3DNKA 3UBGA 3SDAA 1BQSA 5DLLA 3C87A 1VKXB 3VFVB 5TDNB 5HVWA 3T4AB 1T2QL 2FUQA 5E9AA 1ZGLP 3AGVA 2H1PL 3AAZA 2ADIA 2IANE 1UXLA 5B7EA 5C0GA 5JLZA 4LLMA 5EWIH 5I15L 5JHDD 2JTDA 1L7TH 4JHZA 4QXGH 3PAVA 2WCSA 2F6AA 1WA0X 4MXVF 3BUYA 3P11H 1U42A 4AQEA 4JVUA 4WI4A 3VI3A 3EOTH 4IJ3B 3PFUA 5FHBH 4WI7A 1BZ9B 3AG3B 5C0IA 1Q0XL 4L5FH 4MNQD 4UV7H 3SO3B 4FFZL 3CZJA 5EBLA 2BW4A 2IBBA 3D33A 5KS9F 5J6HA 4MCZB 2MCAA 5DC4B 5E8DL 4UB0L 3FT9A 2JJWA 4BFEA 4ZFOL 2A73A 4XOCA 3GIVB 1TLMA 1Z6JT 4XMPH 3U82B 1CGTA 4U3CA 1RMFH 2DQHL 1I9RL 3TNMB 1ZE3H 4PJDF 1DEEB 2FJGB 3KBEA 5DD5L 1MFDH 5FLUA 5D1QE 3OX8A 5TJWK 1LK2B 4ZX5A 5H8DA 4GS7B 4PS3A 2V8LA 1UATA 4RZCA 5EOCJ 2Y9RT 2X41A 5DWUH 3GMNB 5CZXD 4XVTL 1U8QA 1JNHB 1DJGA 4HUWB 1E6JH 2ZKHL 4AE1A 3QNZA 3U1PA 1IJNA 5DMKA 5B38B 2BZ7A 1X7TA 2X2UA 1N4XL 1N10A 2HRPH 2ZPKH 4HS6A 4Y7OC 3FOMB 4MNHA 3NGBC 1DN0B 4AMKH 3P0VH 1TETL 4GG6B 2W92A 1FVEB 4GEJA 5TFSH 3ZTDC 3ARWA 2GC4C 3HEIB 2DQEH 3CHXA 2ZG3A 4JFDE 3VWKD 3HLKA 1N5AB 1EEZB 1RIHL 3CFKB 3E8UL 1SHXA 2PPDA 1WF5A 2Z8VC 2JV6A 4G70B 1HEZB 2BO0A 2HKAA 3BT2H 3EJSA 3T0EE 4X7SH 3OKNB 4MRCA 4A6YH 1AGFB 1SY6H 4LLYA 2XT1B 1X9QA 4HSAC 3GBEA 4DPBX 5L9DH 5CHNB 4MA8H 3IM1A 4HETA 3RVXD 3LMJL 3LRSA 4GIOA 4TUOA 3RIFF 2AJZB 3VFPB 1KGCE 1BZ8A 5JMOC 4R4ND 4KROB 3CVHH 2SEBA 2G30A 2J5LB 4E9RA 2FEDD 4PJDB 4MAYD 4UZGA 4ZUSB 4D9RE 2XXCB 1KTCA 1T7VA 5EZIH 4JZOA 4HEPA 4UTBH 4IJTA 1XAUA 3HFML 4DN3H 3SOBH 2FL5B 5F7BA 3LKOB 3HZKA 2OXGB 5B1CA 5I0VA 5IEKA 25C8H 2CR6A 3ALPA 3QEQD 4F7CB 2FDBP 3EFOA 4W9IC 4K3HA 4EDWH 3VB9A 3LIZH 1VFBA 2B20A 2MQCA 4FGMA 4Y1AA 2O5XH 5KOMC 3JVGC 2ADJB 1KELH 4ZO6A 4AGQA 1A2YB 5HP5A 4YXHL 1TENA 5D8JL 4PBDA 1MIMH 2IQ9L 3AACA 2WY3B 4P05A 3UTTE 1FNHA 4TUKH 2C3WA 3BEVA 1LE9B 2H6PA 4GKOA 3I6LE 4JNXA 3GKWL 3WO4B 1W91A 2CO6A 3O4LB 4M7LL 3SKUD 5IESL 2I9LA 5IOPA 1HDMA 4K71B 3SDDD 3WJLC 1OTUD 3ZE2E 5D7JC 4BFKA 3N1PC 4MMXB 1S9XA 3U0WH 4TQIA 1Q9WB 4M3KB 2WYTA 4PW4A 4JCWA 2AQ3A 4GRLA 1MH5A 3IAGC 2EIKB 1MWAL 4PJ7A 3ZHLA 4XCFH 1YPZB 4PY7B 1MFAL 1NEZB 1CLZL 4KVPA 3VNYA 2EICA 4M6NL 1NFDF 4UQDA 3V5DA 5DLML 4P99A 4AVHA 2FR4B 1QPKA 5CJQH 1XH0A 3KPRE 5AB9A 3GRBA 4PRHB 3CLFH 4XMWA 1W8EA 4H1LG 4MNGB 4F9PC 1F97A 4MSWA 2DQTL 3B3IB 3SO3C 3HRZB 2H0JA 4KNSA 3ZDWA 4DAGH 1HVXA 3U36A 3JWOC 2DH2A 1W8NA 4LCIL 5IUCA 3KPLB 1OB0A 3FUKA 3ZR5A 4ODBD 5JA9A 4RETB 1Z3GL 3JV6A 4OJFH 2C8NA 2R1YA 3S3CB 1IUZA 2WK2A 4NC0B 4OZIA 4GKSB 5KVFE 4Z3JA 2KC0A 4B9GA 3DSNB 3LTVA 5FO9B 3WTVA 5ES4B 1Z5LA 2IV8A 5TE7L 4A2LA 1ACCA 2F2HA 2NRDA 4PQXA 1YC8A 2OP4L 4PLOB 2RBLA 2VNCA 4M9PA 3FUJA 5T3XH 2V4LA 4PFEA 4ZSOA 3VFMB 3U9PH 4XC3L 4P57A 1RLBA 2A99A 2J56A 3ZKQD 2Q6WA 3T65B 1ZCRA 4NLAA 4MDJA 5F0LB 1N5YH 2OMVB 5EEYA 5I76A 3LNEA 2AQ2A 2DBLH 3RU8L 3MRFB 2CO4A 4HOZA 4ZI8A 2MIZA 3X17A 1JOIA 3GSOA 4AQ8A 5I6OA 1U8IA 4OGYH 2P26A 4Y8AA 1LK3H 3MREA 4IBSA 4W9LC 3WNOA 4YHNB 1P7KA 1WVZA 2OMTB 1MZYA 3LS5H 4N8PA 4OSUL 4IKJA 4ODTL 1W9XA 5F1NA 3RIAK 5B38G 1U3ZA 4KTEL 4BCXA 4CJ0A 3U4EB 4JPWH 2VDNH 1AYRA 3QQDA 2UXGA 3ATFA 1FLRL 5B21A 4ZQKA 3O8XB 2NNCA 1QFOA 4YFLI 5F9WB 2FE0A 3NRFA 2XN0A 5ICYB 2ESVD 4R8WL 5F2FA 1G7IB 2OV0A 5FYLH 2K4WA 1KGIA 5F96H 4ZD3H 1HSBB 2J4WL 1AS6A 3GRWA 5DD1L 4FQ2H 4Y1SA 3CFMA 1TPXB 3K1KC 4AQAB 3MRNB 3BVNB 5E0FA 5DHXB 4LRNH 2TRYA 5I6XB 3AMLA 4QRQA 3D0AA 1X4YA 3AXLB 1CFBA 1WG3A 3MGOA 1PG7L 2VDOH 2OMVA 3ELQA 2WXKA 4NRYA 5LNDA 2XU9A 4IK7A 5IMKB 4XXCA 3WLBA 1EO7A 1R34A 3GMOA 1NCOA 1IL1A 5E94B 1YNTF 2G9HB 2WQAA 4NKIL 4RCAA 1E5CA 2VRKA 4H2AA 4F5CA 2AK4E 3BLBA 1D5IH 3FPXA 3IN2A 3LVEA 5B22A 2PR4H 5F71A 1F4XL 2DLFL 3O3AB 1D5MA 1ZHLB 2NTFB 1E65A 1RK0A 1S7WB 4S1QL 4OD1L 3NCYS 1AGBA 4W9DC 3VSTA 2B1AL 1II4E 3HG1A 4A66A 1E27B 2ZP8A 5J11C 5KSAB 1Z0NA 3CG8A 5FYKU 4XN4A 4OFPA 5E08H 2VXQA 5LBSL 2GHZA 2VERN 3BPNC 3FQXA 2XPZA 4FNUA 1FFTB 2XKUA 3INUL 4JM2D 4L3EA 4MZ3A 4NC2B 4QRPA 2BRRH 3I6GA 4FQXA 4LPCA 4KK8C 4R7XA 4MKMA 5B1KA 8FABB 1NOAA 3H55A 5J13B 2HLFC 1OGAD 3I9GL 2IAMB 3QO1A 4KMQA 4UNUA 3NPSC 3VFPA 2B7DT 2RA1A 4WW2B 5I1HL 4P2RA 4ZYKB 3Q6GL 1YUKB 5DO8A 1H0DA 3CSFA 1DVUA 3DXAB 3MLWL 4BZ1L 3SE3A 5MP6H 4AM0Q 5CINL 1PSKL 5HJBA 1KC5L 2EQDA 3OR6A 3PQYA 5LNEA 4JCMA 2FEEL 5C0BE 4M8VA 5FF6A 4GW4B 1J8RA 2OI9C 3D1MC 1JCVA 4G11A 3GUTB 5IGXL 1BEYH 3RVVD 5FECB 2BOBA 5KJ4A 5L8LB 4L4VB 2EO1A 5HYSG 2X0VA 4M1DH 4OZGE 4OLYH 1LLAA 1JGDB 1MQ8A 3CQQA 3P4NA 5ESAB 5FDWB 4G59C 2MNJB 5FA3A 1FLRH 1N6UA 5FOJA 1IJ9A 2TSBA 3QDJA 3AY4A 5HI3C 4BQ9A 5HYFA 4NQCA 4A7GA 3P0YL 1XL6A 2VXVL 4TNWK 1T5XB 2LOEA 3HI6H 2IAMC 4Q9RL 1DBKH 4MHHI 1GKEA 2IDSA 4OKVA 4KXAA 4GRWH 5IB2B 1SDYA 3BEVB 4ES9A 5JOPD 3ULAB 4N90E 4YVUA 1G4MA 5E4EB 4UDUB 5L4JA 3F7VB 4LPWA 4PRHD 2HLFD 4YHZL 4OU3A 4YWGL 3QDAA 5INCB 1G4RA 3E1ZA 4S1RL 5IJKC 1GH7A 2ZJSH 4BE6A 2NR6C 3A4FA 5C0JA 2NQ3A 3VDBA 3RPIA 2J21A 3E80A 4HPOH 4Y9FA 3EG9B 1FG2A 2GTZA 4N2BA 1BF2A 1TU2B 2J71A 3BIKB 1DDTA 5JUEH 4CC0A 5M95B 3VFGL 3QWOA 5C6WH 2AJ3A 3QQ3A 2DWYA 1G94A 5FEBA 1PZCA 1BDYA 1G9NH 3MKGA 1IEBB 4N5ED 3RB7A 1HXKA 1E3XA 32C2A 3EOBA 4HIXL 3GTNA 3UGUA 1NUDA 4UNVA 1X9RA 1U4FA 1ZLUK 6PCYA 1RUML 2ZE0A 4NERA 3S35L 5KSBB 3BAIA 1OAYH 1UM6L 4OFIA 4XMVA 3L3IA 3SGJA 3T8XB 1XD1A 2YKLH 1QLFB 3ARDC 4UB0H 3AY4C 3VH8B 4ZNCD 3CC5A 3D48R 1FV1A 1RK1B 2R83A 3A6CH 3ML8A 4GP8B 5D2NB 4LGSB 2W88A 3X3FH 3IE4A 5JIKA 4YBLB 4WFHE 1A9EA 2R27A 1IFHL 2ICEC 1NC4A 4LSSH 4FXGB 2OJZH 1NBVL 3Q3GB 1KBPA 5I8CA 1B0RA 5I6LA 3F7VA 5FGCB 4NSKA 3Q5TA 3FO0H 5IQMA 5KVEH 2E7LA 3EYUL 3IJHB 2AJXH 2NY1B 1A6WH 2IDTA 2VWEE 5JHAA 1G9NC 1KIUB 4DZ8A 1EAPA 4V1DA 1U8LA 2IALB 5ISZA 5KVDL 3BHBA 3FFCE 1BEYL 2XPGB 5C0FB 2A9MH 1TCRA 3DC0A 4I18C 3ZL4L 2B9AA 1DQTA 2DWDB 3BH9A 3LPOA 3LRKA 2UXFA 4LESA 3L1OL 3NFPA 1QA9A 4LKCB 2BSSB 3QXVA 1EK3A 1MW3A 3Q5OA 5ITFB 1OP5K 4P4KB 3PPSA 2DMHA 4U1IA 3MUUA 5ESAA 3ESVF 2GHWB 2FUTA 5B3JE 4D9RD 3O6FB 1K8IB 1NWOA 4R5TA 1IEHA 2GTQA 3LXCA 4OZHA 3GI8H 5D2NA 3D30A 3TLRA 4Q2ZA 4JFED 3VRLF 3NP3A 5CGBA 5E00B 3IJ8A 3EJPA 4FEMA 2AV7A 3WEXB 1IIKA 2IPTH 4AQZA 3II2A 2FD6L 2CCWA 2VLKB 3HPLB 5C0IB 1YSOA 1JRHI 1CLOL 1PLCA 2XWJA 3KPOB 4JRYA 5DD0H 1AHMA 4ZJ9A 3FTYA 1RU9L 1N59B 4Z18A 4JEGB 4YHKH 2ILLA 1GGCH 2AZAA 1HXYA 5KZCB 1LO2H 1GGTA 4JUTA 2DICA 5EZIL 1DJSA 4KKLD 4GKNA 2AXHA 3N3EA 3V8OA 1J0IA 3HFMH 2WQVA 4GQPH 4BZ2A 3F7PC 5I30L 3O3UN 1VENA 1KYUA 3PHOB 1C08A 3U0PB 3G08A 4YUEL 3TN0A 3LRHA 1CZ8H 1RCYA 1BZDA 1UACL 1MJ8H 3B2UD 2GABA 4OKDA 3GXUB 4O9HH 2OZ4L 5HHMB 1BXXA 2B15A 1N4XH 4UT9L 1J8HE 4PRPE 4LASH 1B9ZA 1Z5YD 4NP4H 1T1XB 2DIAA 1IGFL 1DLHA 3CGTA 2NUTB 2YQ2A 1AGCB 3CSTA 2K7PA 4NO0A 4PV1C 3W11C 1M6UA 4XGZA 3WY2A 2H3XC 1U6AL 2IBZX 2P5ED 4YN3A 5I82A 3UMTA 5LVEA 1ACZA 1NBVH 3NZHH 4RMVA 5INDA 5JOFA 4BH8B 4CC4A 2Z7YA 4X0NA 4X7SL 4A6YL 3K5SA 4UBDC 2WBJA 4N1CA 1I3GL 3UJJL 2OYPA 3IGAB 4K07A 2WAHA 3RWJA 5J1TC 4WSJA 1YQVH 3BWAB 1SNRA 1JRHL 2GJZA 3QCTL 4UIKL 4JFOB 2X2HA 4PRID 2R2CA 4JY5H 1H3PL 1QBLL 1LEGA 5F7LB 5TE6L 3S48A 3VXUB 5AD0B 4LMQI 2ZXDA 1KIPA 3TO4D 1F4HA 3E3QC 3GIZL 4OCLC 4Y2OA 2FQDA 3D08A 4P2OA 4PD4J 2I7SA 3FB8B 3U4EA 2R1WA 4M61B 2XPGA 4G9FD 5I18L 4Q7DA 1OTTC 2AV1B 2DL2A 3CFDB 1KB3A 1I8LC 2GSGB 4XRCB 3VRIA 4PSPA 2G3MA 2F5BL 2WPGA 3MLUL 1M2VA 4K8RL 3NPZB 1JDAA 3TIDB 1S7RB 1XF5A 2F58H 2WIIB 2XN1A 4KHTL 4WFED 3SKMB 4N6RB 2M83A 1XIWB 5ITBL 1SJMA 2Z4QA 3GXPA 3EGSA 1T6VN 1IX2A 2X42A 1ND0B 4FXKA 2I5YH 4PGCA 1AQDA 2EUXA 2HG5B 2K78A 1GC1C 3N91A 1XZ0A 2BVQA 2NDGA 1TMCB 5KG9A 4HCRH 3H42L 5E8PB 3MOQA 4MJID 1N18A 4DQOL 1UZGA 4ZTEA 2JCCE 3BVDB 2XKNA 1N3NB 4KK9C 3QIBB 5CWSB 5FKAB 3R06A 4XCEB 1E9PA 3I50L 1AIFB 2CQVA 3SKOA 2QHLA 2P5PA 2JE8A 1UC6A 4KTDL 5E9DD 4B53A 4P23B 3FMGH 4OFQA 4JFHE 4AITA 1BQLH 3EYVB 3PL6A 4FG0A 3MZTA 5D7KD 5FHAL 4BZYA 4A2FA 2GVYA 3GRWL 3O3EB 1FSKC 2ZOLB 4OR1A 1F4WL 1C5CH 1TT6A 3K80A 5E99L 5CEXA 5DRNB 4M6NH 1LP9B 2PNDA 1S9VA 1TU2A 3KBPA 4YH6A 2FWUA 2EP6A 3PIQB 2WTRB 5CJQL 4K3EL 1G9MH 3S3PA 5ICZB 4KK8D 4WI0B 2CKNA 1RAMA 4GYBA 3V9EA 1YPZA 1H5BB 2JMRA 2EH8L 1L9MA 5GGTH 4ANVA 5BV7L 3T3ME 3S96A 3NG5A 1HU8A 4F15C 5C08E 1A5FL 3CFEB 3HG5A 3WIHH 4EN2A 2DQIL 2FHBA 1ZDSA 3HI1A 1P5UA 3CHPA 3N5AA 4J3OH 1J10A 1QW8A 2LW3A 3RZCB 4LLYB 5KVGL 4O2CA 1OSPH 2X4PA 3CSPA 1E4KC 1IQDA 5D9SB 1ADQL 3QDJD 5E70A 2YPVA 1C16A 1BD2D 5SWZB 4X9FA 4BCZA 2KERA 3VNZA 5BVPH 1WWBX 1RJLA 4MKTA 3O11A 1B6UA 2D7QA 2CJSA 2G3ZA 1AGEB 1MJJB 1A7QH 3WDHA 1MG3C 2OMWA 4JDVB 1EQWA 4ZW6A 3A3YB 1KYFA 1E30A 1MLCB 1MFCH 2ZWZA 3FNKA 3I75B 2QSTA 5CD5D 2Y2TA 4HS6B 2K9FB 2WGXA 1J8KA 3VACA 3H2QA 4IDJH 4RDQF 4CBPA 2QPUA 3BKJL 4TNFA 3NCJH 4R7NB 2FL5A 3PY9A 1BBDH 1CICD 1EHLH 1FNLA 4G42B 4ZOCA 3V0HA 4ZX6A 1T7ZA 1WWWX 2WLJA 3GMRA 3OZKA 4XNQA 3F6LA 4OGYL 4BKSC 4ZSOB 3VFMA 3WHXB 2AK1H 3IDIA 5A6MA 4XVSH 4U6VH 1QSFA 4B3VA 5F9JA 1F4XH 2DLFH 2NR6D 3OMZA 2OMZA 1NDGA 1G1CA 4XBPB 1A3ZA 5BW7A 3ISRA 1NKOA 2PXYC 4Y2DC 3MV7E 2K9UA 4KU1A 3HZMB 4N25A 1E40A 1BIHA 3HUJF 5CJXA 4FC3E 4H8WC 2V3FA 3D4YA 3DVNB 4MGXA 3RWFB 1TYJA 1VFBB 4Y1AB 2A9BA 3MGTB 4IHBA 4QY8B 2A38A 3QISA 1J1XH 4J8RB 4P04A 1A6VL 3B1TA 3OAUL 4HUXB 1MRFH 5IR1B 3QEQA 4FQXB 4DOHB 2B16A 1NM9A 1NLDL 3A6BL 4OZGF 2XIDA 3K7UA 1KY6A 4ACTA 1MFBH 1ASQA 4P9HH 3ISWA 5T8IA 1LDSA 1GVIA 1MW1A 4TSAH 2FB4H 5JQIB 3V7AG 3TA4D 1MFUA 3RKDD 3IJHA 5C07D 3I3DA 3VXUE 1R0AL 3LKQB 4HIHB 4Z9KB 5GGTA 4GRLB 5DYOB 4R7VA 4GUQA 1I7RA 1I8IA 1V54B 3BQVA 5FR3A 3CZLA 3F6IA 2GBTA 2HUEA 1IGML 3WGUB 3GGWA 4APQD 2DEWX 5HDQH 2CM6A 4LLDA 5EOTB 1KJMA 3P0YH 3U2SA 4HJSA 1X9UA 3NJFA 2QV2A 2BHFA 3MLVL 1JV5B 1KCSL 1EERB 2PWGA 2IGLA 4RBPH 4Z7WE 2UXVA 1FNAA 1F41A 1ZV2A 3P3YA 4FTVA 5FC9A 2KLRA 4QRQB 2J5WA 1YYLH 2DKSA 4MQ7B 3ZLQC 3K6OA 4PWFA 1HQRB 5J9PB 4L1HA 1GTNA 3IXAB 3UAFA 4PGBB 2A9AA 3OJVC 4V33A 1NGPL 2X9ZA 2ID5A 2JIXA 5H94B 4NOFA 3PXJA 2WWKT 3WN6A 4A55A 2OSXA 1OHZA 3B3IA 4K23H 4RGNC 5DMYA 2XNAA 3M17A 3PHQA 1CXIA 2CNYA 4KK5C 5KAQF 2DTSA 3CUPB 3CFCH 2YARA 3OLEA 1KDIA 3U7YL 4N2FA 4POZC 5EO9B 1R3IL 3NA4A 2JJTC 4OCMC 3KLHD 1OTSD 1SOXA 1FHGA 2IH8A 7CGTA 2AEQL 4XNZC 3RDTC 1T5WA 2JI2A 3KPNA 3VWJD 1MCJA 4LHJB 4JFEA 4MB1A 4YHNA 2E9JA 3QZWB 4G43B 1T0PB 4P3CH 4X42A 4NS0A 3QIUB 2HN7B 5GISH 1EGJA 4KDTC 3BWUF 3TPKA 2CR3A 1WJ3A 1PCSA 5DMIH 4ZMAT 2ITEA 2ISDA 3X3FL 2NXZC 1U8OA 2BHYA 5IY5B 2AEWA 1QBMH 1P4IH 3L7EA 3QUHA 1CFMA 3TA3C 1F6LL 1NFIB 3CMOL 2NX5E 2YD0A 1IGIH 1IILE 1MCOL 4IIQB 3W9EA 2BS71 3HS8A 4AM0B 3FQRB 4BM7A 4CRPA 4JFSA 4Z7VB 3PWLA 5EC2B 2MCG1 3QR0A 4XVJL 2RMNA 1MAKA 2FECL 1IAII 3FL7A 1TCRB 4MJIE 3ZSTA 3ES6A 1Z1WA 3GSNB 3OKEA 1QRNA 1T1YB 1GJWA 4OJEH 3QQNA 5C07B 4ZFGH 2R8SH 3PDOB 2J55A 1PLAA 5AKVA 2CLZB 3SO5A 3M1OA 1A4CA 3UYRL 4ZX3A 3OR7A 1A1NA 4S11A 5JUEL 3QDMB 1JNJA 1KXQE 3TYFA 3VXMD 5EPMA 5HDQL 4EN3C 3ABKB 3TFBA 2PYEB 2Y72A 2VR4A 4Y16C 3UO1H 5ESVB 3GI9L 1JYNA 1X5KA 2IMNA 2QFRA 3O0RL 5FO8B 5I8EB 1G7JB 2G2PA 2GSGA 1FI8C 3T0EB 4MB5A 3UTQB 4LVNC 3VD0A 2QDWA 2QV4A 4O2EA 3WXVH 1MY5A 3BFWA 2NY3B 1YJDC 4BGLA 5FYLE 3GFUA 2HKFL 1OTTD 5CCJA 1A3LH 2EE3A 3O6FA 2EVJA 2ZNWA 4H20L 5DJZA 2EO9A 4PP1C 4BJLA 2V17L 2XV0A 1LO4H 3L13A 3QPQD 3RHWK 4ZZFA 1KN4L 1ONQB 3NZSA 3CXDH 4UM8B 5K93A 1PBYA 2WGNB 3T8MA 3U0WL 1UWGL 2BNUA 2BVTA 3GK8L 1DJXA 2OXGA 3PGCB 4ERSL 4HXBH 3M1BB 4FJYA 4FJ6A 1EX0A 2HFEA 4OW6A 2CUIA 4RVBA 4CW1A 1W80A 1JNLL 1HL8A 3SCMA 1V27A 2NW2A 2HLEB 2ITDB 1EZUA 4E0RA 4L3CA 1CO1A 3TX4A 3K2UH 4KX8A 2GI0A 1J5HA 2WNXA 4U1MB 1ICTA 5CGYD 4ZO7A 3D0VB 2VC2H 2IAAC 3WNNA 5A3ID 1S78D 3E2HB 4HIJB 1BD2A 3ASWA 2CSPA 1IGTB 3CXHK 3BP7B 5D1QC 3FFDA 3D85B 3EOYG 2ZAIA 2IG2L 2R1XB 4YAQA 2C9QA 1T2XA 5HGAB 2RJMA 5L4IA 4I8DA 3WMQA 2WNKA 2FEDC 1OCWH 4WNQB 2IBGA 4QF1A 2NY1C 1WWCA 1ZLSL 4N6QA 1D2OA 4HKZA 4NHUB 3WU1A 1UGKA 4JN1H 3ABMB 2EDRA 3OXSB 2ZF8A 3O0LA 4PJCA 4LGPB 3ZMRA 1FO0B 4FQCL 4K3DH 4JFDB 4NJAH 4J5VA 5D7IA 3VB8A 5I6KA 4I9XA 1EDQA 5F93C 3MCG1 2XFXB 3GXFA 4HS8H 2BM3A 1XGYL 2O5ZH 5E9DE 2CDGB 4AEIH 3TYFB 3V0WL 3D7PA 2Z31B 4ONFL 1VLXA 4IHOA 5IHLB 1AHKA 2P9RA 3BUDA 4MTMA 1CYXA 1XF5B 3NJIA 3CPLA 3EBIA 1AGBB 4N28A 5AOZA 4LSUH 4PLNC 1A6UL 1CE6B 3V5HB 4KTEH 3JWNC 4ZUVB 3NCMA 1I1AD 5J8OA 1LGVA 3EOBB 1WWAX 4GMTH 4Z78A 4F93B 2AXJA 4CC1A 1IZKA 4QHNB 3IWVA 3SQBB 2GFBA 1EBAA 4PEEA 3TEXA 3RBGA 2NY6C 3ZKXB 2HFFB 5AZEH 5DZOA 1GSMA 2VO8A 4YQXH 3ULVF 2O61A 1PD6A 3GMRB 1HHHB 5I6NA 4AKOA 1G84A 2WWOA 3RHWF 4OUUB 4QRTA 2VDPH 3FQTB 4HGKC 1CT8A 4EIUA 4HWZA 1DBJH 1MFVA 4M7JH 1PPIA 3QT2A 1KXTA 4FG6C 4PV8B 1C8PA 5CZKA 3DV4B 1F2QA 35C8L 2UVEA 2A1WH 1FZKB 4IIQC 4Z5RA 3MI6A 3TO4B 4HCRA 3L9BA 5C0AD 3PGDA 4RIRB 1NJ9A 4PS7A 4EI5C 3PPEA 2F54B 3MNZA 4WAFA 5DDHB 5EULV 3BN3B 2Z92B 4PJEE 4XODA 3MJGX 4AQEB 1YMMD 5DMJB 4ODSH 4TLTA 2WZ0A 1RP9A 3FU3A 5KVGE 3APFA 3KXFA 4N0FB 5JNYB 2CK0H 4EEEA 1SN2A 3PJSA 1KEGL 5JA8B 1I7UA 4Y4KD 3L5IA 3D39E 5KSUA 2FO8A 1G6VK 1IAKB 3GWJA 4PJAF 3PHAA 1JHLL 2LFGA 4PRNB 1KFAL 4YX2L 2DQDH 1VHPA 3QE5A 2C4FT 2H0PA 2GYSA 1XCTA 4LSTH 2Y6TE 1W72B 4HIEA 1HQ4A 1NBZB 3T0EC 5HYIA 1T21B 1X9LA 2QKSA 2XG5B 3RPKA 4L4TA 4MA3B 1BMGA 4BEIA 2Q6WB 3D69A 4IRZA 5DZPA 1F2XK 1T1YA 5AW8B 2PTTA 3U2SB 1DEDA 2EDOA 1YMHB 3H9HB 4RQQB 4PJFF 1OSZB 4JKNA 3VW3H 2AQRA 2VT0A 3IE9A 3GSVA 4FHJA 1CD1B 1NM4A 4XVSL 1NMBL 2FAUA 4F8QA 3JWOL 4N2CA 3BH4A 4FNLH 3P9MA 1A65A 1B0GB 2EH8H 5GGTL 4MXQD 4B9IA 1GL4B 4YSSA 2EE9A 2WINB 4FCAA 3UZQA 1RUPH 5T1LD 4LNRB 4LCYB 1SJXA 3HLAB 1GR7A 3PG2A 3HHSA 2YQGA 5AZEL 3WIIL 4G1EB 4JPVH 3QHZL 1AQHA 4RDBA 1A4KB 2VXVH 1BBJA 3QNXA 5T1DH 4AE0A 3SHSA 4NKOA 4JFDD 3PYCA 4HWEL 2YZ1A 3L7EB 4F57H 1A7QL 4LDLB 2LU3A 3TJEL 3SQRA 2F53B 5AVZB 1MFBL 1OCZB 4M62H 3KWUA 5CBEB 2HVKA 4OGXL 1UA7A 1J05A 4TSAL 1F1DA 1J0KA 1BVKB 1IC1A 4NWUL 4WENB 2WXIA 4X8XA 4Y5XC 3UAAA 5JHLA 4MAYC 3NVQA 4GAGH 3TA3D 4UQBA 4JFYB 2CA4A 1BREA 4C4UA 3HC0B 2UWEF 1KCUH 3ZDYE 4F7TB 1LE5B 1N8ZB 2WC7A 1TLKA 1OPGL 4FZ8H 1OSZA 5B39B 1A66A 3CDZA 4GINA 3G6JA 4ZK8A 4MS8C 3HG2A 1KGYE 2FBJL 4D0CA 2NSQA 3AFLA 4GIAA 2RHEA 2A73B 3EOTL 5FHBL 3M7FB 5T1MB 3WN5A 1QLRA 2EIZA 3EO9L 1BP3B 1E4XI 3CNKA 3HCVA 4HOMA 1BFSA 1QTSA 5G2NA 3HHMA 1GJUA 1AMXA 3QG7L 5MEOA 1SHMA 4XXWA 1F3JB 4Y9BA 4MD0B 3WUWA 4OLEA 1I7ZB 3PAUA 4NN7B 1E28B 1ET7A 2IANB 4PJAA 3QWOB 1UE