3QORB

Crystal structure of human nuclear migration protein nudc
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
119
structure length
118
Chain Sequence
SSSKLKPNLGNGADLPNYRWTQTLSELDLAVPFVNFRLKGKDMVVDIQRRHLRVGLKGQPAIIDGELYNEVKVEESSWLIADGAVVTVHLEKINKMEWWSRLVSSDPEINTKKINPEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Nuclear migration protein nudC
publication title Structural Features and Chaperone Activity of the NudC Protein Family.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding, cell cycle
total genus 28
structure length 118
sequence length 119
ec nomenclature
pdb deposition date 2011-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04969 CS CS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3qorB00
4YE0A 4ZJ9A 2CR0A 4PBDA 1WGVA 3VQLA 4YLCA 3EUDA 1EJFA 2N0KA 2CG9X 1RL1A 3AABA 4RZKA 3W1ZA 2WJ7A 2K8QA 1SHSA 4JUSA 2Y1ZA 2KLRA 4M5SA 2Y22A 5DS1A 2O30A 3QORD 4PCKA 2WJ5A 1X5MA 4YDZA 2KMWA 3L1GA 3Q9PA 3GLAA 2JKIS 1WFIA 3J07A 3L1EA 2MNWA 4FEIA 4M5TA 2BOLA 3N3EA 4I88A 2N3JA 3QORB 5LUMA 3L1FA 2XCMC 4ELDA 3QORC 1WH0A 4MJHA 5DS2A 3VQMA 1GMEA 4JUTA 4YL9A 4YLBA 3AACA 3Q9QA 2RH0A 2Y1YA 3IGFA 3GT6A 3GUFA 3QORA
chains in the Genus database with same CATH superfamily
3V9EA 4L1SA 3WMPA 4G6KL 1GYVA 4M48L 5L88L 3PL6C 3GMNB 1MNUH 4N5ED 3STBA 1U21A 5A7BA 1XFPA 4TNWK 1R46A 5I73C 4UZUA 1ZTMA 3QAZB 4R7DB 4HFUH 3B7UX 2WPGA 3R8QA 2HH0L 3RZCC 3TT3H 5HYJE 5L2JB 3R06B 1EQWA 4NPYB 4N6RB 4NO2A 4UQAA 2Z7UA 3VFWA 5I5JA 2BY3A 4YNYA 1L9MA 2C3VA 1ASQA 1NL0L 3EYQD 4FHBD 4M6NL 3ATBA 1YEGH 5KYXA 3LX9A 4Y4HD 4FLOA 4XMPL 2FT7A 3MRIB 4MJIE 3QXAB 1RZFH 5D1ZA 4BFBD 2XV2A 1BIIB 2G60H 3CN2A 1YPZA 3A4AA 1DVZA 4AW7A 1KXQA 5IBTL 2ZUWA 1CFSA 1XF4B 3F6LA 2O6DA 4XMWA 4ZX4A 2WTRB 3SPVB 1I53A 2H1PH 4WW1A 3O8XB 4QRTB 3DRQA 1EAOA 4WFEE 3K71A 2LLNA 3GSXB 5FLUA 3MFFA 2ICES 1FZMA 3KCWA 4CC1A 2TSAA 3QEGH 4B9FA 2GK0A 4X4YA 4L2YA 2AEIT 2DLHA 3TCTA 1PG7H 2CCWA 1MREH 3QCVH 4PJ8B 4KJQC 2EH8L 3KEDA 3QAQA 4YDJB 4YDMA 1IILE 1PVHA 1TPXC 2JJWA 3TZVA 1EERB 4HJUA 4YOKA 3ZKSD 1IE5A 3UTPD 3WFEL 4H88L 3C12A 4MMYB 1AZVA 3FUHA 5HBBA 2VDKH 4LCVA 2N4IA 5E2TH 2VC2H 3C5ZA 3UTTA 5C0RL 1C12A 4KI1A 1F90H 4F8PA 4PREB 2K45A 2PWDA 3P4MB 1HCFX 3GSWA 1GTNA 3NIGB 4D0CB 5CJQH 1ZHBB 1OP4A 3S4SB 3AWFA 1KB3A 3RGHA 3BH9B 3AQDA 1WEJL 4EKJA 3HI5L 1MJ8L 2HVKA 1S9WB 4G5ZH 1XGZA 4GSQA 3SPIA 3NIFE 4NQDE 1FCCA 4LHUD 3WIHL 2UXFA 2LVEA 3C2SA 1U3HA 3BAIA 4FI7A 2OSLA 4WNQA 2WOYA 2C4FU 1MCIA 5CMAB 4MDRA 2E9GA 3HFML 4XPBH 3RB7A 1JPTL 2HG5B 1FLRL 1QR4A 1F3DJ 3R18A 4HUNB 3BESR 4JB9L 3LNGA 3NJMA 5KW9H 1UQSB 4GKSB 3T4YA 5F1SA 2GSIB 2R27A 4J6IA 4QXUL 3FN0H 2H4EA 5GGRY 4Z7NF 1C1EL 2WP3T 3KL0A 2UVFA 4D2NA 5BMFL 4MQSB 4EXKA 1KTRL 1FVCB 3IMRA 4MD5B 3HUJF 1AHKA 1QHOA 4MNGB 4TSCH 3P73B 4H4NA 3ZE2B 1E2VA 1NCDL 1KN2L 3QUZB 5AQ0A 4R2GD 2IAMB 4XNUL 5IW1B 1ML0A 2KDYA 5GRYA 2CO6A 4CKVX 1Q0XH 2BY1A 3GI9L 3SQOH 5D5MB 3TFKC 4DT2A 4XH2B 5AAPA 5GZOA 4KVCL 1T5WA 2EXWD 1WZMA 2IGLA 5H37A 2WZPA 1U30A 3FBQA 1BM7A 4RLDA 4NKDB 4XBEL 3O45A 1A14L 3QPXL 4FQXB 1USQA 2AEOA 4NWUL 1V27A 2F9BT 5LUMA 1U2YA 2XQBH 2CD0A 5B22A 1ZAGA 5D7KE 4DGWC 3M1BA 2ZZUT 4N2EA 3GD1C 4PJXB 3MBXH 4Z7OE 5KSAA 3BSZA 1R3KB 2Q86A 1CGUA 5D7IA 1TSHA 1IAMA 4AVKA 3KPPA 1FFPB 4UNUA 3SE3A 3OJMB 1JRHH 3FU9A 3VWJB 5E23A 5KJ4A 2X4QB 3LHPH 1W2KT 3BN9D 3Q6GL 4QOKD 1VFBA 3SZ6A 4BXSV 4MMZA 1FO0B 2GSGA 4FJ6A 4NNYA 1BG9A 4WKZB 1WS8A 1Z5HA 4K7PL 4AYSA 4WFFD 5DD5H 3VFGH 3IAGC 2C3WA 4Y5YC 5D7LE 3U36A 3X3GH 1LO3H 1UJ3B 4WAFA 4BH7A 2L7UA 3IJ8A 1IL1B 5KS9A 5KZCB 1OAXH 2CCVA 4J5VA 4X5XA 2VDMB 1C7TA 3F5WB 4OGXH 1I8IB 2CMRH 3RL1B 2YXWA 4PRHE 1XB8A 2Q0ZX 4ZX5A 2XBDA 3FS9A 4Z1PA 4X6CE 3NPSC 2O26U 4JFQB 2DMCA 4DPRA 2XZQH 4OF3A 3DV6A 2YAQA 4ZMWA 4XX5A 2F08A 1VEOA 2GJPA 2OL3A 5ESQB 4P5SA 4OLUL 1Y1DA 2FTAA 3ILPA 4GFXA 4YSSA 4GG6E 4E0RA 1C5DB 1VKXA 4M9PA 3EBIA 1E40A 4GAJL 5JHMA 3CZSA 2F7IA 3ZIYA 4YMPA 3EH1A 1AGFA 2XN9A 3MV7D 3O4LE 4WWPA 1JXDA 4X7EC 1GXEA 5EIIG 5D70H 1OF2A 2CO7A 3QSKB 4XBPA 5L8KB 3RTQA 1AIFA 4JS7A 4NP4H 4PRIE 4X4XA 1JMZA 2K3HA 3CN3A 4KDTA 1JWUA 3UBGA 2BMKB 1U8PA 5ECJE 4KK6D 3IDUA 2Z0BA 5TK4A 4JVUA 1H0DA 4RFOL 4BH8A 1FPTL 1RUMH 1FC1A 3ZBMA 1CJYA 1ZT4A 1SDYA 2YMXL 1FGNL 2PABA 3GPSA 1RSYA 2OR9H 2XZAH 3RTLA 4X98A 1G7PB 5JHDA 3OB8A 1EIBA 3RQ3A 1WAAE 3QG7L 4RBPH 3PWNB 4QHKI 5AOIA 2YOCA 4DGVL 1WCBB 3MRKB 2PPEA 3WEBA 3ZDZB 3ARRA 4XXDA 3HHSB 3PGDA 2Z3FA 4EBQL 4KZDL 2FX8L 5GSVB 2KUTA 3D69A 2YPVH 5L2KB 1X5LA 4LLAA 5JDSA 3D85A 4BZ1H 3I9PA 4GMSL 4U7KA 4F37K 5MERB 4MCZA 2R69A 9CGTA 3HN5A 1NMAL 1TCRB 4NOBA 5C08D 4JRYD 2CIKA 3N3EA 5EMYA 1I7TA 5F3FA 1M71B 2MPAH 4U4IA 4M43H 3WGVB 4MASA 1F00I 5EN3A 4KMQA 1JV5B 1UVQB 3KYKL 5KANG 2EXYD 4GUOA 2NSQA 3ARSA 5HHME 5BXFB 1NFDB 4M1DH 2V5TA 5HXMA 1UCBH 3CFDB 3QI9A 5FB8B 2OW7A 4KKBC 2R56L 3C5SA 3PWLB 1YMME 4NLHA 4OZ4B 4NRXA 1BD2E 3SODB 2ALAA 1KCUH 1T04B 1DDHA 3IJEA 4P9HC 5DS8A 2UY7A 3E9UA 3E3QC 1ONQB 2K1MA 2ZSWA 2JKNA 4PBWD 4CVXA 4F7EA 1CT8B 1L7IL 3RNQA 5MEQB 5EF3A 4WW2A 3ZKMD 2ZXWB 3TCLB 4AC4A 5LHDA 1LM8V 3ERXA 3D48R 4L4TE 5ENWA 3C6LD 4LMQI 1CICD 5C0GB 2BZ7A 2YSSB 1JTPA 2VJXA 3NSYA 1NDGB 5D4JA 4NZFA 3UBHA 2QMJA 3LNEA 3KPRB 3CLFH 4WLCA 4F2MB 1V55B 1BZ9B 4GYBA 3O3DB 1KV3A 3VAEA 4HSQA 3EDKA 4IIQB 4FJYA 1OSEA 1F4HA 1KIRB 1UM6H 3ASOB 2EDWA 1FNSH 4G8GD 2YD9A 4H25A 3K4DA 4YGVA 2WXMA 4MNQD 1A6ZA 2PYEE 5DUPL 2KS0A 3BZFA 3ULVF 2M2DA 3RPIB 3T2PA 1QLRB 4HIHA 4MA8H 4EZLA 3N85H 1NAML 4KHXL 4EI5A 3MNZB 5D2NE 4M5ZL 4PJHB 1ANUA 2BHFA 2HX7A 4Q6KA 3HLAB 1JNNH 2APXA 4J8QA 4JO4H 5GGVY 1WITA 3UABA 3V0AC 3WN5C 2LT9A 4MD4A 4P2QE 3Q6FB 2ZF9A 2AK4B 2XZCL 3KG5A 5C6TH 1MQ8A 2RD0A 4K5NA 4I1RA 4CDHA 5JMOC 5IVZB 3WNPA 5FHBL 2W0FB 2FX7L 4Z7VA 2J56A 4LPYA 5FA3A 3HZVB 3E6FA 4ZX3A 4CBZA 4OFQA 5LDSA 3LEVL 5CIPH 4RBPK 3MLYH 1A6UL 3QISA 4DGYL 1T1ZB 2HCZX 4A37A 1FGVH 5HGBA 1HXYA 4B6ZA 2G9KA 2ZJSL 3N44B 1LEGA 1XF5A 2DQJL 2ZONA 2MNJB 5F0JB 3SE9H 4L18A 1ETJA 5EU4B 4ZUWB 4U1JA 1BXUA 2Q9OA 4PG9B 4OKVB 4NQVB 4OUOA 4TSBL 4LCYB 1EO7A 2YC1A 4LL9A 4A7TA 3MUY1 1WSST 4M4PA 2J3SA 2VLME 3P30H 4ZFQA 5I71C 1AGCA 1HHKB 4WV1B 5I24A 1MAML 1KG0B 5I0WA 4MQ7B 3UEQA 5EDXA 4FQCL 1BV8A 4LHUG 4OSUL 3NP4A 3SBQA 1FAIL 3DOIA 4Z3TA 2Q8AL 1JZ4A 1P4LB 4KKLD 4BXVA 1ZGLB 1RFDH 1NOAA 2IBBA 3B9KD 3ZX1A 3QJFA 3IAQA 2VISB 1F3RB 4EN3C 2JQAA 4TNVK 4IOIB 4FGMA 4UV7H 3VFNB 4ETYA 3IFLL 4G7SB 1WD9A 1NGYB 2KHAA 5L6YH 5EN2B 4UUJB 5FR3A 4WEEA 2Y2TA 2BNQA 3ZU8A 4ACTA 4Z8FH 3VSQA 3TF7C 3MA9L 5KVEL 4G7RB 4G11A 3IDNA 4BQ8A 1IJNA 2ZTBA 1TZHA 3AFLA 3VB9A 3DSFH 4ZW3A 1KEGL 2YPLA 5E4EB 3D3VE 3RPKA 5L4MA 1QTPA 1HJBC 5DJAB 2VOTA 3UP1A 5ICXB 4WU7B 3FUJA 1XBRA 1JFQL 2YQ3A 5DD0H 4UM9A 4U1LA 3ZDXF 2CPCA 3VXSA 2D03L 3CSPA 4WDIB 1P4IL 5DI8A 1B2WH 4QTIL 1B2YA 5ETUB 3W39A 2NCMA 1AXSB 3P4NB 4GW4A 2XIDA 3E1F1 1BJ1J 2FIRT 4NNPL 4UDUB 1XF2B 1NQBA 3FU8A 4FFTA 3KPNB 3EGDB 1HL5A 4HISA 1N7MH 4M62L 2EYTA 3HE6C 1EA9C 3HN3A 3B1TA 5CN3A 2YAFA 4IM8A 1OTSD 4X8GA 3MKGA 5CZXC 2J6EH 3HC4H 4X6DF 5E6UB 1X7TA 3ARFA 4FG6D 5KSVB 5BZDA 1SYSA 5EO0B 1QZNA 2VKWA 4L29B 4XCNB 4L3EE 2H2PD 2BC4B 5F97E 4A39A 1MIMH 5FW7A 2IWEA 3C6SA 1XSIA 4NZDA 4WWID 1O9ZA 5I75B 1P0SE 4XOCA 1WTGT 3TH2T 2BOCA 1ZVSB 5JPMA 2OZ4A 1ORQB 4P2RB 5JIQA 3H2QA 3NQKA 4R4FL 1HOCA 4Z3EA 2R8SH 3WFZA 3I6LD 2G2NA 1T7ZA 1JZ5A 2DLTA 1BHGA 2Z92B 1CC3A 4UOJA 2A74C 3V4PA 3A21A 4ZS6D 3CVDA 5JXEC 5TDPA 3LH8A 4PFEA 2E8YA 1Z32X 2YZ1A 5JHLH 3EJSA 4U6VH 4WRLA 1P7QA 1K5NA 2NY1B 4WJKB 1X9QA 4RZKA 3B9VA 4OAWB 3N41B 3IDMB 5F88B 5DJ8B 5TE7L 2MCG1 4IDJH 2O4EA 1S7VA 3VH8G 3O6KH 5AVTB 4UINL 1GGIL 1IC5L 1IQDB 3SGDH 3ZHKA 4F7CA 1BVLB 4XXCA 5EZPA 1XR8A 3ILQC 1T1WB 2WNGA 4R5XA 4A6YL 2YRBA 3SYAA 5BW7A 4Z95H 2RGSA 2Y72A 4L2LA 2DWEA 1QRNB 2DQIH 4ANVA 1QSEE 2FBJH 4EI0A 3L4CA 4LVHB 4WU5B 2ICWA 1KTLB 4G71B 3D4CA 1FG2B 4LLUB 1MRCL 4YR6A 3VX0A 2VSCA 3BAEL 3C2AL 3GTNA 3QXDA 4FKKA 3VI4A 4N8UA 5HHXL 3C75A 3T4AC 1OAZL 5EU6D 1JPSL 3X1GA 4TUUA 3L2NA 4P46A 2HJLA 3H8NA 3ZT5A 2QSQA 3QNXB 3TPKA 1OY3B 1KEMH 3V55A 5I6NA 1EDHA 4LDOB 1BFOB 4FI8A 5T33H 3LH2H 5B1JC 2KT6A 3ZYZA 1MXGA 1W0VA 1ZWIA 1IEBA 2AQSA 2OTPA 5FM5O 5FX3A 5IHZB 2MPVA 4JRXE 2W81C 1KCSH 1JS4A 3GMQB 4Y7OC 1IM9D 3EYOA 2PWHA 5A16B 4ZO8A 2JJSA 3VYNA 3T0ED 2CGRL 2A9BA 6TAAA 3PY9A 2DMGA 4CJ0A 1GYWA 2AP2A 2J25A 2VO5A 4YFDB 2WJ5A 3UC0L 2D73A 1JUFB 3O9WA 4GAAA 2V2XA 2IWGA 3DKHA 2JCWA 5DJ2B 2ENQA 1WG3A 3D4ZA 2XTJD 2FIKA 3OSVA 4F20A 4XXWC 1JGLH 2EEXA 3QQ4B 1KLGA 4PY7B 1FJ1B 1Y07A 2DOCA 3M6DA 5HHOE 4LKCA 1BAFH 5JNYB 4PR5B 2YGVA 4ODHH 4BK8A 3X11A 4BJLA 1OB1B 1RHHB 2EZ0D 1JZGA 5G5DA 1WISA 3KL3A 3OGCA 3G08B 4KK8D 3ZOAA 2XKSA 1ORSA 4ZI8A 3BP6B 4E36A 4H1LG 1ND0B 3RHWF 1MCPH 1T0NA 2YK1H 5BO1L 4K7FA 3SKUD 2VIRA 1E9QA 3D07A 1CBVH 5EEUA 3F7LA 2ZE0A 4JFHD 1I3RB 3GO1L 3H3BC 4D0DB 2V7NA 4GLRI 2OMXB 2E9BA 2XVBA 4KJWC 3AU0A 1GJWA 4BFIA 1NCCH 2YQ2A 3O2DH 1MY7A 3B5GA 3WLWD 4LPTA 3W82A 1UJTA 5AB1A 3N06B 4PGEA 4TTGA 5CGMA 4KRLB 1SLUA 5MEPA 2Z8WC 2B1AH 1T2XA 3SDXA 1DP0A 4DW2L 4ZUUB 1UXSB 1JNLL 2GFBA 2EQDA 4OFYD 1KGCD 1CO1A 4N1CA 3OM3B 5JIKA 1UKTA 3Q9PA 3AUVA 2VLKB 3G6JB 1JG9A 2KKQA 1FNHA 2ILLA 4L8BA 4UNVA 2Z8RA 3UGEA 3NCCB 2IMMA 3G04B 1NANI 1ZPLA 1PZBA 3BO8A 3ZR5A 5KG9A 4PJEA 3CFJB 1PZAA 4WF7A 5C0AB 4WSGA 4KRNA 2EDBA 2DJMA 4TLUA 3S36L 2N7BA 4NO0B 4OQTL 5T5NG 2AZAA 3ARWA 3JTTA 2VDQB 4HG4K 3ES6B 5DR5L 1G7JA 4ZFOB 4X4KA 5F1NB 2PO6C 2NTFA 5B3JE 3VXRB 5BS0D 3EFDL 3LV3B 1PYWA 2A6JB 4AQZA 1A66A 3WIHA 2WYZA 5I1LB 3WXVH 1CFQA 1KFAL 3PCYA 4KJPD 5LGJA 3JWOC 2WKLA 4L9LC 1K4DA 1A25A 3HE7A 2EE0A 4XO5A 1A3QA 2ZUQB 3VI3F 4GXUN 2X4OB 4ATWA 1BZOA 2C9VA 4LSUH 4JG9A 4JKPH 5HY9B 4QXTA 4IDLA 3CFBA 4Q6IA 4Z7QE 2QGDA 2KMWA 3AXIA 3OJVC 3EOTH 2EVFA 4XOAA 5BV7B 2WWMC 2EDKA 1WAEA 5DC2A 1J8RA 2BIIA 3P0VH 3V6ZA 3H85A 3HUJB 2DN7A 3FB7B 1ZVHA 4YLBA 3NUKA 2RH0A 4HH9B 5J9PB 1DL7L 3MYZA 3QUYB 3RGVB 5JW4N 4OB5H 2PTVA 2XA8L 1J5CA 4BWTA 4HGMA 3REWB 2IOOA 2P5EA 5FO9B 2EDQA 2FO4B 3MBWA 3IWUA 1I8LA 3I3EA 4RA3A 5HPMA 1XZ0B 2CKBH 5D1XC 4RZCA 2Z31C 4W4NA 4YBLB 15C8L 1HKLL 1HXMB 1ICTA 2QVFB 1B9ZA 1GAFL 5AOZA 3OSKA 4UT9L 2AXFB 3PGFH 4QYAA 2IDSA 4LCWE 1G7MA 5EPMB 3RIAF 3VXMD 4ZFGH 3ABGA 3LKRA 2ZXGA 4YEEA 5F1IB 3LKQB 1CFTB 2V3FA 2WXHA 4O2FA 1RQ5A 4QHUB 3LIZL 5EOCJ 5CJ5A 4AG4H 4NJAH 5MENB 4KQ0A 1IGJA 3HNVH 3PP4L 2CH8A 4NS0A 5IG7A 4EQ2A 2XETA 1S9VA 1M7DB 2Z4QA 3B2PA 5I15L 5F7EL 1R3LB 3L3IA 4JJOA 3U6XS 2IPKA 1KNOA 3MNDA 1SNRA 2Q10A 4YIQA 4XCYB 2HX9A 1Z9LA 4IMLA 4NQDD 1JZ2A 4KTDL 2C1PB 4LB8A 2JTDA 4NUMA 2YMTA 3CC5B 4PJBE 1S4IA 3O11A 2EVHA 3DWTA 3OTTA 2BY2A 1EAQA 4I89A 4LCIL 4MCNA 4GQZA 2N0MA 2J4WL 1YYML 3DA0A 2WQ8A 3PAYA 1JXGA 1ACCA 1B88A 5D7IF 3UERA 1DYZA 1TZGL 2OM5A 3C60C 2BSED 1JFHA 5IBUB 5JA9A 1E43A 1RIUH 4YDLB 3B9DA 4LL1A 2VXTL 4JBSA 4UMSA 5EFIA 2NPLX 3K72A 2FQFA 3KLDA 3MPCA 2WYTA 4JN2A 2X40A 5C0EB 5JORB 2Y1YA 4HWEH 2N7SA 5LGHL 1AMYA 5KBKA 2V2TA 2BJML 3TV8A 4HZAA 4IBUA 4NUGH 2LAGB 3Q1EA 3K5RA 1JZDC 4PS7A 1EVUA 4WI0B 5AW3B 3SDDD 2X44D 3VFUA 2CJTA 5ILTL 1CG9B 2ZKMX 4JFUA 4NN7C 1HZHL 2OA9A 1RLWA 3APFA 2WZ0A 1RPUA 1DSFH 2VABB 3K8KA 1CD0A 1UH2A 4OLYH 4NKIH 2ZUYA 3LD8B 4M8VA 4KDWA 3NGBC 1NLBH 3OHXB 4FZEH 5EBGA 4RAVB 4AEIL 5IWLA 5DVOA 5DJ0B 5LXVA 4WUUE 3L8QA 3EIFA 3AG3B 2BVOA 3WJMB 2Z93A 4UAOB 2AXJA 3BW9B 5FFOA 4HKBB 4E5XB 5SWSE 2Q6WA 4MMXC 5A2AA 2GI0A 2ZYHA 1XL4A 2A0LD 4QRSA 2VSKB 4Y4KB 1CFVH 5D7KD 2X4SB 4P3DA 1MLCB 5GRJH 4YX2L 2XTSA 5GRXG 5CSZB 4N8PA 5DU7A 3BIKB 4HUMB 4RX4D 5FKPA 4FXGC 4FEIA 5HHNA 1IEHA 2VDNB 4IW4C 1Y0LA 4PEEA 4QWWD 1FBIL 1QSFE 1SBBA 3N40P 4GUPB 4N2AA 1F4XH 4Y16A 2DIAA 1GS6X 3S0PA 4MCYB 3QDMA 2JK5A 4LDCA 1HINL 2QQLL 1NCUA 3GS0A 2ESVE 3HVNA 4KMTH 4LARH 5KJRH 1HHJA 5E8PA 2ZOLB 2GKIA 4POZC 2JELH 3LQAL 3SE6A 2GJ6A 5EU5B 3CDYA 3IU4L 4AENA 6CGTA 5D7LD 4FQ1L 1Q0EA 4K3GA 2I69A 3OHMB 2Z1KA 2FRGP 4F9LA 3UBXG 3GSUB 4BSWB 1G7HB 3GDCA 1GPOH 2XWCA 1X5XA 3T6QC 4XNMA 4NZJA 1WGOA 4PRHD 3BUQA 2DYPD 3OJ2C 5F9OL 1PMYA 4Y88A 5DMIH 2NY3D 4QCIA 3JVGA 3RU8H 3P9WB 4R4BA 3WEOA 3MCKA 2DS4A 1JRHI 2EXTA 1MEXH 2VR4A 5KYNA 1IV8A 2PWFA 4M5SA 4FTDA 4M6OL 3F7PC 4PI2A 4E41B 3PGCA 3KXFB 2XFGB 1HNGA 2P1YA 3QT2A 1PFOA 4Y4HA 3POCA 3I84A 4LLVA 1KXVC 1IBBA 3GIVB 1AS6A 1B0GB 2ED7A 1J0HA 1RMFH 2VZOA 4ELKA 3BE1H 5HHVL 2BNRE 4R9HA 4EZMA 1I1CA 2MWCA 4C83B 2Z0UA 4A2HA 1KIPB 1J11A 2C9XA 5BRPA 4OF0A 4PRID 3ULSA 3L4XA 2OK0L 1INQB 2XXFA 3RWHB 1N64H 1B6UA 5DYOA 4XI5C 5I1IL 3SY0A 2G9HA 1KPRB 2DM2A 3PV6A 1DE4B 4C56E 4NJ9L 2P8PA 3L3JA 4GO6B 4PRNB 5E51A 4WNJA 1CK0H 3WDHA 3ZMRA 4E42B 4Y1AE 1WIPA 4M7KL 1L5GA 4I48A 1I9IH 4OJEH 2ZUXA 2G0KA 1NCAL 1KLFB 2PPDA 4HPOH 3J8F7 4NEHB 1AO7E 4I77L 1HSAA 1CFNA 3KE0A 4PIBA 1IGTA 3JYCA 1I7UA 3BEWB 3H2WA 4MXWH 1KXHA 5E5MA 1BJ8A 2G5BB 1G7IB 2UV3A 4IGBC 4QY8A 1GW6A 3Q3GA 1ZSDB 4UOW0 3FH8A 4B3EA 2P8MB 4CW1B 1C5CL 1J1XL 1OAQL 2L7EA 5IB4A 1CIDA 2YJQA 5JPNA 3JZYA 3P11H 3VG9B 43CAB 2G0LA 3CK0L 5C6PB 3HBZA 2Y7OA 5HHMD 1PDKB 2ARWA 5BQ7A 1D5XB 4JFPB 2YUXA 1FC2D 4TF4A 1M3JA 3CX5K 4HUVA 3AACA 5FM5M 1YMMD 3KWWB 5KVGH 3BJ91 2VXVH 1D2PA 3IKCB 4LHUA 4MFHA 1W0WB 1CLOH 3JUZA 4GXVH 1JZ8A 3ULUH 4Z7VF 2R2BB 2B5IC 1AQDA 3BGFC 2V37A 4J1UA 2X2JA 3LDBC 5CCKL 4HWZA 4HOXA 4MA1B 2V5YA 4M61B 3W9DA 3QO0B 4OIIL 3FQUA 4JFFD 3I6KA 4OTXL 4G6FD 2EIKB 1TG8A 5AVRB 1DFBH 4LXFA 2J88L 5IVXF 4DP1X 3VVWA 4Z5RB 1MVUA 2ZG1A 1FFRA 1OT2A 3Q8BA 4K3HA 3ISYA 3UAJC 3T09A 5E08H 7PCYA 3NJKA 2LTQB 3EO0B 5AUMB 4KTEL 3OG6B 4JY6B 3KJ6L 1CXIA 1U8QB 4TSAL 2XFXA 1MHHB 2QTVA 4JJ5A 1SLVA 1ECYA 1XH3A 4YC2C 1MFAH 4ISVB 1MJ7L 3II2A 2WZ5A 1WFNA 2L8AA 3EO9H 1OWRM 3KPTA 2QADD 2GT9B 4ZXBD 4KK9D 2NNAB 3RIFF 3ZDXB 1EHNA 5ERWB 3MDJA 4GY4A 4LDEB 4TPRH 2PTTA 3WY4A 4K73A 1EZUA 4P2QD 3NG5A 1A1NA 3V6OC 5CD3A 1ED3B 3BUTA 5HI3C 3CFEA 5K69A 4Y2OA 2GUOB 2WINA 3QVAA 5IQLA 3ORJA 4GQRA 2XQ0A 3EH3B 2XWBB 2NX5B 4MA7L 1XD1A 3UACA 4JO5A 1ACXA 4GAGL 3TIDB 1BF8A 3QAZC 3T6XA 1IFGA 1JZEA 3QZPA 4Z7AA 4UT6H 1C08A 4BCYA 3QORB 4KUZH 2A77L 3FHQA 4X6DB 3WNMA 2E59A 2OTWA 1BVNP 4EZKA 3P3RA 2XWTB 4WI9A 2WTOA 4ORZC 3B8SA 2XPZA 1A4CA 4LSTL 4LRNL 3DURA 2YN3A 5E00A 4GXFA 3W5NA 5E6RB 1CGYA 1SJEB 2XRAH 5C0BE 3FOLA 3QDHA 2FJSA 3CWGA 1FV1B 4LSSH 2DQDL 2F53B 3UPCA 5KVDH 4XMLL 1EGJL 2WXLA 5CAYB 4AV0A 1A2YB 5I0VA 4NZUL 1TLKA 4KU1A 4PJIF 3FJTA 4I0CC 3W9EA 2ZUVA 2WCPA 4CJ1A 4XWGH 2WZAA 5IHHA 5A2LH 4ODXB 3VH8A 5FHAL 4I9WD 3VQLA 3AU1A 2JKRM 1R3HB 4PJ8C 4QIRA 1L6PA 2V9RA 4RNRA 1U8OA 3GSNB 5FGBC 3SGJA 2JIXD 1J7VR 4PWGA 5J1TC 3W0WD 3V5DA 1CD8A 2Y6TE 2DBLL 1VCAA 3V79C 2CK0H 4Q4IA 1E27A 5GS2D 4LEBA 1NGQH 3ENEA 1UENA 4NOFA 1S9YB 3MV7A 1U92A 2AJXH 4PW4A 4UT7L 5B39G 4J6RH 2UZXA 1PX3A 4WWKB 4AJWA 2X6VA 4IMKA 4X8JA 3BP5A 3GJFA 4A6YA 3TIEB 2Z7YA 3FU3A 3HLKA 4TS6A 2AJYL 1PFCA 2N59A 2WLLA 2JXMA 2GTQA 3IMWA 2NUTA 2R1WB 5HVWA 3D2UB 2CZNA 4J12A 1YN6A 2QZ5A 1KCRH 3GI8H 4ZW7A 4JANA 5IESL 5JOFA 4O9HL 1I9RL 4WNSA 5GZNC 1SYVB 1E7VA 3GBLA 5IV2B 5KBPA 1HZLA 1BLNA 2MQCA 4HS8L 4LLDB 1XGRB 3EF7A 3MNVA 4RISH 2BZCA 2OBGA 3U4BL 5E2JA 3RVVC 5HDWA 1OKEA 3WEXB 2EDMA 3RWDA 1FYTB 4PRPE 2GTWA 3O6FD 1RZJC 1BBJA 3CN0A 4K8RH 1QLEB 3P4OB 4JRYA 5C08A 4EOWL 3IDGB 4K94H 5FYKU 1OTUC 2KZKA 3EXLA 4OI7A 4L3ED 1BM3H 5JHAA 1A5FL 3L95A 1WA0X 4ZMNA 1MCJA 3IFNH 3OXSB 1G43A 1W72B 5LB1A 1D9KC 1ES0A 2DQUH 1SMOA 2ZXEB 3VI4F 4ZMQA 3MRPA 1J18A 3S5LG 1ZTXH 2O5ZL 3FSZA 3MLWH 1BCIA 32C2A 2P24B 5ISZD 1KDJA 1NLDH 5LDUA 2CLZA 5FDWB 2ZYRA 1MI5E 1Q9OB 4NWTH 2HRHA 5GJTH 2UXTA 3QEHB 5IKCB 1AZCA 4FE9A 3NJNA 4O58L 4DQOH 2FATH 2IAMC 1IQWL 4H1LA 1KYFA 2VH5L 5DHMC 1U93A 4LVOB 1I8KB 4K07A 4N8VG 3IPEA 2IG2H 4U1KA 4XHJC 3WD5L 1S3KL 1MWAH 2ZCKL 5F6HJ 5KVGE 4U4BA 1UGKA 1OVZA 2PCFB 1MNUL 4H26B 1T1XA 4LEOA 3D25A 5E2UH 3S5YA 3I6GA 4N68A 4FG4A 2J7LA 4FQXC 3RX9A 1N9PA 1TFHA 3L81A 5JIIA 3DX2A 1S7QA 1MG2C 4HFUL 3C6LA 4M8UA 4X0NA 3TT3L 1RIVH 1WS7A 2HT4D 1LD9A 2CHNA 5I30H 3B7RL 4MAYD 4NRZB 1G9MC 5CP3H 3VD2A 1YEGL 4NO2B 1UB6A 3VFWB 4YNYB 1TENA 4P2YA 4XVUD 2C3VB 4ZMZA 2A4CA 1RZFL 4AEHH 2FEEI 3VWJC 5KYXB 2G60L 4G8GA 1QSVA 4PJ6A 4MNQA 3QNZA 4YSPA 1TYRA 4XWOD 2E7HA 1H3GA 4JVWA 3CFNA 5D1XE 4MQTB 4UTBA 1YPZB 5J5EA 2XY1A 1AHWC 3CUPA 4X5WA 1XEDA 2H1PL 1CFSB 1ZXQA 3BKCH 1FFQA 5EC2A 1U6AH 3HG3A 3Q2NA 1UJ3C 2VERN 1TJXA 3MRBA 1DVFC 4OCXH 3FYIB 2B20A 4CSZA 1IC1A 2F7RA 2IXQA 4WW1B 2AQ2A 3L3GA 3QEGL 3DRQB 3K71B 4G6AC 1J5IA 3V0EA 3MO1A 2CBTA 4X9BA 1PG7L 3IEAA 3MFFB 1MREL 1FZMB 3QCVL 3SGDI 5HYSG 4QO1A 1V8HA 2GK0B 3ECBA 3HC3H 4OQTA 2O72A 4PWFA 4G8FA 4X4YB 2QQQA 3RRQA 1YMHA 4XMVA 3SDXF 3LN9A 1XSJA 4EEEA 2R0ZH 1CLVA 1KBWA 1KENH 3M1CA 3WO4B 1TO4A 4KKNA 5D6DC 4RDQG 1G0DA 3U48A 2VDKL 5E2TL 3TZVB 5L2KD 1B9KA 2VC2L 3WDIA 3O3UN 3UOAB 5TTRA 1F90L 4G7YH 4GKLA 2O1AA 3C5ZB 3T3PE 3DGDA 1CN4A 3GDBA 2X0UA 2V5MA 1C12B 4PJEF 5E0FA 2H1XA 5CEZH 5CJQL 4FERA 2V33A 4HAKA 1W15A 4UIKH 5KYUA 3UP6A 3UL4A 3GSWB 4Y5VA 4KAQH 2H7WA 5E6YA 4G5ZL 1UOLA 2VDRH 2HXAA 3CCHA 3QR0A 1REIA 2ZIDA 4DNLA 3MRHB 5TDOB 2HVKB 4MJ5A 1Q1JH 3P69A 3AT0A 5KVDE 4QTFA 1FZKA 4Z77A 4JL2A 4KROD 2GVYA 1U3HB 4WI3A 1UT1A 1Q4NX 2OSLB 3B9KA 4WNQB 1P1VA 1GZHA 5DZ9A 1O7DC 1ZANH 5JQHC 4WUKH 3L5XH 3EYVA 5KW9L 2VN3A 5E5LA 3P3YA 4W6YB 3HTLX 1E3XA 3FN0L 3WKPA 4XP5H 4F2FA 4YHYC 3TFKD 2WO4A 3KPSE 3LS4H 3T4YB 3C09B 2IWFA 4TULH 1YNTA 1JZJA 4P0DA 1TU2A 3U0WH 5J6SA 1ZPUA 2BO0A 4ONHA 5HJ3A 4TSCL 3RE0A 3HI1A 3KPRD 3WSQH 1H5BA 1EJFA 4UT9A 3D7PA 1VGKA 3JZ7A 4KRMB 2EVJA 3GRWH 1DUZA 2C34A 4DOHB 4N90D 2GG1A 2IDCA 1Q0XL 3SQOL 1AJ7L 1JK8A 1E28A 2B4CC 3SPCA 2CO6B 2FAUA 5J4MA 1NWPA 2EIZA 2FQDA 4M5YH 4XCEA 4YFLF 1ZK5A 3ZJAA 5E5RB 5J6GA 1CXKA 1TEGA 4WGKA 1JGDA 1T5WB 3KW8A 1U3ZA 1UCTA 2F19H 2XQBL 3S3PA 4NYLA 3O45B 35C8H 5C07E 1QAWA 1DN0A 4AYMC 4C58B 1FZOA 3MBXL 1A1MA 3RWGA 1JAEA 2QEJA 3M1BB 2O61A 1F1GA 3KLKA 3AB0B 3W57A 3FQRA 1JRHL 4TN9A 5KSAB 1TZ8A 5E4IA 4G59C 2Q86B 1GIGH 1BFTA 5D7IB 2X53A 1XQ4A 3KPPB 4IIQC 4YDVA 1JWMA 3LHPL 3K80A 4C47A 1TKWA 2ZUSA 3H53A 4L5FE 1ZLWH 5TGBB 4ORGB 3RP1A 5DD5L 3VFGL 1VFBB 3VFPA 4MMZB 3X3GL 1ZTXE 1LO3L 4NNYB 3KLAA 1OAXL 4PD4K 2DJUA 3U36B 4OGXL 1VEPA 2CMRL 4BH7B 3UZEA 4ELMA 3S3DB 3ZHNA 5KS9B 3U9PH 4X5XB 2BW4A 2XT1B 3WDJA 5F44A 2XYBA 5F0MB 4QT5A 4JFYA 3BQUD 2XZQL 3C8DA 3UDWC 3Q9QA 4OCRH 4A2LA 5F2FA 4ZMPA 4UZSA 1TMQA 3NSXA 2X1WL 4LO9A 2Y5EA 3ARDD 3DV6B 4HPYH 1JD9A 2OL3B 2WLKA 1H8OA 4AGMA 1RZ8A 2K6WA 3ILPB 3BAKA 4LF3A 4E0RB 1VKXB 1KBVA 5IHLB 5CLWA 3EJJX 4WTWA 4J3OC 5D70L 5CM1A 1AGFB 3CN4A 5F8QC 1S5IH 2XN9B 4KH9A 1TITA 3ZHDA 5AW9B 1AZUA 1T83C 3C6EA 2CO7B 4XBPB 2NQDA 1HCVA 3T71A 1AIFB 4X4XB 4R4NC 1OOAA 5J06A 4U6HA 1JWUB 1RUML 5EU6A 1QWNA 2I9TA 2DV6A 2DI8A 4WV1C 4BH8B 2OR9L 2XZAL 1H0DB 4GIOA 3T0AA 5E1HB 1YZZA 4QYOA 3CMOH 1EXUA 1ZT4B 3UBXA 4DFIA 2CQVA 4KZCA 4TQEH 4Y8AA 3T1WA 5SWZE 4X98B 5JHDB 3GLAA 5GISH 4DPBX 4MS6A 1WIUA 3A23A 3UAEA 1KACB 3S97C 5JW3H 3H4FA 3V4VH 4XXDB 5ALCH 3TT1H 4BZ1L 3U6XA 2BPBA 1KXTB 1IM9A 3U79A 4DUXA 4KNTA 3ETBF 4PJAE 1JTTA 5JDSB 2B1HH 3D85B 3T0EA 1VACA 5I0YA 1YJDH 2DEYX 4MCZB 5BCAA 2MPAL 2H3XC 4M43L 1XD0A 1A0QH 2J73A 2W0LA 1KGIA 1K72A 2CIKB 1B0RA 1I7TB 1SOXA 3GM8A 4GSRA 2A73A 1MRFH 2YUVA 1F41A 5TE6H 1MN4A 4M1DL 3BDBA 4FKHA 5E4EC 1UCBL 2BSBA 1CDJA 2DL9A 4O02L 4X4MA 4AXWA 5CEZE 3QWQB 4GQ9H 3RX7A 3WNNA 4BGDA 3QI9B 2UZPA 5EU7C 3GPEA 2R7EA 1KCUL 1KYOJ 1NMCC 5EEXA 3C5SB 1TNNA 1QPPA 1ZLWK 4NRXB 3CN1A 4I9XA 5DFWH 4ESKA 2IFGA 3VXUE 5BRZD 4MJJA 3TYGH 1Z0NA 1LMIA 1DDHB 1BZEA 1EANA 3IJEB 4ZD3H 5DS8B 2ISDA 4GAFB 2UY7B 2ZSWB 3JBG7 3QEQE 4CVXB 3TN0D 2WMPA 3AGWA 4F7EB 3RNQB 3L9EA 4WW2B 2YD0A 1XR9A 1U0QA 4W9LC 2F74A 2O6EA 5ENWB 5SWSD 2EJ1A 2NY1D 3CLFL 5FAAA 4WI7A 4KZEH 4OD2A 3T6ZA 4OFYA 1RZIB 2AJ3A 1F11A 1UM6L 3VGGA 5KBMA 1FNSL 4JFXA 3OC8A 5C0CE 1JOIA 3LXAA 3VXNA 1J9CT 3MOQA 5MEOB 1Q9KA 4KVPA 1MZZA 3JT0A 4CC0A 4H25B 2XVLA 1LP9E 4YGVB 4B7IA 1SQMA 4MA8L 1A6ZB 1Z9PA 3FU0A 3N85L 1JHLL 4QDGA 1PPIA 3BZFB 2PPCA 4KPHH 4NQCE 1PLAA 2HSIA 2XVKA 4TM9A 1AKJA 3V4UH 3PXLA 4HIHB 4JO4L 1JNNL 2HFTA 1A7NH 3WHXA 4EI5B 4GP8B 4OZHE 4BRVA 5C6TL 3SDCD 1SEQH 2GQHA 2I60H 2XUWA 2B59A 2L3BA 2OCCB 4BQBA 1TLMA 1JDAA 3PWPD 3FFOA 1BOGB 2LFGA 3OQ3B 4Z7VB 4AEFA 4LHQB 7TAAA 3MLYL 2OMYA 3IDIA 5FA3B 3E6FB 4JPWH 1FGVL 4B9IA 2XN0A 4P5MA 4IBYA 3KPMA 3UZVA 3BFOA 3SE9L 4AMKH 2JJTC 3WFDH 1TF4A 3A67H 4JKNA 4N2IA 5HGBB 3MCLH 5KOVC 4GKZA 3LRSA 1HXYB 2BRRH 5LBSH 3CG8A 1I8AA 4JR9H 1LEGB 1XF5B 5CR8A 3QFDA 2HLFC 4XVTH 4Y0GA 3MLVH 3DSNA 3IPFA 3KL5A 5FYJU 5AW0B 3TBVA 1MFEH 3ELQA 1A3ZA 4LVHC 2JB6A 3T0VA 5F96H 5IHBA 2CALA 3LXBA 3P30L 3LKNA 2YC1B 4OIAA 4DETA 1YY9C 1MG3C 3EG9A 4Z7UA 2I7SA 4MSWA 3QIUB 4QUOA 4NGHH 3SYPA 1AGCB 1YQVH 1UA6H 4C4BA 3FFDA 4IU2A 5E8NA 4HOMA 5IFHH 2X70A 1GMIA 1KUMA 3UCRA 2NXYB 3BYYA 3SSGA 1FL3A 3HBPA 1S3RA 1BF2A 1RFDL 4BQ9A 1P1ZA 2YA0A 4C56D 3APCA 1JWSA 3BQVA 4KX9A 4UV7L 4KKAD 5L6YL 2J57A 3V0DA 2B4CH 1KMGA 3QJFB 5AALA 1F86A 5E1IA 3B5HA 5D6CA 3R4DA 1FDLH 2LQRA 4EIUA 3LSOA 3GKWH 5CJ8A 5F9DC 2OLDA 2BNQB 3VXMA 3DSFL 1D5BA 4KI5E 2EO9A 4LGPB 1ZLSH 3IDNB 3EO1A 1VAHA 1Z9MA 1UM4H 1ID5I 1TZHB 1XX9C 4LQ1A 3QZLA 5DD0L 1RJZA 2HP4A 3LRGA 2YPLB 3MJGX 4UQBA 3T2LA 3NBNA 4P2CG 4Z3FA 3TEUA 1OM3H 1KIQA 3TBCA 1R33A 3P77A 3QR2A 5EUOE 2HRPH 2RA1A 3KPQA 1TSRA 4U1LB 1B2WL 4KRPD 3VXSB 2PR4H 4ILDA 2F54E 5F7BA 4Q9CA 4OJFH 1KJ3H 2R4RH 5DI8B 2OJZH 2QBWA 3W39B 4NHUA 1N7ML 4B50A 5C0AD 5AVVB 4GW4B 4NQDA 3EBHA 4WZ9A 1NICA 4BK5C 3VWKA 1QUNA 4Y5XA 4PGBA 3QQNA 1FFTB 2J6EL 3HC4L 3ZE2E 5ITFA 2EYTB 2YAMA 2V8LA 1Z1WA 1EGJA 3PQYE 1M2VA 1X5GA 3ZE1B 4S1QH 1U8IA 2JCCA 2YS4A 3ARFB 3VXRD 1OZUA 1MIML 2R39A 1SYSB 2Y7NA 3DO3A 5BZDB 4BKTC 1NCGA 5EEVA 2ZG2A 3AM8A 3LS5L 5B39A 4PGJA 4TYUA 3PFQA 1YEWA 5FGCB 4J7RA 2BOCB 2R8SL 2FEEL 5E70A 5C6WH 4JM4H 3GGWA 4ODBD 5DZPA 4G9FE 5IMLA 1JPGA 3SDDA 3DXAD 5AG8A 1HOCB 5I1JL 4QNPE 3H6AA 2EKSA 1IBDA 1Q9WA 3BIAX 4OZIE 5EO1A 1SUJA 1CLYH 3OAZH 3KS0H 2HPTA 3V4PB 1ZEAH 3HFFA 5JHLL 4U6VL 2AABH 3QQ9C 5TDPB 1AGDA 4HZLA 2VN6A 4RMUA 1Q1PA 4XR8C 2DQEH 4IDJL 1P7QB 1GVIA 3KHQA 2DTMH 3IRZA 1IGYA 3RGVD 5CSBA 3B3IA 3MJ7B 4XOEA 4HIEA 4KV5F 4F7CB 4FCHA 1U3JA 2DDQH 1XR8B 4Z95L 5SX4H 3O6MH 5SX5H 3PABA 4JG5A 4RX4A 4ZFFA 2DQIL 2FBJL 3ECVA 2R0KH 1D3CA 2DWEB 1BMGA 3S5LA 4OGQC 2OS7A 3ZXAC 4X50A 2LAAA 2ICWB 1V3JA 5BV7C 3QDGB 1OHZA 3FB6A 4YR6B 3S8FB 3VI4B 3HKFA 1LO5A 3DYOA 4BCZA 4UAHA 3UGUA 5I1EH 3BVUA 3HRPA 5C0BD 1ZA6A 2Y5QA 4BK4A 2AK1H 2VRAA 5D7LA 1KEML 4N8VA 3IJHA 3BWAA 4P46B 2HJLB 2AQTA 1B4LA 4BIKA 2P80D 1HCYA 4WHCA 5CGYD 3UZQA 4AYEC 3QUYC 5T33L 4R6UA 3LH2L 3D39E 1F2QA 3VXTA 5AWNL 5M95B 1KCSL 3MRLA 1WA2X 2D4DA 1HHIA 1RURH 4PRHA 5DEZA 2A9CA 5E8OA 1IEBB 2QLVB 1U8MA 1WYJA 2DYPA 5TK2A 5I1DA 3MV01 1WVZA 4UZGA 4X6CA 2AXHA 4OLZH 4EIBA 1E4KC 1NCBH 2BINA 3COOA 3EYOB 4R8WH 4YBLC 2YFOA 1XWVA 3I74A 3DUHA 1IIKA 2E4FA 1OB0A 3AS0A 5ESVA 1JGLL 1VCBC 3O9WB 4HK0A 5B8CA 1BAFL 4ODHL 4BE5A 1KLGB 2FWSA 2JJUA 1O7DE 1Z3GH 3U4AA 4LIQH 3STZA 4KWUA 3DC0A 4DF9A 4WJ5A 3PJLA 4PRIA 1BQKA 1ZT7A 1HIMH 5G5DB 3OGCB 4PW9A 1MCPL 1ORSB 2YK1L 3FUMA 4PVMA 1MCKA 2D9QB 5LNGA 1A21A 2ZXQA 2OW6A 1NBYA 3FTXA 5EOQH 2D7PA 1CBVL 2BS9A 2QV4A 1WWBX 3P3TA 1T0NB 4ODUA 3V52H 3EGSA 3FQXB 4K7FB 1VB9A 4R0LC 3ZDYF 1E9QB 5HYSA 5GGUA 5LQBH 1NCCL 3O2DL 1WAAA 2EYRA 2DWXA 4JHBA 2QTEA 3OAZK 4BFIB 5DQJA 2DW5A 3I3DA 2NZ9D 1R5VA 2B1AL 1XCQA 3SOBH 3HS9A 3NJFA 3OKMA 3AY4A 3NN8A 5D2LE 4PGEB 2MCMA 2FJHA 3JWNH 4HUWA 4PRPD 5MEPB 3SDXB 4AIXA 5C0FA 1PZ5A 3UIYA 1FP5A 1OAYH 1HQRB 2GFBB 4UANA 4MD0B 4JY4B 1UH4A 2NR6C 1SMDA 4A2GA 4HCGA 4U6YA 5CJOH 3SGEH 1AACA 4L8BB 3TPUA 3EKCA 2GW5A 3BO8B 1LO0H 1CLZH 4U1MA 5KG9B 2J1ZA 3P02A 4PJEB 1ZT1B 4UM8A 1UWXH 1YMMA 2FR4A 1BD2A 1AOHA 3A3YB 3LD8C 3K46A 1P7HL 1G7JB 2DWTA 3OHXC 1WZKA 4XMUA 1JVLA 1GCYA 4ZO9A 3WXVL 3ULUD 2UVEA 2P28B 1HFUA 3FO2A 2DYRB 3FSVA 4UAOC 5ANHA 4ZUVA 5IFJB 1K5WA 4JFFA 1PYWB 5EORH 1BMWA 1I8MA 3TEXA 4AVJA 1BYOA 3MJWA 4GSUA 1AIZA 3F12A 4Y4KC 3ML8A 5LGJB 1K4DB 2KDGA 4LSUL 4JKPL 1PZ2A 2YA1A 3HE7B 2AV1A 4PBVC 2ICWJ 4R7DA 4RGND 4TQ8A 4UB0H 4CADB 2RALA 1JYXA 3EOTL 4HSCX 4NPYA 3I02B 1M2OA 4WEBH 4QXTB 3ZQWA 3CFBB 4Q6IB 4X9FA 5I1HL 2VNCA 3P0VL 4PM1A 4KOBA 3MRMB 3HG0A 2KQNA 3MBEC 4WGVB 1HC1A 2SEBB 4F15C 3QWNA 3V6ZB 4ZXBA 2KZBA 3VSTA 4OB5L 3EJUA 3MRCA 2RJMA 1SXZA 1QVOB 2TRYA 3OLDA 3TVMD 1HZKA 5HGAA 2ATKA 2O5YL 4P2QA 5CJXC 3Q48A 5ITBH 4X7SH 4JQVA 1OO2A 3L7FA 5K59E 2P5EB 1WBXA 2CKBL 3MBWB 4R7NA 4U3XA 4TV3A 3GSXA 5LAPA 5IGXH 4NKQB 3S48A 1AY1H 1BEYH 5HPMB 1EUTA 3PGFL 2DY2A 4FXKC 5BQDA 5EH1A 3HC0A 4RZCB 4IOFC 1TQVA 1YRKA 4S1SL 3GRGA 4ZFGL 2FL5A 1WZ1H 1B0IA 5IJKC 1BFSA 1G7MB 4KUCF 4O51A 1RJYA 3LKRB 1A4AA 1UKQA 1ETZB 3MODH 3UEZA 2D4FA 2HWZH 4AG4L 4NJAL 1BZQK 3I75A 1YLBB 4O2CA 4MMYA 1KYAA 3CSBA 4O2FB 2CRIA 3HNVL 5IUCA 3RY5A 2G3ZA 2EVIA 1AS7A 2CR0A 1IGJB 2HRLA 1BA9A 2C4FT 3GSVA 1YC8A 3P4MA 5IG7B 3VGFA 1S9VB 3WENA 3TC9A 3L3IB 3QFJD 3ZYOA 1KNOB 3BGMA 1QEWA 4YIQB 4LP4A 1A9EA 5EA0H 1PZ3A 1XBDA 4OCNC 1BF5A 3CFMA 1S9WA 2YKLH 4IMLB 5T3ZD 1SHWA 4H40A 4QHMB 1K3ZA 1NJ9A 3JYBA 1UWXK 4PJFB 4IBVA 4Z3HA 3O11B 5EIQA 5F6IC 2EDHA 2DQHH 4G42A 2VDQH 5JZ7C 3AGVA 1RIUL 4MB4A 2JIXA 3W0WA 1IMHC 3SDYH 1BJMA 1HI6A 4QPEA 1AR1B 5T3XH 1MDAA 1P53A 5H2BA 2Y23A 4NFCA 1BAGA 3JWDC 4PWJA 2WTPA 5EFIB 4PWHA 3V0VA 3WO3B 3K72B 4LFHD 5ACMA 1MFVA 4TNEA 3FZUC 2CGZA 1G9NH 4FG0A 1KJ2H 1U58B 3ARUA 4JN2B 3L3DB 4NUGL 3KBEA 1R5WA 1BQHG 2G5UA 3MJ8A 4W68A 4CN4A 4G6MH 2V2TB 3U46A 3NCBB 3VG9C 3TFBA 4ELMF 1DSFL 4LIQE 2P44B 3VG0H 3VFUB 1FVCA 4OLYL 3WJLC 1RZ7H 3D8MA 3FFCE 4MNGA 4NKIL 4IJ3B 4WO4D 1BQLH 2B9BA 4BYHA 5JXAH 4L4VE 5CBAA 1NLBL 3H7LA 4FZEL 3GBNH 1RZKC 2X4TA 4MVBC 5GGSA 4CGUB 1S7TA 3VFTA 5FO7A 1MH5A 3PS6A 5BVPL 2PTUA 4P2RE 3STLB 3PF2A 1VESA 3VRLE 2X10A 4P07A 4OD1H 3TURA 2BVOB 2NY6C 4EXPX 2Z93B 1TFPA 5GRJL 1CFVL 4F7MA 3O6FA 3N42F 4GBXD 3DPBA 4U1GC 4WIQA 3ROOA 2YD8A 4DN3H 4YAQA 2MQ3A 1NDMA 3FQ2A 2DWYA 2WWKT 5EHFA 3NFSH 1E50A 5AYQA 1L0PA 4P3DB 4AX3A 3KM2A 1KELH 1ZDSA 5F7FA 5EBLA 3WNLA 4L3EA 1EAPA 1BBDH 3JWNE 1CZ8H 2WXIA 5C0DA 3IDXH 4M1CC 5FKPB 1F4XL 2F58H 5HHNB 3TU6A 4CVZA 4JQXA 4K8RD 2LTQC 4KTYA 2V9UA 3BC9A 3QDJE 3QP3A 4AYBA 3S8GB 3QORD 3K0WA 1OP5H 3OGOE 4A1RA 1NC4D 4Y16B 5E03A 5ISZA 4KMTL 1T89A 4LARL 4WQOA 5KJRL 3D4GA 1MNNA 3VVVA 2MKLC 3QDMB 2JK5B 2JELL 4NQXA 1KPVA 5AL0A 4Q7DA 2CHWA 1HHJB 3EW3B 2EC8A 5E8PB 4C4KT 4ODVH 2OP4H 2GJ6B 1FO0A 1VZGA 3BUDA 3KLHC 3ARED 4G83A 4YSRA 3H1ZA 1GPOL 2VXQH 2V5SA 2A38A 5B7EA 4O02A 5K9QI 2Q7YA 3MCG1 4X7FC 4HC1H 1ZRUA 4RA0C 5DMIL 1U8LA 4N3TA 4XNMB 4P4KB 1I8IA 3GXIA 3RU8L 4A55A 3I50H 3VRIA 1YEJH 5IM7A 3DK0A 1MEXL 5IEHB 4QCIB 4YSCA 1JZ7A 1TJGH 2FO8A 3DX7B 4R4BB 3UMNA 2OJEA 2ED9A 3MCKB 2J8UE 4MAYA 5G4MA 2QZQA 5LG6A 3PGCB 3SEPA 1RMFL 4AV4A 3BE1L 3APNA 3LAFA 4R5VA 2GAZA 4FQ2H 4ODTH 4Y4HB 4N2DA 4LLVB 1OGTA 3DX3A 3HBGA 4ELKB 2F5BH 4OR1A 3QUHA 1N64L 4L0PB 5LCVL 4TXVB 5TD4A 3SDAD 3GHPA 2YSTA 3ZE0F 3DOSA 3ULSB 4POYA 1EBAA 3TA3D 2EUWA 5DYOB 5E2WH 3V9FA 3SY0B 4AQOA 2G9HB 2VQ1A 1NCWH 1GOHA 3PV6B 4U05A 5I8OH 1CK0L 5DXWA 2YAPA 3BLPX 2A6KA 3PWJA 2P8PB 1SEBA 3L3JB 5FW8A 4QRBA 1I9IL 3MOBL 3QPQC 2OXGA 3MA7A 4QKXB 1WFMA 1L5GB 4I48B 4FFVD 5A43C 3RFZA 4HEPG 2UX6A 3QFGA 4JEGB 3GNMH 4QJ5B 1N67A 2EP6A 2Z65C 2V8MA 3LJ3A 4MXWL 1HSAB 5L2KA 4P06A 1CFNB 3H2PA 2FYVA 1IGTB 2N01B 2FGWH 1I7UB 2PN5A 4EZJA 4JG0H 5CIPA 4DTGL 5MERA 5E5MB 4AQ8C 5C0IA 5DJDA 3O0LA 4QY8B 3QQDA 4FA7B 2YKKA 3Q3GB 3E80A 1CVSC 3P11L 4OFVA 4WWKC 5FYLH 1IO4C 3FCTA 1X5FA 3P9MA 3LRKA 5IB4B 1E5ZA 1UFUA 3BPLC 3FRPB 3LPFA 1LQSR 2ZAHA 3ZKNC 1X3DA 4WI4A 5BQ7B 5KVGL 1KIUA 2VXVL 5IK3A 2FLBT 3FNKA 1OP5K 3ULUL 1CLOL 1NFDA 4GXVL 4XODA 2DM4A 4HUVB 3QCUH 3EADA 1ITBB 2FBRA 3RJQB 4QI3A 4XCCH 5IVOA 4LHUB 3FUDA 1J1PH 3TL5A 4NT6A 3GZKA 3V8OA 1NPUA 2NY4D 3SQBA 2XBZA 2ZXCA 3VD1A 4YBQD 3QZNA 1AQDB 1T04A 3FQYA 3BVXA 4IRJD 4HWZB 1G1OA 2EO1A 2CUHA 2WCSA 4BUQA 4NM4H 4TOYH 1DFBL 4JKLA 4N20A 3W9DB 1QR1A 2I9LB 3E8UH 4IKJA 1I1AD 3FQUB 4LLYA 3B1UA 1CUOA 4Y1SA 2AQQA 1NM9A 4GINA 4KC3B 4BZYA 3TCLA 2DB8A 2YGPA 3IS1X 4F9PC 5E08L 2ZXBA 1OAKH 1QX1A 4I2XA 3EYSH 5FGRA 3RA7H 2YSSA 5C3TA 1YA5A 5T3XE 3PREA 3BMVA 2J5WA 2PXYD 4FLQA 5LBVA 3KPRA 5C0CD 4W9KC 1A6AA 1M1XA 1MFAL 1BZ9A 1R19A 2DQ6A 2NNFA 1X7QA 1EMTH 2D7MA 3AVEA 4Z7UF 1N6QH 2XFXB 2ROXA 4HWBA 3VB8A 3EO9L 1EZSA 1KIRA 4JJ5B 4L1BA 1XH3B 2Z8VC 4XO9A 1SJHB 4GH7B 3WHE1 4PLJC 3L3HA 3RVTC 4A2EA 2DPKA 4TPRL 4LVOC 1QLRA 4PCSA 4L1HA 4XAWH 1YHPA 2PTTB 4XN2A 2FEJA 1O6TA 1A1NB 5I19H 5CD3B 4DZBA 1HU8A 3CFEB 4Z7NE 4S0HA 3EBGA 1CQYA 4Y2OB 3ULVH 2BIMA 2WINB 1J0ZA 1IBFA 4CGTA 3CH8A 3PIQA 1MFCH 2IAND 4UT6L 3HUJE 3WBDA 4KUZL 4Y19E 1XIWD 4K9EC 3Q06A 3T0XA 3CFQA 4OGYH 1JGVH 4PV9A 3QQ3A 1QMUA 2GIYA 2VLJD 3HZVA 1C08B 3T1FA 3JXAA 1NGPH 2OTWB 3BP7A 3GXNA 1CL7L 3OBAA 3S34H 2VMDA 3PNRB 2KQMA 4M1GL 2QFPA 4X5QA 1IU1A 2XRAL 2JKXA 1IIIA 5KSBA 5D1ZC 3U1PA 3DURB 2G3NA 5E00B 2JKTM 5EU4A 3C5ZD 2Y69B 5DZVA 4LSSL 3CFCH 3JWDH 4AKOA 5KVDL 4MXVF 1B4TA 1MJJA 3FOLB 4Q0XH 7CGTA 4F5CA 4PWEA 1WT5A 1OXYA 3MV11 1JYNA 4LESA 4PJ5D 4PP2A 1GJIA 4AI7A 2X1XR 4XWGL 3NJIA 3OWEA 1URZA 3IETA 1H8SA 5C7XH 3W9EB 1XVSA 3WAKA 1JERA 4PVNA 3RL2A 1NKRA 4JDEA 4Q52A 3BQUA 1E5CA 3LNHA 1Z9NA 2JCCF 2Q7AA 3VH8B 5JHLA 4DCQA 3AU1B 4Q2ZA 1KSRA 1RZKH 3ARDA 3WO4C 1OD7A 1U8OB 5ACZB 1H6FA 4JHUA 2CK0L 2KPNA 3HR5A 4HKXA 2VQUA 4TLTA 3TZVC 5IT2H 3V5DB 5DFVC 1NGQL 3SBRA 3MREB 4GRMA 4K9JA 2AJXL 3Q2LA 4J6RL 1E27B 2WOBA 4LFHG 4YBHA 4RESB 3T9WA 4KI5D 2E6PA 1WA1X 1JDDA 3MV7B 1U92B 2H0JA 2X4UA 5LWYH 2UZXB 4DPCX 4X8JB 3BP5B 3GJFB 1QPXA 4A6YB 1UEYA 2BWQA 1BIHA 1ZVNA 5JIHA 9PCYA 3FAWA 1J8HD 1IGIH 2JXMB 4FDWA 4URTB 1KCRL 1N12A 2ZX5A 3CIAA 1RV6X 1W0YT 1KOAA 4MA3A 2NUTB 1OTUD 1N8ZB 2F54D 3V95A 4WVRA 3AMKA 2X2IA 1UT9A 3MZGB 4JANB 3FPXA 5JOFB 1ZHNA 4NZTL 1PX4A 4N0YH 1H3PH 3W11C 5KJ7E 1IAOA 4Z18A 1BQSA 1U3HC 3HHRB 5IBLD 4XPAL 3MNVB 4FFZH 4K8RL 4P5TD 3RWDB 3PQYD 4JX0A 4K94L 3R7RA 2XWXA 1BBJB 5C1MB 1BM3L 2HJFA 2J71A 5C08B 4JRYB 3IFNL 2DQUL 5DFTA 1G7LA 3C09C 2VLLA 1ZTXL 3MLWL 4EVNA 1F56A 2I25N 1ES0B 2H6UA 2WNWA 3MRPB 1OK8A 1FFNA 4NWTL 5GJTL 3ABKB 3L9YA 1FN4A 32C2B 4DQOL 2CLZB 3MRGA 2FATL 5FYLE 1MW0A 4AGOA 1ASPA 4GRLD 3QHFH 4FNUA 1TJIL 1MWAL 5A40E 2VDPH 4ONFH 5BRZA 3RUGF 3MJ9H 1U93B 2PYFA 3MROB 1MFNA 5GZOC 4U1KB 2QQKH 1NCTA 2BIQA 5E2UL 4MQXD 4FNLH 3L2LA 3TN0A 1F5WA 5LKNA 4HS3A 1T1XB 4LEOB 3D25B 1H8NA 5IMMA 3I6GB 1RIVL 1UACH 2AEQH 3PHSA 5FO2A 3OVUB 1VFAA 1S7QB 3D1MC 1UM5H 4I3SH 5I30L 2BK8A 3C6LB 2FWOA 2VO8A 2ZP9A 3CIQA 5SWSA 3VDCA 3RX5A 1P5UA 3O2DA 2GSMB 1DVFD 2BDNH 3AB0C 1MFDH 1ACZA 2PLTA 1OARH 3JV5A 2WVVA 3AG1B 4AEHL 5KSAC 3H42H 4NQUA 3T04D 1UB6B 1D5IH 4RMTA 4LVEA 1K6QH 4G8GB 1MW1A 4GS7C 4MNQB 3P3UA 3QNZB 4OLWH 2IF7A 1MCOH 4MMZC 1U6AL 3U4EA 3QXUA 1XGYH 2IGFH 1T7VA 4UQ9A 5FFLA 5IF0A 4X5WB 2ESVA 3CUPB 4WU5A 3OR7A 3GSOB 5DGRA 3MOAH 4G3YL 4D9QE 5EC2B 5PCYA 4IRZH 4E41E 4PVBA 5EF1A 3MRBB 2I32A 3VSUA 3SDCA 2IXQB 4KQ3L 2ARJQ 3S2CA 3HC3L 2P46B 3D2TA 4Z3IA 3DUUB 4JZJA 1ODUA 3MO1B 1JVOA 4KK5D 5DS1A 2YUWA 5CR1A 2R0ZL 3PWPA 2KERA 3LKPA 2J43A 4RDQF 3N0PB 4QO1B 1KENL 2V7HB 3ECBB 5SX4I 3RJDA 4G8FB 1E4XH 1WK0A 3VACA 3K2KA 2AERT 3MGTA 3ZL2A 4ZO6A 1HYRC 3ULVE 2NSXA 3RWIA 2H3NA 3D4YA 3JV0A 4PJDF 4G7YL 3T3MF 3TS8A 4AM0Q 1S7RA 1HYSC 3H54A 3L1GA 4K3JH 4ZOAA 4JFDE 5A16A 2C26A 5CEZL 1Y6KR 3CQFA 1W16A 1INDL 4UIKL 4JZNA 5HGHA 3T5WA 4ZMYA 4G8EB 4KAQL 4CMHC 3TBSA 2CSPA 1QLEH 2Y0SA 3ZN6A 2VDRL 3RTQC 5KYUB 4ZMVA 1AH1A 4Y5VB 1FCGA 1KGUA 2APSA 3CSYA 1WZAA 1LK2A 1Q1JL 2N7AA 3CCHB 7FABL 4ACPA 2XXCB 1VERA 5D7JD 4MJ5B 3PXHA 3D0LA 1PD0A 4ABUA 1IBGH 2G75A 1R0AL 3BP6A 5F0LB 4C56A 1BXVA 2OV0A 1F1DA 2QDWA 5DSCA 1FZKB 1ZANL 2BVYA 4Z77B 2HN7A 4DJMA 3AQZA 4WUKL 3B9KB 3L5XL 4S1DD 5J3HD 4HK3N 1IT9H 2IOIA 4JO8A 1ID2A 4BFNA 3VCLB 1ET8A 2LHAA 2WXOA 3L5HA 1EO8H 2NCEA 3S35X 5JOPD 4AMXA 1IKFH 1NKGA 3EYVB 3N91A 4XP5L 5B7MA 5IUSA 1XB3A 1PLGL 4C8XA 3LS4L 4CC4A 4NCC2 3H0TA 3LVTA 4PAZA 4TULL 3WY1A 2CKBA 3U0WL 1EJOH 1RKRA 1AD9A 3DYMA 3WSQL 3QIWD 4ZUUA 3VJ6B 1YNTB 4LCUA 1TU2B 3GRWL 4ONHB 4JDTH 2F5AH 5HJ3B 2ZWYA 3HI1B 1H5BB 2H6OA 3TO4D 12E8H 1HHHA 1N0XH 1QSZA 2AEPH 1VGKB 3EAKA 3FMGH 3NOIA 3NZHH 3VQMA 1DUZB 3R4RA 1OLZA 3HPLB 4XE5B 1RUKH 1UD8A 4CUCA 3G04A 1VRSA 4M5YL 5DVPA 1RAMA 1JK8B 4HHGA 3VMPA 5HP5A 1E28B 2Y1VA 3BUYA 5AKVA 2ZWNA 4QKTA 4XCEB 5J6GB 2I7OA 1NCNA 1JGDB 5JQ6H 1LWJA 1FI8C 2HKFH 35C8L 4H0HB 4NPJA 5I0DA 4XPTH 3KLLA 4WW2C 3RI5F 4HJEA 1MHCA 4NYLB 1DJXA 4OVVA 3EJYC 1DN0B 1FZOB 3VXRA 1A1MB 3RWGB 1P4UA 1WFOA 2ZSVA 2O61B 3ZDXE 2P7TA 3SGEI 3FQRB 3ATDA 2QPDB 2WXJA 4JREC 2B2XH 4TTDC 2Y22A 2CA3A 2VUKA 1BVZA 4YDVB 1INEH 1HE7A 1JWMB 2C7FA 1BQHA 2VLRE 5GHWH 2AANA 1QATA 1TKWB 4ZAKD 5LLIC 1I85A 1WFIA 3FB8A 4YSOA 5DA4A 4HLJA 3DXAA 3VFPB 3NIGF 5CCJA 3UYRH 3KLAB 4KKCC 4X6DE 5GS1A 3U9PL 4JRFA 4EI5C 2MRYA 4P57A 4PMEA 3GMLA 4IRSD 3ARXA 3MNMA 1NFAA 4UQEA 3PP3H 3QIUD 2K9FB 2J44A 4M3HA 1JV2A 3FQNA 4MS8D 4OCRL 1IVTA 5CO1A 2MQGA 4DP6X 1I7RA 4QT5B 3OX8A 1UC6A 2FHBA 2ID5A 4V1DE 3RGVA 3VXPA 2JQZA 5JDJA 3QC5X 4RCAA 4HPYL 4ZQKA 4LSRH 3CVHH 4RRPG 3GTTA 3CBJB 3T2OA 4OCSH 4ADJA 4ANXA 3S9DB 2F53E 2FO4A 2X87A 3OKNA 4NIYE 1RZ8B 1ZHLA 4KMLB 5J11B 3N42B 1M4KA 5HDBB 3ZK0A 1S5IL 2WSDA 5FOBA 3ARBD 3UXFA 3CVCA 3US9A 4FQHA 4L1DA 2XKUA 4WI5A 4XB8A 5BZWA 4HA1A 1SXNA 2E46A 1MQKH 1MCBA 3MVSA 3SBWC 5F1IA 3RHWK 3K1DA 2EDFA 1EUUA 4N9OB 4ZW5A 2C7UA 2W59A 5C0BA 5D93B 3BRGC 3CMOL 2L4OA 1PTZA 3L3OA 4L23A 2BVPA 5EU6B 5FS5A 2I9TB 4H2CA 4TQEL 4JDVA 2P80A 5FYKH 4LSDA 4QYOB 5GISL 4KHTH 5D5MF 3ZZLA 4K5MA 4XXWA 3BPNB 4PJCA 1DQQA 3V4VL 5JW3L 1WRFA 2AQNA 5ALCL 3TT1L 3MR9A 3TBTA 3AG4B 2OSXA 2B1HL 3K8LA 1B4JH 2C1PA 1YJDL 1IM9B 2XPGA 4JFSA 1A0QL 1E65A 2C3XA 4N0FA 4O4YH 1S7WA 4QHKJ 2Z8SA 1FWXA 1DEDA 5H37H 1WQVT 2AHIA 3WKMH 4PJXF 1MRFL 2HTKD 2PKDA 3DVGA 2R9HC 2PPAA 1B0RB 2L04A 5TE6L 2A73B 3C08L 3CMGA 4PJGB 1L9SA 4P8QA 3IM1A 4GQ9L 4B9ZA 3MLSH 1LE9B 1FYTE 5J0BA 5JORA 4APQD 3CLEH 3LPOA 4AXWB 3QUGA 3DV4A 2GJZA 2DIEA 2VN4A 2R7EB 3TWYA 1BVKA 3TYGL 1DBJH 2IC2A 4NC2B 5FGSA 3HPJA 2FCBA 4XPHH 4KX8A 4ECNA 4FQQB 1B0WA 4B9GA 2EE2A 1WC7A 3MC0A 4TL4A 2BIPA 1AQKH 5LCVA 4BFKA 2XWJB 4L8SA 5DD1H 4KNSA 2WMPB 1WD8A 4FD0A 4R97B 3IB4A 4HEPA 1GZQA 5DRNA 4TUOB 4W6WB 4KZEL 2NXZC 1XR9B 3HG4A 2VM4A 3PP3K 3ARFC 4PRPA 2RMNA 5TQ0H 4XNBA 3WJMA 2AEWA 3QRFM 4QHPA 1EJ6A 3RY4A 3FN9A 4R96A 1AANA 4DH2A 3FRUA 4OD2B 5FCUH 2VMJA 5IQOA 5CFAA 1F11B 3NJJA 5B3SB 2LLGA 4JFXB 2GEQA 3J27A 4P48A 3GYRA 3VXNB 3IJSA 4GIAA 4IQHA 4LOVA 1M9WA 1TZOA 1Q9KB 2ODHA 3HMXH 2OL3H 4KPHL 5JPMC 3V4UL 4XP9H 3IBEA 2EEAA 1A7NL 4BD4A 3SYQA 5DT1H 3DBXA 1BYPA 2RB8A 2A9DA 3FUNA 1HL4A 1AKJB 3NH7H 4KBPA 5H35A 3H9SB 2DL2A 1SEQL 1VDGA 2I60L 3QDGD 1UGNA 3HRZA 3WHXB 4ALAH 1HVXA 2BSRB 2ZX8A 5CWSA 2R1YA 5DC4B 1BEXA 1U42A 4CN1A 5EU5A 5K1JA 1KTJA 3WTUA 1DBKH 4S2SB 3SHSA 3RVXC 2B59B 4XB7A 43C9A 4X42A 4FF9A 3ZDZF 4JPWL 2X89D 1NIFA 1KXQE 2X7LA 1HXKA 4MXQC 2OMYB 3IDIB 4AMKL 3WFDL 3A67L 4TQIA 3MCLL 4P5MB 3WOVA 3DO7A 2BRRL 3SKJH 1TZIB 3KPMB 5LBSL 4LPWA 4JR9L 1F4AA 1OSYA 3MLVL 4FYSA 5DUMH 2AVGA 1AR2A 4GKZB 1X5MA 3ABMB 3LRSB 3RWEA 5DEFA 5BW7C 3QFDB 4P59H 3IMSA 3DSNB 2D0GA 4YSQA 5DQ9A 1R17A 2ZX7A 3TBVB 2JB6B 4N0CC 4NZRH 4PS8A 1JI1A 1TTGA 4DKEH 1NEUA 3D33A 4MJIB 1NFDF 3LKNB 4J4PC 2W9DH 3LY6A 4NGHL 1CDYA 4G5AA 3QC6X 1YQVL 1UA6L 3MGAA 4PYGA 2W0PA 3FTUA 3EHBD 3EG9B 1CB4A 3BOVA 4MSWB 4Z7UB 5IFHL 2G4GA 5E9DD 4ZRGA 5HI4C 4P46C 3DECA 4ES8A 4UILL 3FFDB 3FHAA 3ML9A 4IU2B 3F8UB 2GHZA 5E8NB 3TVMA 5EDSA 4NN6B 2X70B 3UTTE 1INQA 4B60A 1FL3B 2VN7A 2FSEB 1P1ZB 3VI3E 2B4CL 6FABH 1JWSB 3PUCA 2RQ8A 2X1PA 1DE4A 2XWDA 3P54A 1K8IA 1UHVA 2PR9A 3GBMH 1FDLL 4P3WA 3DLQR 2EDTA 4NDMB 1JPST 3GKWL 4NNXA 3GUFA 2CHXA 5D6CB 1JGUH 1WAPA 3LSOB 1ZLSL 2BXYA 4RGMB 3O9WC 1UM4L 5D4QA 3I9GH 3VXMB 1AG6A 3EYUH 5I6MA 1F1AA 1HEZB 3EO1B 4IBWA 4K15A 4DVBA 3KWTA 4ENZA 4YDZA 3OPZH 1RJZB 2HRPL 4E68A 2ATPB 3RNKA 4GT7A 2PR4L 1KIQB 3EYFA 1F42A 4OJFL 3QDAA 4UQIM 1KJ3L 2R4RL 1A6TB 1KB5H 4TVPH 5E9NA 2K6ZA 2OJZL 3NAAH 3MFGB 3QFJA 4PJHF 4TUKH 2ADJA 4JJHA 3V0HA 2X28A 1OE3A 4NHUB 3II3A 3X1FA 4NQDB 5FYKE 4I0KA 4RAHA 4C55A 3VWKB 1QUNB 3IKCA 4TMPA 3H6JA 3KVQA 4PGBB 2ZYSA 4N2OA 4S1QL 4Y5XB 5ITFB 4F33A 1GKEA 1DQDL 1M2VB 2VDLH 3ARGD 5I18H 3EGXA 1X5JA 4OFPA 1ZE3C 1U8IB 3LQZB 5K39A 1QQDA 1GMEA 4MRBA 2EH7H 4N1HB 4P49A 2ZF8A 2RCSH 1O0VA 2YD3A 1NFKA 2QKSA 1JXFA 1ECZA 5CU9A 3ATAA 3MACH 3G5WA 5KSBF 5AVUB 3RDTD 1AQHA 2ZWKA 2WWNA 3RGBA 3LZNA 5B39B 1DHKA 2XN2A 1EFQA 4JM4L 3FH7A 5T3XD 3NABH 3VM7A 3DPDA 3HE7D 2CDFA 4FX5A 2H9GB 2X09A 3WFBH 3REVB 1P84J 5DO2D 3GGWB 5HI5C 5IMLB 1JPGB 1CXFA 3SDDB 4A7QA 3WS3A 1ZEAL 3SJVE 3ZZSA 2EKSB 3D5OF 4WO4A 1Q9WB 5EO1B 3KVPA 1WFTA 2AABL 2L7QA 5D7IE 4ZT1A 2VM9A 5CD5C 4GW1A 3IGLA 2NY2B 1UFGA 2DQEL 5MI0B 3M1OA 3J2PA 1AGDB 2DTML 3L45A 1AGEA 4N1EA 1KJVA 1YVLA 3QE5A 1O5DT 3U83A 3VD5A 1PG7W 3RZWA 2EIBA 1IGYB 4HUKB 2CO4A 2EKJA 3OKOA 1AP2A 3HG5A 4GBXA 2WQVA 1SLWA 2DDQL 3O6ML 4HIEB 4DO5A 5DHVA 3C5JA 4U0QB 5CZVH 1DLHA 2R51A 4Y19D 3BP4A 2R0KL 3A6CL 4Y9GA 1FNGA 3GC3A 4K71B 5F71A 3ZL4H 2AGJH 3PABB 4ZFFB 3DMMC 4XGZA 3DIVA 3NCJH 4JGNA 1T0MA 3QORA 1T6WA 3S5LB 1NC4A 4XNQA 2IQ9H 3BZDA 3WTVA 4QRFA 4Q6IC 5I1EL 2HT3D 2L0DA 4J2QA 3FB6B 4PN6A 5DMGD 2B0SH 4ZFZB 2H32H 1LO5B 3KGSA 4NKOA 3HMWH 2JFCA 1CTNA 4AKPA 1XCXA 3AREA 5D7LB 4N8VB 3RILA 3IJHB 3BWAB 2EC9T 3IDYB 3UZQB 3QHZH 1QOKA 1RURL 5IB1A 3SN6N 3DHPA 1FV1A 2XN9E 1YAIA 1FAKT 2WXPA 3OV6A 2BP8A 1GS7A 2QSCH 3VXTB 1H8LA 3MRLB 3DX1A 3LRMA 1HHIB 7PAZA 4PRHB 4OLZL 3BRFA 1MWAA 4G7VH 1NCBL 5E8OB 2W65A 3BISA 1U8MB 2DYPB 4HBCH 4OF5A 4R8WL 3RWJA 1I8LC 2RACA 1N3NA 2NYYD 5I1DB 4X6CB 2UZYA 2K8QA 2R2HA 1BG1A 3X3FH 4WHDA 1HILA 1M05A 1L9QA 1U4FA 3NSCA 4XRCA 3F6IA 1GH7A 1R3HA 1T7XA 4Y7MA 5HD8C 1J5OH 2APTA 3Q2CA 4U31A 3LKOA 4YHPA 5ESVB 5JHDE 5DMYA 1A8ZA 4HK0B 1S5HA 5T5FA 4YXKH 5B8CB 3Q05A 4JFEE 1Z3GL 5CP3A 4LIQL 2VZ1A 4U49A 3CHRA 5GGVH 3BVVA 3RB5A 1HIML 4Q9RH 2VQTA 2MCAA 5D1QE 3SDAA 1P7KA 4WJ5B 2E8ZA 4OFIA 4PRIB 5CNHA 2YXFA 3NRQA 5HHQA 1ZT7B 4XOBA 5EOQL 3TA3A 3V52L 1R3IH 5EEWA 1DJGA 4PP1C 1DBAH 1O6SA 5DK0A 5AYUH 1NBYB 3KD4A 5LQBL 4HXBH 4ES9A 4LNRA 2OZ4H 4ODUB 1PNCA 3EGSB 1PZCA 3FQTA 5HYSB 3WNKA 5GGUB 4QTHA 1G7QA 1PBYA 3SOBL 3FTZA 4BBWA 3CHQA 3TNMA 3V4PH 3N41F 2VTFA 4QRPE 5DQJB 3QNFA 3H7BB 1R5VB 1MF2H 1XCQB 3MSPA 3OKMB 2H47C 1IBZA 4U6XA 4NBYB 3IE4A 1OAYL 3H56A 3NN8B 4X8XA 2W9EH 4PJAA 4HUWB 4KNQA 3UAAA 5BUAA 1AR1C 4EUPH 5IROD 5C0FB 1TTBA 1PZ5B 1F18A 4BCXA 2H2SC 4IS6A 4BFRA 1ZK9A 5CJOL 3ZGHA 3U9UA 1NIAA 1GYAA 3JWNG 3L3KA 1M3IA 3GS4A 4JHVA 5DMKA 5GSRB 4APXA 4YZFF 1E4WL 4MRCA 4RDBA 4WJG3 4N2NA 3LEYH 4U6YB 1A22B 1LO0L 2OR7A 5DD6A 1EXGA 2VDKB 3OXSA 2YGNA 3TPUB 3RIFK 2VC2B 2CCLA 3K6NA 5HHMB 4U1MB 3BZEA 5FYLD 3RX8A 4TLSA 4FMFA 5TQ2H 2ENSA 2WCGA 4UM8B 1Q9OA 4HBQA 1YMMB 1JMXA 4GRWH 4JUSA 4TVPE 1OHQA 1BD2B 2GB2A 3DVNA 5I0XA 2FR4B 5I8EB 2VW4A 1I8KA 4U1HA 5DFAA 2QPEB 4IRJA 5IWLC 2OJ1A 5EORL 5FYJH 2BZDA 3V0WH 2EIDA 2R1XA 2YXMA 3X2QB 4ZUVB 3IPBA 2B1OA 1I1AA 4JFFB 3MUHL 2PCFA 1I8MB 4G6FB 1H6EA 1XMEB 2QVKA 5F6HI 5C97A 4P4KD 3F12B 3D06A 4UB0L 1XAKA 4DIXA 2FE0A 1WBYA 4N85A 5CCGE 3K2MC 4WEBL 3T65A 3K6FA 2AV1B 2PXYA 4NRZA 3FT2A 4WHYG 5C0CA 4XZ4A 2DLIA 1NGZA 4XP6H 4Y16C 4Z7VE 3K0YA 4I88A 4KXCA 4BA0A 1R75A 1LP9A 2Q5BA 1BPVA 2CJSA 2PYEB 3I2CH 4QGTA 4ZX6A 4N26A 4NQCA 2VRQA 3IMUA 1QEXA 3GRWA 2QADB 2X41A 4ZXBB 2X38A 3MLRH 1MJUH 4OZHA 5IVXE 5ITBL 4X7SL 3MRCB 1PLBA 4F9LC 5HGAB 2ATKB 2M26A 4U1SB 3GZOA 3VXOA 2WXNA 4LGSB 4P2QB 4XTRD 2UZIH 5IGXL 1XH0A 2AQPA 1AY1L 1BEYL 3L7FB 2AITA 4TQHA 1WBXB 4R7NB 4N5EC 2IANA 1Z2KA 1DVTA 2X4PA 4JM2D 1WZ1L 3JVGC 4OGAD 1CD9B 1S78D 1XIWA 4D9RD 3HC0B 3FYEB 3EOYG 1J87A 4UF7C 4H8WC 2VLJA 3ULVD 2FL5B 4X7DC 4WGWB 3EJZD 5F7NC 3MODL 5GPRA 3ZZ1A 2HWZL 3EYQC 4O51B 1RJYB 8PAZA 2HTLD 4FFWD 4Y4HC 3K91A 4HCRH 2QJDA 1XCWA 3G6JF 1ZE3H 1S6NA 1DJIA 2WUBH 3I75B 4O2CB 5JIPA 5HYQA 1RK0A 3OKEA 4FNPA 5F1KC 4YDIH 4F24A 3WY2A 1OCWH 3GXMA 3X1BA 1X5AA 2VDOB 3BUPA 1JDCA 3GSVB 1VGEH 1DO6A 1D7DA 3JQOB 5EA0L 1THAA 2Q1EA 4PJ5A 4Z6AT 2YKLL 4MZIA 3BGMB 1QEWB 2ATAA 1IUZA 5INDA 2CWRA 1A9EB 4AQAB 1E4XI 3MRHA 4H0LC 4ZO7A 5CGBA 5TDOA 2DQHL 4X9IA 5E8DH 4ZTPH 2ZUTA 3T6VA 1TQBB 2OXHA 3THMH 1CTMA 1NJ9B 1TEYA 4P5RA 1YQ2A 3QJQB 1FLTX 4RRPA 2DQFA 1Y6NR 1F3JA 3KAAA 4PLNC 4G42B 3SDYL 1SRDA 5T3XL 1CD1B 1I1RA 2YMOA 2DM3A 2JIXB 1KGXA 3BEVA 3VE0A 3CZNA 3W0WB 3TXAA 3VFRA 1BDYA 1HI6B 1HSBA 1G9NL 5H2BB 1KJ2L 1CF1A 5D72H 3V0VB 1TVHA 1QHQA 2WV3A 1QBMH 1JSYA 3EDDA 4G6ML 5HYQB 2ED8A 5AZUA 4H5SA 4PJIE 1R5WB 3MJ8B 2BVUA 3VG0L 3U46B 5IMOA 5JPNC 4QGYA 1J8HA 1ROWA 2WWOA 3G5VA 3MQIA 4HSAC 4LSVH 3ZW3A 2VUOA 5EUOA 3G5YA 4A63A 5IOKA 5JXAL 1JPTH 3UTSE 3DX9A 3GBNL 3KM1A 2F54A 4Q9BA 3L1FA 1T66D 5CBAB 2X4TB 5GGSB 1A4KA 1S7TB 1D9KA 1A7QH 3VFTB 5FUOH 5CEYB 3IJ9A 5FGCE 4OD1L 5I74B 5FO7B 5CFHA 4OCWH 1MH5B 3FL7A 4U0RC 4QXUH 4NI6A 4Z0XA 1NUNB 4N0UA 3VTTA 4DN3L 1X4XA 3IRPX 4OH2A 4P5TA 3NFSL 3PQYA 4PGZA 1VFUA 3HW7A 2O30A 3O6FB 4F7MB 3ROOB 1KELL 3DPBB 4AWJC 1LEIA 4YAQB 1BBDL 3V4VA 5L0QB 1CZ8L 2NNCA 1NDMB 1P5VB 3IDXL 1D5MA 3TLRA 1SDAB 4XAKE 4BGLA 2F58L 4A2FA 1CE1H 5EBLB 4L3EB 1EAPB 2VXSH 2XZZA 3KYOA 3IFPA 5DHEA 5C0DB 4LASH 3SIKA 1OCOB 4OKDA 4CVZB 2EUXA 4I0PC 3VFOA 2VLRD 5ISZB 2BSDA 4V33A 1A7OH 4JFZH 4ODVL 4UBDD 2OP4L 4NQXB 5KSUA 5LGYA 4GRLA 5TGBA 2OYPA 4ORGA 1KPVB 5D1ZI 4PJ9D 5I73B 3MN8A 4F7TA 4ODSH 4R2GC 1YNLH 2VXQL 4NAQA 3X1EA 3LN4A 4OZIA 4PJCF 1T7WA 2NZIA 4WFHE 3FO0H 5AW6B 2NY5C 2EXWC 1MLBA 2XG4A 4O02B 2Q7YB 4GRWE 1G6RH 3LZFH 4G8AC 2X4NA 3ZSTA 3BKMH 4IHOB 5I1KH 3I50L 4E9TA 1YEJL 1U8LB 5IMKA 3VI4E 1TJGL 4B0MM 4V1DD 2DLGA 2IWKA 2GBAA 3VRIB 4JO2H 5FYJE 5IM7B 4CU8A 4FOMA 3D12B 1DVFA 1T3FA 2OJEB 4CSPA 5ES4B 4MAYB 4Y4FD 1QTYT 4FQ2L 1BECA 2X9WA