3QORB

Crystal structure of human nuclear migration protein nudc
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
119
structure length
118
Chain Sequence
SSSKLKPNLGNGADLPNYRWTQTLSELDLAVPFVNFRLKGKDMVVDIQRRHLRVGLKGQPAIIDGELYNEVKVEESSWLIADGAVVTVHLEKINKMEWWSRLVSSDPEINTKKINPEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Nuclear migration protein nudC
publication title Structural Features and Chaperone Activity of the NudC Protein Family.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding, cell cycle
total genus 28
structure length 118
sequence length 119
ec nomenclature
pdb deposition date 2011-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04969 CS CS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3qorB00
3L1EA 3QORB 4ELDA 3J07A 2N3JA 3N3EA 4YDZA 1WH0A 3QORA 1WGVA 3VQMA 2RH0A 2WJ5A 4RZKA 1RL1A 5DS2A 4YLBA 3IGFA 3GLAA 1X5MA 3Q9QA 1WFIA 2BOLA 2Y1YA 3GT6A 4JUTA 2KLRA 4I88A 4JUSA 4YL9A 2MNWA 3GUFA 5LUMA 2CR0A 4M5SA 4ZJ9A 3QORC 3QORD 5DS1A 3L1FA 4YE0A 3VQLA 4MJHA 4FEIA 1GMEA 4PBDA 1SHSA 2KMWA 2N0KA 1EJFA 4YLCA 2XCMC 3Q9PA 3AACA 4M5TA 2WJ7A 3L1GA 3AABA 2JKIS 2K8QA 4PCKA 3W1ZA 2Y1ZA 2CG9X 3EUDA 2Y22A 2O30A
chains in the Genus database with same CATH superfamily
1PG7H 2WB1A 1U8KA 1TZOA 5TE6L 4Q56A 2ZG2A 5IKCB 5B3NA 1KIQB 2DQEL 4K94L 4FFWD 3UZVA 2ENSA 2LU3A 1V7NL 4HAGA 3AS2A 4R4NC 1CZ8H 5I6OA 3MRKA 1O9VA 3AC0A 3SKJL 2OQJA 2W80C 3ULSA 1S7WA 3RGVA 5CJ8A 2R9HC 2VLRB 3K4AA 4KKCD 1J18A 2Y1VA 2O5NA 4FMKA 3FC8A 3JYBA 4X7DC 2FAUA 1MUJA 3DSNB 1T2JA 4Q89A 1MPAH 3SKUD 3QUZC 2CRIA 3MODH 3HE6A 2ZCKH 4ZMZA 3MGTB 1OIOA 3O41A 2BSED 3BC9A 2YA1A 1R17A 3MR9A 5J4MA 3QJFB 1BVZA 4APQD 3DETD 1BV8A 2VH5H 3K1DA 3ZXAC 1WISA 1T7VA 1RUPH 5IVNA 2IQ9H 4QR7A 1BIIB 1BFOB 2CBQA 5HVHC 2OMVB 2ZNXA 4BFIB 1ZMYA 3GMLA 5EWIH 5HDQL 5IJKC 1QZNA 2BIHA 3DRQA 1UWEH 4N2IA 3RVXC 2X6UA 1KLUA 1ED3A 3CU1A 2XBTA 4MA3B 2ROYA 4BH7B 4MGXA 1L7IH 3HZ3A 3PHQB 4U1IB 3DMMC 4IGBC 2OULB 4P57B 2G75B 3MA7B 3MV9A 3IFPA 1YC7A 2IWEA 4H0HB 1GKEA 3MLTB 3FHQA 3KBPA 1OAKH 2NY4C 3BAEH 3IBEA 4MWFA 1P7QD 4X6EA 5SWZB 4ZAKA 1K8IA 2CA3A 4BUQA 4X8JA 5F97E 2HUHA 3MREA 2JB6A 3AWFA 2WWKO 5LCVL 3HG1D 2BNQB 2QPUA 2IBZY 1WVZA 1WZLA 4ELMB 3EHBD 3DX3A 3QO0A 3RWEA 2Z7WA 1DTUA 2JK5A 3L5HA 2BOBB 5BQ7A 2ZJSL 2OMWB 1OB1B 4JZOA 3RFZA 3BCDA 1MY7A 2LW3A 3TJPA 3GZOA 5D5ME 1MNNA 1KCKA 1TTUA 3TYFB 4AG4H 2IH9A 2O6EA 5DC0A 2GKIA 3WY4A 1DQIA 4KY2A 4EN3B 4F33A 4AJVA 3MOQA 1KACB 3KPPB 5DD3H 1YNLL 3G04B 3ESOA 4MD5B 5D5MF 1H8LA 2UZIL 4C57C 2OL3B 5K69A 1E4XI 4N24A 2P24B 3RYMA 4E41D 3KPOB 3BVNB 1WSST 3U0PA 3CLEL 5IK3B 1RZQA 1NANI 2JKXA 2NY7L 3PAUA 1AACA 4M3KB 1ZHKB 4FTDA 3SPVA 3EFFA 3FQTB 3GS7A 3RZWA 2F54B 3RNQB 1WE5A 4F20A 3PV7A 1FZOB 5EO9B 4AGPA 4FI6A 4P2QD 1J8RA 3N9GH 4TNVK 3GTVA 3QHTC 2ZNWA 2NUTA 1H3XA 1YNKH 4X0KB 5C0DB 4YDLB 2OJEA 1KB9J 2A77H 4DGIL 5J89A 5KSAC 3IFOA 3LIZL 3VU2A 3ECQA 4U1MB 2E7CA 3IMRA 4I3GA 4PSPA 4U33A 4B97A 2BVTA 1F3RB 3GQFA 1F1DA 3VXTA 1X5JA 1KNOB 3ZZLA 1PU0A 2FO1A 4JY6A 5I6NA 5A43C 1ORQB 3IXTB 1DVTA 1T6WA 3LZQA 5AYUL 1UT1A 4WI4A 2OMUB 3T0ED 2AF2A 4KUZL 1HFUA 2DLFL 2ATAA 2N56A 5CFAA 2VJ8A 2AEWA 3W3BA 4ATTA 5HYEA 4G9DB 4MVBD 3MRGA 4OLWL 3CFEB 3FH7A 4F7CA 1G1YA 2CBTA 5AVTB 5ISZA 1WBXA 4YMPA 5L88L 1NKGA 1X9QA 2DQHH 4MZIA 5LGJA 2JKIS 4OKVA 1MVYA 1Q9KB 1Q94A 1QFHA 1NFDB 2NXYC 3ARFB 4G8GD 1CUOA 5FOJA 2CLZB 2BVYA 1QRNA 3AWEA 3FO1A 2HA1A 3KLAB 4M7ZB 3ZT5A 4MS8D 3ECWA 1N64H 5C0AE 5EORL 43CAB 1CGTA 4PJBE 3SBWC 5B8CB 2F58L 3O4LA 2AFNA 4WI2A 2JSFA 1G0XA 1H3PH 3WAKA 5I76A 1A7BA 2GSMB 1DQQA 1GCFA 2YK1L 1LO5A 3MLVH 5HGAB 1ZT4A 3K7UA 4HWNA 3UYPA 3IBOA 1FFOB 3N44B 4PJBF 3QUXB 2VDML 2A73B 5T3XD 2C7UA 2AEPH 2F7OA 1SEQH 5EU6A 1ZLWK 4DJMA 1IO4C 2X44D 1OAQH 2VDPB 3QW9A 4I48A 4LASL 5HYQB 1WCBA 2BFVL 1IEAB 3MLZH 3IWUA 4UYQA 5FYKE 1OOAA 2BPBA 4QHMB 3ARVA 4FNLH 1WS8A 4R83A 3AY4C 5FCUL 3H7LA 1MQKH 3ULUC 5CJOL 5IEKA 1EHXA 4JM2D 5GRJL 5ICXB 3LEXA 5I9QC 3ZZQA 3KPNB 3JWDC 4PRIA 5FECB 1FDLH 5KVGH 3M07A 5DK3A 2OZ4A 4LP4A 2WKGA 1XMWA 4PJ7E 3EFDL 1A1MA 3RNKB 3LZFL 2QADC 3FFCA 1CD9B 3KR3H 2VDRH 3V7MA 1ML0A 4WI9A 2XA8H 2ZOOA 4OZGE 4EUPA 4P23B 1MCOH 5DJDA 5DVKA 1L9PA 5MERB 3GPSA 4PJ7F 3KPRD 4Z77B 3QQ3B 4LKCA 2H3KA 5D7JB 1NAML 4K8RL 2VDKB 1AG0A 2BSRB 4DESA 3KJ4C 1T2XA 2CHXA 2Q0ZX 4OZGF 2NY6D 3OGOE 4RWHA 3AT9A 2EEFA 4U1SB 5CEZH 5FO7B 3KPSB 3IDXH 5F7LB 4LPUA 1YDPA 4LP5A 3VD7A 3L9YA 2MCAA 3TP4A 4IBUA 3ASWA 2VDOL 1X5MA 3RGHA 3MBXH 3VG9B 1YUKB 3GJEB 3ILPB 3H4FA 1NJ9B 5DK2A 3HRZA 4RZCA 1YPZE 4IU3B 3KG5A 1JD7A 3LKOB 2AHIA 1BEYH 3J27A 1VGEL 2X87A 4HJ0D 2DL9A 4Y19D 5JW4N 4KRPB 4XWGL 1G9NC 5DVNA 1H15A 3HAEH 3U79A 1CTMA 1YPZF 3O2WH 3VXUA 1SN0A 2ITCB 3RZCB 4N9OB 1N9PA 2OMTB 3DTDA 4PS4L 4Y2OB 2WVUA 4JZJC 5F3HB 2BVQA 3QIBC 4JFUA 3C08L 5HYJD 1U3NA 4XPBL 2GJ6E 2JLLA 1NLBL 1NWPA 1XGTA 4AV5A 4Y16C 5A16A 4U4IA 5HYIA 3LPFA 3WNKA 4AT6B 1PX3A 2GABA 4NX0A 4M1GH 4F27A 3W5MA 1GH7A 4PRPD 1M7UA 5EUOE 4PGBA 1S7TB 3RJOA 1TZIA 4KRNA 2YSTA 3RTQD 5JIIA 4HS6B 15C8L 4MKTA 4Y1AD 1BVLA 3EO0B 1LWRA 4TOYL 5C0ND 1TXKA 1W72B 1VFUA 3A4EA 2QMKA 3D4YA 2CO7A 2XV3A 4ZTOL 5DQDH 5KYUB 2EXWD 1F2XK 3EF4A 2V5YA 5EUOF 4CW1A 2I9LB 1XIWA 3AJ7A 2NW2A 3GT6A 5EU4A 2DTML 1BVKB 3RWGA 3P73B 1Y6MR 2CALA 4AMKH 4H26B 1OD7A 3OKDB 1A6VL 4M8RA 2DQUH 3IJSB 4WU7B 1BPVA 3PWNB 1OAZH 2PXYC 2V17H 1P53A 3ZDYE 1DBJH 4H88L 2YC1A 5HHVL 3BUTA 5B4MC 4HOXA 4L4TA 4PN6A 3AFLA 2FWSA 3D08A 5IFAH 3SGKA 1D6EA 1V3LA 1PY0A 2RH0A 2GBVA 4OLZH 5E2TH 1P7KB 3ZDYF 2N7BA 1TNMA 3E1ZA 4QRPE 3QR1A 5IVZA 3NZHH 1Z0MA 4YZFE 3Q9QA 3PF2A 4UQAA 1DQLH 4WW1B 1J8HE 5T33L 1EJFA 5F1SA 3DGDA 4GRLD 2YAQA 2FL5B 4UMGA 3CFCL 4YFLI 4YZFF 4ODUA 2GITB 1FNEA 4J27A 1Q38A 2ADGA 3JYCA 4KXDA 5DFWH 3LDBB 2CGYA 4ES8A 2QPEB 4TTGA 4KK9C 2QKSA 3GTNA 4G2AA 4GXVH 1S7QB 4B3EA 3TEYA 1BJMA 4FTVD 4CNIB 2B59B 4G9FB 3S88H 3ARGA 1MAML 4XCFH 3CFQA 3DC0A 3GI8H 2MPAL 4TUJA 1D2OA 4FQIL 3EOYG 4DCQA 5E6ID 2JJTA 3CU7A 4J4PD 4WI0A 3TEZA 3G9VA 4P5TC 4E9WA 2X2HA 1OD9A 1U93A 3PDDA 1PDKA 2ZOTA 2WK2A 4OCXH 1J05A 2ENPA 1OW0A 4O02L 4UT7L 3QK0A 4OJAA 3TBTB 3WD5H 1OGSA 2AEQH 5ICZB 2Y2TA 3VQ1C 3BP4A 2VJ0A 1QSFD 1T21B 2ITDB 3FCTB 3T5WA 1E4KC 1CGSL 4LO9A 5JDSA 1IAIL 3MUZ1 3CAFA 3TVMD 1MHPH 4MNGB 4D9LH 4KXZH 4N2FA 1MCWM 4LLDA 5DHYB 1ZCRA 2B20A 2FD6H 5TE7L 1JSYA 4M43L 5KVEL 2P47B 5F7NC 5BO0D 3AREA 5ABAA 3VXMA 3HG1B 1GKOA 3U7WH 1GOHA 3MRRB 5FLVA 4UCFA 5CLZA 4JRXE 2IFFL 3CN1A 3QSKB 2XY1A 2ZKXA 4E36A 4PJDB 1U41A 1H5BC 2OZ4H 1MFVA 1JWMB 2P5WB 4TS6A 5H2BA 3VRIB 1YYML 4IIZA 5TDOA 4RRPM 1R19A 5B39A 1E3FA 1X9RA 1A4KB 2H26B 4EUPH 3OAYH 3NMEA 4YXLL 3Q1SH 3HJEA 4P5RA 3ZMRA 3H9HA 3HFMH 1EFXA 5DI8B 1VADA 1YA5A 2FT7A 2FYYA 3C60C 4M6ML 5JDJA 1INEL 5CGBA 4P4RB 1IFHH 4WTZA 1H19A 1NL0L 1M4KA 2H6OA 5TK2A 5LNDA 3L5XH 1B0GB 2E7DA 4XPFH 4DGUA 3IAPA 3RWDA 3KJ6L 4G1EA 4M8UA 4NAQA 4XVTH 2R59A 3BP5A 4H2AA 3ARBD 1XCXA 1AOZA 2D3NA 5KYWA 1A7QH 1GGBL 4P2QB 1VB9A 5T5NG 2J73A 5ITFB 3IE9A 5CD3B 4PJAA 5D7SH 2PTTB 1EBPA 1W8OA 1Z0NA 4AMWA 3UC2A 1HKFA 1A9BA 3KXFD 4GFXA 1YY9C 1PKQE 2W60A 1N2RA 3PYCA 2HTLC 4QXWA 1OTUC 2XPGA 2CGRL 1SXSA 1XGPA 1S4IA 1FRGL 3OKMB 5IB2A 4LNVA 2FZ3B 3GHEL 3AAZB 2YN5A 5JW3L 2UY7B 3BAIA 3CE1A 3ULVC 1P2CB 1KDIA 2NYYC 4AQAA 4W81A 3DOSA 3L48A 3JTSA 2VLMD 4R2GD 3X3FH 4ZFOL 3I6KB 3F7RA 1BBDL 3BWAB 4NM4H 4XNQA 2FIKA 4LAQL 1WHPA 4OR1A 4YHZL 4DEUA 4IDJL 4NFCA 2Q6WB 4FQXA 3MZTA 3S0PA 1OSYA 5F93C 3RUGA 4C59B 3U7YL 1TQCC 3T1WA 1NPUA 3GJFA 4ZUTB 4APXB 4H20H 3PP4L 2GBUA 2E27L 1N5AB 4NKIH 1UACL 1BJ8A 1ANUA 3HFFA 4G8GB 4WSGA 3L4VA 5GS1C 5T5NF 5JQ6L 2G2PA 2D7MA 4G5AA 3BFQG 1F8TH 2YEZB 2EDLA 3OZ9H 4QTHA 3ZKNC 4G8AC 1THCA 4G1MB 4JB9H 1R24A 4JM0A 1CGVA 3D3VD 3CC1A 2BRQA 1U6AL 1HL9A 3JV6B 1OSPL 5DC9B 2GSIB 3PL6A 4JO2L 3QZOA 4IOIA 1Q1JH 2X89A 1F6LL 2ZWNA 3MV7A 3NABH 4DSYA 4F7PB 4QHUB 5D1ZI 2Z7ZA 3TFBA 3CXFA 1UUNA 1EXUB 1OXYA 1G6RB 1G7JB 2DLEA 1AC0A 4EKXA 5E51A 2N0MA 2VZ1A 5GRYA 1E6OL 1SVZA 4F5CA 5C1MB 1MFEL 5FO9A 1IQWH 2P80D 1CFTB 2KT6A 5C0RL 1BM3H 3ECVA 5HHME 4JJ5B 5DS1A 1JK9A 1NM4A 2VXVL 3BGFC 2R23B 4W9DC 4JKNA 1YEJL 5J13B 2NY0D 3QPXH 3GUTB 3UBXI 5C8JA 2VL4A 4JM2B 1JXJA 4HOMA 4QRUB 2YR3A 1HH9B 5IHUL 3K8KA 3PP3K 4M7LT 4HUCA 3W0WD 4KKNA 4XNXH 4MMXA 4R6UA 2FNWA 3SD2A 2BC4A 4DUXA 1WGOA 4LKXA 5E5MB 3K2MC 5I8CB 1CC3A 1LQSR 5IBUB 4OCLC 1NIDA 2OPCA 2RGSA 3JWOH 2XLLA 1TO5A 5F7EH 2F19H 1MW3A 3GTTA 3UP1A 2BZDA 5DGQA 4ZSOB 2EVIA 1WJ3A 2ZUUA 2ZT9C 3ULVE 1JGLL 5DQJB 1IQDA 3KPRB 3S4SB 2ESVE 4NQVA 2X42A 3RA7L 1U91B 5KSUA 3OXRA 5D93B 3ETBJ 3WENA 4W4OC 4LHUD 1OF2B 2NY6B 1S7RB 3ZUCA 1OWWA 1WP6A 3ULVF 1C5DA 4GQPH 1OP3K 2BRRH 4W6WB 3M1BA 3OV6A 4OF3A 1ZGLB 5T3ZD 1IBFA 3QJSB 4YBLC 4S1DD 3ZDXB 3PUUA 3CMGA 3CZFB 3T3PB 3SKMA 2ZUYA 4I4WB 4G6JH 4GOSA 4A2FA 4KWUA 4AMXA 5I1KH 4AQZA 2D3JA 4ETYA 4ZMYA 1IGYB 1F4XL 4JFXB 3MPCA 1VHPA 4WFEE 2JJUA 2DQJH 3MOAL 4A2GA 2ZCZA 4AKPA 1AGEA 1N4XL 4NJ9H 5GSRB 3KL5A 5MENE 3P0YH 2QQNH 1N7ML 4XHJD 3TA3C 3TZVC 1RSFA 5K1VA 4FA7B 3EFOB 1DANU 2AABL 4IOSD 5D4JA 3RL1A 4Z7UB 4H8PA 2DDQH 2WN3A 4AX3A 1XR9A 4RVBA 3FFDB 1IM3B 5HYSB 3MX0A 3CTTA 2YQBA 1MAJA 4YK4B 1QEWA 4J3XA 4X5XA 2CBOA 2V37A 3BKYL 4WV1B 4ZFFA 3D39A 3JTTA 1DJZA 4PRPB 4P2RA 3F65A 4EN2A 4HIQA 1KIUB 1D5BB 4O2FA 3RTQB 4OJYA 5J0BA 3KHQA 4Y9EA 1Y18A 5GIRB 4FJZA 4GQRA 2AV1A 3VXRA 3RVVD 4GQ9H 4HJJH 2XX1A 4AH2A 2LHAA 4OZFB 4EVNB 3FUDA 2WWNA 3HLAA 1WA0X 3FUKA 1BQ5A 1J0ZA 1KJVB 3BAKA 2B5IC 5E2UL 4WNQA 2HFGL 1EZUA 3NJNA 4MNQA 3AS0A 5C0JA 1JDDA 3HPLA 1F3JA 4M5ZH 1M05A 4Z5RA 4DP8X 5DHVB 3EGSB 4K71B 4U7KA 4YLQT 1EBAA 4H1LG 1X7SA 2OI9B 5JHDA 3H9YA 4FQHB 1ZTXH 3TURA 2H9GB 5A1AA 1OTTD 3EJZD 3CVHA 1HHHB 4LCYA 4GKOA 4ZXBD 3FOLB 3M7OA 2IMMA 3L95A 5DFVD 3SDAA 3K4DA 4KJQD 1HHIA 3PG2A 1RIUL 5JXAL 2XWBB 5KJRH 4AQEA 1SXAA 3RILA 4Y5XB 2CE6A 1M71B 3U4BH 3MJ8B 4XMLL 4AWJC 5A3IC 1DANT 2QQKL 2ZSWA 2Y1AA 4FCHA 2KDYA 4LNRA 1ZWIB 5GJSL 5JOEA 4CDHA 3V79C 1MIML 1ZIBA 3ISWA 4NOBA 4ECNA 5C0BA 3NTCH 4PB9L 1T0NA 4OGXH 1BX2A 3NK4A 3UTOA 4WFHD 2ARJA 2VE6A 1N0LB 5TE4L 4ZDHB 3GJFH 1L6PA 1Z9SA 2J6EA 2CNZA 4J3WA 4LCVA 3ZO9A 4ANXA 2WOYA 1UA7A 3VXNA 3GLEA 5LB1A 3CVIH 5I0DA 5K93A 2FSEA 5I66B 1BZQK 1T2QH 4LOUC 4QHLA 4WTQA 3Q2LA 2Q76B 3UYRH 5GZOA 1J1OL 2IAAC 4ANKA 4YSQA 1KIRB 3GSVB 1P69B 1TU2A 1U8MB 4GRWB 1E7UA 3HE7A 3RKDD 5GXBB 3DBXB 1FG9C 5E6IB 2V7NB 4NRYA 4IYKA 2AKRA 4ZUWA 4JRLA 4P05A 5C0EA 1P1ZA 3QI9A 1XCQB 3BIKB 4BCXA 1PFOA 3S8FB 1ETZB 3V0VA 3FCSB 4NUGH 1Z32X 2WQRA 3LKRA 1QSFB 4OSUL 1BQUA 2WBJC 3G5XB 4MA8H 3CDYA 5L0QC 1JCKA 4K3EH 2FX8H 4FXGB 4K3DH 2WWKT 4MAUH 4QTIH 5FWRA 1PNCA 2KLRA 3RPBA 4CN1A 5DUBB 3L3OC 3I6LD 3QXTA 4M48L 2ETWA 3O6FD 3FBQA 4GY4A 2Y69B 3PWJB 1CF8L 2RCSH 2HT2C 2XN1A 1AGCA 3MRIA 3NPSC 4XNZC 4KNQA 4JKPH 2BNRE 4QHPA 1LJMA 2OJ1A 5IHLB 1ZLSH 3LRLA 3OHXA 1XX9C 3M17B 5E8DH 5FV2A 4Q2ZA 2BS9A 1QLFA 3BO8A 3GWJA 4WK2B 3DRTA 5D6DA 1JYNA 1U3HD 4D7BA 3QNYA 3B9KC 5ESVA 5F1OB 5EZPA 4CDGC 3SCMC 3HUJE 2AQ3A 1KGIA 1WRFA 4P5KB 5FK9B 4XTRD 1P4LB 3HR6A 5TDNB 3CC5B 1IKNA 3PRZA 3GIVA 1UZ8A 3A24A 3QIWA 3QXWA 4NNPL 4NUMA 1WWCA 3T65A 5DYOB 2AVFA 3RURA 2EH8L 3HUJF 2X40A 1X5AA 1KG0B 3WXVH 4F9PC 1DJWA 4F37F 5GS3A 1EVUA 4U3HA 3ROLB 4HIJB 3T8XB 2ADJA 3QUMA 4I7ZC 3GNML 1XF5A 2PPDA 2R27A 5D70L 3WY1A 4YAQA 4GUPB 3M6DA 5DJ2A 2XXFA 1L0XA 1MNUL 4LLVA 3ARBB 4W9CC 3L7EA 2ZAHA 5C0CA 2HJKB 5E2WH 3UAEA 2YARA 1N12A 3GINA 2VLRE 2Z4TA 1OM9A 4I77L 1EJ6A 4JW3A 5BV7H 1F58H 4OI9A 3T0VA 1BWWA 2ZXDA 4AXWA 4LSRH 1IC7H 3KXFB 3A67L 3F58H 3QDJA 3U36B 3D2UD 4YWGL 4DZBB 3DKHA 3D48R 5KSBA 1IC4L 2VQ1B 2VXTH 1YEFH 5D4IA 1Y1DA 2P44B 4M1CD 2Y7MA 4XC3L 4RGNC 4KO6A 3GLZA 3S5LG 1XEDA 5EBWB 2Y36H 5DRNA 3BSGA 4K9EC 4R2GB 3TIEB 3MNZA 3UBXB 3FB8A 1Z6JT 4TLTA 1W91A 2PP8A 4RFEB 2B4CC 3UTSB 3P3UA 4HEME 3MLRH 4JY5L 3QWRA 1SJMA 3NEXA 1KCSL 3SBQA 1PLCA 5EBLB 2ZUVA 4R97B 3SKOB 3CQPA 4NZRL 5CCKL 3SJVD 4AV4A 4XWOC 1REIA 4UM8A 3EUUA 2X4TA 2Y5TB 4NGHL 3HG3A 5KYXA 3H3PL 1JPTL 2VW7A 3V0AC 4FKHA 5JIPA 3RU8H 4PWEA 3WHE0 5BMFH 1IAOA 5J56B 1FGVL 2HLFD 2CUMA 4U1GB 3IMWA 4AIZA 2XJKA 2WXFA 2B2XL 4WWID 3ARFC 4UB0H 3H9SD 2LFEA 3QORC 3D3VB 1VPOH 4RGMC 4D0DB 1JV5A 4ZUVB 1RIHH 5DD5H 3Q8BA 3APNA 4NHCH 2WZ0A 1SOXA 1KJ3L 4TUOA 3CVHH 4L5FL 1DL7L 1T1ZA 1X6NA 3SBWA 3IKKA 4WRLA 4XBMA 2Q87A 3QJQB 2R83A 3A4DA 4OJFL 3AM8A 3AS1A 1O75A 4O4YL 1WZMA 3T2NH 3GMMB 2AZAA 4K7FB 3WDHA 1QYGL 2HFTA 2CIIA 2KDGA 3X1NA 2J43A 1EHKB 4PJ8D 1ZVSA 5JORB 1EO5A 2UWEB 1UCBL 3SDDA 1JVKA 2VL5B 1D5RA 1MWAA 1MEXL 2Z0UA 4PUBL 3DUUB 4QXGL 3PWUB 3F04A 2NY0B 1VF5C 4M4RB 4MNHB 1QSEB 1S7SB 3ZYZA 4TRPL 1JV2A 5FUOL 1FO0H 1I85C 3DHUA 3FRUB 4UI2A 3W0WB 4ALAC 4Z7AA 1BD2A 4AQ1A 5TJWK 5A7EA 4MAYA 1GIGH 4DEPB 1T22A 3IDIA 4PLNC 2A74B 5SWQB 1IGFL 4E9RA 2JXMA 1UEYA 1KGUA 4ZUSB 2C9SA 3MBEA 5GGUB 1IBGH 2WXPA 2AQTA 5SWSE 3VI4A 4RCAA 2R1YA 4O58H 4RGNE 4XO5A 1U8IB 4YSSA 4WW2C 4XAWL 4OAWA 4KK6D 3LS5H 4KJPC 3NCEB 4R26L 3EJCA 5I16B 5IF0B 3VSUA 4NO2A 2CBPA 4P23C 3UTQB 5KANI 4OV5B 3GB7B 2NNXA 4QOKA 3D09A 2XWDA 4LHUB 3OSKA 1D6VH 3MKGA 3F8UB 5CR8A 4BJLA 2X3CA 1IKFL 3WNNA 1M7IA 3BESR 4JUTA 4P9HC 3DK2A 3VDBA 4H8WL 1AO7A 4O2CB 1SLVA 3WTUA 4LPYA 3QEGH 1Q72L 3BN9C 4GS7C 3ZE0E 5DJCA 3NBNA 3VMPA 3FQXA 1OB0A 5GRUH 4DUWA 1ZSDB 3GD1C 1R3LA 4QJ4B 2OJZH 4CGUB 1GHFH 4NO5A 5MP6L 2D7TL 2FO8A 2R56L 1FV1B 4NCDA 1XGUB 3FK3A 4U3SB 5AB0A 2WXJA 4QNPE 3IWVA 3ZE0F 1KCUH 4YDVA 3ROOA 1BQLL 1JGIA 4NNYA 4KRPC 4OB5L 2CHZA 3QEHB 3NA4A 2VUYA 1JI1A 2IADA 5KAQG 3RZCC 4QNPF 1GGIH 1KGJA 1M1XA 4TYUA 3HHSB 1TQUA 1JFHA 2ORBL 1RK7A 1G7MB 4IQHA 1Y7VA 5EFIB 5CHNB 3ZHDA 4UYPA 3ALXA 5FCSH 3T0DA 5I1HH 1SN2A 3Q2WA 3Q5YA 5C0GA 4FP8H 3QUMH 3DOHA 2ZYSA 1KEML 4PP2B 2WXRA 5C07D 5LDSA 2JKNA 4R90L 5BRPA 3ZTDC 4TQHA 2BMKB 1ZLUH 2L7JA 3KLLA 5IG7B 5HP5A 4LCUA 4XX1G 4N1HB 4YE4H 1KCBA 1DBAH 3SQBA 4L3EA 4B7IA 2CUIA 4GP8B 4UINH 4HMDA 3IDYB 3H42L 3KGSA 1B6UA 4PG9B 5I0XA 3SGEI 4AIOA 4JN2B 2XWRA 5E4AA 4F7MB 5ICYA 5E8PB 1UYWH 1RUMH 3EYFA 4ZXBB 2PO6C 3K0YA 4XMPL 5JIQA 3A0OA 2E59A 4N8VB 3UTZA 3VI3B 1ODUA 3KAAA 4HG4J 5LBSL 4WCYH 3WOVA 5KAQF 1TQWA 3MRNA 1KXQE 1CFNB 1FFTB 3O3EB 2YGOA 2VDLB 5T1KB 2F8VA 2X88A 1CDJA 2CPUA 4GSDL 2E56A 4X50A 4WW2F 2H1LM 1SY6A 2EYRB 3A6BH 4GRMA 1KB9K 4OI8A 4FFWC 3A21A 4XX1E 5E9DA 1ET7A 2ATKA 4U4BA 3CFIC 3OR7A 2WKLA 2ZD0A 4WTXA 3LVTA 5IW1B 2GFBA 4QRQA 4ZS7H 4CVXB 4QXTA 3FKUS 5IESH 1WIUA 4UIMA 4YVUA 4KKCC 4G43A 4JDEA 4YSUA 5GGVL 2YWZA 3VGBA 1B6DA 3BGMB 2GK0A 2CNYA 3LZOA 1MCQA 4OZIA 4HU8A 2PYEB 3QE5A 1W6LA 5FYLL 4UTBA 2XWJB 1H3TA 3OKOB 2D7PA 4YNYA 3NFPB 5AVUB 3WIHL 1AXSA 3FT2A 4APQC 3DETC 5C7ZA 4Y2DC 2UZXB 4WU5A 2R1XA 3G08A 5D1QD 5JMRA 4LE8A 4G8FA 4Z7WB 4MSWA 1KZYA 3CX5K 4DFHA 1YYLH 3VFNB 1OCCB 4CVZA 1XF2A 3QQXA 2J1ZA 3INUH 2OR9H 2KHAA 3H2PA 3NJMA 4P5TA 4ZW7A 1A5FL 5IROD 3VFGL 1U8JA 3L4YA 3VFMB 2GC7C 3MXWL 4OM0L 4XPAL 3H0TA 3O6FB 4UV7L 3PNWB 2R2BB 1JD9A 1FIEA 2R2HA 3BSHA 3BOVA 2O6CA 5DJAB 1A6AB 2WMPA 2HRGA 4PRBB 1MWAH 4GQQA 3G5YA 3IU3B 3L9BA 2XYCA 1EEZB 1I3UA 3T08A 5C0IA 1Z9PA 3CBRA 4OCRL 2AJ3B 1LNUB 4LVHB 2Z92B 1U3HB 5E9AA 3O8XC 3UJTL 1C5CH 1UWFA 3O3DA 1XF4B 4Q9RL 2AGJH 4M1DL 4QY8B 4X6DA 1OANA 1WFIA 3DSFH 3FPXA 1HVXA 3ULUH 1BG1A 3EHBC 3RDTA 4A6YL 5LWYH 2CKBA 1W9XA 1DN2A 3GSNA 4XHQA 4PWHA 3GGWA 1BG9A 5CBAA 5IHZB 4EI0A 1E5YA 4MCZA 5INCB 2CDGB 4X8GA 3F05A 5KN5A 3IMSA 3IRZA 3PXLA 2VIRA 4WUKL 3WMSA 1NEZB 1QFWH 1ZS8A 4L48A 5F2FA 3QC5X 2X4NB 2EDXA 3V0HA 1SJHA 4K3JL 1NGYB 4JBSA 2HG5B 1S9YB 3VTAA 2ENYA 3UC0L 1JF1A 4P99A 3REVB 1QLRA 1CTNA 3CN0A 3ABZA 3FULA 3FB5B 1NFIB 4OGQC 5D72L 4O51A 3KLDA 1BQRA 2ZP0T 3QJOA 3ZQ9A 1DEEA 7PCYA 3EIFA 1JNHA 4XRCB 2R8SL 1CU4L 4M61B 4D8OA 3QA3A 3D2UB 1T5XB 4IW4C 3O2VH 4L0ZA 5J6HA 3UIZA 3LKPA 3LNGA 4ODSH 1B0IA 5EDXA 1SDDB 2VABA 5I1DB 4N2NA 1SMOA 2QBWA 4ODVL 1ILSA 2OYKA 3FTWA 3BQUD 1U8LB 2UVFA 1LDPL 1TTAA 4U3CA 1PNDA 3CDGA 2LR4A 2A4CA 5TF0A 3WELA 1CK0L 3L3JA 5DXWA 1TQVA 5GRZA 3BVUA 2J44A 3EYUL 3C9NA 1R0AL 5EPMA 4LL4A 3T0EC 1F86A 1UQSA 1XGQB 2ZOLB 1KYOJ 3N06B 4KZDH 2R1WA 2FUQA 3BKCL 2JKWA 4L8DB 2K8MA 4NQDE 5CBEA 3PU7A 2OTUB 1NBZB 3D5OF 4W1TA 3V9CA 3GYRA 3SJVB 3WN5B 5HGDB 5CP7B 4TV3A 4MVBC 5DEFA 3FSAA 1KC5H 4FZ8L 2YD4A 3DXAA 4HCFA 3KDMB 1CE6A 3BPLB 2OS7A 4X4MA 5CIPB 5C6TL 1FZKB 1YEKH 5FGBC 1C7TA 2KERA 2K3HA 3CFDA 1OPGL 3L3IB 3MCG1 2YD2A 3H9SB 5IW3A 3VO0A 1MRFH 2IAMB 2QFPA 1S6NA 5LVEA 2NZ1A 3HG1E 1M7DB 4GH7B 4J3VA 5GS1A 4NPYB 4Y9FA 5BS0A 4E9TA 4MS8C 2BW5A 4PR5A 4UDTA 3BN3B 4PB0L 1QPPA 3U2SB 5CMAB 5TQ2H 1GSKA 4XMTA 2NNAB 1OGTB 4QRBA 1G9MH 3N91A 2X9WA 4XO9A 2F9BT 4JO3L 3T0BA 1CTOA 1OAJA 2DJSA 3EO9H 4X99B 5EEUA 2WP3O 2IPKA 3MCLL 2RALA 1RU9L 4EI5D 2R69A 2PABA 2VUOA 3QEQA 4AIEA 2YGVA 1SY6H 1PG7L 2QMJA 4I89A 4YXHH 4PJ8B 4E41E 5HHNA 1DBMH 2P8MA 1JRHH 2J71A 3AUVA 4HKBB 4U0RB 4LBEB 2XVKA 4YHPA 3QDGA 2Z8WC 1UVQA 4BH8A 1KYFA 1I7RA 1CZ8L 4HS8H 3LN9A 1K9TA 3DGCR 4PRDA 2AC0A 1RVFH 2VR8A 5AB2A 3S35X 1KPUA 4QMEA 5E6UB 2YKLH 1T1YA 1NGWB 3H55A 2AXJA 1IBBA 2AXGA 4QGYA 4R7VA 1MLBA 1MPAL 2K9UA 3IGKA 1JGDA 3MODL 2ZCKL 3B7RL 4UTBH 2C1OB 1KBPA 2L7QA 5CLXA 4A66A 5A6LA 1AIFB 3BW9A 5F9DC 4Y88A 3WTSA 3HZYB 2X3BA 2RFXA 1A9EA 2MOVA 3KCPA 3WTXA 1ORSB 1K85A 4HUWB 2CLRB 3UG3A 2VH5L 2X1OA 1YMHB 2CRMA 2ADIB 1GYUA 1KULA 5TQ0H 1RUPL 4H8HA 2IQ9L 3IMVA 5F7MC 2DRUA 3TJEH 3T0EE 4XO3A 3CFNA 3WN6A 4DGWC 2J8UA 2YJLA 5EWIL 1XEUA 3MRDB 5D2NC 3P9MB 1UWEL 5KUMA 3ESUF 2X4OA 5J1AB 1R5WB 2WW8A 4IIQC 5DR5H 5DRZA 3DV4A 2G9HA 3GSUB 5FUZH 5K39B 2ZOKB 1EZVX 3I6GA 1J9QA 1L7IL 4YSDA 1O0VA 2O6PA 1G7HB 1ZSHA 4MMZC 1BBJA 1Q0EA 2ZWYA 3HI1B 1YEWA 5I82A 4EBQH 4X4XA 4G71B 4GKSB 1IAKB 1OL0A 1NUGA 3NCYP 1JCVA 1OAKL 3BAEL 1CICA 3BUYB 3TBSB 4JFQA 4DKAA 3QXAA 1P4IH 2AQQA 4O2EA 4HFUH 4GI6A 2ZXGA 4X6FA 4GXUN 3BHBA 1G1KA 2CKBH 25C8H 2YAPA 3GSNH 5BRQA 3PPEA 3FQWA 2CUAA 2K0RA 1DZBA 3D4GA 2PETA 4QKTA 5I26A 2VQTA 1A65A 3ML8A 4AG4L 2JELH 2NDFA 2P46B 5IBUG 1MN4A 5T3XE 2Y7SA 2JI3A 4UT9H 2YAMA 1HN1A 2WOBA 3IDNB 4G42A 3NJFA 3ARDA 2R2CA 1OQXA 4AZ8B 3LH2H 1T5WA 5DD3L 5C07B 1Y6KR 1UB6B 2BWQA 5HGHA 5IQOA 3IE4A 1ZANH 1GS8A 4JGNA 1R5IA 1PTZA 1LXMA 3D0LB 4WEBH 3Q44A 1FFQA 2ZXEB 1FLTX 5C09A 5C0NC 1YZZA 3Q5OA 1IM9D 1KPRB 1GGUA 2EXWC 4Z78A 3N9GL 4PJ5B 1NDGA 4IRSD 3QAZC 1YNKL 4NCC1 3CUPB 4R96B 4C56A 2VW4A 5I74B 2A77L 2OI9C 4JEGB 2Z31C 4YHYC 2CDFB 5ESQA 3MUGB 1FVCB 4G11A 4S0HA 3TO4A 3ZHLA 4ZSOE 4NQCB 3I3BA 2XU9A 4BYHA 3MFFB 2CDEB 2VERN 3KPRE 4IKLA 4TVPE 5C08D 3RVTC 2ZWSA 2FBRA 4RAHA 5AFAA 1KV3A 2BHZA 1VGKB 2DEXX 2BXYA 5D2NE 4LRIA 1IVLA 4HUKB 5AW2B 2X4SA 2YUXA 1T1XB 7PAZA 1MFDH 1W8NA 5HYSG 1WGVA 2NSQA 3QVAA 3UO8B 4LRNH 3IKCB 3WSQH 1S2EA 3QXVA 2JJVA 2BNUB 4GRLC 3KZ8A 2R15A 2AQ1A 2DQHL 1OWRM 4LFHG 5I8OH 2VM4A 3PWPD 5JPNC 3GS0A 4Z95H 4KK8D 3V0DA 1U95B 2GTWB 2VLRA 4Y19E 1WHOA 2FATH 1BXUA 2Z93B 2DWXA 5ALCH 1OM3H 3WIFB 1N64L 1JMZA 1SMAA 1VERA 5E6IC 3QDHA 3D69A 4J4PC 5KVFH 5KS9E 5I8EB 1H3PL 3FRPA 3V4VA 5HYJE 3QJFA 1RJLB 4DF9A 1HINH 3MLVL 3WTYA 3P9LB 3JZ7A 2WUBH 1A21A 2R69H 1BIIA 4I9XA 1N59B 1BFOA 1GSMA 2AEPL 4FNRA 1HESA 1N70A 2OMVA 4BFIA 3QEUA 3CXDH 1SEQL 1MW2A 1NUDA 3CFTA 1OAQL 1PIGA 3TVMC 2DYRB 3VM5A 4HXBH 4AYSA 4EIBA 3LD8C 4Y1AE 4BH7A 2ZSVB 3L9RB 4WDIB 3VGFA 1M57B 4F57H 4I87A 3MLZL 3PHQA 5F9JA 2QSCH 4PGCB 1WO2A 4PREB 3VYPA 4P57A 1NBVH 1PEWA 2G75A 4FNLL 3MA7A 5TD4A 1MIEH 5H37G 1MQKL 2AITA 4IBWA 4TNFA 1JF6A 3IGAB 5SWZA 4KBPA 3VA6A 1FDLL 4Y8AA 1HSAB 1S3KH 5KVGL 2Y3AA 3KM2A 4OLXH 2BNQA 4WWKD 3D50A 1PSKH 2BHYA 4KGLA 1NCNA 4ELMA 3KR3L 2VDRL 4PIRF 4XMZA 2WCSA 1C16B 2XA8L 4Y5YB 2DQFB 2BOBA 2OMWA 1OB1A 3S36X 1MCOL 4YN3A 1A4CA 1MFBH 5E8OB 3GBEA 4YC2C 1UXSB 4NBYB 3B4NA 4F92B 1X5LA 1Z9LA 2WYTA 1CYWA 3FUIA 3TOPA 4EN3A 2E4TA 5IUCA 5GGSB 3KPPA 3EDJA 3MROB 3G04A 3HIZA 5DEGB 2BSSB 2V3DA 5CEZL 1LE5B 4DOHE 1K5NB 2OL3A 3ARBC 3IDXL 4HJGB 1QA9B 2P24A 1E2WA 3CDZA 3KPOA 4I3RH 4OF7A 3BVNA 3O3AB 4FN0A 3V5HB 5AKTA 3MBXL 4PCTA 5IK3A 2HMIC 1CIDA 3DO4A 1ZHKA 1RUAH 3PGDB 4FTVE 4KTYA 4Y4HB 1BEYL 1PCSA 5GS2D 3FQTA 2F54A 3RNQA 5I5JA 3BQUB 5EO9A 5FIEA 1I1FB 1YYCA 3TXAA 4GW1B 5G2NA 3U30B 4RX4A 2E8YA 4JQXC 5C0DA 2H3NB 4X0KA 2OR7A 3O2WL 1YVLA 3BUPA 1T80A 4R4FH 4I5BB 2W9DH 3RWHB 1B3JA 1T4KB 2B3RA 2WWMD 4U1MA 1SMDA 3GSQB 5DJXB 1K4DA 4R2GC 1X5YA 5GRVL 1B4JH 3UP6A 3U82B 1QSFE 2BIIA 1KNOA 3QHZH 4J6IA 4NS0A 3KPQB 3MLYH 2EE6A 5C3IA 5CFHA 5IJCC 1ORQA 1TFHA 3IXTA 4Z1PA 4NNXB 1IBYA 1Z9MA 4FFVC 3MU3A 4OJCA 4R97C 2OMUA 2ZUTA 5D7EA 3FB6B 5MEQB 2Q5BA 1MCDA 4M1GL 5J12C 2VLKA 3EYOA 3KYAA 2OCJA 1SZNA 1DN0A 3IDGB 4G9DA 4Z7OB 4E9QA 3KPLB 1X44A 4YS4A 4BZ1A 1RZIB 4FLQA 2FCBA 1K4CB 4HDIB 3ZY7A 4Z7NE 5DQDL 4BXVA 1Q9KA 3WY2A 2IWKA 3IPFA 3UG4A 2O61A 1NFDA 4JHVA 4R7DA 1FL6B 1ZVHA 4AMKL 2CLZA 2A9MH 1E90A 4TF4A 1NC2D 2DQUL 3F83A 3CN3A 4NWUH 1A14H 3KLAA 4Z7NF 4PRHD 1OAZL 3GSRB 3PXJA 3QCUH 2V17L 1UD3A 4KXZI 1DBJL 5B8CA 4WI3A 2DWDB 4UAHA 4GXFA 4KTEH 4EI5B 2VSKB 2R39A 3FQUB 3DUHA 4UV4H 4J3OC 5DZNA 2ED8A 2GJPA 3TNMB 5IFAL 4Q6KA 2BXZA 3KGRA 5HGAA 4DPAX 3VDCA 4OLZL 1FFOA 5E2TL 3GBMH 3MBWB 3NZHL 3QUXA 2A73A 3ZRSA 1DQLL 4YH6A 4BRJA 1NBCA 1EV2E 5HJDA 3ZTJG 2DLTA 3FO2B 2NY0C 3G9AB 4JFWA 1RZKH 2EVFA 4ZX6A 3C2AH 4P2YA 5J57B 4DAGH 2I27N 1CYGA 4QHMA 1I85A 2QHRH 4MQXD 2EO9A 1OHQA 4DEPC 4NI3A 5B7EA 2A74C 4GXVL 1JPGB 3VYOA 4Z3IA 1K5WA 5I6MA 5DYFA 4NQXB 5I1CH 1TITA 5ICXA 3S88L 3CHRA 4Y4KC 2DKMA 4DP2X 1ROWA 4JGMA 4XCFL 3TFKD 3KPNA 1H3GA 1NOAA 3GI8L 4ODHH 5FECA 5K9KB 4PJ9D 4TTDC 4WGKA 1JDCA 1QKZH 1T4WA 1CFQA 3LN4A 2OW7A 3V4VH 3RNKA 3UTTD 1FBIH 1NCHA 1XAKA 2VLME 3NFNB 3TV8A 4OCXL 1Z7JA 1ZS2A 3AG3B 4F91B 3WD5L 4P23A 4BKLB 2AEQL 3CX2A 2GBTA 3FZUD 1DVQA 2LU7A 4LMQE 2WPGA 1UGNA 3ATAA 4XXDB 5MERA 5KBDA 3AABA 3OWEA 4Z77A 1F56A 5D7JA 4BUGA 1SF5A 4BUHA 1OLZA 3F01A 2XN9D 2OXGB 4S1DC 1PX4A 1IBHA 4J3OG 4Y5VC 2E7LC 2HKAA 3K8MA 1MHPL 2BSBA 3PQYD 5AZUA 4GI9A 4D9LL 4U1SA 3B56A 3KPSA 4ZZFA 2FD6L 3ZHFA 2XZQH 4PJEB 2C9XA 1WAAE 2ZG3A 4L2LA 1XD1A 3U7WL 2NR6D 3GJEA 3ILPA 4L0YA 1NJ9A 2C4XA 4U05A 4IU3A 1D9KD 2YUWA 3LKOA 3WNMA 5I5IA 2AMGA 3PWVB 1GZQB 1ZHLB 4XHJC 2IXQA 3FPYA 2OZ4L 1ZPUA 3QZBA 1YMMD 4L37B 1BAWA 3QNXA 1IGJB 1XMEB 2CM6A 4I0PB 1WAAF 5ITBH 3F12B 3D34A 2YHGA 4C4UA 1W80A 3N6YA 4XR8C 3L3HA 5E23A 1WH0A 4NRZB 2FO4B 5BPPA 2ITCA 3RZCA 1WZAA 2OMTA 3CFKB 5I73B 3F7VA 4Y2OA 2YD3A 4XCEB 3Q1SL 4MZ3A 2DIEA 5F3HA 5JQHC 2WXMA 3HFML 2OSWA 2WXOA 3VJ6B 3K74B 2HYMA 2FBJH 4Z7VE 1IFHL 2TRHA 3L5WB 4LQ1A 4JCMA 3RVVC 3L5XL 4J3OF 4AT6A 4UOW0 3ATDA 4LHUG 4XPFL 4KZEH 4XAKD 3RIAF 2OL3H 1IM9B 1Q0XH 4XVTL 4LAJH 1S7TA 3VB9A 4LLUB 2DBJA 1KIPB 1KYUA 4PJCE 4R7LA 3TESA 4Z7VF 3AXLB 4BGDA 1A7QL 1A8JH 7FABH 4HS6A 4I85A 1FN4B 4MB5A 5D7SL 3IDYC 5H35B 1A02N 3G6DH 1W72A 2KH2B 3HZMB 3MV8D 3QRBA 4IRSB 5E2VH 5HDBB 3T6VA 3ZL4H 2Y1YA 1JZIA 2XZCH 5KYUA 3LPOA 4FYTA 2FGWH 1YEGH 4U1HB 1OTTC 1UH2A 3EJZC 4PJCF 3W81A 3T0WA 5I0VA 1BVKA 4WNSA 2ZXWB 3P73A 5FF6B 1UD6A 5DFVC 1IARB 1IBZA 3OKDA 8FABB 4KJQC 4PG2C 2BWIA 4OUUA 4WU7A 1NKRA 3PWNA 5C08B 1ZGLP 5JUEH 3BH9B 3SE4A 5DHDA 3W9DA 4F1ZA 3X3FL 2VT0A 4K9EH 2ZKYA 2KPWA 4NM4L 1WFJA 2B4CH 4JKMA 5JNYA 2CCVA 5AYQA 5T3ZE 2OV0A 1P7KA 5AW7B 1JWSB 1EZLA 4PGEB 2NNRA 4WJKB 5LHDA 4H20L 3QS3A 2JI2A 1WZ1L 2EEAA 3RVWD 4WW1A 4NKIL 3BP7B 1IJNA 1GYWA 1R1CA 1YECH 3PWPB 4KJWC 1A6TB 4KTDH 1LE9B 4G80B 3NZUA 3EW3B 1QUPA 2FL5A 3V7AG 1F8TL 1M9WA 3BSZA 3OZ9L 2GITA 5D7IB 4HV8A 3BT0A 3FOMB 4JB9L 3IRCA 3SY6A 4GW4A 1OK0A 3EXJA 2GK2A 4ZMQA 1DQDH 2H0PA 4DHLA 2BSEA 3B1TA 1S7QA 3LSOB 3QDAA 1KB5B 2EIKB 4CNIA 2B59A 1YRKA 4G9FA 3BE1H 4JG9A 1YUHB 3PP3H 1Q1JL 1HE8A 1ZV2A 1UJ3B 2NUPB 1KOAA 3NABL 1PJWA 2XXMB 3DIVA 3F62A 3FFOA 5GGQH 3SSGA 1I1AD 2K8QA 1L3NA 1BQHA 1R3KA 3Q43A 1RIVH 4NUQA 4PJHB 5IBTH 2YFNA 4P4KC 1CFBA 3TBTA 2EXTA 2K7PA 3O6FC 1IQWL 1T21A 1BM3L 5DS8B 3QJXA 4ZFZB 4ADIA 3V7AE 3W57A 1CI3M 1J86A 5AOJA 4NT6B 5BZWB 4Z18A 3FCTA 2VDPH 2V2TB 3KVQA 2JCCB 4GKZA 4YDJB 4N2KA 4XI5D 2QPDB 3QPXL 3HC0B 4MNGA 4AITA 4CVUA 3OLDA 4LVHC 4OBSA 1U3HC 5DHYA 1ZT1B 3EDFA 4UQ9A 1OP3H 4TNWK 4UQ2B 4XNXL 1S5HB 4GAFB 1YNTF 2HVJB 1J87A 4XTRC 4IBYA 1JHLH 3MRRA 3JWOL 1GXEA 4JMNA 4QAWA 4CC4C 5F7EL 2GJZB 5E5LA 5F96H 2F19L 4PJDA 2B0SH 4FKEA 3VI3E 1NCTA 2WLMA 5IVXB 1FG2A 3JT2A 2P5WA 3GKWH 2I07B 2PYFB 3WI9A 3VXSB 3CGTA 5CUSH 1TZ8A 5G5DA 2H26A 1A4KA 4EIZC 3B9DA 4RMSA 4ABWA 3VI3F 1NH6A 4WFHE 3V8CA 2K4WA 2GB2A 5DI8A 5B38B 2VDKH 2BRRL 2EVJA 1TQTA 2YO3A 2DLIA 3HZVA 4P4RA 4QGTA 4P9HH 3N1GC 4W68A 5LBGA 1VFAA 5IEHB 5F6IC 4DPCX 1AHMA 3CHQA 1B0GA 3LNFA 1FPTH 4OFYD 4GG6B 4G6JL 3WKMH 3CZGA 3GLAA 6FABH 4QAMB 4G7QB 1E7VA 1GJWA 1RZ8B 4N2EA 4PJXB 4PV9B 2VLLB 5I1KL 4P3DA 4OF5A 5FUCC 3A6CH 4P2QA 5AZ2H 1VSCA 2DQJL 5ITFA 2YJQA 5CD3A 4NJ9L 2PTTA 3VSQA 4CRPA 4M1CC 2AQRA 2MCPL 3P0YL 2QQNL 4BGLA 4HAFA 4Z7WE 5FYJU 3QG7H 4DQAA 3GK8H 3KBEA 1R75A 5LN8A 2DDQL 3OKMA 2WLZA 2FZ3A 4OZ4B 4DKFH 1NICA 3AAZA 3B7SA 4DN3H 2DS4A 3G6JB 3BH8B 3VTTA 1P2CA 4Z7WF 2ZONA 1EAPB 5CEXB 1F1GA 4QRFA 3I6LE 3I6KA 1S7XB 2FJHB 3BWAA 3WN5C 2IAND 1NMBH 2LLLA 2QGDA 4L4VA 2Q6WA 4Z76A 4XXCA 5L2KD 3BPLC 4GQ9L 4HJJL 1BLIA 2B3IA 5HTSA 4NKQB 4APXA 5CILH 3DX2A 1N5AA 5B21A 5I18H 2WP3T 2AAAA 4X5LA 4G8GA 1HQRB 2VR7A 1W72H 2NY5H 4Q6IB 2XX0A 1D5ZB 4BIKA 2RMNA 4M5ZL 2Z34A 1NC2B 1M56B 2YEZA 5EOTB 4PRHB 1TEGA 4UBDD 3WS6C 2VISB 1Z9OA 3MMEA 1XF1A 1ZTXL 4G1MA 1AYOA 4X6CE 1HILB 2IH3A 5CLYA 3STZB 1J88A 4TLKA 5K9QG 2C1PB 2EILB 1EWHA 2GSIA 5KJRL 3U4BL 2FECL 1SN5A 3RQ3A 4F7PA 3HN8A 4X6CF 2P48B 3O9WD 3OMAB 4PJ8C 1G6RA 1G7JA 3QUHA 2JQMA 3NTCL 4M4PA 5I30H 4OGXL 5T1LD 4DP4X 2Z8VC 1IGIH 3LXUX 1A6PA 3DROA 1G7PB 5AALA 4KNSA 1CFTA 2Z7YA 4OLUH 3TWYA 4A63A 1OE3A 1H8SA 4JJ5A 3TH4T 2RAMA 3CVIL 3J7HA 1PZDA 3QR0A 4IMKA 1PD6A 4AEEA 4XN4A 4RAUB 5JPMB 3GUTA 1AZCA 1RHHA 3BSZH 5FUCE 3ZDZF 4JM2A 2X4PB 3UYRL 2CJSA 4HXAH 3Q8AA 3LXCA 5L8KB 1PZUB 3HR5B 4CADB 4WLCA 5E5MA 4PJ9B 4NKMB 4ZPTA 3KNBA 4KK6C 1WT5A 4DVBB 1ERNA 1JPST 4OF8A 3UTTB 3IXAB 3RPKA 1E4XH 4XBGB 2FLMA 4BFBD 3PUCA 4XZUB 4F8QA 2PW2A 1CLOH 3N50A 3V9EA 3VMOA 5JHLA 1LEKB 1TG8A 4NUGL 4IBZA 3A22A 4PIBA 1NANH 2YRZA 4MA8L 5DQJA 3KPRA 1OO2A 4M7JH 2IPTH 3S4SA 5FKPB 3WFBH 4K3EL 2FX8L 4K3DL 5D4QA 1TEFA 5PAZA 4RRPA 3SJVE 4ELDA 4QTIL 1OF2A 3LRGA 3X3GH 1DSYA 3PQYB 1S7RA 5J5EA 4ZOBA 4F7EB 2RCSL 2ZP9A 2ZF9A 2WXQA 1ZGLA 4JKPL 3WO4C 1ZLSL 1F4WL 5E8DL 3WFDH 3AQDA 3CZFA 2YAEA 4AYEC 4CVWA 4FD0A 1DVZA 1D9KB 4F8NA 2C3VB 4YSCA 3VACA 2R9HD 4NYLB 1IGYA 4JFXA 5E4IA 1YMMB 3K6OA 4RMQA 3SQRA 4GIOA 4HH9B 4ODTH 5GSRA 2GIYA 2YKKA 3L08A 3BIAX 2ZX9A 5DMKB 1ACCA 2A4ZA 3ZKQD 3EFOA 4L29A 2EIDA 3NJXA 3NCCB 2W07B 3NCFB 2TSBA 4RFNB 1GC1H 5LG1A 3WXVL 4HOZA 4Z7UA 8CGTA 1BA9A 2AV7B 3D85B 1GMEA 1IM3A 2PWDA 2VN3A 3FFDA 6TAAA 3FSZA 3ZDWA 4LLMB 1XXFC 1BFTA 3K6DA 2Z0BA 1P4UA 2VR6A 2Y22A 4WV1A 2OP4H 4PRPA 1JMXA 1KIUA 1D5BA 1MCEA 3RTQA 2CM5A 1EERB 1AGBB 5E2WL 4EMZA 3NDZE 2IC2A 3UZEA 4CKQA 2HT4D 4OZFA 4X80H 3MV8B 3DMMD 3GMRB 4IGBD 4EVNA 5BV7L 1F58L 1O7SA 2D2OA 2NYKA 4LSRL 1IC7L 5DJ6B 3F58L 3LCYA 3P9WB 4M02A 5IIEB 1SJEB 4PP1D 2E6QA 2QKIB 2IO5A 4MFHA 2VXTL 4B9YA 1CF1A 1YEFL 1CDHA 3EGSA 1P4BH 1V8HA 2BY3A 3OR6A 3L1EA 4FQHA 5BW7A 4Q7DA 3QZWA 5FFGA 2Y36L 2FGZA 1HHHA 5C0AD 1AAJA 1I3VA 3FOLA 1TNNA 1LWJA 3A4FA 4JPKH 3F3HA 4L8BB 3KWVA 3MLRL 5LGKA 4Y5XA 1JXGA 1ND0B 3MJ8A 5ANME 4OT1H 5ESAA 2VMJA 3LZRA 3O3UN 4URKA 5ILTH 1ZWIA 5E8NB 1QASA 1GY2A 4K9JA 4B5ZA 1H6FA 3P40A 3QFDB 3WDJA 3MXVH 5CSZB 4ZDHA 3RU8L 1KYOK 2N3JA 2XG4B 3O45B 3DGGB 5BMFL 2EO7A 1N6UA 1XXDC 4PJFB 5JOFB 1D7CA 2Q2LA 1UD2A 3SOBH 3UX9B 4AW4A 4UB0L 4ERSH 1VPOL 4QT5B 2PNDA 3FU5A 4QRRA 5I66A 5FYKD 1AZVA 4PQXA 3VNYA 2AMUA 2MQCA 1RIHL 3IN0A 3P4NB 3Q0HA 5DD5L 2Q76A 1HE7A 2NOYA 3BVDB 3EJUA 5D1QC 1KIRA 4FLSA 4NHCL 5FYLD 4JY4A 1U8MA 1I8UA 3CVHL 3PDGA 1FL3B 4LIQH 5EBMB 4ZMTA 2AK4B 1QQDB 4LCWA 2V7NA 1GAFH 3D4CA 5MEPB 1CL7I 1XCQA 3BIKA 5EZLB 5IROC 2DYSB 3MYZA 4LDCA 2VXQA 4P5MB 4OGYH 3T2NL 2CK0H 2HPTA 3OSVA 3S34H 2H6UA 4ZW6A 2JJWA 4LLYB 1U36A 4WUUB 1D3CA 5C07E 1QSFA 5T3XH 3G5XA 2UXVA 1G6RH 2WWOA 3ZKXB 2VAJA 1UWXK 2VC2B 4FL4C 4FXGA 1UA3A 4FYQA 2XVGA 1KZQA 5DUBA 3FB7B 2J6EL 1NA8A 3FBKA 2R29A 4XNMB 3UJJH 3PWJA 1E67A 1QWNA 4NDMB 4RBPK 1EHLH 1SPDA 4R4BB 4X9FA 2F2HA 1FO0L 3K72B 3JVGC 4YJZL 2CJUH 1J1XH 5IB5B 5HHOD 3M17A 2EINB 1GIGL 2ZCLH 2V5SA 4QYAA 2H1XA 1IBGL 3NVQA 5LGHH 4OI7A 1E2VA 2H0JA 3B6SB 4FQPA 4IDLA 4O58L 4XODA 5DTFB 3MCKB 1KPVB 4P5KA 3LS5L 3VNZA 3VXPB 5TDNA 1CCZA 4M9OA 2LOEA 3CC5A 4GAYA 1KCWA 4WTWA 3H2QA 2COQA 4PYHA 5AW9B 5JHLH 2O93L 2OX5A 4GAJH 4K5OA 5DYOA 1MY5A 3CFBB 5FFLA 1D6VL 4B0MM 1QP1A 3TN0B 4JO1H 1NC4B 1PZSA 1Q9LB 2TRYA 4JQIA 3ECUA 1XF3A 4HIJA 5AEAA 3T8XA 2GJ6D 1CGUA 3RIFK 4H25A 3EO1B 4HPOH 4OCYH 3QEGL 5BJTA 4BE5A 3MRPA 1WAEA 3EYVB 2VRQA 3Q3GB 1NCCH 4LXFA 5GRUL 2HJKA 2EVGA 2OJZL 4K7PX 3AUWB 1GHFL 3CG8A 1WC7B 1XGZA 3L1GA 4HAKA 1PJ9A 4UTAA 4EDXB 5D1ZA 3FYIB 2Q3AA 3CVCA 3KXFA 1KCUL 3BQUC 5D1QE 4NWTH 3KS0J 4DZBA 1HKLH 3ZJAA 3CFUA 4HYTB 2AANA 3NSYA 12E8H 1JUFB 2R0ZH 2VQ1A 3MC0A 5BQDA 4R5VA 2X0VA 1F0LA 3NAAH 4LSDA 3ESVF 1GGIL 5A2LH 5F6HJ 3QBTB 4YR6A 3SY0B 5EBWA 3OMNB 1RZ7H 3TIEA 5CSBA 3UBXA 1ZE3H 5I1HL 2C5DC 4RFEA 5F3BB 3UTSA 2IANB 2BP0B 3JT0A 5AW1B 4BA8A 4FP8L 1AS6A 3QUML 4PI0A 1HNGA 4W4NA 2X10A 5L2KB 5EBLA 2N1KA 1UM4L 3CIQA 4NFDA 1H0DB 1NFAA 3CPUA 3SKOA 2XKNB 2DMHA 1Y0LB 4YBHA 2QVIA 4N28A 3ZR5A 2CIKB 1XL6A 2N59A 1X7TA 2Y5TA 4RZKA 4BFJA 1P6AB 4YE4L 4DO5A 1DBAL 1XTMA 2EQDA 1T0MB 3QRGH 2KPNA 4OZFH 1P9MA 4JFED 4UINL 4XBEH 1M3JA 1G94A 1UATA 2XCMC 1TMCB 4XP5H 1UYWL 1RUML 3D3VA 4YDIH 4YPJA 3ZW3A 4HU2A 4YQXH 3II3A 4D0DA 5DHVH 4ZUVA 1FSKC 2Y07H 4WCYL 2V9TA 1A6ZB 4EI5C 3JV5A 1JHKH 1M1SA 1YN7B 1ZV5A 3NIDE 3R06B 4UILH 4D8PB 2P5ED 3OKKB 3A6BL 2XWZA 4C47A 3WEBA 3GMMA 5T1LB 1DO6A 3CHXA 3IETB 3NZSA 4K7FA 4KITB 3ARQA 1A2YB 1KTDB 2R2EB 2XZAH 4JL1A 3N1PC 3SE3A 4UM9B 1ZLDA 3EJJX 4E9VA 4AJ0A 4Y16D 4Z3GA 3HN5A 4ZS7L 3NIDF 2K6WA 1E8WA 1VFBB 3EZ8A 4XXWC 4YEFA 5IESL 2UWEA 1PD1A 2VL5A 4N0UB 2JKSA 3PWUA 4PMEA 4POZD 3CIAA 5F9WB 4MNHA 4Z3TA 2X1WL 4XB3A 1QSEA 1S7SA 1MJ8H 2F74B 3LQAH 4PJGA 4PVLA 1X5KA 3NRPA 4J28A 2BY0A 3FRUA 3W0WA 3NSXA 1GA2A 2ID5A 3GDBA 4LCIH 4N2CA 5SWQA 2FRGP 4ZUSA 2E9JA 1SHSA 4KXBA 1BQKA 1LL1A 4GRWH 1YCSA 1J0JA 2K70A 5IOPB 1YYLL 4KFMA 2L7UA 3GMQA 1TKWB 4NKOA 1U8IA 4FHBD 4ZW3A 1CWVA 1CDYA 3INUL 3L4ZA 2OR9L 2X1QA 3LYRA 5TTRA 3WJLA 2PXYD 2ZUWA 1PF3A 2WXKA 2VXQH 1I1RA 5D5MB 4HEPA 5I16A 3US9A 1W0WB 5IF0A 3UTQA 4OV5A 3GB7A 2R7EB 4GB9A 4NB7A 4YLBA 3HBQA 3S48A 4RSYA 1HJBC 5IQ9A 3RWIB 2BIQA 4KKAD 1MWAL 1X5IA 2G60H 4NQQA 4TSBH 2R29H 3RHWK 3BVVA 5F0LB 1F6AB 3N40F 4OFVA 2CR3A 3MNVB 2G5BB 1C5CL 1ZSDA 5HJBA 4PJIE 2VZUA 3P4OB 1QUNB 2AGJL 2JFCA 5I1LB 3DSFL 2A6DB 3D25B 4FFZH 4PGJA 1FV1A 1HHGB 1XGUA 5EN2B 3ULUL 3FT4B 3DVGB 3QUZB 4U3SA 5JXEC 5LWYL 1O5PA 2C9RA 2K1MA 1GGYA 3H6AA 1HOEA 4PJIF 3B9EA 3TO2B 3VWKD 3QEHA 2WUCH 5HY9B 1OF0A 1UA6H 2MOGA 5F7WC 2QHLA 3O81A 1QFWL 2CO2A 4F2EA 5I73C 3WY3A 4HC1A 2QEJA 4LLAA 1QI4A 2C8NA 1KDJA 1G7MA 5HVHB 3HB3D 3P02A 3QARA 2PW1B 3QB7C 5CHNA 3WJJA 5EZJA 3RBSA 4JQIH 3FUNA 2HVBA 4BCYA 3UPRB 3VVVA 3U1PA 1WCQA 4PP2A 4KVCH 2QPSA 3DMMB 4IGBB 2BMKA 4BQ8A 1ZXKA 4XOAA 5IG7A 1JYVA 4HHWA 1IC1A 3O2VL 3LRHA 3G6AA 1HXYB 3G3LA 4IRSC 3ZOAA 2NY4B 3FT1A 4UTAH 3IJHB 4Y89A 3MTRA 4D9RD 3LN5B 4NPKA 5DDHB 1LILA 4HLEA 4XT1C 1AD9B 4JN2A 5IMKA 1M9SA 2G3XA 2J1YA 2GIXA 4WAFA 5C0AB 4ZXBA 2WM0A 2F08A 4PJBB 3EKCA 3GHBH 4N8VA 2W0LA 2M83A 4U7SA 3L1OH 3UTPD 4AGLA 4HBCL 2VZ3A 4GBXA 1CFNA 1RZFH 4KZDL 3O3EA 2HP4A 3K6FA 4PBDA 1W8EA 4NZ8A 4QUOA 2EABA 2I9TB 5T1KA 3SDCA 4AI7A 3US0A 2HVKB 2B7DT 4W9LC 3ZTJH 2DWYA 2EYRA 3VD4A 1KC5L 4DW2H 3MTXA 1AH1A 1ADQA 4A7GA 4E9XA 3MGOB 1A9VA 1YEKL 4JO5A 5EHFA 4BCZA 4CVXA 5DCCA 1MRFL 2XRAH 5A6IA 2GCYB 2UXFA 3MAWA 3ZX1A 1HYRC 1RULH 3AU1B 1R47A 4AYBA 3ZTNH 3RL2B 2PYEA 3B5TA 4OLEA 2WVVB 4JDZB 4KROD 5DUJA 5E1AB 5TQ2L 2KBGA 2YMOA 1G9ML 1JPFB 1LO2H 2XWJA 3AQXA 2OBGA 3OKOA 3NFPA 4FJ6A 5KSAB 3U48A 1YN6B 1OTUD 2UZXA 4PJ7B 3VD0A 2D31A 2ATPB 3EO9L 3IDJB 1KELH 1N3NB 3VFNA 3BLBA 5F6HI 3QWNA 4NQEE 4OZGB 5LGYA 4EKJA 1SY6L 4YXHL 1QFUH 2NYYD 1DBML 1UKSA 1JRHL 2F8OA 5D96C 3U1SH 1EQWA 1I7TB 3VFMA 3WKPA 1EMTH 3O6FA 4HS8L 3PNWA 2R2BA 1NPJA 2EDKA 1RVFL 5DJAA 3OC8A 4Z0XB 4PRBA 4ZO9A 4G5ZH 2PR4H 3KCWA 1GY1A 2YKLL 3IU3A 3VYNA 3E9UA 1EEZA 5HI4D 5HHOB 5F89B 4RAVB 4S2SB 1A25A 5I23A 4YZWA 2AJ3A 1LNUA 2Z92A 5LBVA 3TCLB 4UTBL 1BHGA 2M8XA 2ZAGA 1YPZB 3SPGA 1XF4A 3MRJA 4WWKC 1IE5A 4QY8A 3V6OC 3KD4A 3LS4H 3N41B 4FNPA 1T6VN 3ATEA 3HE6D 3HNVH 4WO4C 3WUWB 1MFCH 3QT2A 1D7DA 2J12B 3A3YB 5C08E 5IHZA 5TQ0L 4X7TB 4X7CC 2YMXH 3K46A 5GZND 5INCA 2CDGA 5MEND 4B5EA 5FW8A 3TJEL 4V11A 4DTGH 1NEZA 3VX0A 4N8PA 4H8UA 5KW9H 2X4NA 3RWCB 5DR5L 3R18A 1NGYA 2GJ6B 1ET8A 3RE0A 5J11C 5FUZL 4M62H 2HG5A 2XQYK 5G4OA 1S9YA 4S1QH 5FGCE 1LO4H 1S8DB 2H45A 5CP3A 1TJIH 3REVA 4KKLD 3KPMB 3DI2B 2FBOJ 4FERA 4GYBA 3FB5A 1NFIA 3U6XS 4WHYH 3O6MH 4EBQL 4MA7H 3ZE1F 5CEZD 1MSPA 1UT9A 3AW5A 1V05A 1I8IB 3B5HA 4XRCA 5D7IE 3EBIA 1P4IL 4M61A 1GTFA 1W0VB 3BDYH 4OTXH 3L4WA 4HFUL 4IOFC 3HNTH 4HKZB 4G8IB 1HAWA 4HZAA 2NTFB 1S7UA 2CKBL 25C8L 3GSNL 4FQLH 5I1DA 1MFAH 3P69A 3EADA 1OV8A 1K8DA 3A23A 1UJTA 5D7IF 5JW4R 2DQGH 5AW0B 1JNLH 1A3LH 1U8LA 2NX5E 1Q0YH 2JELL 4JHBA 1RJZB 4UANA 3E2HC 3ZDYB 4KDTA 4FHJA 5BOZG 4UT9L 1KFGA 3BI9X 4HC1H 3DVIA 3LNDA 1HQ4B 2VLJA 2DD8L 4BE6A 2A5UA 3LH2L 4PTTB 3TT1H 5KG9B 1XGQA 2ZOLA 4P2OC 4B53A 4UQBA 5B1JA 2OTUA 2XSKA 1NBZA 3RIKA 1ZANL 2C9AA 3CSBA 2QGCA 2VERA 2UYLA 3KJ4B 3PHAA 4QRPB 3WN5A 2EDQA 2DIBA 4WEBL 5CP7A 5HGDA 1HJCA 1D5IH 3FU6A 3HS8A 3BZEB 2JCCE 4L4JA 2ZWZA 1J8HB 3KDMA 4NHUB 3TEXA 4JFEB 4EZKA 2NY2D 5CIPA 1NMAH 1FZKA 4WF7A 2QELA 2GI0A 3L3IA 3H9SA 3GMPB 4Q6IC 2IAMA 1J9TA 1DR9A 1V7MH 2JCCF 2BCMA 4NPYA 1JN6B 3V6OE 4PW9A 4FDWA 3PV6B 3RIFF 1YEDB 3MV01 4YSEA 2F53A 3U2SA 5CMAA 1K72A 5IT2H 2NNAA 1OGTA 4ENZA 4WKZB 2P28B 2X9YA 2Y7NA 3W11C 2UY6B 4N2BA 5INDB 1E9QA 2P5EB 4KXAA 3TZVD 2FEEL 4JZJB 2BH0A 1HU8A 4JRYA 4X99A 2JTYA 3QIBB 3AGVA 3TX4A 2VDLH 1RUQH 1I8MA 1BVNT 4R0LB 1MFDL 3KHOA 3QUGA 4Y16B 4PJ8A 3JV0A 4HKBA 1ADQH 4LRNL 3OTTA 4IK7A 4LBEA 3WSQL 5AW8B 3U6RA 1BGXH 4GG6E 1FNLA 1DE4B 3AB0C 1O6SB 5I8OL 1KLGB 4Z95L 2P45B 5ISZD 4GAGH 2V4LA 2EE9A 1NGWA 2FB4H 2KC0A 2FATL 1SF3A 3DX6B 4UNTA 1RUKH 5ALCL 3TFKC 1OM3L 2GTZB 1MF2H 2IGTA 3X1FA 1ITBB 4JRXB 1WFOA 2HSIA 4KJYB 3WIHA 1QRND 3CD4A 1WUZA 4JFFE 1AIFA 2PCFA 1G5GA 4BHUI 3HZYA 5JHBA 5ACZB 5KVFL 1GGTA 1U4FA 2PXYB 1ORSA 1TZHA 4M56A 5MEOB 3O0RH 4HUWA 2CLRA 1KWGA 1HINL 2IBBA 1YMHA 2JMRA 3IFNH 2ADIA 3FZUC 4OD2A 2WUBL 3T09A 1Q9OB 2R69L 3UBGA 1UD8A 3PFUA 1JZEA 2Y6SD 4ODBD 3BPNC 3CXDL 4OJDH 1IFRA 4DPRA 3AU0A 2XQ0A 4IM8A 3MRDA 1M53A 2IGFH 3EDDA 3FONB 2L8AA 4P3WA 3TS8A 1I75A 5J1AA 4F8PA 4HXBL 3GSUA 3MRLA 1U8OB 5K39A 3TCXA 2W81C 5EU6D 5KOMC 4F57L 5FAAA 3IJ8A 2P8LA 3TA4D 1I4FB 1BQSA 1G7HA 1MHHA 2QSCL 4HK3N 3SYAA 1J8SA 3HI1A 4LPCA 1NBVL 1B2YA 3C87A 1FYHB 2DH2A 1DVFD 1MIEL 2NR6C 3SGJA 3VTMA 2NMSA 4LLQB 2FHCA 2XNAB 1OE1A 3LKNB 4GKSA 1IAKA 3BUYA 4ZTPH 2P5PA 3TBSA 4PRHE 1B0WA 5DK0B 4LOUD 1S3KL 4OLXL 1NFKA 4FNUA 1PSKL 1PKQB 3VWKB 4HKXB 2H32B 3NP4A 4PRID 2Y72A 2Z64C 1V27A 3C8DA 3R4RA 4JJOA 5DMIH 3PFQA 1HDMB 4TUKH 2K9FB 3AXHA 3BZ4B 3FFCD 2C9PA 1MFBL 4XPTH 5IOKA 3LRSB 5GS0H 1ID2A 1EUUA 4K73A 2OCCB 2VSCA 5EDSA 4X4KA 3IDNA 5E5UB 2CH8A 4W9HC 4AZ8A 2WBJD 4L3FA 4ZW8A 1WA2X 5DMYA 4HIXH 1UB6A 4L9LC 43C9B 3ES6A 3L1FA 5CP3H 5JW5B 3D0LA 4I3RL 3RFRA 1GS7A 4FXTA 4RMTA 5FKAB 4MXVE 3DX8B 5LN4A 4CMMB 3Q8EA 1X5FA 4UAOC 1NCDH 2HT2D 4I2XE 1KPRA 4AQOA 1RUAL 3NJHA 2PPCA 5ERWA 2DEWX 2NPLX 4LDEB 3OHMB 1XB6A 3EH2A 5DD6B 4HLJA 4KK5D 5EO1B 4FADA 1RZGA 4A68A 2QKIC 4PJ5A 5DZOA 4MXVF 4HJ1A 4L3AA 4ODWB 3CUPA 5AAMA 4R96A 3ZO0A 3UTTE 1H5BB 2FT8A 1DJYA 4R4FL 3UPCA 4JM4H 2CDFA 2W9DL 3MUGA 3OPZH 1FVCA 1T04A 1F4HA 2WXLA 2X09A 3T6ZA 2J88H 5FYJH 1R34A 1WTGT 1B4JL 4NQCA 1LLAA 3MFFA 1NCWH 4Y1TA 1RZJC 3QHZL 2WINA 5IMMB 4FXKC 1DBKH 1FLRH 1E4WH 1L5GA 3BLKA 1LYQA 2XN9E 4FG2A 1H9DA 1VGKA 1MRCH 3PQYE 1H3VA 4CBZA 1JHTB 3C60B 1T1XA 1IRAY 2GHWB 3R0NA 1CYXA 3RVWC 2RTTA 2X2JA 3UYOD 3KW7A 3QQ9C 3N1QC 3L3DB 3LZLA 3SKNA 3CN4A 3IKCA 4N2LA 3GEWB 2BNUA 2I26N 5CIPH 1R5VA 1HEZA 4GQZA 4XBPA 4P06A 4HJUA 1U95A 2QSTA 4P3CH 2GTWA 4G72B 3T4AB 3MHZA 2A9ML 1F3DJ 2Z93A 4NWUL 1XIWD 1A14L 1JVOA 1JPSH 2JE8A 4N2HA 1UADC 3WIFA 4ZYKB 3QCUL 3ETTA 4KTEL 2IDSA 2AP2A 1FVEB 1I1AC 1WBYB 2H47C 3APDA 4I18C 5I8EA 3VGAB 5BNXD 4UV4L 1RJLA 4J6RH 2XXGA 1NBYB 2ESVB 3GBML 4L4TD 1EH9A 4GO9A 4BKTC 3Q6GH 5HBBA 4LB8A 4RMWA 1MCPH 3ZKXC 2F15A 3ARYA 5JLZB 2SEBB 2BOCA 2OSLB 5GJTH 2OAAA 4AGOA 4XI5C 1Z9NA 4DT2A 1AQ8A 1RZKL 3MRKB 2K6ZA 3ABLB 3MLSH 3AG1B 2ZSVA 2DQDH 2V3FA 3L9RA 1S7WB 3DUSB 4WDIA 4XWOD 4DAGL 2X5PA 5CU9A 4JN1H 4PGCA 4PREA 1ZT7A 3LPGA 1WITA 2QHRL 2NYZA 2ZYHA 3RPIB 4AL8L 3MRFB 5I2IB 4FNSA 2B14A 3HE6B 2WNXA 1E6JH 5I1CL 1J0HA 5K59E 3ZYJA 5IHHA 2ICEC 4L1BA 1RMFH 4ODHL 3EUDA 3VU1A 3MR9B 1HSAA 3BKJH 4JFOB 1QKZL 2WQAA 5MENB 2C26A 4V33A 5BUAA 3V4VL 5J9PB 1FBIL 4YDZA 2VWEC 1I9RH 4B9ZA 1ZPLA 2H8PB 5E0FA 5K59F 1C16A 4Y5YA 4OVUA 1GYCA 2DQFA 3VE0B 3WFZA 2W59A 1ID5I 5E8OA 4FA8A 2AZUA 4LLWA 3UROR 1HZKA 1ED3B 1U8PB 4AUJA 5IJBC 2WIMA 5GGSA 4EJ1C 1E43A 3MROA 5DEGA 2BSSA 1LE5A 3BGFB 1K5NA 5EN3A 3O4OC 4HJGA 1QA9A 2FQDA 2XZQL 3O3AA 3V5HA 2EIMB 1MCFA 4JG5A 4L8SC 4X6EB 4MWFB 1C1EH 1FFNA 2KUTA 3FQ1A 1INDH 4U6XA 2WQVA 2AXWA 3MREB 4LSTH 3GUFA 4Y4HA 5EB9A 3ML9A 3VXMD 1KF9B 3BQUA 4X5PA 1I1FA 1ESOA 5AAPA 4GW1A 2YD1A 4HWUA 1JZ8A 5CN2A 4JZOB 1DVUA 5DD0H 2OSYA 1SFHA 4I5BA 1LTXA 4GUCA 3RWHA 1T4KA 4Z3EA 3J07A 1O9WA 3GSQA 2FQEA 5DJXA 3TGXA 4DP1X 1NZRA 4XE5B 4OFDA 4F33B 2FBJL 1IILE 1DFBH 3KPQA 2G3NA 4NNXA 1F11B 4U1JB 3D7PA 1EFXD 1UXWB 3K8LA 4ADGA 1WZKA 1A7NH 2DQCH 2O5ZH 3FB6A 4KZEL 2OL3L 1Q0XL 5CLTA 2NY2B 5AAWA 1QAWA 1QLEB 1BF8A 3U7AA 3IDGA 1EAOA 7FABL 1R46A 4H13C 1JXKA 1USZA 3APFA 3C6LA 3KPLA 3SPVB 2BO0A 3X11B 4RA0C 1RZIA 3G6DL 1K4CA 5E2VL 4A1RA 2O5YH 4XN8A 3ZL4L 1UASA 2XZCL 4UBDC 4YBQC 1BVOA 2FGWL 1YEGL 5DFAA 1NGXB 1E5ZA 3SDXE 2L04A 5DWUH 2F0CA 2HTKC 3KGTA 1SVCP 3IFOB 4ZNEA 5JIDA 5JUEL 2VWEE 3GSRA 4N2MA 3TZVB 3VVWA 3WFHB 3V0JA 1QNIA 3Q9PA 2R0LH 2DWDA 4XPGH 4MJ6B 3SDXF 4JY6B 4EI5A 3O9WC 4A39A 4Z7IA 4A7TA 4K9EL 5AG8A 2J5WA 3FQUA 3A6OA 1NCBH 1FHNA 2AXFB 1CS6A 2B4CL 3GIZH 4FQJH 4EDWH 3TNMA 2QV4A 3POCA 3RGBA 2W65B 4OGAD 4ZBJA 5FXCH 3SQOH 2BIOA 4RETB 2QQLH 3THMH 4LARH 3MBWA 3VFSB 2TSAA 4N2DA 3HPJB 7CGTA 1EEYB 2CUHA 1DCEA 1YECL 4JFPB 4F7CB 4HLZH 4KTDL 5ISZB 3FO2A 4WJG3 5A2FA 2Q7NA 2BNRB 4R84A 2AJVH 2MKWA 1Q94B 3P2BA 2VO8A 3ZZ1A 4KUCD 1QRNB 2EDRA 1DQDL 3AG2B 1J9SA 1JPGA 2HRPH 1SNRA 1PG7X 2YPLA 3HUJB 4NQXA 3WL9B 1VFMA 3BE1L 1YHPA 2PWFA 2A9AA 5K9KA 2PO6D 5J6SA 4P48A 1H6EA 4ONHA 1EZVY 3WHXB 5GGQL 1DQQB 5C9KA 4NAJA 3M86A 4FYRA 2IOOA 4RQQB 1RIVL 3NFNA 4Z6AT 1A64A 2DOCA 5IBTL 4AKOA 1TPXC 3S3JA 4BKLA 1H6UA 5FLUA 3TPUB 4P2CG 4F8TA 5L2KE 4XXDA 1D5MB 4Q97A 4IRJC 4HSQA 1MRDH 4RWYH 4H8WC 2OYMA 3A5VA 1E40A 2OXGA 2PTUA 2VDPL 1HHKA 3P3SA 1JK8A 3SDYH 4UWQB 1DVFB 2LFGA 2G3ZA 1G7QB 5IFJB 1HAUA 1UEMA 4WI7A 3QP3A 1FYTE 3AS3A 1SM3H 4N4YB 4WSKA 2WQ8A 4PJEA 4M7KH 5EEZA 3LEXB 5F8QC 3WTVA 1C5BH 4NRXB 5F96L 2B0SL 1GZQA 1ZHLA 5FB8A 1I8LA 4L5FE 4L37A 3GKWL 4GAAA 1IGJA 4N2OA 4I0PA 3F12A 4Y2DD 3UGXA 3IS1X 5CUSL 1IU1A 5LNEA 2FO4A 4MJ2A 2BW4A 5DJDB 1OCRB 3CFKA 3E6FA 4OIBA 3RY6A 1ZV9A 4XCEA 2J1WA 2WBJB 5B1KA 3V52H 5DGRA 5L0QB 3QUYA 1CFMA 3KH4A 3VJ6A 2VDKL 3SPJA 4OZHE 4TSCH 3OKNA 4NQDD 5BRZA 3WKNA 4POUB 5DHEA 4HFWA 4P9HL 5T1JA 2WAQA 3GRWA 1BMGA 3L3OB 3L5WA 4FG6D 4H44C 2HT4C 4N0UE 1FPTL 2B1HH 2F6AA 4NZJA 3UAJA 3WKML 3QIUD 5IR1A 3BYTA 5TDPB 1WDAA 3NPSB 4XNZB 3HS0C 6FABL 1C08B 4LVOC 4TKWA 5ACLA 4HMEA 1KIPA 3WFEH 4F24A 4OZHF 5BVJB 2XKUA 2VSMB 3AXLA 2G4EA 3A6CL 4PP1C 5AZ2L 5GPRA 1JJUA 5H35A 5D1XD 5TPWH 4CBPA 3FQ4A 2BVOA 1CDGA 2P7TB 3VWJD 3O8XD 2CR6A 3B9KB 1AQHA 3S5LB 4N25A 3SCMB 1UTDA 2ODIA 4U1HA 4UNIA 3SYQA 2V8LA 3QG7L 5FF6A 3HAEA 3GK8L 3GRBA 4JFDA 3QJUB 5LAPA 1MAKA 5IW6B 4D3CH 1F13A 4Z3HA 4DKFL 2X1PA 2BVQB 2ZXCA 3BH9A 4DN3L 5C97A 4D94A 5FO8B 2DPKA 1BF5A 4XPHH 1THAA 5KOVC 3V6BR 1OZUA 4KDWA 3UERA 4Y0GA 2VMFA 2FIRT 5KBPA 4FFYA 5L6YH 2JKJA 1NMBL 4PGZA 2NY3D 4NN6C 2XDHA 5C71A 3EJQA 3QQDA 2DMCA 4WY7H 3ERXA 4P2RD 4PGBB 1JWSA 4PGEA 5HI3D 1LK3H 4J23A 2APBA 3IMTA 3VXRD 1RPQA 5CILL 3TWCH 4I0KA 3BP7A 5I18L 3PWPA 4AUYA 5EEXA 1A6TA 2NT1A 1LE9A 4G80A 1QSZA 2CJTA 1RQ5A 5CZVH 5FYKU 5EA0H 1W72L 3HBPA 2NY5L 1PGRB 2D9CA 3GBDA 4FG0A 1XIWB 1MHEB 2PLTA 3U0WH 1IZJA 2OYLA 2Y7LA 3FOMA 3QO1B 5SWSB 4G6FD 3RP1A 4P9MH 2XBZA 3LSOA 5JHDD 4RGNB 2FHBA 2KMWA 2K45A 2YC1B 3WNOA 3O2DH 1YUHA 2H2PD 5JO5A 1ZAGA 3GF8A 1NIAA 1EX0A 1UJ3A 1UH3A 2NUPA 3ARTA 4HSAC 3SDAD 2Y1ZA 1KENH 1CLCA 2CRZA 2K7QA 4PJHA 5JMOC 1A0QH 4C8XA 5I30L 1ZHNB 3NK3A 4OKDA 3QFGA 4L1TA 1IGIL 4TQIA 2DIAA 3B83A 1FE8H 1FGNH 4OLUL 1DQMH 3O3BA 4PRAB 5C0BD 5DS8A 3F6IA 4ZFZA 5BZWA 4WHDA 3WS3B 4NT6A 4POYA 3UBFA 5KVDH 1Z3GH 2V2TA 1T83C 3ZE0B 4YDJA 4D0BB 4XP6H 3V6ZB 3HLKA 3BSZL 3CX5J 4LDOB 3OLIA 2WO4A 1HNFA 1ZT1A 4HXAL 3QORB 2B16A 2YFOA 3I9IA 4BQBA 4RGMB 1S5HA 3BAYA 1QPKA 4Y8DC 2NY1D 1E4XL 2GJZA 3IDUA 2I7OA 4YHLH 5D2LE 5EULV 1NOFA 1CLOL 5IVXA 2RQ8A 5JOPD 3QI9D 3MJGX 3C5JB 4WNJA 2I07A 2PYFA 4PW3A 3VXSA 1S7VB 1SDYA 2VXSH 1OTSD 4KVPA 2IPTL 1HWWA 4M7JL 3WFBL 2F7QA 2MJWA 4NZDA 2ZG1A 3TF4A 4QHNB 2WZ6A 5D2LF 2Y6TE 3UMTA 3QULB 3X3GL 3FQRB 4M8VA 1UG9A 4Y7OC 4N2AA 5B38A 2ODHA 1GZHA 5JDSB 4LSPH 4Q4EA 5E6ZA 3SBPA 3FUMA 1MW1A 4LLDB 3UZQB 3WFDL 4C4KO 5IEHA 4MZ2A 3S9DB 1CDIA 1TLMA 3AROA 1I3RB 2H3XC 1A66A 4AVJA 2ZOWA 2FWLB 4PV9A 1RZ8A 2VO5A 2JJSA 1R3HB 2VLLA 3FAWA 3PPSA 4PJXA 5FYLE 3VXMB 3B43A 2APSA 4AJYV 4HULB 3ZR6A 3II2A 2A6KB 4KQ3H 4QXVA 4XZ4A 4ODTL 4DK3A 2UX7A 4X8CA