3QORB

Crystal structure of human nuclear migration protein nudc
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
119
structure length
118
Chain Sequence
b'SSSKLKPNLGNGADLPNYRWTQTLSELDLAVPFVNFRLKGKDMVVDIQRRHLRVGLKGQPAIIDGELYNEVKVEESSWLIADGAVVTVHLEKINKMEWWSRLVSSDPEINTKKINPEN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Nuclear migration protein nudC
publication title Structural Features and Chaperone Activity of the NudC Protein Family.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding, cell cycle
total genus 28
structure length 118
sequence length 119
ec nomenclature
pdb deposition date 2011-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04969 CS CS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3qorB00
4PCKA 4JUTA 4MJHA 4PBDA 1RL1A 3N3EA 3Q9QA 2WJ5A 3L1GA 1WH0A 4YLCA 2WJ7A 4YL9A 1X5MA 3VQLA 5LUMA 2O30A 3QORB 3GUFA 4RZKA 4YDZA 4M5SA 4YLBA 2CG9X 1WFIA 3L1FA 3VQMA 3EUDA 3GLAA 3QORC 2RH0A 5DS2A 2KLRA 1WGVA 2CR0A 1EJFA 3Q9PA 4YE0A 2K8QA 2JKIS 3AABA 2MNWA 2N0KA 2Y22A 4ELDA 3QORD 1GMEA 4FEIA 3AACA 1SHSA 2XCMC 2BOLA 2KMWA 4M5TA 5DS1A 4ZJ9A 3J07A 3L1EA 4I88A 2Y1YA 3IGFA 2N3JA 3W1ZA 2Y1ZA 3GT6A 4JUSA 3QORA
chains in the Genus database with same CATH superfamily
2B14A 2RA1A 4DGYL 3MRGB 5F1OB 1L3NA 4Q9RH 1GY1A 4R6UA 5EZOL 2BVPB 3MUGB 1BZ8A 4P5KB 4YQXH 5C0BE 3PWLB 4N3TA 1AZCA 1I9RH 2IH9A 4NQQA 4BFJA 4JQIH 1YNLH 2DTSA 12E8L 3VFSA 2WBKA 5GGTA 2NXZD 5J9PB 3D87B 3F04A 5T1JA 3IE4A 4HD5A 3MV9E 3MBXL 4E41E 5F1IB 2WM0A 1E90A 4ZG1A 3LSOA 3U1QA 5T1MA 4GJTB 5A16B 4H88H 5LAPA 1U6AL 4FQXD 3QHFL 1EHLH 4J39A 2W91A 1KBVA 4G9DB 4NSKA 3O3EB 3IYLW 4HWBH 3QQ3B 5I1AA 1LO4L 1WTGT 3KNBA 1JN6A 4UDTB 4OKVB 3DKHA 5FGBA 5HYJB 1RVFL 1M6UA 3OZLA 2A38A 4HPYL 4MNQD 3ENEA 5SX4H 3FCBA 5C0DB 4AE0A 4JDZB 3DI2B 5F9OL 3KBEA 1TU2A 3NACL 2QR0A 3UJIL 3GMLB 3MNZA 5EF2A 1I7RB 2HRHA 4FE9A 3WTSA 2BK8A 4MWFB 1VJSA 5B38G 1LDPL 4H26A 1ZS2A 4DW2L 4OAWA 3EYOB 5HP5A 2WXOA 3ZKSD 4CMMB 3RFZB 4Y4HD 1SVCP 1XHHA 2LAGB 4J6IA 3NJLA 1N67A 5HGDA 1XGUA 4DT2A 4N0YL 3A6BH 4P4KD 1KFGA 2HTKC 4H5SA 4WWNA 1HQRB 2HKFH 2DM3A 3BUQA 4XNZB 1KY7A 3BUIA 1CBVL 5LGJA 4N2MA 4H40A 2CH8A 5EN2A 4JFPB 3JZ7A 1W15A 4CN1A 2NXZC 5AG8A 1MJ8L 2WP3T 4JMNA 3VXPA 2OTPA 4NLAA 4DGVL 3CMOL 2PTTA 4DAGL 4M43L 1MVUB 4U6HB 3U4AA 4DHLA 1KC5H 4MJJA 5KSAB 1CWVA 1RJLB 4HHWA 5DGRA 3O45B 2V2XA 4BQ9A 3LXCA 5E6SB 4BZ1H 3HS0A 3NIFF 4MAUL 2X28A 1YEGH 4OCWL 4OGQC 4P5SA 1N70A 1T20B 4EZKA 3KLAA 2BPBA 25C8H 3CHPA 1RUKL 1X5ZA 3F7LA 1AHWA 1IX2A 2HLAA 4Y1TA 4GAGL 3C6LD 1PG7L 3QHZH 4IHOB 4BDVA 1Q72L 4HF5L 2DQGL 1OB1A 3ARBB 3X3GH 4AMWA 1E8ZA 4F20A 4O2EB 4FMKA 5HVGB 1YNKH 1FNGB 2ENYA 1Z7JA 2FX8L 1GGCH 2VMCA 3HEIB 4OZGE 5E6ID 4Y4HC 1FNFA 3K0YA 3QI9B 4R9HA 2YEVB 2G2NA 4UQ2B 5FPIA 5DD6A 5F21B 1LE5A 1JZ5A 4P4KC 4UTAH 1U3JA 1NCNA 2JELH 3O6FA 3X14B 3KXFA 2HVKA 4JPQA 4KRLB 4LNRA 3V6FB 3VXSE 1VIWA 1SMDA 1U4FA 2FJHA 5DZOA 1YAIA 3Q2NA 3HVDA 1BHGA 3LIZL 1TQCC 4UILL 2VSKB 3DXAD 2EYRB 4NQVB 4TQHA 3QDAA 3Q8CA 3WXWH 4EVNA 3BKML 3DUUB 3QO0A 4BFOA 4YSAA 5FOBA 1F58H 1GR7A 3SDXF 3TTSA 1GS8A 2NY5L 2VN3A 1DHKA 5D5MF 3UC2A 3UAEA 2Q6WB 2ED7A 4XPHL 4PB9H 4Y19D 3W39A 2UWEF 1FYTD 2H32H 1S7UB 4FXGA 1D7FA 2VZ1A 4KMLB 4L2YA 3WN6A 1U8JB 1G94A 3P4MB 3FB5A 2J8UA 3OKNA 4X4ZA 2UXVA 4NUGL 4O2FB 3N1QC 4PJXA 4L48A 1DJXA 3P4OA 5HY9A 2VDLH 1SEBA 5JHLH 4J5VA 3SD2A 1U8QA 5C6TL 2BMKB 5C1MB 3SDDB 3C6LC 4WTQA 3MV11 4G8IB 3V0WL 3O8XA 3RNKB 3GUFA 5EBWB 2XRAH 3EOBB 3BE1L 5LXGL 5E23A 4QRRE 1X44A 4KJWD 2DWTA 3KPNB 2DQTH 5E0QA 4PS7A 4EBQL 4NRXB 5J1AB 1T1ZB 1JFHA 4WGVB 3SOBH 3BT0A 4HMEA 1Y0LA 3NH7L 2OL3B 3GSOB 1BYPA 1PZ2A 2Y4SA 3LIUA 3PWNB 1KBWA 3RI5F 3X1GA 4Z7WA 4Y89A 4J3TA 3TO4D 3GKZA 2PTUA 4GO6B 3JWDH 3MA9H 4H8WL 4LPXA 2ZZUT 4ODUB 1QSFE 4XNMB 3Q05A 1WCBA 5C09B 3FTZA 5E8NB 4GFTB 4M6OL 5CJ8A 4YL9A 5ALBL 3A6OA 1F2QA 2YOCA 1QMUA 1TJIL 4GBXB 2BFGA 4EQ2A 2MWCA 2ZKMX 1A6UH 4GI9A 1KBKA 1F3JB 4L8DB 4TOYH 1DE4A 1QQDA 1ZLEA 3FF7A 1XH2A 5KSBA 3OLIA 5TFSH 4M62H 2QQLL 1TQBC 4IKJA 2EEDA 4DVBA 5EFIB 2H6PB 4M5ZH 4EDXB 5AW9B 3U36A 4YGVA 4GAFB 4IK6A 3HE7C 1TCRB 2CU9A 3MXWL 4JFDE 5JR1L 1M3JA 2E47A 4XH2B 4YZFF 3X17A 3SE4A 1UJ3C 1URIA 1DVTA 3JVGC 2XWCA 2W94A 2DBLH 2GABA 5ES4B 1FCGA 3VFTB 4AUYA 3UPRA 4WY7H 2GBUA 1LQBC 2P45B 4XBEL 3NOIA 4WU7B 3FFCA 5KYUB 4KJWC 3ZL1A 3ZOAA 1ETB1 1T2QH 4LSVH 3NJIA 2R83A 2X4QA 4NUMA 1Y18B 4X6CF 4MB5A 3QNYB 3HKZA 3OGCB 4JPVL 2W0LA 1U3YA 1T89C 2A6JA 4RSVA 3PYCA 3FL7A 3I2CL 5T3ZE 5B4MD 1AQDA 1FC1A 1KMGA 1GYUA 2XY2A 4NO0B 1MCQA 2JB5L 5FYKE 4XNDA 4UAOC 1JWSA 2EC9U 2FD6L 3ZUCA 3EFOA 1QBLH 3QXVA 3VX1A 3OX8B 3G5YA 4EI5B 2J71A 4AQ8A 2C9RA 1EZSA 5ACZA 4PVNA 2PYED 5I6PA 3W5MA 4Q9QH 4FQQA 4LCYA 4M1GH 4L37A 3ETTA 5F7DA 5CKAA 4R2GD 4KQ3L 1C1EH 1J1OL 1NAMH 3RDTB 4ZSOB 4R26H 4PWIA 4RAUA 4L3EA 3ZTDC 2R0LL 4NNYB 5LJYH 5DTFB 2DI9A 5CCHE 1YPZB 2KBGA 5I8KL 2EUZA 2YKLH 2ZNWA 2B4CH 4XN1A 2NCEA 3FU7A 4OIIL 2O6EA 5C0RL 2CXGA 1FFOA 3CE1A 3TYFB 1A3RH 5AB9A 2ZOLB 3CPLA 4HOZA 2NY1D 4UQCA 2LFGA 3DGDA 1A6ZA 1PZSA 1UB5A 4OF5A 5JOEA 4WSKA 3VMNA 3Q6GL 4MNGE 3RIAK 4PJCF 1XZ0A 4EDWL 3ZPDA 3Q8EA 5B4MC 2H0EA 3JWNC 4ZO9A 4XP9H 3MYJB 4NWUL 3B7RL 1QR1A 1MCOH 2I5YL 1CO1A 2P8LB 1H3PH 3H85A 1U3NA 3I84A 5IFJA 1N7MH 4GO9A 3S37L 1MZYA 3UERA 3CFQA 3QDGD 1XGRA 5D70H 3RZCC 3ZDZE 4ANKA 3SYQA 4GRWB 2J6EL 2X53A 5E4EC 1LO3L 1B90A 3F83A 4XCCL 2YPVL 2ZCKL 2BZ7A 2NW3B 4TUKH 4BELD 4IRJD 4QNPE 1OSPL 1XSIA 6PCYA 4ZOAA 4LMQE 2D7MA 1XF2B 1HI6A 4QRSB 2VLRD 4J4PD 5IQNA 2AEOA 2AKRB 3D85B 4IOSA 5E8OB 4X4YA 5DK0B 2BS8A 3GC3A 3ZR5A 2QELA 1IKFH 5AD0B 3ROOA 5FEBA 4DWHA 1PG7W 1SLWA 4PBDA 1FP5A 4WFEE 4OI9A 1YEIL 3L1GA 1FORL 4AKQA 2NY1C 2ICES 4ODBD 4FERA 2CHWA 1OAQL 1BFOB 3H9SD 2AK1H 4ZMWA 3OZKA 3UAJA 2G3NA 2EEAA 1DQJB 1P6AB 1YEFH 4MSWA 4ZAKC 2CO7A 2EIZA 3IFNL 5IHLB 3ZKXB 2CGRH 1QI4A 4P3CH 3F00A 3G5XA 2ZPKL 2EDXA 2V2WB 1OT4A 4UWQB 3QT2A 5FGCE 3IMSA 4PRPA 1QBML 2XN9D 3SKNB 3MLSH 5CBEB 1OAUL 5JUEH 4R3SA 4MVBD 1A6TB 3LRLA 4XN7A 2YGVA 5K59F 2PN5A 2RQ8A 4I18C 5ESVA 1IM9D 4XO4A 1WBXA 4ZZKA 3QRGL 3BPCB 3CLEH 3WE1A 4K8RD 2JKTM 2PETA 3VQ1C 1LEKB 4IRJC 1KLGA 1CCZA 1EO8H 1DVZA 2XZCL 2ZWZA 4W9ZA 4Y4KA 3FCGA 5E8PB 3GPEA 2VL5B 3HA0A 4DO5A 2XJKA 4HIPA 5AKSA 4UINL 3KPQA 2A83A 2GT9A 2YBRA 2W59A 4J1UB 2P26A 3WMQA 1E4WL 3HR6A 5I1HH 1PKQA 2X89D 3ZSSA 1JYWA 2Y6SC 3ULUE 1QVOA 2IGLA 2WBJB 1DQKA 3KPRA 3TEZA 2LQRA 5DUPH 3ULVC 5D1XD 4G6JL 3C5JA 3OAWA 4WUUE 2R1WB 2O4EA 4ISVB 5J5EA 2G5BA 3PAVA 5JW4N 1RIVH 3LB6C 5CJXC 3QQDA 1OP4A 2V7HA 3AB0C 1VPOL 2LOEA 4A7TA 2BNRA 5JPMB 4P46B 3BP4B 1XXFC 4U1MB 3HZMA 3D25A 3F84A 43CAA 3IFPA 2P24B 4PSPA 5FA3A 4NWTL 2XTLA 1JGLL 1MFEH 2RIKA 1IFGA 3RWFB 2JCCA 1G9HA 4Q6IB 3PLYA 2QQKH 4WV1B 3AM8C 4XMTA 1SBSH 2BNUA 1N0XL 2H5UA 2J72A 2W92A 5HD8D 2R56H 2JFCA 4OZHB 3W11D 1E6OL 3LAFA 5MERA 4TLKA 1K85A 1R5IB 4M8RA 5J13C 4NQEE 5DQJB 2H1PL 1HINH 3BZDA 3LZPA 3MUUA 2AXJA 1EGJL 3MV9A 2XFXB 3JV6A 4E41A 4CVXB 3WLBA 5HVHC 3AFLA 3RIFK 1EJOH 2JH2A 3JWNG 3WJJA 5HTSA 2ZXQA 1T04A 1F4WL 3ZE0E 2JIXB 4UUJA 4RFEB 4I2XB 1ASPA 1OM9A 2CRZA 3GNML 4ILDA 5D6DC 3JQOB 1TVBA 3OWRA 4EUPH 1MJUH 4N2EA 1WIPA 4I7ZC 3FQ4A 3B2UD 1UB6A 3C5ZA 3DVGB 1S7QA 4M5SA 4JDEA 1S5HA 3T0EB 1HAUA 3TCLA 1D7CA 1OANA 2OW6A 3A6CH 4M6NH 4N2OA 1ED3A 1F3RB 3LEXB 5EIVA 5C0FB 3TYGL 3UTZA 4IBSA 1FNHA 5DJXB 2YEQA 5KYYA 1HOEA 1DFBL 4F8QA 2CPCA 3DBXA 1NOLA 2VDQH 1IKOP 1ZEAL 4AMKH 2P42B 2B0SL 5EEUA 1NGQH 1BAFH 4BA0A 1GHFL 3GINA 1J1PH 4APQB 5JXEC 4BH8B 3QFJD 4PMFA 4RRPM 4U1SB 1NBVL 5GGUB 1BD2B 3RWDA 2WXGA 3MOBH 3WD5L 5JLZB 4G2AA 4TRPL 1AP2A 1Q90A 3THML 2YGQA 3Q5TA 2DWXA 2VZOA 3K80A 4NXSA 2O72A 2DQCL 3I50L 1Z9LA 4AM0B 2AVGA 4U1KA 3ARRA 3U2IA 3KEHA 4H4NA 5DURB 4A63A 3SYOA 1DBKL 2P9RA 3HLKA 2AXWA 5AW2B 4RETB 1JZ8A 4FXKA 4HH9B 1LHZA 3VO0A 1Q1JL 3PP3K 3MCYA 3N3EA 4K7FB 2WSDA 3R4RA 4Q74A 4I77L 3FTYA 5FYJE 5EULV 5A3ID 4L8SA 2V33A 5GZND 2VXSH 3V4VH 3GXMA 1PNDA 3QUHA 2AQSA 3S98A 3ERXA 5BUPA 3DNKA 1YUHB 1I3RB 3HN5A 1IJ9A 1QFWI 1RHFA 4ADJA 3D12B 4PRNA 4UF7C 2LFEA 3EDDA 1WZMA 4OZGA 5F6HI 5KWYC 4U6XA 2Q8BH 4B9CA 2PWFA 5FO8A 5JHDD 1HHIA 3MRBB 2XWTA 3GRWL 4PV9A 4YDNA 2VKXA 2NLJB 2J1XA 3D3VB 3MA7A 5GS3A 3FU8A 2Z3FA 5ISZB 3BX7C 2YK1L 3LIZA 3ZDXE 1H9DA 4YDIL 3Q8BA 4U7KA 3U4EB 2IANE 4JMXA 5IIEB 4MD0A 3ZYOA 4R96B 2X2IA 4ZW6A 5J1SC 5I1KH 2PLTA 2JJTA 4N2KA 5EO1B 4Z7AA 4KU1A 5IVZB 3RWCB 2NX5E 4JPWH 1UZ6F 1MWAL 3KDMB 4PJ7E 4YPGA 5IW6A 1AR1D 5AVVB 3O3AB 1TUPA 4JHVA 3UP6A 4OD3L 4W9GC 1ADWA 2OX5A 2DQEL 4YHOH 1BLIA 3O6ML 3OB0K 5CJOL 3VWKC 4UV4H 1HQ4B 1CICD 5EBGA 4FZEL 4NPYB 1YEWA 1U0QA 2YWYA 3RAJH 1O75A 4GQPH 4HIHA 4PJDA 4AENB 3KM1A 1KJVA 2KL6A 5L2KB 1NGPL 1JPTL 3MBWA 3UBXG 3V5DA 1JF1B 1E4XL 1S9YA 1TXKA 1VZIA 1XGQA 4HUMB 2DOCA 3UGEA 3BUDA 3ULVL 5E08H 4EO5A 5F6IB 3D5OF 1XV8A 1V7NH 4AJVA 1KLFB 4ZS6D 1VF5C 3EOAB 1QKZH 2E9IA 4P99A 5FFGA 1F6LL 1SXCA 4OIFA 3VAEA 1DLFH 5E8EA 1AC6A 5AKTA 3MX0A 4B9YA 2L7EA 3QCTH 4LVNB 1QSFA 1VFAA 5HHOB 3QUZA 5I6KA 1WEJH 2VMFA 4EE2A 5EU6B 5FCUL 2Y69B 4IKLA 4GH7B 2XBDA 4NM8L 1M53A 4WO0A 3U9UA 3DVNA 3PGCB 3O9WA 2DLHA 3MRJB 4BYHA 4K5OA 3S37X 3S5YA 1K8IA 4NBXB 1GCYA 4ZMNA 4FP8L 1HOCA 2VZTA 2EIDA 4X6BB 1AR1C 2H0FA 3BD4A 1BQLL 4HJIA 5C7XH 3NEOA 3WIHA 2FBOJ 1BX2A 4JFDA 5EN3A 3N2JA 1L5GB 5I0VA 4Y7MA 4M7JH 5TF0A 4O5LH 1OIOA 5DVMA 4RX4A 4XVSH 1DZBA 3VXUB 1BF5A 2X9ZA 3IK2A 4JFTA 4QLRA 5GGRY 5CN3A 3UTSE 1HH6A 3M45A 5KAQF 2XV0A 3GKWH 2RCSH 2DMKA 3DVIA 3TBBA 3LHPL 4MDIB 3SDYL 3WO4C 5KYXB 2WZAA 3O2DL 4JZNB 5H4ZA 4G7QB 1OALA 4IRSB 5DCCA 4PGBA 2YBGA 3I9PA 5IBUB 4AI7A 2AEPL 2ZXWB 1MSPA 3HNTH 3OV6A 3SPHA 4JM4L 4FNTA 1JSYA 5D2LE 3IGAA 5IMOA 5C0AB 4MRCA 4A6YL 4ZODA 1ZVSB 2AEQL 5DUBA 1OGAB 3ECUA 3T0VA 4HWZA 5F2FA 1TQVA 4HG4K 3ZN6A 4NNXB 4BCZA 2FJFA 2UVFA 2FO1A 1MW0A 2G2RA 5I28A 1JVKA 4GOSA 1A1NA 4B9GA 3C9NA 4C47A 1TTFA 3Q1SH 4FQ1H 4A04A 4PJHF 3VFNB 4BWTA 3MR9A 2QVIA 3U6XA 5HDQL 1FO0A 4WEMB 1P4BL 4X80H 4KZDL 2HJKA 1Q0XL 2H0JA 1HEJC 4QXUL 3OAZH 1EXUA 1NLBL 3O6FD 2VDRH 4FHBD 3KXFD 3RUGF 4G6ML 3DMMA 3B37A 5C08B 1XCTA 1NOFA 3O4LE 4ZUVA 4F58L 1UENA 3VW3H 1L0QA 3NFNA 4Z6AT 1QTYT 1WSST 2BVUA 3VXQB 2IGFH 3DX4A 2ITCA 4G8GE 4HZLA 1X5XA 3U46A 4Q9BA 4N8CH 1KPVA 2ZUXA 1TQWA 2AJXH 1RK0B 3T0DA 1DSFH 1KENH 3COOA 3SE9L 3Q1EA 1CD8A 1SPDA 1LVEA 2IPUK 2J6EA 2XZQL 2VM9A 2XZZA 2V5YA 4I8DA 2KI6A 3GSUA 3V95A 1QZ1A 4ZYKB 5DF0A 1UVQB 5HDRA 2XTJD 2A6IA 4I0CC 3WJLC 5KN5B 3LNEA 4YLQT 1HL8A 3GXIA 2DIEA 2WLJA 4YDVB 2BERA 3WG7B 3K4DA 1UKTA 2FRGP 3LCYA 1EXHA 1OSEA 3O8XD 4FZ8H 2B08A 1C16A 5LCVA 5KOVC 1I4FB 4JRFA 4U0RC 3V6OA 1DEDA 5E2WL 1FRGH 5EU3B 3T9WA 2AZAA 1G7MB 3FU9A 3BFQG 5BVPH 3PXHA 1V3JA 3C09B 4XCYA 5AYUH 2CJ3A 4HS8H 4GG6B 3L9RA 3GJFK 4LKXA 1FG2B 1WT5C 1Y6NR 2IFGA 5DLML 2VXVH 4ZS7L 3VFOA 4PJFB 2H32B 1F56A 2L4OA 2VLJB 4N90E 4NO3B 4G6KL 2XLLA 1F8TH 1UEMA 3L5XH 3RY6C 4JANA 5TQ0L 5GISH 1GJIA 2PW1A 1LP9B 2Q3XA 4QO1B 3HG3A 1QTPA 1YDPA 4UQIM 2VDLB 5D6CA 3WHXA 4UT9A 1B88A 2ZG3A 2VQ4A 3AU1A 4WAFA 3MROA 4D9QD 3QXDB 3QCVH 1F3DJ 1HHGB 1OM3H 1RZIB 3FUFA 3WFZA 3CSYB 1HS6A 2BHUA 5HYSG 1YLBB 1QSZA 5EOCH 4PJIF 2B39A 4HGWB 2XUWA 1QNZL 2CCLA 4GPVA 1S7VA 2XTJC 1AJ7L 4ZTPL 3K6OA 3UCRA 3DRTB 3MLXH 4OFIA 1CLYH 2KERA 3O8XC 5D2NB 1NJ9A 2E74C 2ZP9A 3IXTB 2FIKA 2V5TA 3A4DA 2IG2H 2PPDA 4F1ZA 5C3IA 3INUH 3HZ3A 4KC3B 4U1HB 2OMYA 3TV3L 5D9SB 2UUDH 4MCMA 4LOUD 3MV8D 2YSSB 3SKOB 1FL6B 1GGTA 4EN3B 2B59B 5DDHB 1N12A 3FO0L 3MACH 3VSUA 2EADA 2GFBB 1VEPA 1KTLA 2D73A 3VG9C 3J27A 4JY5L 1JGUL 2YEZA 1R3JB 4WUUA 4Y9GA 5BOPA 2XDHA 3FU5A 1IAIH 1R3HB 3LPWA 5DS2A 1GGIH 3UMNA 3WY2A 4AXWB 2EDNA 5AW6B 1R1CA 3JTSB 3BP6B 3W2DL 3T77A 3QNXA 3MRRB 4JHAL 3O4OB 5AALA 3ZTNH 5JW3L 1F45A 5ID0A 2WXHA 5FO7A 3N85L 2WWMC 1A4CA 4LEOA 1U8HB 2AQ1A 3H56A 2VZUA 4P57B 5E1IA 1J0HA 3F58L 2G3MA 1JHLH 1J0YA 4CGTA 3EO9H 3UTPE 3O2WH 5IQLA 2DDQL 2D0GA 3IDJB 4A7GF 1NAKH 2AGJL 4HHAB 3ZL4H 2QZ5A 3WKPA 5F89B 4L3ED 3SE4C 4TQEH 2CNYA 1U8KA 2B3IA 1ZY9A 2AQQA 1Z3GL 5J6HB 4YNYB 1QW8A 3QJVB 2JKNA 4NQEA 4I9XA 1CZ8H 4L23A 4FQCH 1EGJA 1XD1A 2X4UB 5DHMC 2CDEB 1V55B 5AW8B 4ZPVB 4KMTL 3K6SB 4RGMC 5EV7A 1GZQB 5ANME 2VQ1A 4UMGA 2GEQA 5K5YA 4JFQB 2OTUB 3BVNA 4PH8A 2ADYA 3DV4A 1F18A 2WZ5A 3ZRFC 3WNOA 5KANG 1NAMB 3DX6B 4CDGC 5L6YH 1RHHB 2JQAA 1WFUA 3HS8A 2C7FA 3P30H 3PPSA 4NZRL 2G3XA 3K7UA 1B2YA 5BVJA 3FMGH 5D1QA 4F9LA 4XE0A 1MPAL 3GLEA 2WQVA 4F93B 2BSEA 3DRQA 3DX3A 3SB3A 5CIPA 2VL4A 4H2CA 3B3IA 1H0DB 4IOSD 8FABA 3S3BB 3TEXA 4O51A 3ARFA 3BGFC 3LQAC 3G9AB 4BFIB 2ORBL 4GS7B 4XNYH 5HI4C 1NBZB 2EACA 1FZKA 3ZY7A 5HYJE 4OB5L 1QNIA 1SHSA 2Z8WC 5CCKH 1CURA 4IU3A 4NYLA 2HWZH 1B0RA 2VWEE 4E9YA 4UT7H 4O9HH 4JFEB 4BSVA 2H0PA 3N06B 4U2ZA 3UAJD 4I48B 5KBKA 2EDMA 3G3LA 3VJ6A 4FQJH 1UZGA 4HP5A 3KG5A 2FLRT 1I7ZA 3EO1B 2C26A 3H9HB 3PDGA 2WNWA 4MLIA 1A1MB 3CDGB 4NRZA 1KCRL 4KKNA 1UWGH 5K1JA 2ITEA 2C4XA 1D5MB 4PRPD 1TYRA 4UMSA 4AQEA 2IQAB 2PXYB 1BW8A 3ARPA 3GRGA 1AXSA 3L8QA 1G7JB 1KIPA 1TZGH 3FHQA 5FUOH 2A99A 1QFPA 1BZQK 1K5NB 2Y07L 3CFBB 4IU2B 4PJAB 4YSUA 2AEIT 2OJEA 4ABQA 5GS0L 4XHQA 3BZFB 2XKSA 3LQZB 1JUFB 4KKZA 2BSRA 1MFUA 3LVTA 4KY1L 2YPLA 2Y25A 4Y4KD 3GRWA 1K2DA 3CHXA 5T5FH 3FO9B 3QQNA 3QA3A 1THAA 2OR9H 2XG5A 3D0AA 3OPZH 3QB7C 4NI3A 3FO1B 5BV7C 2X9XA 4X7SH 1ZHNB 3BCFA 3STZA 4U6VH 2OMUA 3TXAA 4WFFD 3ZGHA 1QFWH 2IANA 1IBZA 1LD9A 2NNCA 4RBPH 1TIUA 1K4DA 1ZLWH 1H15A 2X88A 1MJJA 3KPRD 4FQHB 3EO0B 3M17A 1D9KB 1AIZA 5FYKU 1MWAA 3UABA 1WAAE 4ZPTA 3UAJC 6FABL 5DRXB 1JZFA 1EUTA 3G5ZA 1RZ8B 2APTA 3AQZA 2FX9H 1A3ZA 1TMCB 3L3JA 3NZ8B 1UA6L 1MW1A 3WFEL 5E6YA 3WNMA 1KB9K 2I07B 4WW2B 3HNVL 1RSYA 7CGTA 3QJXA 2ISDA 1HN1A 1RULL 1X5FA 2HVBA 3PHSA 3GK8H 4XN8A 1R24A 3P77A 5TH2A 3HPJB 3QXUA 4R0LC 1S7XB 2W9DL 1F4AA 5I1DA 2YPKA 2VISA 2J8UF 5LAXB 3FTXA 4AM0Q 1RSFA 3GYRA 4J28A 1KF9B 3Q3GB 4PJXF 3GBNH 4PYHA 4R7VA 5C0BD 4DPBX 3RL2B 2BOCA 3STLA 2C3XA 2CK0H 2WLIA 4WHYH 1KACB 4X6DB 3GDBA 4QHUA 4KK9D 3MV9D 1WS8A 3JT2A 4FQPA 4LL1A 3S36L 4E41D 3D2UB 4L4TB 3QXWA 3K71B 5BQ7B 1S9XA 2E76C 3WLWC 2C3WA 4HZAA 5I18H 1UATA 1WBYA 2G75B 4HKBB 2VW4A 1ODAA 1FJ1B 4GRLB 5AW7B 1U8OB 3QIBC 4YHNB 3LS4L 3ZZ1A 4OFQA 3MRQB 2BWQA 4L4VA 3C5ZD 4Z7WF 2FECI 3HHSA 3JSSA 4K8RH 2H3NA 2Y5QA 1HZHL 1REIA 4K73A 5I17B 9PCYA 3MRIB 1H8OA 3U6RA 1C12B 3RX5A 4FA7B 2OL3L 1YEJH 3ARSA 5F7HA 3C08L 4HPHA 5I1EL 5SWZB 2GSIB 5IHUL 1BJ1H 2R29H 3GLDA 3UTSA 2F61A 4BFNA 5KSBF 5J6GA 3FSWA 3POCA 5C09E 3NSFA 1DEEB 1QO3B 3CFKA 3I6GA 1J88A 3PNRB 1C5BH 5LDSA 4IIQA 1WC7B 3QORA 1U92A 1P84J 5AB0A 4EUPB 3QPKA 4RVBA 2CHXA 2QPEB 4ONGL 4WHTB 1W6WA 1NPUA 1FFPB 2FJSA 3ALWA 4F7EB 2P44B 3T1FA 2EC9T 4KFMA 1VGEH 3NABL 4MBOA 1EEZA 5D2LA 3E8VA 1TKWB 3SYPA 1ZHLA 1DCEA 4GP4B 4YX2L 3GI8H 4DQOL 3QFGA 2C9AA 3QE5A 5IBTH 1DQLH 2J73A 2VDQB 3HIZA 1G9MC 3SEPA 2IAMC 1A6VH 4LPYA 2PWDA 3KH3A 3IMVA 1DQDL 4U1NB 2X4SB 3VDBA 4X50A 4APXA 1CYGA 4GKSA 2WKGA 3IU3A 2G9KA 4KKPA 2F6AA 1E9OA 4NUJB 5L4JA 1E6JH 2XZAH 4ZFFA 4G9FB 2WB7A 2F8VA 3IF1B 5T1DH 1FHNA 3CFIC 1ORQB 3FCTB 3HE6C 2B9BA 1YMHA 2P52A 1ZSDB 3DURA 5DZVA 1A3QA 1IGFL 2VSCA 1BVLA 3ARZA 3B8SA 4XBPB 4HC1L 3P9MA 3WFCL 5F72S 1N6VA 4UZUA 1E3ZA 1RI8A 1U2HA 5FDWB 2WGNB 3TPKA 5ITFB 1VGKB 1NFDB 4MMZC 5FWQA 1HHHA 3GBLA 4GIPD 2AV1A 4PS4H 3D30A 2OMVA 4XCFH 2AXHA 3O4LA 4QRUA 4RGOH 4W68A 3C60A 1JNJA 5CP7B 3S5ZA 1D7BA 4HUVA 3QEQB 1GY2A 1PZDA 4N24A 5FYLE 1NOAA 1BGXH 4QRQB 3VD0A 4NBZB 1LEIB 1U3ZA 5I8CA 3V4VB 2XVKA 4ZSOE 1AQMA 5IQ7L 1YJDC 4Z8FL 2OCCB 1U8LB 2CJSA 2OQJB 1CGUA 1T0MB 3SDXB 5J7CC 5DXWA 3LN4B 4HJ0D 2VAAA 1RP9A 3KL3A 4FFVD 1ZANH 4J7RA 2FJGB 4O00A 4C56A 5BV7L 1NEUA 3RTQC 5I75C 3I75B 1NC2A 2I9LB 4MMYA 2F58L 5I5IA 3H3PH 5BRZB 4HUKB 2H3KA 3HRZB 4P8QA 4ABUA 4QRRD 1PSKH 3DIFA 5DRNA 4XI5D 4XP5L 3RX7A 5CBAA 3SE8L 4FJ6A 4Y9CA 1RJZB 3SE3C 2BRQA 2VKWA 5DJYA 4S1RL 3KGUA 5GSVB 2VW7A 5D8JH 3LNHA 3UZEA 6CGTA 4KROC 4GRWE 1QSFD 4QHPA 2RACA 3QUZD 1I1FA 4OV5B 5D72H 2WXMA 1D5BA 2MQGA 1X9UA 2P5WB 1X5GA 1S46A 3E6HA 3O9WD 3DBSA 2BJMH 4ZMOA 3TH3T 3FT3B 3GB7B 3FT1A 4XCEA 1N0LB 2K45A 5E03A 4TUJA 4NOBA 3GSNL 1NH6A 3I9AA 1YQVH 2QKIC 3CFJA 4X6EB 3I3BA 3TNNA 1QSEA 2DJSA 1UM6H 3K2UH 3WTUA 5HHMB 4HJ0C 2YD1A 3K4AA 3BAEH 3BYYA 4JFDD 5EBMB 4YO0B 4ZFOA 4IRZH 4KJYA 3U4KA 2IPTL 4I5BA 1NMBH 3ZQ9A 2R2HB 3MRDB 4RX4D 4PR5A 4WW1A 3H9ZA 4OIBA 2ZWLT 2X41A 3CCHB 5IHBA 3PIQB 1XB3A 5IHZB 5JOFA 3FC8A 2SODB 3L5JA 5IFHL 4LOEA 4WJG3 3LEYH 4YWGL 5CILH 4XI5C 1KTDB 3BO8B 2VR4A 4ZTEA 5L8JB 2COQA 4J8QA 2WXNA 4MQTB 3O6KH 4JO2H 2CUHA 4R4FL 5I30L 4E5XA 3WY1A 5IT2H 4JG1H 2N1TE 5IF0B 3KLHD 1ET5A 35C8L 1IM3A 3E80A 4JRXB 5MENA 3IU4H 3HBPA 2NQDA 3EFDH 2I69A 5C9KA 1HDMA 2Y1VA 1KG0A 3QUXB 1URZA 2KMWA 1G9NC 3CXHJ 5FYJU 3V7MA 5C2UB 5FYKD 3VH8G 2GTWB 3FN3A 2HVJB 4PU2A 2ITFA 5HI3D 2YQ3A 3CBJB 1DVXA 3EIFA 5HJ3B 2ATAA 3LRMA 3MPCA 4ELKB 4FTVB 4WTZG 4OSUL 2CKBL 4ABVA 4LZKA 1KFAL 1P6FA 2BNQA 3V52L 5AWNL 3IETA 1ACYH 3VXNA 3S6CA 4LLMB 1ORSB 3V79C 3T2OA 1TJHL 1NCBL 4PJ8D 4ANXA 1FVCA 4TTGA 2VCOA 4QTIL 2Y1AA 1IGJB 4I3SH 1JPFB 4M7LL 4U3SB 1E4KC 2WHVA 1YECH 3RL1B 3VFUA 4OUUA 4N2LA 4OY9A 3NG5A 5GGTH 2AEWA 5AOLA 3KL5A 4MXVF 2KLSA 2CJUL 3MNDA 3FQYA 5IV2B 4BSWB 5IMLB 2BVTA 3EYQC 4GW1B 1M3IA 4HIIB 2WJ7A 4R5TA 5BW7A 4LARL 2JCCF 4P2QB 4L0YA 3DMMD 4XXDA 3GO1H 4NN5C 2NT0A 4MMXB 1BIIB 4ES9A 1P7KA 3KLHC 4WJ5A 3KPOB 5DHYA 3M1OA 2V8LA 5A7BA 3NSJA 3ESNA 5D7EA 1TTCA 3HBQA 4MAYB 1F6AB 4PJCB 4Y4FA 2JXMA 2BRRH 4A7UA 5IR1B 1YN6A 4N0FB 1IGTB 5HI3C 4P5KA 4OZHE 5LNGA 3PWLA 2VABB 3ZIYA 2V2TB 2ZXCA 2B77A 5J9PA 4X8JB 2VDKL 4JN1L 4BH7A 1T21B 4ACTA 5ICXA 1CGSH 5JOPD 3PE9A 5F1IA 4IMKA 4PJ8C 5TE7L 2N7BA 5MI0C 1OF2B 5DC4B 2VDRB 2XA3A 3SHSA 3MNMA 3I85A 3LN5B 1P9MA 2OZ4L 4G9DA 2NUPA 4TVPL 3O3EA 4I2XE 4A2LA 2P7TB 4KTEH 4OKVA 1OP3K 3I6LE 5HYJA 4TV3A 4ORGA 2P8PA 1A7PL 1KYOJ 3L4ZA 5F9AC 3S36X 5L9DL 2K4AA 1USZA 3V0GA 1J11A 5C0DA 4E42B 2ZYSA 1JZHA 4OF8A 3T0EE 4JDZA 5JIMA 3OMNB 4DK6A 5IEHB 3GMLA 3GSVA 1X5IA 3FONA 1IFHL 1I7RA 3O41B 1X5MA 1F1AA 5HHQB 3U0TB 1PY4A 2H2SD 2J6WA 5CEYB 4KHTL 2R0ZH 4DVRH 3EYOA 1A14L 2G5RA 2X05A 4CMMA 3F3HA 3NCMA 3RFZA 1YEEH 5C0EB 4JFWA 2LHAA 2GAZB 4NO5B 3UTTA 1OK8A 4FD0A 4K3DL 4Q0XH 4S0TD 2FHBA 2EIMB 4ZQKB 5BNXD 4AQ1B 1NMAL 3SDCB 3LNGA 3WN5C 1LO2H 1BD2E 2CM6A 4PB0H 3QO1B 4FQ2L 1XFPA 2DQHL 5DQDH 1KT2B 4JFPA 5EIIG 1TYJA 5CN1A 1COBA 5JQIB 2OYMA 5G4NA 3ARDB 4DTGL 3AY4A 3KS0H 4POZD 3RWJA 4LPTA 5HGAB 4U6HA 4HU2A 1RJLA 5AVZB 4I3RL 8CGTA 1QD0A 3O45A 3PP3H 5DJAB 1EBAA 3MJ8B 2NSMA 2Q87A 3TT3H 3LPGA 3ULUD 2PPEA 2ZKYA 1CFSB 5CEZE 1QFWM 1XH1A 1T20A 1ESOA 4UZGA 4G5ZH 2CPUA 3NCCB 3LXBA 5JPNA 4F91B 2D03L 3OAUL 1UT1A 4H8HA 2NY2C 4WUUD 4ERSL 1M9SA 4LF3B 2FNWA 4IHOA 1QYGL 3S3DB 1R33A 1MFBL 1YEHH 2Z92B 3HJEA 3NA9L 2A9ML 4JKNA 3LYRA 4KK8D 2FT7A 3PAZA 4O2EA 1EX0A 4RZKA 4XVJH 1Y6MR 3C87A 5E6IB 4HEMA 4ODTH 3HG1A 3L81A 2RH0A 1U8PA 2HX8A 3CIAA 1T7XA 5A40E 3GI9L 3T4AB 4RFOH 3IDYB 3D3VE 3BWAB 3FNKA 5TE6H 3PPEA 4Y5YB 2WIIB 4LSTH 3V6FA 5IFAL 2XPYA 2ZX9A 4HS6B 4DP6X 5ISZE 1BZOA 1A9VA 4LSRH 4A2FA 2EYRA 1JS4A 3DUUA 5DJ8A 2ZUQB 3DA0A 3QXTA 2E7CA 4PI0A 5F7WC 5BUGA 3S9DB 3NFSL 4NQED 4PS3A 1G9NL 4PJDF 1U8JA 3ULUC 3BDBA 4PSRA 3B2VL 4W9IC 3EZ8A 5HVFB 1WVZA 4AX3A 2HT3D 2VXQL 4NQDB 2PW2B 2WLMA 2BMKA 3MKGA 3SDDA 1AGBB 1RD6A 4OF6A 5DC2A 4G8IA 3IJYB 4Y5XA 5C8JB 2VR6A 3RNKA 4LIQE 1KGWA 4P9ML 2Q7YB 3DYPA 5EBWA 3EOBA 1IQWH 1OPOA 2LLNA 5DMYA 3DETD 4JCLA 3PHQB 2PPAA 4NRXA 1T1ZA 2X6VA 5LWYL 4QF1B 5LHDA 5KBDA 3HCVA 2OL3A 3GSOA 1AYRA 5I9QC 3PWNA 5HSFA 5D1QD 4FI6A 2DH2A 2IFFH 2PP9A 5JIHA 3TFKD 1EO7A 3L3IB 3ZHKA 2WINB 3KM2A 3FQXB 2DQUL 2BSED 4XNMA 4ODUA 3L4WA 5HHOE 5C09A 4YL4A 4ODVL 4HWUA 5E99L 5EU6E 1HH9B 1NUGA 3UZQA 1XL4A 3ARFD 4GBXA 2GJJA 4XMUA 3D06A 1F3JA 4L8DA 2CMRH 4UQAA 4YVUA 3ZZQA 5I1JL 4N8VG 43C9B 1F41A 2CO2A 4PLKD 4XR8C 4PW9A 3S2AA 2H6PA 4EDXA 3TBTA 3UTOA 2DEWX 2F7IA 1ONQA 2ROXA 1HXKA 4FFYL 4FLHA 1M7XA 2HJFB 3F6LA 3FQNB 1XF1A 4P2YA 4RZCB 1TCRA 3QJFB 2HT3C 5E2VH 1MFAH 2XQ0A 4FQLL 4XH2A 5CWSB 2P8MB 4K4KA 4DEWA 4EZJA 4LQFH 4DKEL 1J5IA 1FV1B 3VFTA 4CL7A 3VXUE 3H2WA 1KELL 1U30A 3DX7B 3L13A 1E8WA 4WU7A 5CMAA 3QIUC 1C5DB 5KYUA 1EK3A 5EO9B 1Y18A 1JHTB 3LRSB 3QNYA 1A7RH 4Z95H 3OGCA 2BIMA 2Z7ZA 1HYSD 1LE9A 5IWLC 1ZSHA 2R0KH 1VHPA 5DHVH 1E3XA 2B2XL 4FMFA 4CC4A 3K81A 4PVBA 2YPLD 3AAZB 2XN2A 2VE6B 1BVZA 2IDTA 4J6RL 4WCYL 4HOXA 1MFMA 3MJ7A 1NEZB 2IV9A 3CQQA 4P23A 5I26A 1IGIH 5C0AE 5EOQL 4IQHA 4JKPL 4RMBA 3RB7A 2IAND 4NM4L 3OX8A 2PYEB 1FGVH 1OGAE 5DD3H 5EOTB 3FQRB 3MRLA 4N8UA 4LMQI 4R2GB 4FYRA 2DAVA 1I53A 3RDTA 1T4WA 4QHLB 4Y2OB 4ZSOA 3UBFA 4M93B 2XBTA 1KCBA 4NNYA 1Z66A 3K2IA 4J3UA 1YPZA 2ADIB 4KBPA 1XQ4A 4G7YH 3V6ZB 1UUSA 3C8HA 4BV1A 3B56A 1UASA 3Q7JA 4IEFB 4DESA 3FSAA 2FJUB 4N85A 1VFBB 3FU0A 3TYFA 1WWAX 3GD1C 2ZOLA 3QEUB 1IIKA 1TNMA 2W80C 3D39A 4Q14A 2DM2A 1OT2A 1TTRA 5CFAA 2DJ4A 2V6HA 1E9QB 4L1BA 4GW5B 5C08E 5EIQA 3TCTA 1AOZA 1A9EB 4EIZC 3GLAA 5JDSA 1O0VA 3V9CA 1H9VA 2EE0A 2ICWJ 2VRAA 3NAAL 4P4RB 5DRZB 2O1AA 1RZ7L 3MYJA 4UU9B 1IFRA 1ITCA 1L0PA 1TO4A 2YOAA 3N1MC 4LRNL 1Z9NA 5DUMH 3MCG1 2AERT 3SGKC 1XEUA 3KJ4C 2VZ3A 1W0WA 2J21A 5DWUH 3X3GL 3TLRA 5E56A 4JZJC 4K71B 2NYYC 4KVNH 2NW3A 4LDCA 5F96L 1EIBA 1NUNB 3C6SB 1ZVNA 1XF2A 3HUJA 4QRSA 3NQKA 1E27B 4LHQB 4JJOA 3DI3B 2AKRA 3OKKB 5E8OA 2JELL 3GSNA 5DK0A 4E0RB 3FH8A 1DCLA 4L4VD 5CZRA 2R39A 2ZXGA 1OTSD 4CMHB 3GJFH 1HIMH 4LP5A 1WHPA 3H9SB 1QLRB 5AW1B 3D6GA 2NTFB 4GAYB 3SN6N 1BFOA 4GG6E 4TQPA 3U0PB 3TS8A 1B4RA 1X3DA 2D7TL 1DQJA 1UKQA 4PJFE 3UTSD 2VLJE 4DFIA 4DN3L 1J5OL 2J1KA 3AS3A 2HP4A 4P9HC 1LP9E 2O61B 1HL5A 4B7IA 1KBBA 2V2WA 3SKNA 1ZRUA 3HC4H 1NCIA 3R7RA 3QORD 5J56B 3EJRA 4D9RD 1A6TA 2YC1A 3Q2VA 2E5EA 3LZQA 4DP8X 3WUWB 3REWA 3CWGA 1OW0A 4OCYL 4OJYA 3BPCA 5CAYB 3TA3C 2A7BA 1LEKA 3MLWL 5ITBL 3BIKA 3NJJA 5BXFB 2FX7H 1T1XA 4YXHH 5IGXH 2WSPA 2VL5A 3TASA 1Q94B 4G42A 5D2NE 2UV3A 1W0YT 1UWXK 4U1JB 4UB0H 4AYBA 4J1UA 4B95C 3BH9B 1DTUA 4JAMB 5DO2D 4GKZB 1AFVL 4DGYH 5KSVB 1DJSA 1DQTA 2WNXA 1OTSC 5KJRL 1BWWA 5EZOH 1BEXA 2WN2A 5IBLD 2WBJA 1J87A 3HHMA 1T7YA 3NT0A 3ZT7A 3KCWA 2ZOOA 4QGYA 4NCC2 2BHFA 12E8H 4NEHB 3W1ZA 3KPMA 2H6UA 1PL3A 4ISVA 4C4KO 3CZKA 4PW4A 1IEBB 3MBXH 3ECQA 4HUXB 3DV6A 4G43B 4JM2C 4G71B 3MBEB 4QOKB 3ZKMD 3L2LA 1JV2B 1U6AH 3CQFA 5LN4A 3FRPB 3QHFH 4PJHB 2IDSA 5JPMA 5JA9A 2ID5A 3CSPA 1IRAY 3TC9A 3TN0B 1LO4H 4LRIA 1IC7L 4HCRL 4P46A 4U1MA 4IIQC 2VGLM 1N26A 1SXSA 3O4LD 4K5PA 5E00B 2F2HA 3C60D 4HPYH 1J8RA 3F7RA 4NZJA 4CW1B 4YC2B 4X0KB 5ABZA 5F9OH 3NACH 4FNSA 2J57A 4WTZA 3UJIH 3RWFA 3F7KA 4KH2A 1JL8A 1W0VB 4WV1A 4UYPA 1M4KA 1V05A 1LDPH 1OCCB 2BXZA 4DW2H 4QAMB 1IVTA 2PR9A 3FTVA 4HD9A 1R5IA 3BSGA 4EOWL 1IBGL 5DQJA 1KUMA 1DR9A 3TWCH 1WO2A 4N0YH 3EYVB 3L3OB 4L1DA 2DD8L 2WXQA 5MEPB 2XFXA 4AWJC 4C56D 4CVXA 4LPCA 2R2BB 5IBLC 1CBVH 1NC2D 5FUZL 4U31A 5DFAA 2OTWB 5DJDA 2J1WA 1IEAB 2LU5A 5F9WB 5DMJB 4I2XA 3ZIMA 1TETL 1MJ8H 4ORZC 1QBLL 1AACA 4DGVH 1BQHB 3CMOH 4DAGH 1MH5B 4M43H 4GSDL 2EILB 2XV6B 3ZHLA 5GGVY 4F8LA 4JHWL 2V5MA 4BCYA 5CSGA 3T0EA 4EJ1C 4QRBA 2GUYA 4WU5B 4YS4A 2YHGA 5AAWA 4Q52A 1E7UA 4MAUH 4OCWH 1J9TA 3CLFL 5F70A 5DHXB 1ND0B 1MY7A 4JFOB 2ADGB 1RUKH 4BFKA 4A67A 4GAGH 1PG7H 3EUUA 2ALAA 1J8HB 1MEXL 3PGDB 1Q72H 4FHKA 3AW5A 2DQGH 4HF5H 4BH8A 4GO8A 3QFDB 1MN4A 5LBSL 2ZOUA 2YA2A 4U1SA 1U95A 2UZXB 5JLZA 2MHAB 2FX8H 1QSED 1ANUA 2E9WA 5GIRB 4HJ1A 3VXTB 1Z2KA 5HGBA 4AM0A 2XQYA 2YSTA 3QG6A 2P80A 3S5LG 4XP9L 1ETJA 1RJYA 5E2TL 1JF5A 4JFEE 4PJIB 2W0PA 1N5AA 1ZLUK 3SKMA 3BLPX 3LIZH 3NCBB 4TS6A 4UILH 4RMWA 2FEJA 4PGCB 3L54A 4HH9A 3BKMH 3TIEA 3OF6A 4JS7A 5LN8A 3BH8B 3SDAC 3OPUA 4ZOBA 2ZAHA 2NY5H 2IMMA 5KS9B 4XPHH 3NGBB 1AXIB 1X5JA 1J86A 1WYJA 4BK4A 1AZRA 2OSLB 3APMA 3DROB 3EBAA 1IM3D 1NBCA 4JFVA 1KSRA 2IXQB 5MEND 2CLVB 4YSRA 4NUGH 3MLZL 4LBEA 4PJAE 1IKFL 4HUWA 4NENB 3K8KA 4XC3L 5C6TH 2NY3C 3M46A 2H1LM 5EIIA 1SN5A 3V0WH 3MRBA 5A6MA 4KJPC 1GKOA 2NLJA 3BE1H 4YFLI 5DA0B 4BZ2L 2LT9A 5LXGH 4IGBB 3ZMRA 1OXYA 4PJ9C 5ISZA 3UTPD 2BNQD 4EBQH 2CA4A 4R96A 3NH7H 2FL5B 3MLYL 3GXPA 5LDUA 1MKFA 3G6JB 2AJZA 1CFQB 1S8DA 5EO1A 3SODB 3VYNA 4OGZA 1VESA 3BJLA 4Y5VA 3KDMA 4H8WH 3BGMB 4JREB 5I6LA 1R3KB 3OC5A 4M6OH 3O3AA 2MJWA 5ALBH 5DVPA 3CZEA 1TJIH 4PY7A 1EUUA 3EKCA 3HAEA 4HPOL 3OXRB 5A7EA 4QXGL 2ZSVB 3PAYA 4N2FA 1HQ4A 1U8NB 2QQLH 1PEWA 3QC5X 3D7PA 3EYFA 3IN2A 3X11A 4AENA 2I60L 5L2KA 1MVFA 5M7QA 1ZGLP 5DR5L 2Z7WA 1JF1A 2NZ9D 3E6FA 3MXWH 4P59L 5JR1H 4LEXH 4YFLF 4FTDA 3NJHA 3FH7A 3NK3A 3S8WA 4Y4FD 1OWWA 2YGPA 1MREL 3D50A 2TSAA 2NOYA 2JTYA 2DYRB 4XBEH 1SN0A 4DGUA 5B3JF 3VFSB 1GC1C 1O7DE 3QC6X 4BKLB 4P48A 4X6DE 2VMEA 4M5YL 5D1ZB 5HHOA 4F57L 1LEGA 3LSOB 5EU6A 4JPVH 4L4TE 5EC2A 5B21A 5BS0E 1ZT4B 1RL1A 2XIIA 3WAJA 3PGCA 4NSKB 5FW7A 4HQQL 3BSZA 1Q1PA 1P5UA 3I2CH 1TO5A 4MXQC 4AYSA 3KLSA 4U1GB 4MNHA 2CDFB 1BJMA 1NZRA 2BH0A 4X6BA 5HYJD 2E27L 4FFYA 1G9EA 2JB5H 3AMLA 3GJEA 3APDA 3MNZB 2V9UA 2FD6H 1M56B 1PAZA 4LPWA 1L5GA 4CILA 4HJEA 4OAWB 5KVGH 3VXUA 2IVFC 4HK3N 7TAAA 4KQ3H 1J1OH 4J3OD 4AE1A 4BINA 5D93C 1L9PA 2AJYL 1WUNT 2WKLA 4AEIL 2R0LH 4H5SB 3OQ3B 1L6ZA 2X4NB 5I8KH 5LGJB 3DGGB 5DYOB 4MDIA 1ZTMA 2WCSA 4OIIH 2EDWA 4HWBA 1SXAA 3DHMA 5C0RH 5A43C 4JZNA 2CAKA 4IRSA 4WWOA 2PTTB 4MKTA 3WJMB 4AYEC 4YSCA 4Z7OB 3SKUD 4HOMA 4TMPA 4BQCA 4HV8A 3B8YA 1CFTA 2VR8A 3Q6GH 3MTRA 1AXTL 3F01A 1J0JA 5C0AA 2C7UB 4RNRB 5B1AB 4EDWH 1ZVSA 4LCCB 1NCAL 1AQKL 4NWUH 5ELIA 2YAPA 2I5YH 3F7YB 3N1PC 1T1WA 1Q9LB 1GGBL 1SDYA 1ZA6B 2VWEC 3S37H 3GTVA 1WCQA 4NNXA 4R7NB 2BSTB 3CHQA 4J12A 4A68A 2J6EH 3CDCA 1GSMA 1LO3H 1OB1B 4G9FE 2IEPA 4XCCH 2ATKB 2YPVH 5K9OA 2ZCKH 1O7SA 4PWHA 5IB4B 5DUJA 3VFNA 1OSPH 3LD8C 4FCHA 1X7SA 3RFZC 1UUNA 1FZJB 4GIOA 1LE5B 3HG1D 4ONFL 5D7HA 1CS6A 4FEMA 5ESAB 3Q2CA 4DFHA 3LKPB 2WQAA 2Q3ZA 2X4PA 3DYMA 2HVKB 3KXFB 3UC0L 3ESMA 3RILA 4XNZC 4K55A 5C08A 4BZ1A 5I0ZA 2ZG1A 3LKOB 3FQ1A 4UI2A 5KVEL 2QGEA 2J56A 5FM5M 4YZWA 4YHLL 1YEIH 4BUQA 1FORH 2CHZA 3ZTJG 4DO6A 3QEQE 3FUJA 5FOBB 1OAQH 5KSAC 3P40A 2ZE0A 3GHEL 1JMZA 4MKMA 3LKSB 3JXAA 3F7PC 3C8KB 3IFNH 1KB5L 1KN4L 4FXGB 3DJ9A 3B2XA 1GW0A 3FB5B 3BD5A 3OKNB 4LHUG 4F37F 4M4RA 5I8OL 3KH4A 4AK1A 2DM7A 4PJXB 3SDXE 2ZPKH 3W5NA 3BN9C 4ZYKA 1UVQA 5HY9B 2MMXA 1QBMH 1U8QB 4JVPA 3STBA 5KN5A 1OAUH 3SDDD 2WLHA 4FKHA 3WGUB 4QTFA 1Z9SB 2MNWA 2HAZA 5BRZE 3SQOL 5IHWA 2QADD 2PKDA 3P3RA 3ARBC 3QRGH 4OI8A 1I4FA 4NQSB 2KT6A 2AXFB 1T83C 2VN6A 3OZ9L 5EU3A 5MHSE 1V5JA 2XZCH 1CT8B 1AD9B 1Y0LB 3IJSB 3QI9C 2R69L 4R4ND 4BRVA 1ITBB 3JV5A 4UINH 2CGZA 4Z7WB 4MJIB 2EO7A 2O6CA 1ZWIB 3CH1B 3NRPA 3V2AR 4GG6A 1OY3B 1E4WH 3RG1C 1FG2A 1J10A 4PJFA 2H32A 2F54E 2F0CA 3CPUA 2MPVA 4L9LC 4NO3A 5C09D 2WYZA 4N26A 3UJJL 2RHEA 3QQ9D 1LP9A 4HLZG 4KX7A 4QO1A 3QUYC 4WFHE 4GBXD 3EJYD 1PIFA 4N0CC 2P5WE 1BVNT 3RWIB 5CD3B 4U33A 1DE4B 4G6JH 4G7RB 1CFNB 4FJYA 2AJSL 5AZ2H 1XB8A 1OAJA 2FSEB 2ZAIA 2EABA 3VD4A 1RZIA 1R3IL 3U36B 1HWWA 1VPOH 3B7YA 4HGWA 4RISL 1EDYA 5KTEL 1E5BA 1OCWL 5HHME 4E9XA 1PLAA 4TYUA 5E08L 2BY2A 3FQTA 4RA0C 3VI3B 2VN5A 2IDCA 4NWTH 5D2NA 3OMAB 3HB3C 3AGVA 1JGLH 3IXTA 4W9FC 4NAMA 3FFCB 3CFTA 3ULAB 4DPCX 4YZFE 2X4QB 3MUY1 2EJ1A 1N0XH 4EI6A 5D9SA 2AZUA 3G5VB 1QHQA 4Q89A 3VDCA 4KNUA 5D7JC 1FL6A 1E6OH 1MG3C 3MRNB 2B59A 4PRIB 5DDHA 4BHUA 1YG9A 2GFBA 2H1PH 2EKSB 4XPTL 4I1NB 5AUMA 1R3JA 1EGJH 2WQRA 1R3HA 4JRXE 5DVOA 4AXWA 1AQDB 2BIIA 2EDBA 3JTSA 3C2SA 3US0A 1BIHA 1QWHA 3MRRA 4S1QL 1F4WH 3VMOA 1JWSB 4NKIL 1HHKA 4QJ3B 3BESR 3GNMH 3KYOA 4HCRA 4P23D 1N18A 1EPFA 1U8HA 1VACB 3MO1B 1JTOA 3QR0A 5ID1B 4EI5D 4LCYB 4PJ5B 4E9QA 4XX1G 2BOBA 3MAWA 5BQDA 2FT8A 2Q5BA 3BWZA 3DUSB 2K0RA 4RGNB 3RDTD 3TVMC 3IDJA 4PI2A 5CINL 1SJHB 4XMZA 1E5YA 5F89A 3VXMB 1E65A 4P0DA 3O6LL 1ZEAH 2EYTB 5DD5L 2Z93A 1XSJA 2R8SL 3RBSA 2B0SH 5J6HA 4YNYA 4NC1E 5AW4B 5DHVB 1GHFH 1FFOB 3T3MF 1N59B 1TMQA 1IO4C 1I7UA 1XIWB 2CDEA 4X7FC 4ZPVA 3GMOB 1A6ZB 4XXCC 3SCMA 5KANI 3K6SA 1NBVH 1KB3A 2EEBA 2MCAA 3WD5H 4TRPH 2FB4L 4LOVA 4P2QE 1OP5K 3THMH 4JFQA 2D31B 1T2XA 1XZ0B 2W1NA 4PWGA 4AGMA 2DQCH 2ZUSA 3I50H 4KK6D 1I1AB 2OYKA 1WAPA 3JUYA 2E4TA 2MRYA 1CLOL 1JV5B 4XNQB 1NAMA 4TSAL 3KWUA 5I74C 1DBKH 1XGRB 4PJCE 3ZE1F 1AKJB 1U3HB 2R0WL 1Q1JH 4XPFL 5JW4M 3CZGA 4MX7B 5AOJA 4EI5C 4XGZA 1SRDA 4I77H 3BKCL 2C5DC 3B43A 4B0MB 3T2NL 1WWWX 2FQFA 4XTRC 2WLNA 1H0DA 4FNPA 1KCSL 4X4YB 5DMGC 4NKDB 1S9VA 1XSKA 3HI1A 3RY5A 4BFIA 5A2LH 1QEWB 4OLWL 3GRWH 3HVNA 2IDUA 4U4BA 5DZLA 3PU7A 1JZGA 4FA6A 2NNRA 4XO5A 4UQBA 4J3OF 5J57B 1A25A 3EZJB 5HJBA 4LCUA 2BDNL 2YK1H 3Q0HA 4YDIH 1PW3A 1WDAA 2CO7B 2Q2EB 4I48A 2O5XL 1G1OA 5BMFL 1AS7A 2HB0A 3EO1A 2PWGA 2BS9A 1A7OL 3H9HA 3D4YA 3CDGA 3OSKA 4DQAA 1MWAH 1QLEL 1YEKL 4R3SB 3I9GL 2HUEA 5H4YA 2ESVB 2IQAA 2PXYA 1G7QB 4Y2DB 4JPSA 5HHXL 4OD3H 1P1ZB 4OM1L 1K5NA 3CFBA 4JDTL 1BVOA 2DQEH 4TTDD 2PP7A 1BZ9B 3O6MH 4LLAA 5MEQB 5CJOH 2MFNA 3BZFA 4LGPB 3LQZA 4FZEH 1FRGL 3GJFB 2DQDL 4OM0L 4IHBA 4C83A 4GXUN 1KY6A 3CLWA 2P5EA 1NGPH 1JPTH 1B3IA 3KPQB 2YBRB 4PG2A 1E4XH 3SY6A 4OJFL 4TF4A 4JVUA 3FO1A 4FKEA 3CX2A 3ULVH 1T0OA 3VWJB 1TDQA 3KPRB 4G7SB 1G6VK 2WBJD 3BIAX 3CUPB 3JYCA 2NZIA 1CG9B 1KXVC 3EO0A 1DZ0A 4FQHA 1D9KA 1HL9A 1NDMB 2OMWA 2HTLC 3EUDA 2BLFA 5JMRA 2WNGA 5SWSB 1CE1L 4M29A 4KQ4L 1O6TA 2G5BB 5DRXA 3CSBA 3ZR6A 2C4FU 5E4OA 1RZ8A 5FCUH 3QQDB 5LGYA 3DC0A 4LOFA 4NM8H 1TZOA 4AITA 3IE9A 1SOQA 2GJRA 2BNRB 1BMWA 3V5KA 1XX9C 3BIBX 1AHKA 1HCFX 2BSSB 2E75C 2I07A 3FKUS 3FN9A 3L16A 4YUEL 2R23B 4FP8H 4P46D 4A7VA 2MPAH 4HK0A 3UYPB 1G84A 2V9RA 3IFPB 4F7MA 3CU7A 1BQLH 1Y7VA 2WXLA 3AJ7A 4P5MA 3T0AA 3VM7A 2JCCB 3PUCA 4E36A 4Z7VF 2BNUB 3T0WA 5C2BL 5LAXA 5MERB 3DLQR 2GITB 5M94B 3F2LA 3Q3GA 4OJCA 4L4JA 3ZYJA 3TO2A 3UTQB 2MOQA 2E9BA 4Y19E 1U91A 2VW6A 4MQSB 4X6DA 4HT1L 1I9IL 2DQIL 3OKMB 3WLBB 4L4TA 3IJ8A 2NXYC 3LHPH 4NKQB 4D8OA 4E9LA 3SDYH 5BQ7A 4NQDE 2G75A 2J3SA 3O2DH 4HKBA 4TVPD 1TVBB 2R59A 1IL1A 1FJ1A 1SMOA 1U8OA 2Q20A 1BOYA 3MU3A 3O81A 4GRLA 4NB7A 4YHNA 2AEPH 3I6LD 4MA1C 1UB6B 1RZKC 3MRQA 1GGYA 4G59C 1OLLA 5K9KB 1PEZA 3AXHA 4JDEB 1S5HB 4JM4H 3N55A 3EO9L 2A73B 1ED3B 2A5UA 3T0ED 4LLWB 4MFHA 4URKA 3UTZB 4QPEA 5JPMC 1EHAA 4A6YH 4FI8A 5I17A 4XOAA 4P46C 2AEQH 3ZW3A 3T04D 1C12A 5KZCB 2WVVB 1ILUA 2QVKA 2X09A 3MDJA 5SWZA 3KLDA 1BG1A 1M9WA 1FL3A 2ICWA 4Q6IC 4DGWC 3L7FB 2D4DA 1JMXA 3JWOC 5TK2A 1QO3A 2WYIA 2JKIS 1CFVL 1X6NA 4K9JA 5HDQH 1AP2B 3EYUL 4HXBL 2VT0A 1P4BH 1WC7A 4KZDH 3GM8A 4JLRA 1Q0XH 5EMYA 1DUZB 1KTRL 2AF2A 5TF1L 3L5WB 4QXUH 8PAZA 3M88A 1P5VA 3RQ3A 1NLBH 1UM4L 1EWHA 2P80D 4W6XB 3WNLA 4BWUA 4F7EA 4G6MH 1JZDC 3PWVA 4KRPB 1JNNL 1NL0L 1D5RA 4F58H 1C9SA 4FXKB 1J1XL 5JW4R 2EDFA 4AYDC 3H0TB 3OF6D 5B38B 5B7EA 1I8UA 5H35A 4U1NA 2X4SA 1AZBA 4L8SB 1U33A 1F02I 4PRDA 2XZQH 5CNHA 4NUJA 5GS1B 1UWEL 2BOLA 4NGHH 4ODXB 2WO3B 4FA8A 5IB2B 3IF1A 2H41A 1SY6L 3FCTA 4HSQA 4KKCD 4OBSA 4TXVB 3ORJA 1ZSDA 4U6XB 4YDJB 1N6QL 3FO2B 3W9EB 1JGDB 2R2CA 1PZCA 3GTTA 5FO8B 4PV9B 4APQC 2DLFL 4FJZA 5FDWA 1CFMA 1VGKA 1NFDA 2QQQA 2ZONA 1RURH 5DZPA 2LVCA 2Z0UA 2RB8A 2Y6TE 5E6UB 5E2WH 3ZYZA 4AJYV 5ISZD 5AAPA 4X9YA 4IJ3B 1YPZF 3CVBA 2PYEE 5CP7A 5H2BB 2VAJA 3L4XA 1KN2L 3CFDB 3GLZA 2Z31C 1LEIA 5DLMH 2ADJA 4ZS7H 3V4VA 4L5FL 2C9UA 4G6KH 5IW6B 1QOKA 1Z5LB 1UXMA 1U8LA 1XGPB 1ZVYA 3IM1A 3K3QA 5TQ0H 3QZBA 3UJTL 1MQKL 2J8HA 4AEHL 2OQJA 4OGXL 3VSQA 1T0MA 1MRDL 5T1KB 4WNSA 3CSFA 2WOYA 3LN4A 3OKLB 5DHDA 1RZJC 1RP8A 3PRZA 1EFQA 2DJMA 1OK0A 4PJDB 3I75A 4EI0A 2I9LA 3O2VL 5BRZA 5L2KD 1HNFA 4BFEA 1QNZH 3HRZA 2N7SA 1OOAA 3U9PL 1OQXA 3B7UX 2A74B 3IJ7A 2D0HA 1AJ7H 2MIZA 4ZTPH 4WO4C 2R69A 1JRHL 2C9SA 5B7FA 4GSXA 4C54A 1A7NL 2AHIA 3RWHA 4DGIL 2W9LA 1OTTC 2FWOB 5E8EB 3HUJF 4X7TA 4W9EC 1FHGA 4ZNCD 4XNXL 1VFAB 2BIPA 1A65A 3QUZB 3TV3H 3ETBF 4E9RA 3U4BL 5HHOD 2VH5L 4GUQA 3KDPB 4XP6L 5EU6D 5I0XA 4P2RA 3FO0H 3U9UB 4LHUA 1FPTL 4P2OB 4QDGA 4F8PA 1RV6X 4JY5H 1KXQE 1JGUH 2OZNA 3FT3A 2MOVA 4XO9A 1BREA 3GB7A 4XE5B 3Q48A 1RJCA 5JIPA 3W2DH 4JHAH 5JW3H 4X6EA 2QFRA 1NIBA 1BX2B 3N85H 3RVVC 3RVWC 3GSWB 1N2RB 4XVUC 5HDBB 5I19L 2E3VA 2VJ8A 5EBMA 4ZTOL 1GOHA 3F58H 3CHOA 3A5VA 1SJVA 3TONA 2GIMA 4X4ME 3H9SE 4JG5A 3ESVF 3VXUD 2LW3A 3CCHA 3PIQA 5IHZA 2DDQH 4AL8C 1N4XL 3OR7B 2K78A 5DU7A 2AGJH 3BISA 4OZFG 5C6WH 3CZFB 1ZVHA 2X9WA 3WO3B 1KTDA 5AVRB 5F6IC 4WSGA 1RZFL 4YSDA 2AMGA 3QYCA 1Z3GH 1GIGL 3BVXA 3NCYP 4AQAB 4K3JL 1HEHC 1UFUA 4N0UA 4Z3GA 2LLLA 5KBMA 5IF0A 4M4PA 4ADIA 2X1QA 5TGBA 2WLYA 4IRSD 4PJ6A 1E50A 4KMTH 1MDTA 4KAQL 4F8NA 3KBFA 1MNUL 5CFHA 1EZUA 4JZOB 4X8CA 3KYAA 1DVFC 4QHKJ 2GTWA 5C0AD 1FBIL 4K7PL 1IAKA 1I8LA 5DUBB 2EE3A 4ELKA 4FTVA 2R15A 2HRPL 2H2PD 4Z3FA 1XGTB 5AOMA 1M6OB 3MNVA 5AVSB 3JWOL 2LU3A 1UOLA 2V9TA 2FJFB 3HC3L 3RBGA 1BZDA 3AWGA 1B9ZA 1ORSA 4NZRH 2Z8SA 2Y3AA 3C9NB 1GGUA 3FB8B 2NYZA 5L88L 6PAZA 2BHZA 4JGUA 4U3SA 1MPAH 2YA0A 1NANI 1FZMB 3IFOA 4YHML 3KWWA 2ZT9C 3CVHL 1WFOA 4JFZL 3QXAB 2H7WA 4HSCX 1CDBA 4BSWA 3K6NA 4GW1A 4QOKE 4HIIA 4PJHE 2ORBH 1XCTB 4P2QA 3U7WH 4V2CB 5C08D 3PF2A 4BQ6A 4W9CC 1BIIA 3DHPA 3ZKND 4OB5H 3KPOA 2E7BA 3U46B 1NLDL 3QAQA 4QYOB 1KPVB 4JEGB 2Z9TA 2NY4C 3ULSB 5CGYD 5T3XL 1MAKA 4MAYA 1ZLSH 4AYMC 3V0VB 1EFXB 4Z7OF 1T5KA 3SZ6A 3WKML 5IR1A 2KLTA 1PDKA 1IGTA 4N0FA 4F8OA 3ABGA 1KCRH 3VGHA 3T6WA 3RPBA 4X8JA 1XGYL 5F44A 1NBYA 1GMIA 4AH2B 1TQCB 3ESUF 5HI5C 2C1OB 1D6EA 3GEWB 3W57A 1OF2A 2Y07H 1C16B 5GS0H 3ECWA 4G6AC 2XYCA 3K0WA 5I76B 3LN5A 1L0YA 2KZWA 2FWLB 4KY1H 3IAPA 3MV01 1L9MA 1CDJA 2EDHA 4LT7A 4E42A 1JZ7A 3L9RB 4N6QA 3ZXAC 5EUKA 1CDYA 1IE4A 3N41F 4JANB 3U0TA 4Q56A 4PWEA 3C8DA 5CEYA 2EQDA 2PW1B 1O5DT 5CGMA 2CSPA 3WFBL 1OZUA 1MHPL 3BAYA 5CGYC 5LUMA 1BV8A 3QPXL 6FABH 2GAZA 3AU1B 4NO5A 2B1AL 1DQML 3CZJA 4ZQKA 1BA9A 2E86A 1SNRA 3DHUA 4N6RB 4AQ1A 2N56A 4WI0B 3SDCA 1M1XB 2VERN 1UA6H 5HPOA 1H6FA 3QO1A 1V3KA 3E8UL 3LHAA 1KT2A 4HFWB 4N2BA 4UQ3B 3WFEH 3HNVH 2ATPA 3ARDA 4MHHG 4RLDA 1IC0A 1RULH 3IDMA 3IMWA 4UT6L 5HGAA 2GKIA 5IROD 3KVDD 4PJIE 4AYGA 1MXDA 4DOHB 4PP2A 5DJAA 3HN3A 2W9DH 2VRQA 1YMMB 3GIVB 5C0IB 2OMYB 4TUUA 1CFSA 5IUCA 1JD7A 1OWRM 1N10A 4EN3D 3C09C 5HVWA 1KTLB 5FM8A 2BJML 1A7QL 3HE7B 3X13A 3SKJL 4G1MB 4LAQL 2NNXA 3B9KC 3POHA 3S36H 2UY7B 1UJ3B 2VXUL 5DS1A 3BUTA 3T77B 2Z92A 3QNXB 4HG4J 1IKNC 3WYRA 4PEEA 4U3CA 5ID0B 3EDKA 3E7JA 2HRLA 3LS4H 4NZ8A 3BWAA 4WI9A 4Y5YA 2WIIA 5E5LA 2VYRE 3ARYA 1HZHH 3N44F 3AT9A 4N68A 1FLTX 2FUQA 4GXVL 1MHHB 1YY9D 4ZT1A 5FC9A 1YHPA 3SO5A 1H5BC 4FAAB 4F3FB 2OL3H 3G6JE 1QABA 5I1EH 3JUZA 1NCTA 3C08H 3UG3A 5IROC 4IBWA 5IHUH 3RY4A 3ZRCC 2K8MA 4ELMB 1PAMA 1MCCA 5FO2A 7PAZA 1MIEL 3JWDC 3MCLL 3S35L 4S0SD 4RMTA 1EAPA 3PWPB 3E2HB 4UBDC 5E6ZA 1ET7A 4UQEA 5DEZA 2VDPL 3A3YB 3SCMD 2VQ1B 4EN3C 4NQDA 1KCLA 1YVLA 3BQUA 2PW2A 3BVNB 1CLCA 2DQFB 2VUKA 4JHUA 1AGBA 4ONGH 3DV4B 3IJYA 5C8JA 2F8OA 2Q7YA 1H8NA 1WZ1L 1H8SA 1UZ8B 3D69B 2BW5A 5B1JA 2UXFA 3NABH 4K5MA 1JZ3A 3OQRA 4I1RA 3F12B 2ARJB 4YX2H 1ACYL 1NCOA 3PHQA 1OAKL 2WXFA 3QWRA 3VG0L 4DQOH 1ERNA 4WLCA 1LO5B 5D1QB 3CHRA 2AK4B 4ZD3L 3V0JA 3RA7L 1DQDH 3GBML 3CTTA 5DK2B 2APWA 4Q4EA 2VR3A 3DRQB 3L3IA 1T66D 1UGNA 2BP3A 2WINA 3FQXA 5SX4I 2R4RL 1RUQL 1IGML 4MA8L 4ZOEA 3R18A 1YY9C 1G0YR 3ARFB 3OM3B 4HGKC 1HH9A 1WBZB 3HI6L 3NN8A 3S48A 4C58B 5CZVL 3ML9A 4N5EC 5D7KE 5FKAB 4FG2A 2NMSA 4K94L 1B0GA 4KKBD 1IGFH 4MQ7B 2GVYA 3WELA 1U58A 4HC1H 4MZRA 1YEDB 3WFCH 5F7MC 43C9A 1ZV2A 2R4SL 1ZOXA 3A22A 1B0RB 3IRPX 2H47C 5E4EB 1JZIA 1ZMYA 4BSVB 1IT9L 2BIOA 2HG5B 2HJFA 3FQNA 3P0YH 4JFED 4RZCA 3W3BA 3U2SB 2P43B 3CMGA 3QJFA 5EZJB 4MYPA 2OPCA 1F3DH 4HCGA 3VJ6B 4QJ4B 1JXGA 1PCSA 4EXKA 3LDBB 1TF4A 1VRSA 3PQYA 1MCSA 4ONOA 4M1DL 4CJ1A 3DX7A 3IPEA 4UIMA 1HXMA 2UZYA 5IQ7H 1VENA 1RUPL 3KVQA 4S1DC 5EO9A 2IBZY 2H26B 3U0WL 4UOZA 2XXMB 1AXSB 1KIPB 2IAAC 2PXYD 5T1LA 3VXRB 4TNGA 1LWRA 1PKOA 2D9CA 3G6DL 4HIQA 3WKQA 1SY6A 4CBPA 2B4CC 1KYAA 3ML8A 4PREA 3LKRA 1QPKA 1SXNA 5BV7H 5CUSL 5I2IB 4EKXA 2F58H 2P5ED 4HUUA 3QA3B 1GVIA 2PWHA 4Z7OE 2GY7B 1B6DA 1O6SB 1D5XA 2EKJA 1NEZA 2OMUB 3R4DA 5FXCH 4KKBC 4LE8A 1LD9B 4XP5H 1LTXA 3FQWB 1OCRB 3K2MC 3V4UL 1MJJB 3M17B 3FQRA 1OAZL 1T0NB 3QULB 1X7TA 1D9KD 1FQ9C 1IB5A 4S1RH 2X1WL 1PF3A 1E43A 2P4AB 2H8PB 3B2PA 3M6DA 3G5ZB 3SQBB 4XCNA 2ADIA 3R1GL 2AFNA 4GINA 4A37A 1QAWA 1CTMA 1THCA 2UX6A 2B1HH 5E5UB 1HESA 3AABA 1QW9A 3KHQA 4JM0A 3VVVA 2WV3A 1VFBA 3FUMA 1I8MA 2BXYA 3RP1A 5KOMC 1R24B 2PXYC 3GSNH 3KXFE 3Q8FA 4PJGA 4UCFA 3UXFA 1LO0L 3P77B 4KPHL 4PHXA 5T33L 4GW5A 3PL6B 1EZVX 1A9EA 4MB3A 1FZOB 5IVXF 2A4ZA 3EH5B 2IPTH 3L4VA 1KWGA 3VI4A 4D7PA 4M6AA 2E9GA 4P4RA 5GRUL 3AB0B 4UU9A 2BOCB 5IFHH 2NZ1A 5CCGE 4YWGH 3TESA 4M3KB 2F5BL 4LL4A 4UTBL 5BUAA 1TZ8A 2ZG2A 1HEZB 5HDOA 1DSYA 4L4TD 3GFUA 4FGMA 1HNGA 5F8QC 2HLFD 4PJXE 4UM8B 3TCXA 4R4FH 5EHFA 5I30H 2DMCA 3C6SA 1KXQA 3U7YL 35C8H 2AANA 2X6AA 4GRLD 3B34A 3OKKA 4Z76B 1KEML 2CA3A 4Q4IA 4L4VB 4GG6F 3HHSB 1MUJB 4N5UA 4IIZA 1S5IL 4PJFF 3N1GC 3IEAA 5J13B 3M86A 4OW6A 2AV7A 2ICEA 2ENQA 2FEDC 4WW2C 5ERWB 3S3CB 1LDSA 3G7TA 3J7HA 1LP9F 4OSUH 4Z78A 1QLRA 1QI5A 4IKIA 2CKBH 3R06B 4Z7WE 4GAYA 3SGJA 2Z7UA 1KFAH 7FABL 3U0PA 4HDIB 2IIJA 5SWZD 3V52H 5AWNH 2FBRA 3BP7A 4LGRB 1WFMA 5D7LB 1NCBH 3CFKB 4QTIH 1LILA 4M7LH 2O61A 3DGCR 4H1LG 2WGXA 4UIKL 1ZLVK 2DW5A 3QORB 1U92B 4J2XA 4U2YA 3RNQB 3SJVA 4HVBA 2CJUH 5KSBE 1AVAA 1O7DC 1PYWB 4OFPA 1FAIL 1TR7A 3EF4A 3FTSA 4WJKB 3FN0L 3IMRA 4PS8A 4ZQTA 4HUCA 3T1FB 3SPVA 3PFUA 1NA8A 3L1OL 4LARH 4A38A 2EIJB 1EEZB 1GZHA 2JLPA 3RGVC 2WANA 4A6YB 1N3NB 3EF7A 4Q6KA 5BXFA 3ZJAA 3NDYE 3VI3E 2XA8L 3RVTD 4CC0A 5I1GL 3L45A 3P3SA 4F5CE 1QEXA 2J2ZA 3FFCE 4JAMA 1AZZC 5KSVA 1Z0MA 4ZFFB 3F7QA 4JKMA 5F7NC 2EE2A 4Z7NF 4ZUWA 1YMHB 3DURB 2VDKH 3PXJA 4JN1H 5IM7B 2PF6A 3CFUA 3LMJL 4WWKA 1IEBA 5F3FA 4JCWA 1JGVL 5TE7H 4G43A 1MRFL 3MBEA 1CI3M 5EBLB 1HHHB 3TBSB 3N1FC 2OZ4H 5E0FA 2E9JA 2OMVB 2BCKA 4KUCD 3TN0A 2YAFA 4ODHL 2QV4A 2YUVA 5L9DH 2DJUA 1A7PH 5E00A 2XU9A 1QX1A 4HUVB 2YN3A 4PJ5E 3QEQD 1DN2A 1KB9J 4X0KA 1PPIA 4ZW8A 4UYQA 4CW1A 4NP4L 3LXUX 4JK0D 1IFHH 4RGNE 2ZSWA 1BZ7B 1W0VA 3U30C 2Z1KA 1A22B 4OKDA 3VXME 4M3JA 4KHTH 1BYOA 4YAQB 1A14H 1F11B 1YYCA 4ALAL 5D55A 5E8DL 2YMTA 5ETUB 1FNAA 2XG4A 5C3TA 2VAAB 2DIBA 4OF7A 2Z8VC 4K3DH 4C56B 4KITB 3EYVA 5MEPA 5DJCA 1S7RB 2RFXA 3FUHA 1NC2B 2C9QA 2NNFA 5J3HC 1NMAH 3OAYH 3SBWA 3BW9B 2OTWA 5AOKA 5BRZD 4FQ2H 2DQHH 2WYTA 1HSBB 1IEAA 1WFIA 4LVEA 1FLRL 3X3FL 1G43A 1Q9WA 4DTGH 1GS7A 1JNHB 3T2PA 4JDVB 3S35X 1YO4A 1MH5A 2QSQA 1CQKA 4TLUA 5LNDA 4I3RH 1WG3A 2XBZA 15C8L 2AABL 3D4ZA 4A2HA 1OHZA 1T7ZA 3WEOA 4KZCA 3BN3B 4WU5A 5I1LA 1H6EA 4YBLC 4GT7A 4MQXD 1I1FB 1NCJA 4FL4C 2E7LA 1ND0A 4R90H 4JFOA 3AG4B 3C12A 4WFHD 1DBML 2D03H 2P5WD 3OAUH 3MLPA 4ERSH 4XCEB 1J8HA 1DLHB 1QYGH 2K3HA 4EIUA 3QFDA 3NA9H 4MLSA 3UJJH 2A9MH 3CFJB 3TNNB 2UZXA 1QSEB 1P6WA 2MHAA 4JQVC 2LGNA 3BZEB 5HHMD 1AG6A 1NKOA 3L7EA 4KJYB 5GRYA 3GI9H 4UT6A 4I5BB 4ANVA 3D9AL 3W82A 4TVSa 4XPGL 5J6SA 4PR5B 5IFAH 4PJIA 2OFQA 5EZIL 5FF6A 3VRLF 3MOQA 4PGCA 4LFHG 3QIWC 4TLSA 5DSCB 3BH8A 4LCWA 3R8BB 3RIKA 3QWNA 1OTUD 3HN8A 5IK3A 1SJXA 2KPNA 5KS9A 3NFSH 2Y06L 2AS5M 1CDHA 3MOAL 1G9NH 2X5PA 3DO3A 4YHYC 2OSLA 2ESVE 3S88L 4MQXC 4ZDHA 1E28A 2IXQA 3V0DA 2CLVA 3B2VH 3AREC 3P73B 1IAMA 3HAEH 1UWFA 3KW7A 5HYSB 2VXQH 4NENA 3G9VA 5AZEL 1A8ZA 2E59A 3ALPA 4F1SA 1NBQA 1I75A 2YUWA 4IRZA 4GNKB 2E7HA 1BM7A 4P5TC 4OFVA 4QXWA 4TNWF 5C92A 1N64L 4FTVD 2IOOA 1Q0YL 3VE0B 4IGBA 1PKQE 2Q8AL 1AI1L 2WUCL 1BM3L 1FIGL 2CWRA 5DEGB 2Q86B 3WO4B 5LWYH 3KLKA 4I0PC 2EXWD 4L3FA 4TSCL 1H6UA 3KPRE 3FHEA 3OGOE 4G8EB 1BXXA 1N19A 3G6JA 1CFQA 4D0CA 5CO1A 3A23A 5KBPA 1Z1WA 2DV6A 4UM9B 3RRQA 5SWSE 3VD2A 3PV7A 2DQUH 3QUML 2F53A 1ZPLA 5C3LD 3QARA 1PZ5A 2XC8A 4N2DA 4ODVH 5E99H 2CR3A 2BWDA 4BUHA 3ARGC 5DVKA 5JHMA 2BNRE 3OXRA 3V5HA 5T3ZH 1R17A 2QLVB 4P2QD 3T3MB 5AB1A 5GZOC 1DUYB 2OS7A 4MXVE 3ZO9A 4WJ5B 2FX7L 5DHYB 5JORB 3ZT5A 3P9LB 1G6RL 2AAVA 1N8OE 2ZWNA 5EUOA 4FFYH 4MD4A 4N87A 4XXWA 4NKOB 2ICWI 2QT6A 2JCCE 3QUXC 3AQYA 4FQLH 4MAYD 1ZKAA 4X6DF 4Y4FB 4BK5A 1TQSA 2JXMB 4DKEH 4D9LL 1YN6B 2IALB 5AAMA 5E9DB 4AUUA 2APVA 2OSXA 3MC0A 4GMTL 1KELH 5TPWL 1U41A 4UDUA 1TCMA 4BH7B 1FN4A 2R1YA 4BKLA 3TJHC 5ICXB 3ZE1B 5D1ZA 4U4IA 4GIAA 5CZXD 1KJ3L 1G7PA 1RFDL 5ICYA 1ZT4A 2K7PA 3PNWA 2BC4A 2K70A 2NUPB 1KGCD 2KC0A 2ENJA 1PFCA 2B2XH 4NC1C 5IB3A 2B16A 4ORGB 2P8PB 2CDFA 3V7AG 5T8IA 4J6RH 3P0GB 4WCYH 4D8PB 3GSVB 3FONB 1WLHA 4NZUH 5EOQH 4W6YB 1QHPA 4JKPH 4MXWH 3UBGA 4NM4H 4MMXC 3UAAA 2DWEB 4NAJA 2ZKXA 4F2FA 3KW8A 1NCGA 4HIEA 3RKDD 1FL5B 1RKRA 3RJOA 4Z8FH 3APFA 5LBVA 5IJKC 2ZXBA 3UTTB 3TWCL 1X4XA 3BT2L 4DETA 1ZTXL 4X5RA 1RAMA 1SJMA 3WNJA 2X4NA 4YFDB 2FTAA 1ZT7B 1FUNA 5TTRA 3DGGA 5DYOA 4RFNC 3SDCD 5LGHL 2DLIA 4R7DB 5ALCH 5F7AA 4KGJA 3TZVA 2GUOB 2FLMA 3ARDD 3RWJB 3P9WB 2KZKA 3EBGA 1CTNA 3EH4B 1F6FB 1DJZA 3ARQA 3WJMA 2A9BA 1H19A 3AXIA 3N42F 4FQXC 2OMXA 3KLQA 2X44D 3QNZB 4F7PA 2C7UA 3ATFA 4RNRA 1S4IA 3IPFA 5J89A 4LCCA 4R4BB 4FXLA 3NAAH 4Q6YA 1RZ7H 4NX0A 5JPNB 1HE7A 3F7YA 4YHKL 1ZA6A 1Q9LA 4LRNH 5I6XC 1MHCB 1NIAA 4L1HA 5BZXA 2YRLA 3VSTA 1ADQL 4G6FD 4R7NA 2CK2A 2ARJQ 3BFOA 2BSTA 4ETQB 1BEYL 2BVOA 4XMVA 3H55A 3VSVA 2ATKA 2XX1A 1X4YA 1NFDF 2NR6A 4P07A 5IB4A 1TTBA 2NRDA 1H3XA 1PMYA 3FFDA 4KUCF 4WI6A 5F96H 2B7DT 3HG1B 4PGDB 3TA4D 1FZJA 1U8PB 4XMWA 5CD5D 4WTWA 1S9KC 2MNUA 5ESAA 4X98B 3FB7B 3LKPA 2XXCB 2BP0A 3DJSA 4AQ1C 2A9DA 2JJSA 3CBRA 5FM5O 3JV0A 2Y7QB 3CC1A 3LKOA 4MCNA 3NPSC 3WDJA 3O0RH 3ZHNA 5DJ8B 3GXFA 1JPEA 2OR8A 1AANA 3TJEL 1EZLA 4UOQA 2P46B 1JZ6A 1UQSA 1CIUA 2D7TH 3LKSA 4X4XA 3C8KA 4OD2B 4Z7VB 4DN3H 1J5OH 4UTBA 5C07B 3TBVA 3IKKA 4HJGA 3GZKA 1T6VN 3KLLA 1SDDB 2V17L 3BEWB 5IG7B 2BY1A 4NQDD 2OR7A 3NTCL 1XBDA 1IARB 1WV7T 3BQUD 3ZO0A 1RPUA 4Y5XB 4PJDE 2HMID 2QADB 1HFUA 1TPXC 4OCYH 1Z9SA 1FG9C 2XPZA 4KH9A 4PJEA 5A6LA 4NQSA 4KO5A 5GRVK 2AXFA 1XF5B 3MLWH 2YRBA 5ITBH 5A2KH 2QDWA 5E6IC 1ZA3B 1CT8A