3QP1A

Crystal structure of cvir ligand-binding domain bound to the native ligand c6-hsl
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
178
structure length
178
Chain Sequence
MRPLPAGLTASQQWTLLEWIHMAGHIETENELKAFLDQVLSQAPSERLLLALGRLNNQNQIQRLERVLNVSYPSDWLDQYMKENYAQHDPILRIHLGQGPVMWEERFNRAKGAEEKRFIAEATQNGMGSGITFSAASERNNIGSILSIAGREPGRNAALVAMLNCLTPHLHQAAIRVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A strategy for antagonizing quorum sensing.
pubmed doi rcsb
molecule keywords CviR transcriptional regulator
source organism Chromobacterium violaceum
molecule tags Transcription
total genus 62
structure length 178
sequence length 178
ec nomenclature
pdb deposition date 2011-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03472 Autoind_bind Autoinducer binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.80 Alpha Beta 2-Layer Sandwich Beta-Lactamase Transcription factor LuxR-like, autoinducer-binding domain 3qp1A00
1H0MA 3QP6A 3QP2A 3IX3A 3QP1A 4NG2A 5L10A 3QP4A 5L09A 3IX8A 4Y15A 3IX4A 3QP5A 2AVXA 3QP8A 4Y13A 2UV0E 1L3LA 4Y17A 3JPUA 4LGWA 4LFUA 3SZTA 5L07A 2Q0OA
chains in the Genus database with same CATH superfamily
4OONA 4KENB 5FQQA 5EOOA 1FCNA 3E4PA 1K6RA 3VOYA 1F98A 1MWUA 3MBZA 4PMAA 2GNXA 2VGLM 1ERQA 1TD5A 2X02A 1TS0A 3NULA 2OLVA 2HJEA 3F1OB 3CITA 4UA6A 1JTDA 3ITBA 3M2JA 3PR6A 1KGFA 4DE3A 3TJZC 3F1NB 2WAEA 2GX5A 2W3EA 4NXGA 2HGVA 4DXCA 4QY6A 3RXWA 1N9LA 5M19A 3QP2A 3O5YA 1RGZA 2ZD8A 4IUHA 3IF6B 2WAFA 1TF1A 2ZC6B 1K6SA 2VZWA 4KZ4A 1D7EA 1Q2PA 1L3LA 5HZHA 2P04A 2J3TC 3JVUA 1I2WA 3E98A 4KQRA 3DTEA 4EEPA 2H28A 5AQBA 1ODVA 4UQIM 4QY5A 5TBMB 4WM9A 4JGRA 3VP4A 5F68A 3K3DA 2WGVA 1W63Q 2Y2KA 3LI8A 4Y17A 2ZBBA 3VSKA 5HSQA 2O9CA 1GCEA 4WBGA 3HREA 1S1ZA 4YWZA 1PW1A 4UEYA 5DTTA 2A3UA 3IF5A 3IHBA 3IQAA 3MKEA 1CK3A 4NXEA 3SW1A 1VM1A 3IX8A 5D3OA 2X71A 3H82B 4B4ZA 1PWGA 1ZKJA 3C38A 1FIKA 1PIOA 5L2FA 1EROA 4FH2A 5HDDA 2EX6A 4KZ3A 1ES2A 2ZMFA 2ZM2A 5KIZA 2W0NA 2PD7A 2K7SA 1SDEA 1S1YA 5HAIA 1K4EA 5FA7A 3NC8A 2KOIA 4PM5A 2Y91A 4L9EA 5M1AA 3FV7A 3VP2A 4HBUA 5A8BA 2H0YA 4EUZA 4BBVA 3L7HA 1F9IA 1XJ4A 3G32A 2P08A 3LR0A 3HUOA 1XX2A 2FFYA 3LIAA 3UPOA 3O86A 4HEFA 4CJNA 3NY4A 2WGIA 3GTCA 4UQIS 1TS6A 4BBTA 1BLCA 3N7WA 1ESIA 4N92A 2JC7A 4FSFA 1K38A 3WS5A 1OTEA 3GR2A 1P9WA 1PZPA 4Y0TA 4MBFA 3M6HA 4N1XA 3UMDA 3NDEA 3OPPA 2W3GA 1Z09A 2V1ZA 2INWA 4DKIA 4OPYA 5GHXA 3G2YA 3S7PA 1VETA 1D06A 1FR1A 3Q82A 4UA9A 2HDRA 4IBXA 5DFXA 5FQ9A 3Q07A 1YMXA 2HZ5A 3QP5A 4HP9A 1W5DA 3MMHA 2VA0A 5DF8A 5CERA 3KSIA 4EUVA 4JXVA 1CJFA 4WLAA 3T4JA 1T1BA 3FG8A 5HARA 1ZG4A 1TDGA 1FSYA 1SZVA 2J8YA 3CUEA 4HNBA 4OOMA 5CTMA 3RH8B 4JGOA 5EPHA 4I3AA 5GHZA 4O8GA 2QPNA 1HLUP 3OPRA 1XFQA 4H6JB 2Y2GA 2PR6A 5J8XA 1H8ZA 2W3DA 5HPIA 1DRMA 1S4SA 4JBFA 1H8MA 3LIEA 1FCMA 1QMEA 3D4FA 4EW7A 1L2SA 2ZL1A 2W27A 5CEDA 3T1RA 4GHIA 5KZHA 1OTDA 2K2NA 2QWSA 4CLCB 4KZ6A 2ZC4B 4UHUA 3F1NA 4Y0UA 2Q9NA 3E0YA 1NZOA 3IWIA 4HHDA 1KVMA 1YLYA 1EWZA 1H0MA 1NYYA 2I72A 3IF6A 4Q0HA 2HV1A 3LY4A 2WKEA 4ARZB 4RQ9A 3QNBA 1OTIA 2EA9A 1YAXA 4U3TA 4BQMA 4X56A 1YLZA 3FWLA 1HZOA 5TR7A 2Y2PA 3UB5P 1G28A 5TBMA 2NUTC 1G5UA 3C7UA 3LIBA 3T4TA 4EBPA 3BLMA 2P7JA 4OQ0A 5DTKA 1BTLA 2BASA 1UGUA 4RA7A 5CXWA 3RJUA 4WL9A 3S7OA 3LR3A 2PRFA 5FAQA 1XA1A 1WE4A 2ACGA 3G4PA 4X55A 3A3IA 5GLDA 1W79A 3ZG0A 4BD1A 3MR0A 3BYDA 4S2JA 2EXBA 4DDYA 4KQQA 3SS3A 1YMSA 3S7NA 2HDUA 3ZQ5A 3ZNTA 5U47A 2W1RA 2JKRM 2ZC3B 4Q0JA 4IJGA 1GA9A 1HVBA 1RGYA 1L0GA 4R4RA 1PNEA 1O07A 4P6ZS 4MEZA 3A3FA 3PHYA 5HWTA 5CGXA 3MJQA 5KSHA 3AGEA 2KDKA 5EVIB 4E3IA 4HP4A 4R4SA 3P7NA 4XUXA 4PHTA 2C6WB 5F83A 4ESPA 3GRJA 1JVJA 2ZM0A 3OPLA 2ZJ9A 1LT0A 2PYRA 4EWFA 1SHVA 2OAP1 5FSRA 4R6LA 3MF0A 4GS9B 1LL8A 1H8YA 3SH7A 5HD5A 4FCFA 4R23A 2W1TA 5JYPA 1YT4A 3HVFA 3N8RA 5F1FA 2MJ6A 3UB6A 4YOFA 2LB9A 3PBOA 3SS4A 4KUKA 5MC7A 1M40A 4X69A 4C3QA 3BFFA 2B18A 2WKIA 2VV6A 2P74A 4WF0A 3GVBA 3LR5A 4UA7A 1GA0A 1S0WA 2XLNA 2EX2A 3BJNA 1MKMA 3FPWA 4E3JA 1IYQA 3G35A 3FC7A 5HWWA 1OPXA 1SDNA 3CLOA 4HJ6A 2G2WA 1XGJA 3DTIA 3NHQA 3LIFA 2V1BA 1P0ZA 3BECA 3TRCA 5J3WA 5EM1A 3T1SA 1STZA 4F3LB 2V2FF 3KSFA 2EXAA 2O9AA 4MNRA 3HUNA 3ZDJA 3LI9A 3MS6A 5HW3A 4IVIA 2XEPA 5FDHA 4KQOA 1LL9A 3U2AA 1YSPA 3SOIA 3C4PA 3MZDA 4ZDXA 2B5RA 5L8MA 3OZHA 1OTAA 1MWRA 3T4KA 3VOZA 4KZ7A 4DF6A 5EM0A 1GSXA 2JBFA 3V3SA 1O7EA 2B02A 5I5LA 3IX4A 3ZCZA 4KG2A 2XQZA 4P87A 1KE4A 1PRQA 1PI4A 5DJTA 1ZTUA 3HCYA 4KZ8A 1GSWA 5BOHA 2JN7A 2X01A 1SKOB 1I2SA 3EEAA 4GCZA 4DN0A 4WZ5C 2LB5A 3OC2A 2FFFB 3JVVA 5FEGA 5F82A 2PBDP 5HDCA 1IOUA 4X6TA 2VEAA 3CI6A 2VX8A 4ARZA 4QPRA 4NG2A 4EV4A 1KGGA 2JHEA 1BT5A 4G3WA 5EVID 4CPKA 1HTZA 1NZUA 5DTSA 2HDSA 1S6RA 1X0OA 3WS2A 4Z1WA 1PZOA 5CGWA 2ZQAA 1ESUA 2WK0A 4MN5A 1JTGA 3IXBA 1KE3A 3PBSA 4QU3A 5I94A 5AQ9A 4PM7A 2YKFA 3A3DA 4S2OA 1IKGA 3KO6A 4S2KA 5GLAA 3UE1A 3NI9A 5DKKA 4OH0A 4UAAA 3HLFA 3ZNYA 3QP6A 5EFWA 3O87A 2V0WA 3NCKA 2XA7S 2PAVP 4S2NA 3E2LA 2XDMA 3UE3A 5EECA 2GDNA 4N1HA 3T50A 2EFUA 5HAPA 5HAQA 3CUEC 1YSQA 4LRXC 4XT2B 4PKYG 3T4OA 3DW0A 3IH9A 3M6BA 1TVFA 4HI4A 1G68A 4JF5A 5HL6A 3NOPC 4X53A 1CI9A 4R3BA 4CLCE 2V8FA 1S4RA 3CMZA 5EVIA 1PFLA 4KZAA 3UPNA 2E8IA 4OQIA 4JF4A 1BLSA 3ULFA 1W7FA 3F1PB 2OWHA 3TE8A 5IU1A 3PAGA 4I38A 2PR5A 5FAPA 1NY0A 1T1CA 2VGLS 2VK3A 1YKDA 4G3VA 3VV4A 4O7DA 5E43A 3ZHHA 4JF6A 3IF6C 4DJ2A 1YLJA 2DRWA 5CHMA 2Y2LA 2YKHA 3H7WA 2IWBA 2C5WB 4E6WA 2HF6A 3OCLA 1MXOA 4IBRA 3G6OA 5L09A 1MWSA 4PM6A 2HP9A 3T4SA 2UV0E 2VKSA 4WZ5A 2XK1A 3NOUC 5F69A 1TEMA 4WN5A 1ALQA 3V3RA 2Y2MA 4HH3A 5FASA 2EWWA 1IYPA 2HDQA 3BFCA 1W63M 4P85A 3S7QA 1K54A 1TS8A 2CC1A 1DP8A 3PYPA 4X1LA 4ZBEA 3HJIA 4GKUA 2QMIA 1XFNA 4IUKA 4I3JA 4GD6A 4R0QA 3DWKA 4MMNA 3PBTA 5K5BA 3AGFA 1T1AA 5A90A 2JKTI 4BL3A 1VB6A 1YLTA 3T1QB 3VE4A 2J9PA 3BFDA 4OQGA 2E8JA 1L0EA 3IXDA 2XR0A 5DF7A 4LRYC 2J7VA 1Y4OA 4L0LA 5F6AA 3WS1A 2WKPA 5J7EA 3HL9A 2KX6A 1K25A 4LV1A 4MLLA 3HLEA 3S4XA 2PT7A 4OLGA 4JXWA 5EV0A 5HWVA 4WMCD 4GDBA 3E4QA 4IVKA 5E2HA 3T1XA 2RL3A 2M1CA 3NECA 4LCLA 1Y28A 1OT6A 3HLBA 3DAVA 1SKOA 4DXBA 1M6KA 3W4PA 3KSGA 1BSGA 5FATA 1JWPA 2G7UA 2D02A 5C5KA 4HY8A 1PWCA 4PM9A 1ZC2A 4Y3IA 2ZQ8A 4BBUA 3PXPA 4EERA 4B4XA 3NIAA 4ZTKA 1SCWA 1HD8A 5CTNA 3FKWA 1V9ZA 3T12B 1NYMA 3FPVA 4C6YA 3R7WB 3IBJA 1G6AA 3MXSA 3O3VA 1NJ4A 2JKTM 3G34A 4E3KA 2O99A 3F1OA 3N6IA 3MQOA 1PW8A 2JCHA 1WYBA 3KYEA 1L0FA 3UDXA 4EQ1A 5HFOA 3W4QA 1ES3A 2QZ6A 2JKRI 2ZOIA 4LCMA 2PDRA 3UY6A 3VSLA 1WYCA 4OPQA 3MFDA 4R1GA 4Y15A 1N9NA 4E3MA 1PYYA 2QJ7A 3TG9A 2WADA 5M18A 2PU4A 4N9KA 4WMCA 4U0XA 5CHJA 3UPPA 2M7VA 4BJPA 4H8RA 1MY8A 4DE2A 1YPRA 3B3XA 2OWJA 3KYZA 3O88A 3RTYA 4HJ3A 2HJ9C 4I5SA 3BM6A 3HLDA 1N9OA 2VJWA 3N8SA 1NLYA 3UN7A 1A0KA 1YLPA 2W3FA 4KZBA 2WZXA 4E04A 1F2KA 4PPRA 3NOTC 2HP5A 3H82A 5HD3A 3K2NA 1KVLA 1CI8A 1GHIA 2L4RA 5DKLA 3VFHA 5TFQA 1CEFA 2KLIA 4NXBA 3ZFZA 3NJAA 1GHMA 2Y8HA 4NXFA 3G30A 4CLCC 2Q0OA 3F1PA 4WZ4A 4I3IA 1K4FA 2M7UA 2BTFP 3CPTB 4JXSA 5KSCA 2ZMVA 4WEKA 2WKHA 3V50A 3BFGA 4F94A 3UNWA 4EBLA 4X68A 5GL9A 4K0XA 4D60A 5A92A 5G4ZA 1IEMA 2R9XA 4NK3A 1XXMA 4JXGA 1KDWA 1IKIA 4BMWA 1FOFA 3CWFA 5E2EA 3NBLA 4BWIA 3QHYA 4AFIA 4QWOA 2ZLYA 5E2FA 3N4IA 1XPBA 5EVEA 2WUQA 5FI2A 1OMEA 2OV5A 4RVAA 3EEHA 1K57A 4BLMA 5L07A 3FYZA 3Q81A 5HPFA 5EE8A 2IWCA 4O0PA 2Z2LB 4PAUA 1MC0A 3V5MA 3EWKA 1MKIA 1BZAA 2V8CA 4JKTA 4WYYA 1JNUA 2J9OA 1QMFA 1XP4A 5EVLA 1Y54A 4HQAA 4MBKA 1BULA 1BUEA 3KX0X 3PBNA 1PWDA 1LI9A 3UB8A 4S2NC 4CLCD 3CJMA 3OBFA 3GQZA 4X25A 1LI0A 2Q9MA 3BW6A 4NKPA 5DJUA 3OPHA 3A3JA 5CRFA 3A0RA 4NETA 3G2ZA 5G18A 4Y5FA 1YQSA 3HLWA 3V39A 4RX2A 2ZOHA 1IYSA 2WGWB 5EVIC 2XD1A 4EBNA 2A24B 2BG1A 3IXHA 5IT5A 3VMAA 3ZG8B 4MN7A 3DBAA 1CQAA 4N9LA 2HP6A 3IS2B 1VQQA 2Y2NA 2PYPA 1GSVA 1JWVA 3WRTA 1C3BA 2V9AA 4FUWA 4K08A 4NEED 2ZM8A 3C4OA 3JYIA 2Z6DA 4H6JA 3A0SA 1Q2QA 4B88A 1L0DA 3FKVA 4QHCA 5HDSA 1FR6A 4QB8A 4OPZA 2XD5A 1VETB 5KMWA 3K3CA 2Y59A 5F1GA 5L10A 4KUOA 5FL3A 1T19A 3RFBA 2V1AA 3GMWA 4PKYA 4CLCA 4QJGA 3T4QA 5CEBA 2Z6CA 1K54C 3DWZA 3B42A 4Y2FA 2J3WA 4K91A 2IWDA 5DVAA 4ID4A 4HESA 2XFTA 1RCJA 5CGSA 5DF9A 4HIAA 3CHWP 4P0MA 3WRZA 2QHKA 3VP3A 1BYWA 3V67A 3ISGA 2HPBA 4XXRA 1VEUB 1ZHHB 3VFFA 1MBLA 3UE6A 4LGWA 2CMNA 5FEFA 2ZQCA 3IBRA 2Y4AA 4LPZA 5IHVA 2XH9A 1W8QA 4M4XA 4ME4A 3WWXA 5CECA 2ZL1B 3Q7ZA 2PU2A 3Q1FA 4GHIB 4LV3A 4KQDA 2WZZA 1LSWA 4S2LA 4U0TA 3JPUA 3SS5A 1ES5A 3MXQA 5F5YA 4MCWA 2Z2MB 3BEBA 3GSGA 4OPRA 3E4OA 2G2UA 4G3KA 3HUMA 4GOGA 3R4KA 1I5QA 2AVXA 4Q8IA 2O9BA 3TOIA 3QNCA 3PTEA 1DP9A 3MQ0A 3EGDC 5AVFA 3D72A 4GN2A 3W4OA 3ZVTA 2A2LA 3CPTA 5TJJA 4EESA 5EUAA 1K56D 3EQUA 4Y7PA 4JGQA 4Y13A 3BWLA 3VE3A 3P01A 1K0KA 1KDSA 4MBHA 3L9KA 2VV8A 3BQAA 1U60A 4OVDA 3IHAA 4OOLA 4S2PA 3ZG7B 3UO9A 4GS9A 2WKQA 4GNUA 1BLHA 5J4EA 3WS4A 2R9WA 4HH2A 3SZTA 3KYQA 1H3QA 2DMWA 3MZEA 5DFYA 4IHQA 2XSSA 4O01A 2Y79A 3LGOA 1K55C 1IYOA 4Z9QA 5FDSA 2PBYA 1EI5A 1FILA 1P97A 4GDNA 3W2ZA 1DJCA 3LEQA 4DE1A 2VGKA 4RYEA 2IA2A 1MZUA 4Q0IA 2J3TD 1YLWA 2ZQDA 3RXXA 2QYBA 2ZMAA 1UWPX 4OP8A 1MWTA 1MPLA 5AQ7A 3S1YA 1KOUA 1J9MA 2O0YA 3MFXA 3BFEA 3BLSA 3BY9A 4LLOB 3MXRA 3AGDA 1EW0A 5FQJA 2V0UA 3CG5A 4F3LA 2RCXA 1K56A 3DTKA 3LO7A 4S2MA 2Y2IA 2JKFA 2W1TB 2VLGA 2WGWA 1DY6A 5EOEA 2Y2JA 2QJ5A 4FH4A 2A24A 4L9GA 5FQMA 1LLBA 3LICA 2DCFA 4WEJA 2EX9A 4XUZA 1ES4A 1VHMA 3EOIA 1N9BA 3ZG5A 1D1JA 3IS2A 3H9WA 1Z6FA 4IEDA 3VP1A 5AJGA 2Y2HA 3HBRA 1N4OA 3IX3A 3UB7A 1S66L 4DDSA 4B93A 5A91A 3QP8A 1DJBA 1RP5A 3NDGA 3CAXA 2P9VB 3WS0A 3BY8A 3IXGA 4A5RA 4JGPA 4ETXA 5E2GA 3HLCA 1TDLA 4II7A 1K57C 4GB7A 4JPMA 5CHUA 4GW9A 1FQGA 4BD0A 4DJ3A 2XGNA 2FH5A 4LRZE 2OAQ1 2Y2OA 1OTBA 4WELA 4MN6A 3LUQA 4R38A 5G4YA 1VEUA 4JLFA 5GLCA 3W8KA 4MDZA 2R78A 3Q7VB 3B33A 3FZCA 1ACFA 1F5MA 2JE5A 1E3UD 1LSXA 4D2OA 3UDFA 4OOYA 3MKFA 2Y55A 4P6ZM 2PD8A 2W3HA 2EFXA 4E3NA 4GLQA 3D9YA 3PBQA 3UMEA 3M2KA 1XJ3A 3P98A 4HOIA 3SH9A 3PBRA 2WYXA 4HJ4A 1K55A 1WA9A 5IS1A 1H5XA 4E6XA 4S2IA 1E4DA 5FI6A 3ICYA 3U4LP 4OKPA 4YNRA 5FI7A 3VOLA 3LCEA 4KZ5A 1LSVA 1XGIA 4DRTA 1ZG6A 2WKRA 5GHYA 4EQIA 4LV2A 5HX9A 3LYXA 2XROA 2OLUA 2ZQ7A 4BL2A 1DP6A 4HBTA 4XT2A 2H0TA 4LFUA 1BLPA 2GJ3A 3CZDA 4GD8A 3ZYTA 4EEUA 2ZC5B 3MZFA 1NRFA 1E25A 1W8YA 1V9YA 3OOVA 2L0WA 4BENA 3MQQA 3P09A 1P9RA 2XF3A 4EXOA 1KE0A 4E3LA 2PHYA 5AQAA 1CEGA 2DNSA 1ONHA 4EETB 2J80A 1J3WA 2H10A 1E3UA 3T4LA 3QP1A 1JWZA 2A49A 4I39A 1AXBA 3BQ8A 4C75A 1LHYA 1G6OA 1XA7A 4B9OA 1GHPA 1KGEA 5FQIA 3ITAA 1ONGA 3MSHA 4K0WA 1NXYA 2VV7A 4X1MA 4M3KA 1NLZA 2BLSA 4OLDA 3GECA 3C30A 3KSHA 3B47A 2OOLA 3EQVA 3IH8A 4ZJ1A 5A93A 3C2WA 2V20A 3GV9A 5CX7A 5AVEA 4OP5A 4YFMA 3D3OA 1OJGA 1T18A 3HLGA 2XRNA 3UB9A 4GJ4A 4E3OA 4ZJ2A 5TGFA 5HL1A 3IWOA 4L9FA 2UWXA 4GZBA 4R70A 2H5SA 4ZAMA 2K31A 5JYOA 4R3JA 2XFSA 2ZC7A 3ZVWA 3IT9A 1XJ6A 1AWIA 1OT9A 1LL5A 4DE0A 3SH8A 3I7JA 2FZ0A 1ERMA 4ZRRA 2NUPC 3H7WB 4FTXA 3IWQA 4P6BA 3LR4A 2ZQ9A 3HJKA 3G31A 3OCNA 3LEZA 3C7VA 4CQHA 2L1MA 3LFVA 3EGXC 4RX3A 4WUJA 3A3EA 4LENA 1IELA 4FOFA 1PI5A 5FAOA 5GLBA 3OLOA 4KG5A 2OSUA 1CF0A 2P9VA 4PM8A 4LV0A 1XJ2A 5LBRA 2VGJA 3TW8A 3UDIA 1XKZA 3VP0A 4KG6A 1FCOA 4Y0OA 3PAEA 4QD4A 3GDIA 3C5AA 2GZAA 2QKPA 3ZGAB 4YINA 1NWZA 2EX8A 3S22A 1S67L 2EWVA 1NRJA 3N8LA 3BRMA 1FSWA 4FD8A 3TSGA 3R7WA 1OJ5A 2I9VA 1TS7A 3A0VA 2XA7M 4DMZA 2B95A 4OQHA 4EU0A 3LIDA 3QP4A 3Q7VA 4ETZA 3E2KA 1DJAA 2D01A 5FQKA 4R3AA 3LY3A 1SKFA 3DTMA 4ZJ3A 1UWNX 2Y2QA 3ZG9B 1YM1A 3C8CA 4KZ9A 3UE0A 1IFQA 2JKGA
chains in the Genus database with same CATH topology
1H0MA 3QP6A 3QP2A 3IX3A 3QP1A 4NG2A 5L10A 3QP4A 5L09A 3IX8A 4Y15A 3IX4A 3QP5A 2AVXA 3QP8A 4Y13A 2UV0E 1L3LA 4Y17A 3JPUA 4LGWA 4LFUA 3SZTA 5L07A 2Q0OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H0M A;  3QP6 A;  3QP2 A;  3IX3 A;  3QP1 A;  4NG2 A;  5L10 A;  3QP4 A;  5L09 A;  3IX8 A;  4Y15 A;  3IX4 A;  3QP5 A;  2AVX A;  3QP8 A;  4Y13 A;  2UV0 E;  1L3L A;  4Y17 A;  3JPU A;  4LGW A;  4LFU A;  3SZT A;  5L07 A;  2Q0O A; 
#chains in the Genus database with same CATH topology
 4OON A;  4KEN B;  5FQQ A;  5EOO A;  1FCN A;  3E4P A;  1K6R A;  3VOY A;  1F98 A;  1MWU A;  3MBZ A;  4PMA A;  2GNX A;  2VGL M;  1ERQ A;  1TD5 A;  2X02 A;  1TS0 A;  3NUL A;  2OLV A;  2HJE A;  3F1O B;  3CIT A;  4UA6 A;  1JTD A;  3ITB A;  3M2J A;  3PR6 A;  1KGF A;  4DE3 A;  3TJZ C;  3F1N B;  2WAE A;  2GX5 A;  2W3E A;  4NXG A;  2HGV A;  4DXC A;  4QY6 A;  3RXW A;  1N9L A;  5M19 A;  3QP2 A;  3O5Y A;  1RGZ A;  2ZD8 A;  4IUH A;  3IF6 B;  2WAF A;  1TF1 A;  2ZC6 B;  1K6S A;  2VZW A;  4KZ4 A;  1D7E A;  1Q2P A;  1L3L A;  5HZH A;  2P04 A;  2J3T C;  3JVU A;  1I2W A;  3E98 A;  4KQR A;  3DTE A;  4EEP A;  2H28 A;  5AQB A;  1ODV A;  4UQI M;  4QY5 A;  5TBM B;  4WM9 A;  4JGR A;  3VP4 A;  5F68 A;  3K3D A;  2WGV A;  1W63 Q;  2Y2K A;  3LI8 A;  4Y17 A;  2ZBB A;  3VSK A;  5HSQ A;  2O9C A;  1GCE A;  4WBG A;  3HRE A;  1S1Z A;  4YWZ A;  1PW1 A;  4UEY A;  5DTT A;  2A3U A;  3IF5 A;  3IHB A;  3IQA A;  3MKE A;  1CK3 A;  4NXE A;  3SW1 A;  1VM1 A;  3IX8 A;  5D3O A;  2X71 A;  3H82 B;  4B4Z A;  1PWG A;  1ZKJ A;  3C38 A;  1FIK A;  1PIO A;  5L2F A;  1ERO A;  4FH2 A;  5HDD A;  2EX6 A;  4KZ3 A;  1ES2 A;  2ZMF A;  2ZM2 A;  5KIZ A;  2W0N A;  2PD7 A;  2K7S A;  1SDE A;  1S1Y A;  5HAI A;  1K4E A;  5FA7 A;  3NC8 A;  2KOI A;  4PM5 A;  2Y91 A;  4L9E A;  5M1A A;  3FV7 A;  3VP2 A;  4HBU A;  5A8B A;  2H0Y A;  4EUZ A;  4BBV A;  3L7H A;  1F9I A;  1XJ4 A;  3G32 A;  2P08 A;  3LR0 A;  3HUO A;  1XX2 A;  2FFY A;  3LIA A;  3UPO A;  3O86 A;  4HEF A;  4CJN A;  3NY4 A;  2WGI A;  3GTC A;  4UQI S;  1TS6 A;  4BBT A;  1BLC A;  3N7W A;  1ESI A;  4N92 A;  2JC7 A;  4FSF A;  1K38 A;  3WS5 A;  1OTE A;  3GR2 A;  1P9W A;  1PZP A;  4Y0T A;  4MBF A;  3M6H A;  4N1X A;  3UMD A;  3NDE A;  3OPP A;  2W3G A;  1Z09 A;  2V1Z A;  2INW A;  4DKI A;  4OPY A;  5GHX A;  3G2Y A;  3S7P A;  1VET A;  1D06 A;  1FR1 A;  3Q82 A;  4UA9 A;  2HDR A;  4IBX A;  5DFX A;  5FQ9 A;  3Q07 A;  1YMX A;  2HZ5 A;  3QP5 A;  4HP9 A;  1W5D A;  3MMH A;  2VA0 A;  5DF8 A;  5CER A;  3KSI A;  4EUV A;  4JXV A;  1CJF A;  4WLA A;  3T4J A;  1T1B A;  3FG8 A;  5HAR A;  1ZG4 A;  1TDG A;  1FSY A;  1SZV A;  2J8Y A;  3CUE A;  4HNB A;  4OOM A;  5CTM A;  3RH8 B;  4JGO A;  5EPH A;  4I3A A;  5GHZ A;  4O8G A;  2QPN A;  1HLU P;  3OPR A;  1XFQ A;  4H6J B;  2Y2G A;  2PR6 A;  5J8X A;  1H8Z A;  2W3D A;  5HPI A;  1DRM A;  1S4S A;  4JBF A;  1H8M A;  3LIE A;  1FCM A;  1QME A;  3D4F A;  4EW7 A;  1L2S A;  2ZL1 A;  2W27 A;  5CED A;  3T1R A;  4GHI A;  5KZH A;  1OTD A;  2K2N A;  2QWS A;  4CLC B;  4KZ6 A;  2ZC4 B;  4UHU A;  3F1N A;  4Y0U A;  2Q9N A;  3E0Y A;  1NZO A;  3IWI A;  4HHD A;  1KVM A;  1YLY A;  1EWZ A;  1H0M A;  1NYY A;  2I72 A;  3IF6 A;  4Q0H A;  2HV1 A;  3LY4 A;  2WKE A;  4ARZ B;  4RQ9 A;  3QNB A;  1OTI A;  2EA9 A;  1YAX A;  4U3T A;  4BQM A;  4X56 A;  1YLZ A;  3FWL A;  1HZO A;  5TR7 A;  2Y2P A;  3UB5 P;  1G28 A;  5TBM A;  2NUT C;  1G5U A;  3C7U A;  3LIB A;  3T4T A;  4EBP A;  3BLM A;  2P7J A;  4OQ0 A;  5DTK A;  1BTL A;  2BAS A;  1UGU A;  4RA7 A;  5CXW A;  3RJU A;  4WL9 A;  3S7O A;  3LR3 A;  2PRF A;  5FAQ A;  1XA1 A;  1WE4 A;  2ACG A;  3G4P A;  4X55 A;  3A3I A;  5GLD A;  1W79 A;  3ZG0 A;  4BD1 A;  3MR0 A;  3BYD A;  4S2J A;  2EXB A;  4DDY A;  4KQQ A;  3SS3 A;  1YMS A;  3S7N A;  2HDU A;  3ZQ5 A;  3ZNT A;  5U47 A;  2W1R A;  2JKR M;  2ZC3 B;  4Q0J A;  4IJG A;  1GA9 A;  1HVB A;  1RGY A;  1L0G A;  4R4R A;  1PNE A;  1O07 A;  4P6Z S;  4MEZ A;  3A3F A;  3PHY A;  5HWT A;  5CGX A;  3MJQ A;  5KSH A;  3AGE A;  2KDK A;  5EVI B;  4E3I A;  4HP4 A;  4R4S A;  3P7N A;  4XUX A;  4PHT A;  2C6W B;  5F83 A;  4ESP A;  3GRJ A;  1JVJ A;  2ZM0 A;  3OPL A;  2ZJ9 A;  1LT0 A;  2PYR A;  4EWF A;  1SHV A;  2OAP 1;  5FSR A;  4R6L A;  3MF0 A;  4GS9 B;  1LL8 A;  1H8Y A;  3SH7 A;  5HD5 A;  4FCF A;  4R23 A;  2W1T A;  5JYP A;  1YT4 A;  3HVF A;  3N8R A;  5F1F A;  2MJ6 A;  3UB6 A;  4YOF A;  2LB9 A;  3PBO A;  3SS4 A;  4KUK A;  5MC7 A;  1M40 A;  4X69 A;  4C3Q A;  3BFF A;  2B18 A;  2WKI A;  2VV6 A;  2P74 A;  4WF0 A;  3GVB A;  3LR5 A;  4UA7 A;  1GA0 A;  1S0W A;  2XLN A;  2EX2 A;  3BJN A;  1MKM A;  3FPW A;  4E3J A;  1IYQ A;  3G35 A;  3FC7 A;  5HWW A;  1OPX A;  1SDN A;  3CLO A;  4HJ6 A;  2G2W A;  1XGJ A;  3DTI A;  3NHQ A;  3LIF A;  2V1B A;  1P0Z A;  3BEC A;  3TRC A;  5J3W A;  5EM1 A;  3T1S A;  1STZ A;  4F3L B;  2V2F F;  3KSF A;  2EXA A;  2O9A A;  4MNR A;  3HUN A;  3ZDJ A;  3LI9 A;  3MS6 A;  5HW3 A;  4IVI A;  2XEP A;  5FDH A;  4KQO A;  1LL9 A;  3U2A A;  1YSP A;  3SOI A;  3C4P A;  3MZD A;  4ZDX A;  2B5R A;  5L8M A;  3OZH A;  1OTA A;  1MWR A;  3T4K A;  3VOZ A;  4KZ7 A;  4DF6 A;  5EM0 A;  1GSX A;  2JBF A;  3V3S A;  1O7E A;  2B02 A;  5I5L A;  3IX4 A;  3ZCZ A;  4KG2 A;  2XQZ A;  4P87 A;  1KE4 A;  1PRQ A;  1PI4 A;  5DJT A;  1ZTU A;  3HCY A;  4KZ8 A;  1GSW A;  5BOH A;  2JN7 A;  2X01 A;  1SKO B;  1I2S A;  3EEA A;  4GCZ A;  4DN0 A;  4WZ5 C;  2LB5 A;  3OC2 A;  2FFF B;  3JVV A;  5FEG A;  5F82 A;  2PBD P;  5HDC A;  1IOU A;  4X6T A;  2VEA A;  3CI6 A;  2VX8 A;  4ARZ A;  4QPR A;  4NG2 A;  4EV4 A;  1KGG A;  2JHE A;  1BT5 A;  4G3W A;  5EVI D;  4CPK A;  1HTZ A;  1NZU A;  5DTS A;  2HDS A;  1S6R A;  1X0O A;  3WS2 A;  4Z1W A;  1PZO A;  5CGW A;  2ZQA A;  1ESU A;  2WK0 A;  4MN5 A;  1JTG A;  3IXB A;  1KE3 A;  3PBS A;  4QU3 A;  5I94 A;  5AQ9 A;  4PM7 A;  2YKF A;  3A3D A;  4S2O A;  1IKG A;  3KO6 A;  4S2K A;  5GLA A;  3UE1 A;  3NI9 A;  5DKK A;  4OH0 A;  4UAA A;  3HLF A;  3ZNY A;  3QP6 A;  5EFW A;  3O87 A;  2V0W A;  3NCK A;  2XA7 S;  2PAV P;  4S2N A;  3E2L A;  2XDM A;  3UE3 A;  5EEC A;  2GDN A;  4N1H A;  3T50 A;  2EFU A;  5HAP A;  5HAQ A;  3CUE C;  1YSQ A;  4LRX C;  4XT2 B;  4PKY G;  3T4O A;  3DW0 A;  3IH9 A;  3M6B A;  1TVF A;  4HI4 A;  1G68 A;  4JF5 A;  5HL6 A;  3NOP C;  4X53 A;  1CI9 A;  4R3B A;  4CLC E;  2V8F A;  1S4R A;  3CMZ A;  5EVI A;  1PFL A;  4KZA A;  3UPN A;  2E8I A;  4OQI A;  4JF4 A;  1BLS A;  3ULF A;  1W7F A;  3F1P B;  2OWH A;  3TE8 A;  5IU1 A;  3PAG A;  4I38 A;  2PR5 A;  5FAP A;  1NY0 A;  1T1C A;  2VGL S;  2VK3 A;  1YKD A;  4G3V A;  3VV4 A;  4O7D A;  5E43 A;  3ZHH A;  4JF6 A;  3IF6 C;  4DJ2 A;  1YLJ A;  2DRW A;  5CHM A;  2Y2L A;  2YKH A;  3H7W A;  2IWB A;  2C5W B;  4E6W A;  2HF6 A;  3OCL A;  1MXO A;  4IBR A;  3G6O A;  5L09 A;  1MWS A;  4PM6 A;  2HP9 A;  3T4S A;  2UV0 E;  2VKS A;  4WZ5 A;  2XK1 A;  3NOU C;  5F69 A;  1TEM A;  4WN5 A;  1ALQ A;  3V3R A;  2Y2M A;  4HH3 A;  5FAS A;  2EWW A;  1IYP A;  2HDQ A;  3BFC A;  1W63 M;  4P85 A;  3S7Q A;  1K54 A;  1TS8 A;  2CC1 A;  1DP8 A;  3PYP A;  4X1L A;  4ZBE A;  3HJI A;  4GKU A;  2QMI A;  1XFN A;  4IUK A;  4I3J A;  4GD6 A;  4R0Q A;  3DWK A;  4MMN A;  3PBT A;  5K5B A;  3AGF A;  1T1A A;  5A90 A;  2JKT I;  4BL3 A;  1VB6 A;  1YLT A;  3T1Q B;  3VE4 A;  2J9P A;  3BFD A;  4OQG A;  2E8J A;  1L0E A;  3IXD A;  2XR0 A;  5DF7 A;  4LRY C;  2J7V A;  1Y4O A;  4L0L A;  5F6A A;  3WS1 A;  2WKP A;  5J7E A;  3HL9 A;  2KX6 A;  1K25 A;  4LV1 A;  4MLL A;  3HLE A;  3S4X A;  2PT7 A;  4OLG A;  4JXW A;  5EV0 A;  5HWV A;  4WMC D;  4GDB A;  3E4Q A;  4IVK A;  5E2H A;  3T1X A;  2RL3 A;  2M1C A;  3NEC A;  4LCL A;  1Y28 A;  1OT6 A;  3HLB A;  3DAV A;  1SKO A;  4DXB A;  1M6K A;  3W4P A;  3KSG A;  1BSG A;  5FAT A;  1JWP A;  2G7U A;  2D02 A;  5C5K A;  4HY8 A;  1PWC A;  4PM9 A;  1ZC2 A;  4Y3I A;  2ZQ8 A;  4BBU A;  3PXP A;  4EER A;  4B4X A;  3NIA A;  4ZTK A;  1SCW A;  1HD8 A;  5CTN A;  3FKW A;  1V9Z A;  3T12 B;  1NYM A;  3FPV A;  4C6Y A;  3R7W B;  3IBJ A;  1G6A A;  3MXS A;  3O3V A;  1NJ4 A;  2JKT M;  3G34 A;  4E3K A;  2O99 A;  3F1O A;  3N6I A;  3MQO A;  1PW8 A;  2JCH A;  1WYB A;  3KYE A;  1L0F A;  3UDX A;  4EQ1 A;  5HFO A;  3W4Q A;  1ES3 A;  2QZ6 A;  2JKR I;  2ZOI A;  4LCM A;  2PDR A;  3UY6 A;  3VSL A;  1WYC A;  4OPQ A;  3MFD A;  4R1G A;  4Y15 A;  1N9N A;  4E3M A;  1PYY A;  2QJ7 A;  3TG9 A;  2WAD A;  5M18 A;  2PU4 A;  4N9K A;  4WMC A;  4U0X A;  5CHJ A;  3UPP A;  2M7V A;  4BJP A;  4H8R A;  1MY8 A;  4DE2 A;  1YPR A;  3B3X A;  2OWJ A;  3KYZ A;  3O88 A;  3RTY A;  4HJ3 A;  2HJ9 C;  4I5S A;  3BM6 A;  3HLD A;  1N9O A;  2VJW A;  3N8S A;  1NLY A;  3UN7 A;  1A0K A;  1YLP A;  2W3F A;  4KZB A;  2WZX A;  4E04 A;  1F2K A;  4PPR A;  3NOT C;  2HP5 A;  3H82 A;  5HD3 A;  3K2N A;  1KVL A;  1CI8 A;  1GHI A;  2L4R A;  5DKL A;  3VFH A;  5TFQ A;  1CEF A;  2KLI A;  4NXB A;  3ZFZ A;  3NJA A;  1GHM A;  2Y8H A;  4NXF A;  3G30 A;  4CLC C;  2Q0O A;  3F1P A;  4WZ4 A;  4I3I A;  1K4F A;  2M7U A;  2BTF P;  3CPT B;  4JXS A;  5KSC A;  2ZMV A;  4WEK A;  2WKH A;  3V50 A;  3BFG A;  4F94 A;  3UNW A;  4EBL A;  4X68 A;  5GL9 A;  4K0X A;  4D60 A;  5A92 A;  5G4Z A;  1IEM A;  2R9X A;  4NK3 A;  1XXM A;  4JXG A;  1KDW A;  1IKI A;  4BMW A;  1FOF A;  3CWF A;  5E2E A;  3NBL A;  4BWI A;  3QHY A;  4AFI A;  4QWO A;  2ZLY A;  5E2F A;  3N4I A;  1XPB A;  5EVE A;  2WUQ A;  5FI2 A;  1OME A;  2OV5 A;  4RVA A;  3EEH A;  1K57 A;  4BLM A;  5L07 A;  3FYZ A;  3Q81 A;  5HPF A;  5EE8 A;  2IWC A;  4O0P A;  2Z2L B;  4PAU A;  1MC0 A;  3V5M A;  3EWK A;  1MKI A;  1BZA A;  2V8C A;  4JKT A;  4WYY A;  1JNU A;  2J9O A;  1QMF A;  1XP4 A;  5EVL A;  1Y54 A;  4HQA A;  4MBK A;  1BUL A;  1BUE A;  3KX0 X;  3PBN A;  1PWD A;  1LI9 A;  3UB8 A;  4S2N C;  4CLC D;  3CJM A;  3OBF A;  3GQZ A;  4X25 A;  1LI0 A;  2Q9M A;  3BW6 A;  4NKP A;  5DJU A;  3OPH A;  3A3J A;  5CRF A;  3A0R A;  4NET A;  3G2Z A;  5G18 A;  4Y5F A;  1YQS A;  3HLW A;  3V39 A;  4RX2 A;  2ZOH A;  1IYS A;  2WGW B;  5EVI C;  2XD1 A;  4EBN A;  2A24 B;  2BG1 A;  3IXH A;  5IT5 A;  3VMA A;  3ZG8 B;  4MN7 A;  3DBA A;  1CQA A;  4N9L A;  2HP6 A;  3IS2 B;  1VQQ A;  2Y2N A;  2PYP A;  1GSV A;  1JWV A;  3WRT A;  1C3B A;  2V9A A;  4FUW A;  4K08 A;  4NEE D;  2ZM8 A;  3C4O A;  3JYI A;  2Z6D A;  4H6J A;  3A0S A;  1Q2Q A;  4B88 A;  1L0D A;  3FKV A;  4QHC A;  5HDS A;  1FR6 A;  4QB8 A;  4OPZ A;  2XD5 A;  1VET B;  5KMW A;  3K3C A;  2Y59 A;  5F1G A;  5L10 A;  4KUO A;  5FL3 A;  1T19 A;  3RFB A;  2V1A A;  3GMW A;  4PKY A;  4CLC A;  4QJG A;  3T4Q A;  5CEB A;  2Z6C A;  1K54 C;  3DWZ A;  3B42 A;  4Y2F A;  2J3W A;  4K91 A;  2IWD A;  5DVA A;  4ID4 A;  4HES A;  2XFT A;  1RCJ A;  5CGS A;  5DF9 A;  4HIA A;  3CHW P;  4P0M A;  3WRZ A;  2QHK A;  3VP3 A;  1BYW A;  3V67 A;  3ISG A;  2HPB A;  4XXR A;  1VEU B;  1ZHH B;  3VFF A;  1MBL A;  3UE6 A;  4LGW A;  2CMN A;  5FEF A;  2ZQC A;  3IBR A;  2Y4A A;  4LPZ A;  5IHV A;  2XH9 A;  1W8Q A;  4M4X A;  4ME4 A;  3WWX A;  5CEC A;  2ZL1 B;  3Q7Z A;  2PU2 A;  3Q1F A;  4GHI B;  4LV3 A;  4KQD A;  2WZZ A;  1LSW A;  4S2L A;  4U0T A;  3JPU A;  3SS5 A;  1ES5 A;  3MXQ A;  5F5Y A;  4MCW A;  2Z2M B;  3BEB A;  3GSG A;  4OPR A;  3E4O A;  2G2U A;  4G3K A;  3HUM A;  4GOG A;  3R4K A;  1I5Q A;  2AVX A;  4Q8I A;  2O9B A;  3TOI A;  3QNC A;  3PTE A;  1DP9 A;  3MQ0 A;  3EGD C;  5AVF A;  3D72 A;  4GN2 A;  3W4O A;  3ZVT A;  2A2L A;  3CPT A;  5TJJ A;  4EES A;  5EUA A;  1K56 D;  3EQU A;  4Y7P A;  4JGQ A;  4Y13 A;  3BWL A;  3VE3 A;  3P01 A;  1K0K A;  1KDS A;  4MBH A;  3L9K A;  2VV8 A;  3BQA A;  1U60 A;  4OVD A;  3IHA A;  4OOL A;  4S2P A;  3ZG7 B;  3UO9 A;  4GS9 A;  2WKQ A;  4GNU A;  1BLH A;  5J4E A;  3WS4 A;  2R9W A;  4HH2 A;  3SZT A;  3KYQ A;  1H3Q A;  2DMW A;  3MZE A;  5DFY A;  4IHQ A;  2XSS A;  4O01 A;  2Y79 A;  3LGO A;  1K55 C;  1IYO A;  4Z9Q A;  5FDS A;  2PBY A;  1EI5 A;  1FIL A;  1P97 A;  4GDN A;  3W2Z A;  1DJC A;  3LEQ A;  4DE1 A;  2VGK A;  4RYE A;  2IA2 A;  1MZU A;  4Q0I A;  2J3T D;  1YLW A;  2ZQD A;  3RXX A;  2QYB A;  2ZMA A;  1UWP X;  4OP8 A;  1MWT A;  1MPL A;  5AQ7 A;  3S1Y A;  1KOU A;  1J9M A;  2O0Y A;  3MFX A;  3BFE A;  3BLS A;  3BY9 A;  4LLO B;  3MXR A;  3AGD A;  1EW0 A;  5FQJ A;  2V0U A;  3CG5 A;  4F3L A;  2RCX A;  1K56 A;  3DTK A;  3LO7 A;  4S2M A;  2Y2I A;  2JKF A;  2W1T B;  2VLG A;  2WGW A;  1DY6 A;  5EOE A;  2Y2J A;  2QJ5 A;  4FH4 A;  2A24 A;  4L9G A;  5FQM A;  1LLB A;  3LIC A;  2DCF A;  4WEJ A;  2EX9 A;  4XUZ A;  1ES4 A;  1VHM A;  3EOI A;  1N9B A;  3ZG5 A;  1D1J A;  3IS2 A;  3H9W A;  1Z6F A;  4IED A;  3VP1 A;  5AJG A;  2Y2H A;  3HBR A;  1N4O A;  3IX3 A;  3UB7 A;  1S66 L;  4DDS A;  4B93 A;  5A91 A;  3QP8 A;  1DJB A;  1RP5 A;  3NDG A;  3CAX A;  2P9V B;  3WS0 A;  3BY8 A;  3IXG A;  4A5R A;  4JGP A;  4ETX A;  5E2G A;  3HLC A;  1TDL A;  4II7 A;  1K57 C;  4GB7 A;  4JPM A;  5CHU A;  4GW9 A;  1FQG A;  4BD0 A;  4DJ3 A;  2XGN A;  2FH5 A;  4LRZ E;  2OAQ 1;  2Y2O A;  1OTB A;  4WEL A;  4MN6 A;  3LUQ A;  4R38 A;  5G4Y A;  1VEU A;  4JLF A;  5GLC A;  3W8K A;  4MDZ A;  2R78 A;  3Q7V B;  3B33 A;  3FZC A;  1ACF A;  1F5M A;  2JE5 A;  1E3U D;  1LSX A;  4D2O A;  3UDF A;  4OOY A;  3MKF A;  2Y55 A;  4P6Z M;  2PD8 A;  2W3H A;  2EFX A;  4E3N A;  4GLQ A;  3D9Y A;  3PBQ A;  3UME A;  3M2K A;  1XJ3 A;  3P98 A;  4HOI A;  3SH9 A;  3PBR A;  2WYX A;  4HJ4 A;  1K55 A;  1WA9 A;  5IS1 A;  1H5X A;  4E6X A;  4S2I A;  1E4D A;  5FI6 A;  3ICY A;  3U4L P;  4OKP A;  4YNR A;  5FI7 A;  3VOL A;  3LCE A;  4KZ5 A;  1LSV A;  1XGI A;  4DRT A;  1ZG6 A;  2WKR A;  5GHY A;  4EQI A;  4LV2 A;  5HX9 A;  3LYX A;  2XRO A;  2OLU A;  2ZQ7 A;  4BL2 A;  1DP6 A;  4HBT A;  4XT2 A;  2H0T A;  4LFU A;  1BLP A;  2GJ3 A;  3CZD A;  4GD8 A;  3ZYT A;  4EEU A;  2ZC5 B;  3MZF A;  1NRF A;  1E25 A;  1W8Y A;  1V9Y A;  3OOV A;  2L0W A;  4BEN A;  3MQQ A;  3P09 A;  1P9R A;  2XF3 A;  4EXO A;  1KE0 A;  4E3L A;  2PHY A;  5AQA A;  1CEG A;  2DNS A;  1ONH A;  4EET B;  2J80 A;  1J3W A;  2H10 A;  1E3U A;  3T4L A;  3QP1 A;  1JWZ A;  2A49 A;  4I39 A;  1AXB A;  3BQ8 A;  4C75 A;  1LHY A;  1G6O A;  1XA7 A;  4B9O A;  1GHP A;  1KGE A;  5FQI A;  3ITA A;  1ONG A;  3MSH A;  4K0W A;  1NXY A;  2VV7 A;  4X1M A;  4M3K A;  1NLZ A;  2BLS A;  4OLD A;  3GEC A;  3C30 A;  3KSH A;  3B47 A;  2OOL A;  3EQV A;  3IH8 A;  4ZJ1 A;  5A93 A;  3C2W A;  2V20 A;  3GV9 A;  5CX7 A;  5AVE A;  4OP5 A;  4YFM A;  3D3O A;  1OJG A;  1T18 A;  3HLG A;  2XRN A;  3UB9 A;  4GJ4 A;  4E3O A;  4ZJ2 A;  5TGF A;  5HL1 A;  3IWO A;  4L9F A;  2UWX A;  4GZB A;  4R70 A;  2H5S A;  4ZAM A;  2K31 A;  5JYO A;  4R3J A;  2XFS A;  2ZC7 A;  3ZVW A;  3IT9 A;  1XJ6 A;  1AWI A;  1OT9 A;  1LL5 A;  4DE0 A;  3SH8 A;  3I7J A;  2FZ0 A;  1ERM A;  4ZRR A;  2NUP C;  3H7W B;  4FTX A;  3IWQ A;  4P6B A;  3LR4 A;  2ZQ9 A;  3HJK A;  3G31 A;  3OCN A;  3LEZ A;  3C7V A;  4CQH A;  2L1M A;  3LFV A;  3EGX C;  4RX3 A;  4WUJ A;  3A3E A;  4LEN A;  1IEL A;  4FOF A;  1PI5 A;  5FAO A;  5GLB A;  3OLO A;  4KG5 A;  2OSU A;  1CF0 A;  2P9V A;  4PM8 A;  4LV0 A;  1XJ2 A;  5LBR A;  2VGJ A;  3TW8 A;  3UDI A;  1XKZ A;  3VP0 A;  4KG6 A;  1FCO A;  4Y0O A;  3PAE A;  4QD4 A;  3GDI A;  3C5A A;  2GZA A;  2QKP A;  3ZGA B;  4YIN A;  1NWZ A;  2EX8 A;  3S22 A;  1S67 L;  2EWV A;  1NRJ A;  3N8L A;  3BRM A;  1FSW A;  4FD8 A;  3TSG A;  3R7W A;  1OJ5 A;  2I9V A;  1TS7 A;  3A0V A;  2XA7 M;  4DMZ A;  2B95 A;  4OQH A;  4EU0 A;  3LID A;  3QP4 A;  3Q7V A;  4ETZ A;  3E2K A;  1DJA A;  2D01 A;  5FQK A;  4R3A A;  3LY3 A;  1SKF A;  3DTM A;  4ZJ3 A;  1UWN X;  2Y2Q A;  3ZG9 B;  1YM1 A;  3C8C A;  4KZ9 A;  3UE0 A;  1IFQ A;  2JKG A; 
#chains in the Genus database with same CATH homology
 1H0M A;  3QP6 A;  3QP2 A;  3IX3 A;  3QP1 A;  4NG2 A;  5L10 A;  3QP4 A;  5L09 A;  3IX8 A;  4Y15 A;  3IX4 A;  3QP5 A;  2AVX A;  3QP8 A;  4Y13 A;  2UV0 E;  1L3L A;  4Y17 A;  3JPU A;  4LGW A;  4LFU A;  3SZT A;  5L07 A;  2Q0O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...