3QP1A

Crystal structure of cvir ligand-binding domain bound to the native ligand c6-hsl
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
178
structure length
178
Chain Sequence
MRPLPAGLTASQQWTLLEWIHMAGHIETENELKAFLDQVLSQAPSERLLLALGRLNNQNQIQRLERVLNVSYPSDWLDQYMKENYAQHDPILRIHLGQGPVMWEERFNRAKGAEEKRFIAEATQNGMGSGITFSAASERNNIGSILSIAGREPGRNAALVAMLNCLTPHLHQAAIRVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CviR transcriptional regulator
publication title A strategy for antagonizing quorum sensing.
pubmed doi rcsb
source organism Chromobacterium violaceum
molecule tags Transcription
total genus 62
structure length 178
sequence length 178
ec nomenclature
pdb deposition date 2011-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03472 Autoind_bind Autoinducer binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.80 Alpha Beta 2-Layer Sandwich Beta-Lactamase Transcription factor LuxR-like, autoinducer-binding domain 3qp1A00
4Y17A 4Y15A 2UV0E 4LFUA 4NG2A 3IX3A 5L10A 3QP8A 3IX8A 2AVXA 3QP4A 3QP6A 3IX4A 5L09A 1L3LA 5L07A 4Y13A 4LGWA 3QP5A 1H0MA 3JPUA 3QP2A 3SZTA 2Q0OA 3QP1A
chains in the Genus database with same CATH superfamily
3MQ0A 2KX6A 2OLVA 5CEBA 4CJNA 4HHDA 1YM1A 4RYEA 4KZ5A 3CHWP 5LBRA 2I72A 1K56A 5TFQA 3V3SA 3OCNA 1FILA 5FA7A 1SKOA 4X1LA 1YT4A 5FQKA 3DTKA 3HJIA 2L1MA 3JYIA 4FOFA 5FASA 1JVJA 5J7EA 1XPBA 1I2SA 4MLLA 4EQIA 3CPTB 2GX5A 4NKPA 1AWIA 4QU3A 5AQBA 1DRMA 4ME4A 5FAOA 2A24A 5TGFA 3C30A 1ALQA 1UWNX 1LSVA 3BLSA 3FYZA 2RCXA 3G34A 3Q7ZA 3FPWA 4NEED 1WE4A 1A0KA 3NI9A 2OOLA 3WS1A 1JWZA 2W27A 4JXVA 5CEDA 4E3MA 3W4OA 3N6IA 2W1RA 2E8JA 1PI4A 3T1QB 3ZG8B 3SW1A 1MWUA 1L2SA 2E8IA 2J3WA 3G35A 1LL8A 1PWDA 1OTDA 5U47A 5FQMA 1MKIA 4EEUA 2XD5A 4KQQA 3A0SA 1BLCA 4ZJ3A 1ZTUA 2C5WB 1MWTA 1PW1A 1T1BA 3IXHA 4FD8A 5DFXA 4WLAA 4Y0TA 2EWVA 3SOIA 3UB6A 4PM7A 4EQ1A 5EV0A 5L10A 2Z6DA 3R7WA 1IYQA 4R0QA 4LRZE 4LCMA 1P97A 2XDMA 2VV8A 1M6KA 4GCZA 1LI0A 3U2AA 5A93A 1S4RA 2WKEA 5DJUA 4X68A 4HOIA 1G6AA 2XH9A 1XXMA 4GKUA 4K91A 1GA0A 2OV5A 1F98A 2I9VA 4EV4A 4KG2A 2JKTM 4YOFA 3NCKA 3G2ZA 5KSHA 4P6ZM 5G18A 4CLCE 3ZDJA 3T4QA 3UE3A 3FV7A 5HD3A 5D3OA 4OONA 4OVDA 5EECA 5KIZA 1MPLA 4QY6A 5DF8A 2PRFA 2A2LA 1D7EA 1J9MA 4OP5A 4HI4A 3A0RA 4K08A 4DE2A 3V50A 5FI2A 3C38A 4PM9A 5FATA 1BULA 1PZPA 3WS4A 4JBFA 3DWZA 3PBRA 1NZOA 1TEMA 1FIKA 3B33A 3KSGA 2XEPA 1WYCA 4BLMA 1ZG6A 2ZL1A 3HLDA 4KG6A 1N9BA 3IXBA 1GCEA 4PAUA 3WRZA 2WGIA 4HQAA 3NOUC 2ZC7A 5IHVA 4CLCA 1Z09A 5AVEA 4B9OA 4K0XA 3GQZA 4F3LA 1TS7A 2HZ5A 5HAQA 4BBVA 4UHUA 1W79A 3BFCA 4Y15A 1BUEA 1GHIA 1I5QA 2INWA 3IS2A 3HUMA 3BLMA 1Y54A 1YLTA 3K3DA 3LUQA 3M2JA 2VV7A 3EEAA 1VQQA 4U0TA 1Q2QA 4UQIS 4ZDXA 4ARZA 1HZOA 3HUOA 4HJ6A 3CJMA 3IF6A 2OAP1 2PBYA 2WADA 3D4FA 3GDIA 5EVLA 4XUZA 4D2OA 2ZC3B 5BOHA 4S2PA 4L9GA 2ZM0A 3CLOA 3Q1FA 5A90A 3CI6A 3S4XA 1ES4A 1CF0A 2Q9NA 4OQHA 4I3AA 2WGWB 2ZMAA 3EEHA 2JKFA 4PKYA 1T1CA 3NJAA 5C5KA 4X53A 4LV2A 5FAPA 4GB7A 3QP8A 3B42A 4GDNA 4N1HA 3NHQA 4H6JB 1K6RA 3GVBA 5CGSA 2P04A 2PYPA 1YLJA 2PT7A 3KYZA 5G4YA 2EXAA 2VEAA 3C5AA 5DKKA 2FZ0A 5GLCA 2XF3A 2PBDP 4B4XA 2J3TD 3MXQA 4EUZA 1TS6A 5CHJA 4WZ4A 3S1YA 3NOTC 4KUKA 4MBFA 3VOZA 4DJ2A 4WZ5C 4IUKA 3HLWA 3SH9A 4F94A 1PFLA 3LY3A 1K54A 3GRJA 2OAQ1 1IKGA 5A92A 2PYRA 1ZC2A 1C3BA 1YLPA 1XGJA 3PXPA 4R4SA 1KE4A 5EVIB 2QPNA 4DKIA 4GHIB 3SH8A 2C6WB 2YKHA 1FOFA 4QJGA 3Q82A 5JYOA 1DJCA 2P9VA 5DJTA 1TDLA 1KGEA 3IXGA 4I3IA 4Y17A 2BG1A 3IXDA 1YMSA 3G2YA 4C6YA 1MWRA 1CI8A 3U4LP 3BFFA 1D1JA 3RJUA 1YLZA 2DRWA 2W3GA 1UWPX 3UB8A 3QP5A 1LHYA 5HPIA 3T4OA 3DWKA 2CMNA 5DVAA 5FI6A 1GA9A 2W1TB 3L9KA 1XJ4A 3N8SA 3PTEA 4NG2A 2NUPC 2OLUA 4MEZA 4OPZA 4LENA 4L9FA 4HP4A 5GLAA 1LL9A 4PPRA 4LCLA 2Y4AA 1QMEA 4A5RA 3E4QA 3C8CA 3H82B 4HEFA 2OWHA 3UY6A 4I38A 1N9LA 5DFYA 3IH8A 4GNUA 3C2WA 2ZOIA 1MZUA 5IU1A 4I5SA 3LIEA 1H3QA 3FG8A 1IYPA 1MKMA 1G28A 1W8QA 3E2KA 1ZHHB 3PBOA 4Y13A 4Q0HA 4JGPA 4EU0A 2V1AA 5FAQA 2ACGA 5EVIC 1SZVA 3BFEA 3LR0A 3NY4A 4QWOA 4HH2A 4BWIA 2H10A 3ITAA 3JVUA 1VEUB 2ZM2A 4QPRA 1NZUA 4EETB 4WMCD 4C75A 2ZC6B 3AGFA 1E3UD 3NDGA 2JKRM 2XLNA 1JWPA 1TS8A 4S2MA 3UMEA 2R9WA 4DE1A 3VP1A 3P09A 1TDGA 3VFFA 3LI9A 2Y2PA 5CTMA 5J8XA 5FEFA 2V2FF 2QJ7A 1LSXA 2WKPA 4JPMA 3VSKA 3F1NB 4Z1WA 3VE4A 3JPUA 5GL9A 4OQGA 3NECA 4EBPA 4IEDA 1LI9A 4YFMA 2R9XA 1FR1A 1K38A 4WL9A 4PHTA 2V1BA 4B93A 2ZMVA 5KMWA 1Y28A 3IBJA 4KZAA 3BYDA 3PBQA 1SDNA 1V9YA 2O99A 2XA7M 1PIOA 1OTEA 4X55A 1H0MA 4GZBA 4S2NA 4FH2A 1H8MA 1LL5A 1L0GA 3ZGAB 4OPRA 5HD5A 3V3RA 5I5LA 3D72A 1PWGA 3MZDA 3V67A 2DCFA 3E98A 4HIAA 3MXRA 3ZNYA 2ZQ9A 1IFQA 5CGWA 3VOYA 2HP5A 3IWIA 4L0LA 4FTXA 3LIAA 1T19A 3N7WA 5DTSA 2Y2LA 1XJ6A 3PAEA 3ZHHA 1KOUA 4OOLA 3EWKA 3LFVA 4EW7A 3ZFZA 3UPPA 1FCMA 3HLEA 3E4OA 3G32A 4NETA 4WBGA 2QJ5A 4K0WA 5HDDA 1MBLA 4R3JA 1JWVA 3IHBA 2R78A 4P87A 2O9BA 3LO7A 3FWLA 3LYXA 1L3LA 1BT5A 3BQAA 4DDSA 3F1OB 1NLYA 4X1MA 3H9WA 2BASA 2FFYA 1VB6A 2X02A 3HLGA 3HVFA 2PU4A 3MBZA 3DTEA 2XFTA 4D60A 2YKFA 1T1AA 3EGXC 3RXXA 3LIDA 1MC0A 3O5YA 3PBTA 5HL6A 2IA2A 2V1ZA 4U0XA 1F2KA 2B95A 2HDQA 1YLYA 3LR4A 1L0DA 1STZA 4WYYA 3VP0A 4EXOA 3TOIA 2PR6A 4PKYG 3K2NA 1P0ZA 4X69A 1ES5A 2M7UA 2PR5A 5CHUA 4G3VA 2EX8A 2ZOHA 1CQAA 1OTAA 3HBRA 3HLBA 3WWXA 3MJQA 1VETB 1K25A 2UV0E 1ACFA 2Y2QA 1NLZA 4N9KA 2ZM8A 1G68A 1S66L 4GD8A 5HSQA 1W7FA 4Y0UA 3UB5P 3RTYA 2HV1A 4ZJ2A 3VP4A 1S4SA 5CXWA 2VGKA 1KGFA 2HPBA 1W63Q 5EM1A 2Y2MA 2JKTI 4HBUA 3Q7VA 3VE3A 2WGWA 3BY8A 4MMNA 5FEGA 5TJJA 1RGYA 5HZHA 4R38A 2ZC5B 3GECA 1MWSA 3VFHA 4P6BA 2Q0OA 4LRXC 4P6ZS 5CERA 4H6JA 5JYPA 2M1CA 4OPQA 1YMXA 1J3WA 2JBFA 1YSQA 4KZ7A 3MF0A 4RVAA 2Y2KA 1SHVA 5CECA 4X25A 2GZAA 4QD4A 3NIAA 3HLCA 3V39A 2G2UA 4NXEA 3KX0X 3A3JA 1BTLA 5E2HA 3HUNA 4OH0A 4EESA 3BM6A 4PMAA 4DDYA 2Y2IA 4UA6A 3OPPA 2Y91A 3A3DA 3PR6A 1YKDA 2QMIA 3PBNA 3P7NA 4HBTA 4XXRA 5HAPA 1SKOB 2Z2LB 1DP9A 2Y8HA 5EVIA 1ES3A 1ZKJA 2EXBA 5E2EA 2VLGA 4GHIA 3IH9A 2HDSA 2A3UA 3G6OA 2ZD8A 3C4PA 3QNCA 3CUEC 3NDEA 2HF6A 1IOUA 2RL3A 3HREA 2XD1A 5EOOA 3MS6A 2VZWA 4Q0JA 1F9IA 3UPOA 2L4RA 3W4QA 3FKVA 5F83A 3T1SA 2W1TA 4Q0IA 4ZJ1A 4O8GA 3LEZA 1KGGA 2VK3A 3N8LA 2ZMFA 5FDHA 4JKTA 1ONHA 1PW8A 3FKWA 4DE0A 1DJBA 3KYQA 4WM9A 3RH8B 5M19A 3NC8A 2EFXA 3AGEA 4MN7A 5HAIA 4KZ3A 3S7QA 4E3LA 1L0FA 3H82A 4OP8A 1DY6A 2XQZA 3D3OA 2J9OA 2O9CA 4JLFA 1KE3A 5CRFA 1Q2PA 4U3TA 1K56D 1ES2A 3S7NA 1ZG4A 4MBKA 4R3BA 1S1YA 2WKHA 2B18A 4FCFA 3AGDA 3WS0A 4RX3A 3HLFA 4R70A 1KDSA 3O87A 3QP6A 4IBXA 4QY5A 1ESUA 3R4KA 5L09A 1E25A 3G4PA 2XFSA 3NBLA 3ZVWA 3OOVA 1K0KA 4GD6A 1KE0A 2JKGA 1K6SA 4IVKA 4NXFA 1YQSA 4UA9A 3T4LA 5E2GA 1GSWA 4S2KA 3B47A 3FPVA 2J3TC 1W5DA 4IHQA 3UNWA 2W3EA 4N1XA 1O7EA 1PZOA 3SS5A 4FH4A 5EE8A 5AVFA 4PM5A 1TD5A 3F1NA 3ZYTA 4CQHA 3EOIA 4BD0A 2PD8A 5IS1A 2FH5A 3ZG5A 1KVLA 1KDWA 4JF5A 4E04A 4RA7A 3ICYA 3UPNA 2Y2HA 4ID4A 1NYYA 1DP6A 3MKEA 4XUXA 4MN5A 4MDZA 2ZC4B 5DTKA 4RQ9A 3A3IA 4O7DA 2H0TA 1YLWA 3EQUA 4QB8A 3HL9A 3RXWA 2XR0A 2PDRA 4CLCB 3LR3A 5HDCA 1T18A 3BECA 4B88A 2LB9A 4RX2A 2MJ6A 3RFBA 3ZG7B 5G4ZA 3PYPA 5EUAA 3O88A 3BFDA 3MR0A 1ERQA 3MZFA 4MBHA 2JE5A 4IJGA 3VSLA 1P9WA 3OPRA 1CK3A 5J4EA 1HD8A 1BSGA 3PBSA 3T4KA 2PD7A 3I7JA 1CEFA 3IF6B 3HJKA 5HL1A 1BYWA 4Y3IA 2V0UA 1O07A 1S6RA 4GW9A 3H7WA 2V0WA 3ZG0A 4E3KA 5AJGA 4JXWA 5FDSA 3QP2A 1YPRA 4IVIA 4B4ZA 1LT0A 3K3CA 4LFUA 4Y7PA 3N4IA 5MC7A 2WKQA 3Q07A 4JF4A 3IX8A 5M1AA 2PHYA 3UB7A 3VP3A 4HESA 5CGXA 1XFQA 5GHXA 4HJ4A 2BTFP 4FSFA 2QWSA 3D9YA 2WGVA 4BD1A 3DW0A 3CPTA 3IX3A 4CLCD 3S7OA 5HARA 4DE3A 3WRTA 3F1PB 1GSXA 5KSCA 1JNUA 3CZDA 4BENA 5FQ9A 5L2FA 1XGIA 4KZ9A 4CLCC 3TRCA 4HP9A 2XK1A 1CI9A 1D06A 2ZQDA 3A0VA 3BW6A 5GHYA 2XSSA 5TBMB 5FL3A 3UDXA 2XA7S 3LEQA 4BQMA 2Y2OA 2KDKA 2VGJA 2JHEA 4G3KA 2H0YA 2AVXA 4XT2B 4MNRA 3KYEA 1TF1A 4H8RA 4JXGA 5DF9A 1OJGA 1VETA 1LSWA 1OTBA 3IF6C 2WAFA 3SH7A 2P08A 2W3DA 4KZ6A 3QP4A 2VGLM 3ITBA 1YSPA 2NUTC 2HP9A 1H8ZA 5DTTA 3CUEA 3DTMA 3GTCA 3UE0A 1P9RA 3CAXA 4E3OA 3T4SA 3UDFA 4GOGA 4Q8IA 1KVMA 4E6WA 1AXBA 1IELA 3OPHA 3UN7A 4DXBA 3IWQA 2HDUA 2V9AA 5A8BA 2WUQA 5EM0A 4MN6A 3SZTA 4S2IA 2PU2A 2QZ6A 5J3WA 5F1GA 5M18A 1NJ4A 2HDRA 2K7SA 4WUJA 4ETXA 2D02A 3E0YA 3M2KA 3ZQ5A 1H5XA 3KSFA 2QKPA 2Y2NA 4OOYA 1M40A 1K54C 1OT9A 3S7PA 5EOEA 1HTZA 2O0YA 4KZ4A 2HGVA 3M6HA 1OT6A 1PWCA 3WS2A 5EFWA 1I2WA 4S2LA 3LY4A 2HJ9C 1FR6A 3N8RA 1OMEA 1ERMA 4OQIA 5F1FA 4HH3A 4M4XA 4E3JA 1U60A 2J80A 2DMWA 1N9OA 3A3FA 4I3JA 3FC7A 4MCWA 2OWJA 4KENB 3IF5A 4IBRA 4LV1A 3O3VA 1CJFA 4PM8A 1YAXA 3CG5A 4BBUA 4WZ5A 2WKIA 1EI5A 3NULA 4FUWA 2VX8A 2W3HA 2ZQ8A 1IYOA 5GHZA 2OSUA 2X71A 2EX6A 1PRQA 2JCHA 2JC7A 5EVEA 3T4JA 2VKSA 2P7JA 4ZTKA 5F69A 3OC2A 3KSIA 4HJ3A 2B02A 2XRNA 4DMZA 5L8MA 1RP5A 4X56A 4GJ4A 2JN7A 2XROA 1G5UA 1JTGA 1NRJA 4GN2A 1IYSA 1XX2A 2GDNA 2LB5A 3W2ZA 4EEPA 1EW0A 4NXBA 3MQOA 1W8YA 3MFXA 4GS9B 4ZBEA 3NOPC 4DRTA 1IKIA 2UWXA 2HJEA 3T1XA 1QMFA 1FSYA 4WELA 1SDEA 1XJ3A 4Z9QA 3SS3A 3PHYA 2J9PA 1PNEA 4OQ0A 5HFOA 4HY8A 1XA1A 2FFFB 3UO9A 5HX9A 4DJ3A 2W0NA 3OCLA 3UB9A 3LCEA 3E2LA 5F82A 5GLBA 4O01A 4EERA 1GSVA 3MSHA 2WZZA 4LV0A 4OLDA 3IHAA 2K2NA 4LGWA 4R4RA 1E4DA 3BRMA 1DP8A 3VOLA 4OOMA 3WS5A 3QNBA 3ZG9B 1FCOA 4UA7A 4OPYA 3HCYA 4GLQA 1LLBA 4EBNA 3BWLA 3T4TA 2H28A 4P85A 3CITA 4S2NC 2ZQCA 1HLUP 3GR2A 1WA9A 3TG9A 2K31A 3IQAA 5F68A 2A24B 1K55C 1S0WA 4WMCA 2J8YA 3G30A 1E3UA 3BEBA 4S2JA 1ODVA 3OLOA 3PAGA 1TVFA 3C4OA 4E3NA 4Y5FA 1XKZA 3O86A 2ZJ9A 4LPZA 2QYBA 3IWOA 3UE6A 1OPXA 4S2OA 4ETZA 2A49A 3OPLA 2V8FA 1S67L 2ZQ7A 5AQ9A 3QHYA 1K57C 2Q9MA 4KQRA 1ESIA 4AFIA 3KO6A 1ONGA 3B3XA 4KZBA 1F5MA 2P74A 5HPFA 3GV9A 1SCWA 3MMHA 3OBFA 2IWDA 3IBRA 4WEJA 4WF0A 2V8CA 4E6XA 5GLDA 5HW3A 1GHMA 1EWZA 4UQIM 4CPKA 3R7WB 3M6BA 3Q7VB 3DBAA 1NY0A 2Y79A 2L0WA 3KSHA 5FI7A 2DNSA 4Y0OA 4JGOA 3DAVA 3GMWA 1VEUA 2IWBA 1IEMA 2EWWA 1BLHA 2Y2GA 3UDIA 1HVBA 4BBTA 1Z6FA 1EROA 3CMZA 3UMDA 1L0EA 3W8KA 1BZAA 1V9ZA 5CTNA 3ZNTA 3MXSA 4EUVA 2WZXA 3C7VA 3F1PA 2M7VA 1XJ2A 3BJNA 4R6LA 1XFNA 2GNXA 3LI8A 1FQGA 3ULFA 4KG5A 4IUHA 1NRFA 3TW8A 3FZCA 2EA9A 3LGOA 3MFDA 1MY8A 3VV4A 4I39A 5TBMA 4ZRRA 1PYYA 3VMAA 1NYMA 2W3FA 4L9EA 2D01A 5HDSA 1NWZA 4XT2A 5HWVA 3CWFA 2Y2JA 3G31A 4JF6A 4LRYC 5F5YA 4YWZA 2ZL1B 3MKFA 5CHMA 1PI5A 1S1ZA 1GHPA 1CEGA 4KQDA 5FSRA 4R3AA 4EBLA 3P98A 3TJZC 2ZLYA 2GJ3A 5E43A 4F3LB 1RGZA 5DF7A 2Y55A 5E2FA 4HNBA 3IS2B 3ZCZA 3OZHA 3C7UA 4JGQA 4DN0A 4O0PA 3UE1A 1RCJA 4YNRA 3TE8A 4X6TA 5IT5A 4II7A 2H5SA 4ARZB 3ISGA 3BFGA 3GSGA 3W4PA 4DF6A 4JGRA 2KOIA 2X01A 4BL2A 1FCNA 2ZBBA 2BLSA 1K4FA 1BLSA 3IT9A 4QHCA 5K5BA 2KLIA 5L07A 2JKRI 4LV3A 1XP4A 3T50A 4OKPA 5FQQA 5EPHA 2J7VA 1Y4OA 4UAAA 1VM1A 2WAEA 2Y59A 3BY9A 1UGUA 4LLOB 5EVID 3T1RA 1N9NA 3A3EA 3F1OA 1G6OA 5CX7A 2PAVP 4NK3A 3TSGA 4PM6A 3DTIA 1X0OA 1MXOA 1OJ5A 5FQIA 2G7UA 3EGDC 3T12B 2ZQAA 3VP2A 1W63M 1DJAA 3SS4A 2EX2A 2WYXA 4KZ8A 4R1GA 2XGNA 4BL3A 1SKFA 4EWFA 1K4EA 4N92A 2G2WA 5AQAA 3MQQA 3V5MA 3LIBA 2EFUA 5HWWA 5F6AA 4UEYA 4P0MA 2EX9A 3JVVA 2VJWA 2IWCA 3P01A 1N4OA 3L7HA 3E4PA 5AQ7A 2O9AA 1BLPA 2VGLS 4GDBA 3ZVTA 1OTIA 2P9VB 3QP1A 1NXYA 1WYBA 5I94A 4KQOA 5DKLA 4YINA 1JTDA 1VHMA 3EQVA 4JXSA 2VV6A 5KZHA 1TS0A 4C3QA 4ESPA 4Y2FA 2QHKA 4WN5A 4WEKA 1K55A 4BJPA 3LIFA 2WK0A 4N9LA 4NXGA 5TR7A 4GS9A 1H8YA 1FSWA 4BMWA 3IX4A 4G3WA 2CC1A 3LICA 2V20A 1XA7A 2Z2MB 3S22A 4E3IA 2HP6A 2WKRA 4M3KA 4OLGA 4ZAMA 1K57A 5FQJA 3MZEA 5A91A 2VA0A 3Q81A 3BQ8A 2Z6CA 4KUOA 3LR5A 4R23A 3H7WB 5HWTA 2B5RA 4DXCA
chains in the Genus database with same CATH topology
4Y17A 4Y15A 2UV0E 4LFUA 4NG2A 3IX3A 5L10A 3QP8A 3IX8A 2AVXA 3QP4A 3QP6A 3IX4A 5L09A 1L3LA 5L07A 4Y13A 4LGWA 3QP5A 1H0MA 3JPUA 3QP2A 3SZTA 2Q0OA 3QP1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Y17 A;  4Y15 A;  2UV0 E;  4LFU A;  4NG2 A;  3IX3 A;  5L10 A;  3QP8 A;  3IX8 A;  2AVX A;  3QP4 A;  3QP6 A;  3IX4 A;  5L09 A;  1L3L A;  5L07 A;  4Y13 A;  4LGW A;  3QP5 A;  1H0M A;  3JPU A;  3QP2 A;  3SZT A;  2Q0O A;  3QP1 A; 
#chains in the Genus database with same CATH topology
 3MQ0 A;  2KX6 A;  2OLV A;  5CEB A;  4CJN A;  4HHD A;  1YM1 A;  4RYE A;  4KZ5 A;  3CHW P;  5LBR A;  2I72 A;  1K56 A;  5TFQ A;  3V3S A;  3OCN A;  1FIL A;  5FA7 A;  1SKO A;  4X1L A;  1YT4 A;  5FQK A;  3DTK A;  3HJI A;  2L1M A;  3JYI A;  4FOF A;  5FAS A;  1JVJ A;  5J7E A;  1XPB A;  1I2S A;  4MLL A;  4EQI A;  3CPT B;  2GX5 A;  4NKP A;  1AWI A;  4QU3 A;  5AQB A;  1DRM A;  4ME4 A;  5FAO A;  2A24 A;  5TGF A;  3C30 A;  1ALQ A;  1UWN X;  1LSV A;  3BLS A;  3FYZ A;  2RCX A;  3G34 A;  3Q7Z A;  3FPW A;  4NEE D;  1WE4 A;  1A0K A;  3NI9 A;  2OOL A;  3WS1 A;  1JWZ A;  2W27 A;  4JXV A;  5CED A;  4E3M A;  3W4O A;  3N6I A;  2W1R A;  2E8J A;  1PI4 A;  3T1Q B;  3ZG8 B;  3SW1 A;  1MWU A;  1L2S A;  2E8I A;  2J3W A;  3G35 A;  1LL8 A;  1PWD A;  1OTD A;  5U47 A;  5FQM A;  1MKI A;  4EEU A;  2XD5 A;  4KQQ A;  3A0S A;  1BLC A;  4ZJ3 A;  1ZTU A;  2C5W B;  1MWT A;  1PW1 A;  1T1B A;  3IXH A;  4FD8 A;  5DFX A;  4WLA A;  4Y0T A;  2EWV A;  3SOI A;  3UB6 A;  4PM7 A;  4EQ1 A;  5EV0 A;  5L10 A;  2Z6D A;  3R7W A;  1IYQ A;  4R0Q A;  4LRZ E;  4LCM A;  1P97 A;  2XDM A;  2VV8 A;  1M6K A;  4GCZ A;  1LI0 A;  3U2A A;  5A93 A;  1S4R A;  2WKE A;  5DJU A;  4X68 A;  4HOI A;  1G6A A;  2XH9 A;  1XXM A;  4GKU A;  4K91 A;  1GA0 A;  2OV5 A;  1F98 A;  2I9V A;  4EV4 A;  4KG2 A;  2JKT M;  4YOF A;  3NCK A;  3G2Z A;  5KSH A;  4P6Z M;  5G18 A;  4CLC E;  3ZDJ A;  3T4Q A;  3UE3 A;  3FV7 A;  5HD3 A;  5D3O A;  4OON A;  4OVD A;  5EEC A;  5KIZ A;  1MPL A;  4QY6 A;  5DF8 A;  2PRF A;  2A2L A;  1D7E A;  1J9M A;  4OP5 A;  4HI4 A;  3A0R A;  4K08 A;  4DE2 A;  3V50 A;  5FI2 A;  3C38 A;  4PM9 A;  5FAT A;  1BUL A;  1PZP A;  3WS4 A;  4JBF A;  3DWZ A;  3PBR A;  1NZO A;  1TEM A;  1FIK A;  3B33 A;  3KSG A;  2XEP A;  1WYC A;  4BLM A;  1ZG6 A;  2ZL1 A;  3HLD A;  4KG6 A;  1N9B A;  3IXB A;  1GCE A;  4PAU A;  3WRZ A;  2WGI A;  4HQA A;  3NOU C;  2ZC7 A;  5IHV A;  4CLC A;  1Z09 A;  5AVE A;  4B9O A;  4K0X A;  3GQZ A;  4F3L A;  1TS7 A;  2HZ5 A;  5HAQ A;  4BBV A;  4UHU A;  1W79 A;  3BFC A;  4Y15 A;  1BUE A;  1GHI A;  1I5Q A;  2INW A;  3IS2 A;  3HUM A;  3BLM A;  1Y54 A;  1YLT A;  3K3D A;  3LUQ A;  3M2J A;  2VV7 A;  3EEA A;  1VQQ A;  4U0T A;  1Q2Q A;  4UQI S;  4ZDX A;  4ARZ A;  1HZO A;  3HUO A;  4HJ6 A;  3CJM A;  3IF6 A;  2OAP 1;  2PBY A;  2WAD A;  3D4F A;  3GDI A;  5EVL A;  4XUZ A;  4D2O A;  2ZC3 B;  5BOH A;  4S2P A;  4L9G A;  2ZM0 A;  3CLO A;  3Q1F A;  5A90 A;  3CI6 A;  3S4X A;  1ES4 A;  1CF0 A;  2Q9N A;  4OQH A;  4I3A A;  2WGW B;  2ZMA A;  3EEH A;  2JKF A;  4PKY A;  1T1C A;  3NJA A;  5C5K A;  4X53 A;  4LV2 A;  5FAP A;  4GB7 A;  3QP8 A;  3B42 A;  4GDN A;  4N1H A;  3NHQ A;  4H6J B;  1K6R A;  3GVB A;  5CGS A;  2P04 A;  2PYP A;  1YLJ A;  2PT7 A;  3KYZ A;  5G4Y A;  2EXA A;  2VEA A;  3C5A A;  5DKK A;  2FZ0 A;  5GLC A;  2XF3 A;  2PBD P;  4B4X A;  2J3T D;  3MXQ A;  4EUZ A;  1TS6 A;  5CHJ A;  4WZ4 A;  3S1Y A;  3NOT C;  4KUK A;  4MBF A;  3VOZ A;  4DJ2 A;  4WZ5 C;  4IUK A;  3HLW A;  3SH9 A;  4F94 A;  1PFL A;  3LY3 A;  1K54 A;  3GRJ A;  2OAQ 1;  1IKG A;  5A92 A;  2PYR A;  1ZC2 A;  1C3B A;  1YLP A;  1XGJ A;  3PXP A;  4R4S A;  1KE4 A;  5EVI B;  2QPN A;  4DKI A;  4GHI B;  3SH8 A;  2C6W B;  2YKH A;  1FOF A;  4QJG A;  3Q82 A;  5JYO A;  1DJC A;  2P9V A;  5DJT A;  1TDL A;  1KGE A;  3IXG A;  4I3I A;  4Y17 A;  2BG1 A;  3IXD A;  1YMS A;  3G2Y A;  4C6Y A;  1MWR A;  1CI8 A;  3U4L P;  3BFF A;  1D1J A;  3RJU A;  1YLZ A;  2DRW A;  2W3G A;  1UWP X;  3UB8 A;  3QP5 A;  1LHY A;  5HPI A;  3T4O A;  3DWK A;  2CMN A;  5DVA A;  5FI6 A;  1GA9 A;  2W1T B;  3L9K A;  1XJ4 A;  3N8S A;  3PTE A;  4NG2 A;  2NUP C;  2OLU A;  4MEZ A;  4OPZ A;  4LEN A;  4L9F A;  4HP4 A;  5GLA A;  1LL9 A;  4PPR A;  4LCL A;  2Y4A A;  1QME A;  4A5R A;  3E4Q A;  3C8C A;  3H82 B;  4HEF A;  2OWH A;  3UY6 A;  4I38 A;  1N9L A;  5DFY A;  3IH8 A;  4GNU A;  3C2W A;  2ZOI A;  1MZU A;  5IU1 A;  4I5S A;  3LIE A;  1H3Q A;  3FG8 A;  1IYP A;  1MKM A;  1G28 A;  1W8Q A;  3E2K A;  1ZHH B;  3PBO A;  4Y13 A;  4Q0H A;  4JGP A;  4EU0 A;  2V1A A;  5FAQ A;  2ACG A;  5EVI C;  1SZV A;  3BFE A;  3LR0 A;  3NY4 A;  4QWO A;  4HH2 A;  4BWI A;  2H10 A;  3ITA A;  3JVU A;  1VEU B;  2ZM2 A;  4QPR A;  1NZU A;  4EET B;  4WMC D;  4C75 A;  2ZC6 B;  3AGF A;  1E3U D;  3NDG A;  2JKR M;  2XLN A;  1JWP A;  1TS8 A;  4S2M A;  3UME A;  2R9W A;  4DE1 A;  3VP1 A;  3P09 A;  1TDG A;  3VFF A;  3LI9 A;  2Y2P A;  5CTM A;  5J8X A;  5FEF A;  2V2F F;  2QJ7 A;  1LSX A;  2WKP A;  4JPM A;  3VSK A;  3F1N B;  4Z1W A;  3VE4 A;  3JPU A;  5GL9 A;  4OQG A;  3NEC A;  4EBP A;  4IED A;  1LI9 A;  4YFM A;  2R9X A;  1FR1 A;  1K38 A;  4WL9 A;  4PHT A;  2V1B A;  4B93 A;  2ZMV A;  5KMW A;  1Y28 A;  3IBJ A;  4KZA A;  3BYD A;  3PBQ A;  1SDN A;  1V9Y A;  2O99 A;  2XA7 M;  1PIO A;  1OTE A;  4X55 A;  1H0M A;  4GZB A;  4S2N A;  4FH2 A;  1H8M A;  1LL5 A;  1L0G A;  3ZGA B;  4OPR A;  5HD5 A;  3V3R A;  5I5L A;  3D72 A;  1PWG A;  3MZD A;  3V67 A;  2DCF A;  3E98 A;  4HIA A;  3MXR A;  3ZNY A;  2ZQ9 A;  1IFQ A;  5CGW A;  3VOY A;  2HP5 A;  3IWI A;  4L0L A;  4FTX A;  3LIA A;  1T19 A;  3N7W A;  5DTS A;  2Y2L A;  1XJ6 A;  3PAE A;  3ZHH A;  1KOU A;  4OOL A;  3EWK A;  3LFV A;  4EW7 A;  3ZFZ A;  3UPP A;  1FCM A;  3HLE A;  3E4O A;  3G32 A;  4NET A;  4WBG A;  2QJ5 A;  4K0W A;  5HDD A;  1MBL A;  4R3J A;  1JWV A;  3IHB A;  2R78 A;  4P87 A;  2O9B A;  3LO7 A;  3FWL A;  3LYX A;  1L3L A;  1BT5 A;  3BQA A;  4DDS A;  3F1O B;  1NLY A;  4X1M A;  3H9W A;  2BAS A;  2FFY A;  1VB6 A;  2X02 A;  3HLG A;  3HVF A;  2PU4 A;  3MBZ A;  3DTE A;  2XFT A;  4D60 A;  2YKF A;  1T1A A;  3EGX C;  3RXX A;  3LID A;  1MC0 A;  3O5Y A;  3PBT A;  5HL6 A;  2IA2 A;  2V1Z A;  4U0X A;  1F2K A;  2B95 A;  2HDQ A;  1YLY A;  3LR4 A;  1L0D A;  1STZ A;  4WYY A;  3VP0 A;  4EXO A;  3TOI A;  2PR6 A;  4PKY G;  3K2N A;  1P0Z A;  4X69 A;  1ES5 A;  2M7U A;  2PR5 A;  5CHU A;  4G3V A;  2EX8 A;  2ZOH A;  1CQA A;  1OTA A;  3HBR A;  3HLB A;  3WWX A;  3MJQ A;  1VET B;  1K25 A;  2UV0 E;  1ACF A;  2Y2Q A;  1NLZ A;  4N9K A;  2ZM8 A;  1G68 A;  1S66 L;  4GD8 A;  5HSQ A;  1W7F A;  4Y0U A;  3UB5 P;  3RTY A;  2HV1 A;  4ZJ2 A;  3VP4 A;  1S4S A;  5CXW A;  2VGK A;  1KGF A;  2HPB A;  1W63 Q;  5EM1 A;  2Y2M A;  2JKT I;  4HBU A;  3Q7V A;  3VE3 A;  2WGW A;  3BY8 A;  4MMN A;  5FEG A;  5TJJ A;  1RGY A;  5HZH A;  4R38 A;  2ZC5 B;  3GEC A;  1MWS A;  3VFH A;  4P6B A;  2Q0O A;  4LRX C;  4P6Z S;  5CER A;  4H6J A;  5JYP A;  2M1C A;  4OPQ A;  1YMX A;  1J3W A;  2JBF A;  1YSQ A;  4KZ7 A;  3MF0 A;  4RVA A;  2Y2K A;  1SHV A;  5CEC A;  4X25 A;  2GZA A;  4QD4 A;  3NIA A;  3HLC A;  3V39 A;  2G2U A;  4NXE A;  3KX0 X;  3A3J A;  1BTL A;  5E2H A;  3HUN A;  4OH0 A;  4EES A;  3BM6 A;  4PMA A;  4DDY A;  2Y2I A;  4UA6 A;  3OPP A;  2Y91 A;  3A3D A;  3PR6 A;  1YKD A;  2QMI A;  3PBN A;  3P7N A;  4HBT A;  4XXR A;  5HAP A;  1SKO B;  2Z2L B;  1DP9 A;  2Y8H A;  5EVI A;  1ES3 A;  1ZKJ A;  2EXB A;  5E2E A;  2VLG A;  4GHI A;  3IH9 A;  2HDS A;  2A3U A;  3G6O A;  2ZD8 A;  3C4P A;  3QNC A;  3CUE C;  3NDE A;  2HF6 A;  1IOU A;  2RL3 A;  3HRE A;  2XD1 A;  5EOO A;  3MS6 A;  2VZW A;  4Q0J A;  1F9I A;  3UPO A;  2L4R A;  3W4Q A;  3FKV A;  5F83 A;  3T1S A;  2W1T A;  4Q0I A;  4ZJ1 A;  4O8G A;  3LEZ A;  1KGG A;  2VK3 A;  3N8L A;  2ZMF A;  5FDH A;  4JKT A;  1ONH A;  1PW8 A;  3FKW A;  4DE0 A;  1DJB A;  3KYQ A;  4WM9 A;  3RH8 B;  5M19 A;  3NC8 A;  2EFX A;  3AGE A;  4MN7 A;  5HAI A;  4KZ3 A;  3S7Q A;  4E3L A;  1L0F A;  3H82 A;  4OP8 A;  1DY6 A;  2XQZ A;  3D3O A;  2J9O A;  2O9C A;  4JLF A;  1KE3 A;  5CRF A;  1Q2P A;  4U3T A;  1K56 D;  1ES2 A;  3S7N A;  1ZG4 A;  4MBK A;  4R3B A;  1S1Y A;  2WKH A;  2B18 A;  4FCF A;  3AGD A;  3WS0 A;  4RX3 A;  3HLF A;  4R70 A;  1KDS A;  3O87 A;  3QP6 A;  4IBX A;  4QY5 A;  1ESU A;  3R4K A;  5L09 A;  1E25 A;  3G4P A;  2XFS A;  3NBL A;  3ZVW A;  3OOV A;  1K0K A;  4GD6 A;  1KE0 A;  2JKG A;  1K6S A;  4IVK A;  4NXF A;  1YQS A;  4UA9 A;  3T4L A;  5E2G A;  1GSW A;  4S2K A;  3B47 A;  3FPV A;  2J3T C;  1W5D A;  4IHQ A;  3UNW A;  2W3E A;  4N1X A;  1O7E A;  1PZO A;  3SS5 A;  4FH4 A;  5EE8 A;  5AVF A;  4PM5 A;  1TD5 A;  3F1N A;  3ZYT A;  4CQH A;  3EOI A;  4BD0 A;  2PD8 A;  5IS1 A;  2FH5 A;  3ZG5 A;  1KVL A;  1KDW A;  4JF5 A;  4E04 A;  4RA7 A;  3ICY A;  3UPN A;  2Y2H A;  4ID4 A;  1NYY A;  1DP6 A;  3MKE A;  4XUX A;  4MN5 A;  4MDZ A;  2ZC4 B;  5DTK A;  4RQ9 A;  3A3I A;  4O7D A;  2H0T A;  1YLW A;  3EQU A;  4QB8 A;  3HL9 A;  3RXW A;  2XR0 A;  2PDR A;  4CLC B;  3LR3 A;  5HDC A;  1T18 A;  3BEC A;  4B88 A;  2LB9 A;  4RX2 A;  2MJ6 A;  3RFB A;  3ZG7 B;  5G4Z A;  3PYP A;  5EUA A;  3O88 A;  3BFD A;  3MR0 A;  1ERQ A;  3MZF A;  4MBH A;  2JE5 A;  4IJG A;  3VSL A;  1P9W A;  3OPR A;  1CK3 A;  5J4E A;  1HD8 A;  1BSG A;  3PBS A;  3T4K A;  2PD7 A;  3I7J A;  1CEF A;  3IF6 B;  3HJK A;  5HL1 A;  1BYW A;  4Y3I A;  2V0U A;  1O07 A;  1S6R A;  4GW9 A;  3H7W A;  2V0W A;  3ZG0 A;  4E3K A;  5AJG A;  4JXW A;  5FDS A;  3QP2 A;  1YPR A;  4IVI A;  4B4Z A;  1LT0 A;  3K3C A;  4LFU A;  4Y7P A;  3N4I A;  5MC7 A;  2WKQ A;  3Q07 A;  4JF4 A;  3IX8 A;  5M1A A;  2PHY A;  3UB7 A;  3VP3 A;  4HES A;  5CGX A;  1XFQ A;  5GHX A;  4HJ4 A;  2BTF P;  4FSF A;  2QWS A;  3D9Y A;  2WGV A;  4BD1 A;  3DW0 A;  3CPT A;  3IX3 A;  4CLC D;  3S7O A;  5HAR A;  4DE3 A;  3WRT A;  3F1P B;  1GSX A;  5KSC A;  1JNU A;  3CZD A;  4BEN A;  5FQ9 A;  5L2F A;  1XGI A;  4KZ9 A;  4CLC C;  3TRC A;  4HP9 A;  2XK1 A;  1CI9 A;  1D06 A;  2ZQD A;  3A0V A;  3BW6 A;  5GHY A;  2XSS A;  5TBM B;  5FL3 A;  3UDX A;  2XA7 S;  3LEQ A;  4BQM A;  2Y2O A;  2KDK A;  2VGJ A;  2JHE A;  4G3K A;  2H0Y A;  2AVX A;  4XT2 B;  4MNR A;  3KYE A;  1TF1 A;  4H8R A;  4JXG A;  5DF9 A;  1OJG A;  1VET A;  1LSW A;  1OTB A;  3IF6 C;  2WAF A;  3SH7 A;  2P08 A;  2W3D A;  4KZ6 A;  3QP4 A;  2VGL M;  3ITB A;  1YSP A;  2NUT C;  2HP9 A;  1H8Z A;  5DTT A;  3CUE A;  3DTM A;  3GTC A;  3UE0 A;  1P9R A;  3CAX A;  4E3O A;  3T4S A;  3UDF A;  4GOG A;  4Q8I A;  1KVM A;  4E6W A;  1AXB A;  1IEL A;  3OPH A;  3UN7 A;  4DXB A;  3IWQ A;  2HDU A;  2V9A A;  5A8B A;  2WUQ A;  5EM0 A;  4MN6 A;  3SZT A;  4S2I A;  2PU2 A;  2QZ6 A;  5J3W A;  5F1G A;  5M18 A;  1NJ4 A;  2HDR A;  2K7S A;  4WUJ A;  4ETX A;  2D02 A;  3E0Y A;  3M2K A;  3ZQ5 A;  1H5X A;  3KSF A;  2QKP A;  2Y2N A;  4OOY A;  1M40 A;  1K54 C;  1OT9 A;  3S7P A;  5EOE A;  1HTZ A;  2O0Y A;  4KZ4 A;  2HGV A;  3M6H A;  1OT6 A;  1PWC A;  3WS2 A;  5EFW A;  1I2W A;  4S2L A;  3LY4 A;  2HJ9 C;  1FR6 A;  3N8R A;  1OME A;  1ERM A;  4OQI A;  5F1F A;  4HH3 A;  4M4X A;  4E3J A;  1U60 A;  2J80 A;  2DMW A;  1N9O A;  3A3F A;  4I3J A;  3FC7 A;  4MCW A;  2OWJ A;  4KEN B;  3IF5 A;  4IBR A;  4LV1 A;  3O3V A;  1CJF A;  4PM8 A;  1YAX A;  3CG5 A;  4BBU A;  4WZ5 A;  2WKI A;  1EI5 A;  3NUL A;  4FUW A;  2VX8 A;  2W3H A;  2ZQ8 A;  1IYO A;  5GHZ A;  2OSU A;  2X71 A;  2EX6 A;  1PRQ A;  2JCH A;  2JC7 A;  5EVE A;  3T4J A;  2VKS A;  2P7J A;  4ZTK A;  5F69 A;  3OC2 A;  3KSI A;  4HJ3 A;  2B02 A;  2XRN A;  4DMZ A;  5L8M A;  1RP5 A;  4X56 A;  4GJ4 A;  2JN7 A;  2XRO A;  1G5U A;  1JTG A;  1NRJ A;  4GN2 A;  1IYS A;  1XX2 A;  2GDN A;  2LB5 A;  3W2Z A;  4EEP A;  1EW0 A;  4NXB A;  3MQO A;  1W8Y A;  3MFX A;  4GS9 B;  4ZBE A;  3NOP C;  4DRT A;  1IKI A;  2UWX A;  2HJE A;  3T1X A;  1QMF A;  1FSY A;  4WEL A;  1SDE A;  1XJ3 A;  4Z9Q A;  3SS3 A;  3PHY A;  2J9P A;  1PNE A;  4OQ0 A;  5HFO A;  4HY8 A;  1XA1 A;  2FFF B;  3UO9 A;  5HX9 A;  4DJ3 A;  2W0N A;  3OCL A;  3UB9 A;  3LCE A;  3E2L A;  5F82 A;  5GLB A;  4O01 A;  4EER A;  1GSV A;  3MSH A;  2WZZ A;  4LV0 A;  4OLD A;  3IHA A;  2K2N A;  4LGW A;  4R4R A;  1E4D A;  3BRM A;  1DP8 A;  3VOL A;  4OOM A;  3WS5 A;  3QNB A;  3ZG9 B;  1FCO A;  4UA7 A;  4OPY A;  3HCY A;  4GLQ A;  1LLB A;  4EBN A;  3BWL A;  3T4T A;  2H28 A;  4P85 A;  3CIT A;  4S2N C;  2ZQC A;  1HLU P;  3GR2 A;  1WA9 A;  3TG9 A;  2K31 A;  3IQA A;  5F68 A;  2A24 B;  1K55 C;  1S0W A;  4WMC A;  2J8Y A;  3G30 A;  1E3U A;  3BEB A;  4S2J A;  1ODV A;  3OLO A;  3PAG A;  1TVF A;  3C4O A;  4E3N A;  4Y5F A;  1XKZ A;  3O86 A;  2ZJ9 A;  4LPZ A;  2QYB A;  3IWO A;  3UE6 A;  1OPX A;  4S2O A;  4ETZ A;  2A49 A;  3OPL A;  2V8F A;  1S67 L;  2ZQ7 A;  5AQ9 A;  3QHY A;  1K57 C;  2Q9M A;  4KQR A;  1ESI A;  4AFI A;  3KO6 A;  1ONG A;  3B3X A;  4KZB A;  1F5M A;  2P74 A;  5HPF A;  3GV9 A;  1SCW A;  3MMH A;  3OBF A;  2IWD A;  3IBR A;  4WEJ A;  4WF0 A;  2V8C A;  4E6X A;  5GLD A;  5HW3 A;  1GHM A;  1EWZ A;  4UQI M;  4CPK A;  3R7W B;  3M6B A;  3Q7V B;  3DBA A;  1NY0 A;  2Y79 A;  2L0W A;  3KSH A;  5FI7 A;  2DNS A;  4Y0O A;  4JGO A;  3DAV A;  3GMW A;  1VEU A;  2IWB A;  1IEM A;  2EWW A;  1BLH A;  2Y2G A;  3UDI A;  1HVB A;  4BBT A;  1Z6F A;  1ERO A;  3CMZ A;  3UMD A;  1L0E A;  3W8K A;  1BZA A;  1V9Z A;  5CTN A;  3ZNT A;  3MXS A;  4EUV A;  2WZX A;  3C7V A;  3F1P A;  2M7V A;  1XJ2 A;  3BJN A;  4R6L A;  1XFN A;  2GNX A;  3LI8 A;  1FQG A;  3ULF A;  4KG5 A;  4IUH A;  1NRF A;  3TW8 A;  3FZC A;  2EA9 A;  3LGO A;  3MFD A;  1MY8 A;  3VV4 A;  4I39 A;  5TBM A;  4ZRR A;  1PYY A;  3VMA A;  1NYM A;  2W3F A;  4L9E A;  2D01 A;  5HDS A;  1NWZ A;  4XT2 A;  5HWV A;  3CWF A;  2Y2J A;  3G31 A;  4JF6 A;  4LRY C;  5F5Y A;  4YWZ A;  2ZL1 B;  3MKF A;  5CHM A;  1PI5 A;  1S1Z A;  1GHP A;  1CEG A;  4KQD A;  5FSR A;  4R3A A;  4EBL A;  3P98 A;  3TJZ C;  2ZLY A;  2GJ3 A;  5E43 A;  4F3L B;  1RGZ A;  5DF7 A;  2Y55 A;  5E2F A;  4HNB A;  3IS2 B;  3ZCZ A;  3OZH A;  3C7U A;  4JGQ A;  4DN0 A;  4O0P A;  3UE1 A;  1RCJ A;  4YNR A;  3TE8 A;  4X6T A;  5IT5 A;  4II7 A;  2H5S A;  4ARZ B;  3ISG A;  3BFG A;  3GSG A;  3W4P A;  4DF6 A;  4JGR A;  2KOI A;  2X01 A;  4BL2 A;  1FCN A;  2ZBB A;  2BLS A;  1K4F A;  1BLS A;  3IT9 A;  4QHC A;  5K5B A;  2KLI A;  5L07 A;  2JKR I;  4LV3 A;  1XP4 A;  3T50 A;  4OKP A;  5FQQ A;  5EPH A;  2J7V A;  1Y4O A;  4UAA A;  1VM1 A;  2WAE A;  2Y59 A;  3BY9 A;  1UGU A;  4LLO B;  5EVI D;  3T1R A;  1N9N A;  3A3E A;  3F1O A;  1G6O A;  5CX7 A;  2PAV P;  4NK3 A;  3TSG A;  4PM6 A;  3DTI A;  1X0O A;  1MXO A;  1OJ5 A;  5FQI A;  2G7U A;  3EGD C;  3T12 B;  2ZQA A;  3VP2 A;  1W63 M;  1DJA A;  3SS4 A;  2EX2 A;  2WYX A;  4KZ8 A;  4R1G A;  2XGN A;  4BL3 A;  1SKF A;  4EWF A;  1K4E A;  4N92 A;  2G2W A;  5AQA A;  3MQQ A;  3V5M A;  3LIB A;  2EFU A;  5HWW A;  5F6A A;  4UEY A;  4P0M A;  2EX9 A;  3JVV A;  2VJW A;  2IWC A;  3P01 A;  1N4O A;  3L7H A;  3E4P A;  5AQ7 A;  2O9A A;  1BLP A;  2VGL S;  4GDB A;  3ZVT A;  1OTI A;  2P9V B;  3QP1 A;  1NXY A;  1WYB A;  5I94 A;  4KQO A;  5DKL A;  4YIN A;  1JTD A;  1VHM A;  3EQV A;  4JXS A;  2VV6 A;  5KZH A;  1TS0 A;  4C3Q A;  4ESP A;  4Y2F A;  2QHK A;  4WN5 A;  4WEK A;  1K55 A;  4BJP A;  3LIF A;  2WK0 A;  4N9L A;  4NXG A;  5TR7 A;  4GS9 A;  1H8Y A;  1FSW A;  4BMW A;  3IX4 A;  4G3W A;  2CC1 A;  3LIC A;  2V20 A;  1XA7 A;  2Z2M B;  3S22 A;  4E3I A;  2HP6 A;  2WKR A;  4M3K A;  4OLG A;  4ZAM A;  1K57 A;  5FQJ A;  3MZE A;  5A91 A;  2VA0 A;  3Q81 A;  3BQ8 A;  2Z6C A;  4KUO A;  3LR5 A;  4R23 A;  3H7W B;  5HWT A;  2B5R A;  4DXC A; 
#chains in the Genus database with same CATH homology
 4Y17 A;  4Y15 A;  2UV0 E;  4LFU A;  4NG2 A;  3IX3 A;  5L10 A;  3QP8 A;  3IX8 A;  2AVX A;  3QP4 A;  3QP6 A;  3IX4 A;  5L09 A;  1L3L A;  5L07 A;  4Y13 A;  4LGW A;  3QP5 A;  1H0M A;  3JPU A;  3QP2 A;  3SZT A;  2Q0O A;  3QP1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...