3QP3A

Crystal structure of titin domain m4, tetragonal form
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
101
structure length
101
Chain Sequence
GPFTLDHAPRITLRMRSHRVPCGQNTRFILNVQSKPTAEVKWYHNGVELQESSKIHYTNTSGVLTLEILDCHTDDSGTYRAVCTNYKGEASDYATLDVTGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Titin
publication title Crystal structure of titin domain M4, tetragonal form
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 24
structure length 101
sequence length 101
chains with identical sequence B, C
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2011-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07679 I-set Immunoglobulin I-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qp3A00
4JFFB 3TF7C 4S1DD 1C5DB 3R8BB 5B8CA 3BYYA 5FM8A 4YDIH 4WUKL 5KJRL 1UZ6F 3C6SB 4F15B 2YPLE 2EDWA 2YOCA 4Y4FC 3ARGC 1ACYL 3GKWH 3LN4B 4PD4J 3WLWC 2E9JA 2DD8H 1GYAA 3K4DA 3MJ8A 1NCUA 1S7XA 3LPWA 4JAMB 2GAZB 2EE3A 1TETH 3D39B 4WU7A 4EEEA 3PL6B 3EO0B 4Z7VB 2X89D 5LGHH 3RJDA 32C2A 5C6PB 3P3YA 3T2QA 1VERA 2YC1B 4JO4L 2HFTA 4W4OC 2HTKC 3X14A 1IM9A 3MFFA 2NTFB 1DBBL 1XCTB 2RR3A 1A6ZA 3VDBA 1OGTA 3QIBA 2VTFA 4XBPA 4M02A 3PABA 2LU4A 5I9QB 2R29H 1K5NB 3MUGA 2O5XL 5HGAB 3VFTB 2F74A 1A4JA 2P5WB 2F53B 4XP6H 3V2AR 2XWBB 3L5XH 3NZ8B 4GBXD 4JVUA 2MCG1 1I7UB 3I6KB 1IILE 4KKAD 1JYVA 4KROD 5HJ3B 3QUYD 5FUZL 5BS0A 3SQBA 4ENEC 2F9BT 4KK6D 5K59F 4BM7A 1G7LB 2BOBA 4XCCL 2DL2A 1CGVA 3EDFA 2EDKA 4NN5C 4QYOB 2Q7YA 5SX5H 3NIGF 4GAYA 1ZHBB 3QULA 4KV5E 3PGFL 5JTWA 4NZUH 1MLCA 2X4TA 2PO6A 5D2LA 3TZVC 1J12A 3SDXA 2HFFB 4HCRL 4Y2DB 3GSUA 1RVFH 4ODVL 1MFBH 4L3CB 5FOBB 3LQMA 2A0LD 4BK5A 5D1XA 5KSAB 2IGFL 3OAUH 5C08D 3CK0H 1HQ4B 3TV3L 2OTWB 3MRJA 4OZFB 4XBEH 1Z0MA 4P9HH 4HV8A 1ZA6A 1DDHB 2IPUK 4B0MM 1HKLL 4J7RA 1M7IB 2VDKL 1C7TA 3TT1L 1E0OB 3LH2L 3P4MB 4Z7WF 4LASL 4OGAD 2AJZB 3MRBA 5C0ND 3F58H 1INEL 2CD0A 5AUMB 1LK2A 2HN7B 3TIEB 1PD6A 4KDTC 1OTTC 1J0YA 4HX1A 5ESAB 2Q6WB 4S1SL 5D7KD 1TVHB 4PJHE 4O58L 1J05A 4XAWL 1JTTA 2LE9A 5CWSA 3RIAF 3HE6D 3WFBL 3CLEL 4F7MA 5LGKA 4HKZA 3ZKMD 5ADPH 4PJIA 1PLGL 3T0EC 4ZUTA 3E1F1 2VISB 1OAUH 3VFMB 4JHWH 2D4FA 3P9LB 2YD5A 3IB4A 5IM7A 1RMFL 1NFDA 5EIQA 4DZ8B 5KSBF 2H2PD 4QHNB 3SDYL 4PV8B 3VD3A 4JQIH 2AEPH 4JKPH 3FFDB 1P4LA 4K8RD 5ADOL 3JTSA 2NY3C 1OW0C 5BV7C 3BQUA 1RFDL 3CXDL 3M1BA 2QQLL 4M7LT 3VE0A 4X7SL 1XR8A 3MCG1 5IB4B 4MAYC 3TP4A 3TM6A 4ZD3L 5FV2A 2R0ZH 2PXYD 2QHLA 1QSZA 3DVNA 4ELMB 3OG6B 5K9OA 5KAQG 1MJUH 4MWFB 5KSUB 4BZ2H 5DQ9A 4K7PX 3X3FH 2Y06H 3SDAB 4IRZL 4FQLH 1QFHA 4RWYH 5LAXB 1MJ8L 3LDBB 1UH2A 1P7KA 2ITDA 4PJHB 2WUBL 4NOBA 3DO7B 3SE9H 3LS5H 1CXIA 4KJWC 1MHCB 3MLPA 5ENWA 1ED3A 2EO9A 3RWDB 3QXDB 1XR9A 5L2KA 1FZOB 4R4FL 5J3HD 4YDLC 5TPWL 4ODXA 5T3XD 5MEND 3PWLA 2I9LB 5CGYC 4P4KB 5FDWA 3U30B 4KZEH 4NDMB 3S3SA 2FO1A 5I18L 2OP4H 3JTTB 1FIGH 1RZ8B 5I0DA 2VL5B 2AEIT 1AI1L 4MA3A 4PJ7A 1J0JA 1CFVH 2D7NA 1Y6KR 3HMWH 5FM5O 1MQKL 4OF8A 3GSOB 4I3RL 3U82B 3FO1A 4IHOB 4XVTH 5F89B 2X05A 1TVBB 3RU8L 5JIIA 4P2YA 3RVUD 1FYTE 5I1IH 1NMAH 4QTHA 2WP3O 1ZT4B 3DUUB 4Q9RH 35C8H 4G8FB 4DOHB 4XPFL 4GRLA 4PJBA 3HZVA 1ADQH 2V6HA 1XZ0A 4HQQH 3RTQA 3U36A 3GI9L 1GSMA 5EFIA 4X6FB 1NGWA 4E42A 1ZTXH 3HUJE 3UBXI 1CBVL 5EBMB 4XC3H 1QACA 3L1OL 3WXVL 1JUFA 4Y88A 1CLZL 2X4NA 1IGFH 2B1AH 3C6LA 3KPRA 3TYGH 3LKOA 4NRXA 5C6WH 3EKCA 2NZ9C 1J10A 3O6LH 1TZGL 4MA8L 1UXWB 4P5KA 4XP1L 3W9EA 4HK3J 2K9UA 3ARDA 4G8GA 4WI7A 5FKAA 5E8OB 1T0MA 5HBBA 2AAVA 1DVFA 2QQKH 12E8H 3BMVA 3HC0A 2IPKA 5AAMA 1MEXL 3BGFB 2Y07H 3H3KA 2R2BA 2A6IA 3ZDYE 1MRFL 2EXWC 3JUYA 2XACC 4E9LA 4WRLA 3DX7A 1T20A 1TTUA 3VXPA 1MCEA 3CZJA 1MVUB 4U3CA 3RWGA 3R06B 2GY7B 2OL3A 1Z3GL 3VXQA 3TCLA 4EBQL 2NW3B 2P49B 3QEGH 4ZAKB 3UYRL 1ZANH 2CK0H 1MF2H 1D6EB 3QXTA 2VLRA 4LCIH 3LB6D 3QQ9D 3PV6B 1KJVB 4HIEA 1ORSB 5IHZB 5AZEH 2XOTA 1L9MA 3NCYP 4P4RB 3DX6B 4HFWB 1LQSR 3O3AB 5DEGA 3HKFA 3K0WA 1TJIL 2AJSL 4MQXD 3K3QA 43C9A 2CIIB 4EN3C 3VD4A 3VG0L 2O5ZL 4ETQA 1UKSA 3DO3A 2CGRL 2QADB 2YD9A 3ZHKA 4NUJA 2GKIA 5TJWK 5J6GB 4BFGA 1A7QH 5EU5B 4OGXH 1OGAB 5SWSD 5IW3A 3PGDB 2V2XA 3JWOL 1U36A 3GJFA 3BRDA 3DVGA 1R0AH 1H0DB 1VGEL 1EJ6A 5GISL 2L7UA 2E7BA 4G7VL 4NC1E 3BZDA 3L6FB 1LDPH 3UCRA 1IZKA 2R29L 5GS1C 5CGTA 1Y0LA 4NC0B 4ODUB 1XGQA 3EFFB 4MAUL 1NSNL 4Z0XA 3GB7A 5HYJA 1DLHB 1S8DB 2OTPA 4DKDC 1KCUH 1H8NA 1U2CA 5GRJH 4P3DA 4YO0B 1FVEA 3LZFL 4JPIB 4YWGH 4F7CB 2GITB 5E08H 5CCKL 2VOTA 2OS7A 4LSSH 5F1IB 5JHLH 3QQ4A 5ALCL 2Q86A 4BA8A 5IMKB 1DSFH 3SCMC 4XTRD 5E4IA 1U8NA 1I1AD 4NN5B 3GMPB 1HZHH 4QHLB 5HDBF 1WBYB 3H7BA 4K3GA 2CIKA 5ICXB 4WWKD 5IJVA 1P4BH 2YSSB 4U6VL 4YEFA 3UP1A 1IQWL 1DANU 1YY8B 5C0JB 4EUPB 1X5JA 1CU4H 1DUZA 2KQMA 4UIMA 5MEPB 1X9QA 3UTSA 1KN4L 4C57C 2A6DB 4P49A 4UNUA 4MJIB 4X5XA 3VGAC 3GMMB 5JW5A 3CK0L 4WUUE 3X3GL 1O5DT 3CXHJ 2P43B 4RGNB 3O6FA 1MWAA 5IVZA 1CZ8L 4RFNC 3T0AA 3U48A 1LEKA 3QA3A 2YXMA 4UB0H 4N8CL 1D3CA 3B3IA 3I84A 1AGEA 4ZFOL 3O3UN 1KC5H 3FO9A 3HZMB 4PLJD 5FO8A 2DQFA 4WNQA 3BFOA 1GGCH 1G9MC 3IFNL 2BDNH 1JF6A 3QJHA 3WD5L 2VC2H 4RMTA 1CE1H 3JWDL 5D5MF 2R1WA 1G7JA 1O7SA 3WEXA 1NBZA 3C60C 5JHDB 3ZE1F 3C2AL 4MJ4A 3DRQB 4Y8DC 3SJVA 4O5LL 4Z7UE 3VCLB 1ZKAA 4AH2A 1PZUB 1AY1L 4XP4L 4AMKL 5DD0L 4P5MA 4G9FD 3T0EB 4MQ7B 3FFCD 2QQNL 4MS8C 3CDGA 3HR5A 4Q74A 1TZIA 5DUBB 3V0WL 4NM4H 2ED8A 2OJZL 1MFEL 1BJ8A 2DJUA 2R69H 4QRRD 1H5BC 4PJCE 1SY6A 1UKTA 4P2RD 3THMH 1OY3B 5D2NB 4AL8H 1H3PH 4H20H 43CAA 1T89A 3HMXL 1HDMB 1T83A 1KV3A 3EYSH 4PRPE 3L3OA 5DJZA 2AXGA 1VEPA 3FN3A 1BD2A 5F9DC 5FKPA 3ARBD 5D70H 1AP2B 2HP4A 1TJGL 4UZGA 2VR5A 1C16A 3FZUC 1FVCA 4L3AA 3HB3D 2X1OA 5FCSH 1F2XK 1R3HA 4LLQA 5I6XB 3VWJA 2MFNA 3DRTB 4YGVB 2G75B 2K7QA 4JO1H 4RFOH 5IBTH 5SWZB 3QFDB 1VKXA 5ESQB 4P2OB 8FABA 1FFPA 1T2JA 1VACA 4UDTA 3SE4C 3HZYB 1WUNT 3Q6FB 5CSBA 2CRYA 4HAGA 2YWYA 1HN1A 1YMHA 1MHPH 5ANME 4U7KA 2FJGB 4FNLH 3O6MH 3T4YB 4GW5A 4WDIB 1I9RH 1QBMH 5ISZE 3D85D 3MLSL 2FSEB 2DI7A 4OD2A 3GBNH 1CK0H 4YDLB 5MERB 1S9VB 4HXBL 5T1KB 2M1KA 3VXMB 2GHWB 4NHCH 4EIGB 3OJDA 3P4OA 1IT9H 1D6VL 3DXAB 5FYJL 1HHHA 4JFQA 3TH3T 1NC2D 3TO4A 1HHGB 1F3RB 1X5KA 5HYEA 2D7OA 4YX2H 2XICA 3QRFM 1BHGA 2BMKB 1RZJC 4XI5C 3ARED 3HNVH 3ROLB 2W0FA 3MRNA 2Z91B 1P7QB 4MCZB 4Y5XC 2YD4A 1DUYA 2OM5A 4BFIA 3LPFA 2NNAB 4TPRL 5IQ9A 1UB6B 1U8PA 4C56A 3WN5A 2H8PB 4XNZC 2X41A 4HIHA 3I3DA 3DIFB 3QQNA 1BM3L 2HVJB 4K9EC 4HQQL 5C0EB 5MHSE 2R0WH 3O2WH 3WFEL 1TQBC 5D2LF 3I02A 4NQCD 1ROWA 5KTEH 5DRZA 4GS7C 5IVXF 3DMMD 2DLEA 2OJEA 1R5IA 2EO1A 4O51A 1PKQE 2AJXH 5EORH 5IEHB 3ZO0A 1UXSB 3MRRA 3QDJA 4ZUUB 3RNKB 4NQVB 2ESVD 2EECA 5E94A 4CVZA 4JPWH 5DK0A 2ATKA 4M48L 4RNRB 3DX8B 5H94A 1BREA 3ZDZE 3FONA 5BRZA 4WCYL 4LARH 3DV4B 5EO0B 2MCPL 2R23A 3BP5B 1FGNL 1J87A 3PQYE 1YPZA 3RY6A 4WGWB 2YUXA 4N0UA 1X5YA 2NY4C 3MV11 4U1MB 2BNQD 4KQ3H 4G9DB 3VH8A 1UM6H 3MCKB 3OKLA 1CTOA 5C0CA 3QI9B 3MBEC 5CJBA 3WJJC 4CN1A 4XP5H 3ZKND 5CFHA 4PLKD 3FOLB 5F3BB 1JHKH 5JORA 4GKSB 4GMTL 3TBVB 4J2XA 3BD3A 5J11B 1GGTA 1OAXH 3VXNA 2APWA 1NDMB 5C9JA 4JFYB 5IQ7L 5I1JH 3MNVA 1ZSDB 2V2WA 3HI1B 4PY8I 3WUWG 4X8JA 1K4DA 2BVOB 5E95B 2I5YL 4ONGH 2VAJA 1F3JA 1PKQB 2GTZB 5HHMB 4P3CL 2BOCA 4R2GC 4Q9QL 1CL7H 5T3ZL 3N85H 3KYNB 3O4OC 1PX3A 1CF8H 1D5MA 2DWDB 5I74C 4QXGH 4U1LB 5B39B 1NBVL 2C3GA 3LY6A 2UZIH 3I2CH 4PJAE 2WBKA 4RRPG 4EN3B 2GCYB 3RZWA 1Q9LB 4HW6A 5J89A 5FYLL 1SJEB 1OM3H 5F88A 4HJJL 2DQHL 4MNHB 4TUOB 2V17L 3E3QE 5DURD 1AQDB 5FYLD 1S7TB 2DN7A 1CFQA 4OCYL 1JN6B 5GGQH 4FQQB 4I77L 4HHAB 2C4XA 4G6ML 2OQJB 5E5UB 5JA8B 3X12B 1JPFA 3CU7A 3OHXA 1NDGA 3U79A 4LSTL 4U3HA 5JQ6L 4CW1A 4D8PB 4AK1A 2EDOA 3HS0B 3ETBF 5D4QA 4JM2B 3S4SA 3QUZA 5GS1B 3MLVH 4JVPA 3LV3A 5F21B 5GXBB 2FEEL 3BUTA 3RZCA 4HH8A 1G7MB 5ESVB 3BOVA 5JMOC 5E08L 1NC4A 3QDMA 4ZXBD 3CSPA 5JNYB 3WSQL 2FGWL 3U6RB 1NAKH 4LSRL 1U8LB 1UWGH 2FX8L 2R1YA 5JPNB 1AO7D 4D0BA 3QDGD 1N2RB 2B39A 5CJQL 5FUCE 1BP3B 2EIZA 3ALXA 2D0GA 2KPNA 2UWEB 1NCBH 5DLMH 2OTUB 4NCDA 1G7HB 4PJ7F 4PG2A 3WIFB 4P9HC 3QT2A 1QFPA 3QCVH 3MFGB 1N6QH 3ARXA 3GSNH 1E27A 1CR9H 2YUWA 3L3KB 1CU4L 1MCBA 1ZVHA 4OLUL 2CLZA 2ENYA 4DZBA 3VXUD 1BOGA 2NYYC 4I18C 3O0RH 3ILPB 3UC0L 1RZIA 2WNGA 4OLXL 4ZFZA 2D7TL 4QT5B 4OI7A 4FS0A 3UTZA 2IALA 3TNMA 5BJTA 5IHUH 3OKEB 1YNKH 4JQVA 2OMNA 3G5VB 3S9DB 3GSRA 4OJFL 1T5WA 1IL1A 2BXYA 5D7JD 5E2VL 4AT6A 3AMKA 1JGDB 2W0KA 1NKRA 3MXWH 3ZT5A 1LEGB 5KSVB 1JHTA 2JIXD 2DDQH 4I9WD 4U0RB 2ZKHH 2DQEL 4ONHB 3VD7A 5FA3A 1TJHL 3KGRA 4HUKB 5KW9H 2NW2A 1I8KB 2A1WH 4YIQB 4X80L 2A6JB 4JZOB 2B0SL 4NRZB 3OPZL 2XZCL 4FG6C 5IHLB 3L7FA 4PRHB 4XZUB 5KANI 2IBZY 4IRSC 4MXVF 3DGGA 3TWCL 2GJZA 2P8PA 5TE7H 3TA3D 4NPYA 1KEGH 2FLRT 3LSOA 3MLZL 4HS8H 3KXFD 2W1NA 2W65B 1BZ7B 3QFJD 1SBSL 5JUEH 3REVB 4RGOL 4GKNA 1ONQA 3FRPG 2GK0A 2C4FU 2CDEA 2PYFA 4NZTL 3VXSA 4ZOAA 2XWJB 2P48B 4Y4FD 3ARGD 5FO9B 2IFFL 3WLWD 2EYSB 5F1OB 1RU9H 2VKXA 2FD6L 5KVGL 1NLDL 1BWWA 2E6JA 2NX5A 1YY9D 4JANB 3RX5A 4U1NB 4FA8A 2C1PB 4S11A 1OB1A 2FR4A 2XWTA 3PXJA 2HG5B 2R8SL 1RQ5A 1YEKL 1AIFA 1Z9LA 4IS6B 4ZS7L 3WDJA 1E4KC 1CICB 1RIUL 1SVZA 3H9SE 2HKFL 1FZKB 4LCCB 4N90D 1QHPA 5I75C 5E8EB 4D9LH 4X7TA 5AWNH 5FECB 5GGSA 4G8EA 3GMOA 4FQCH 2VDQL 1U3JA 3BGMA 5EWIL 4JY4B 2ADIB 1GZPB 1XGYH 1S7WB 5T1MA 1EFXB 5HDLA 5JW4N 3S36L 5JW4Q 1M71B 1BX2A 3ZE0E 2DF3A 3LQZB 5L0QC 3KJ6H 4P46D 5F8QC 3F7YB 3TZVD 3GIZL 3QXWA 4RMRA 2ZCHH 4H0IA 2YA0A 3Q3GB 5L8LB 5C6TH 2DBLL 2FLBT 4Y5XB 4LVNB 4X4ME 2QHRH 5I15H 5FFLA 1F4YL 3MLXH 5GJSH 3P30H 4OCRL 5C09B 3G6DH 3WHE1 5SWQA 1N5AB 1TQBB 4WO4D 1KELL 1BLNA 5EOCL 1M4KA 2AJXL 2BNRD 4FXKA 4IMLA 5FIEA 2BCKA 2CPCA 1EVUA 2GIYA 4BQBA 4PTTB 1OLZA 4CNIA 1CDHA 2Z92A 1FL5B 4Y5YB 4JPWL 4Z7WB 3W0WD 1ZGLP 3CMOL 4ELKA 1TXKA 4KKCC 1OTTD 5EN2B 5IB5A 3QG7L 4NM8H 4S0SD 4ZUWB 1H3VA 4XMKL 2H32H 1MI5B 2NY4B 3BSZL 2E9BA 1GZQA 3RIFK 2EYRA 4WFHE 1GXEA 4M00A 2XFXB 4R0LA 1YQ2A 5IROC 4N0FA 3CSYB 2AABH 2ZPKL 1MFAH 3MCLH 4XPTL 3F6LA 2PR4H 3MV8D 1P84J 5CEZL 5JDJA 3GIVB 1A1OA 2F8OA 4WTXA 5C0RL 1Q0XH 3ARPA 4M6OH 3SOBL 1MCWW 2DLIA 5CEZD 2XV6B 4G80A 5DMJB 4PREB 1EMTH 1V05A 2Q76A 5MI0C 5EULV 1KJMA 3TEUA 4N1EA 2NY3D 1IRAY 3Q0HA 4MSWB 2W0PA 3P73B 4N8VA 3SGEH 1IARB 1AGCB 3NIDF 2EC8A 4MAYD 5HVHC 1ZLSH 3RDTA 3SDDA 5IR1A 1UWEL 4LAQL 4RQQB 2RCSL 2G5RA 5FYKD 1YMME 4R2GB 3OXRA 3NA4A 4X99B 5EBLB 1IGTA 2FJHA 4OIBA 1RZKL 2F5AH 2G60H 3TN0C 3BJ91 4WV1A 5IFHL 5CIPA 4ALAL 1T66D 3UMTA 4WHTB 2DWEA 3JWNC 1C7SA 4GAFB 4HLJA 1NEUA 4YZFE 3S36X 2W9DH 1Q1JH 4UQ3A 4P5TA 5DQDL 2H3NB 4BSVA 3N0PB 2QQQA 3K4AA 1KJ3H 3MR9A 4RCAA 4XCFL 5KZCD 4POZD 4GMSL 4KJWD 2IFGA 1QEWA 3QNXA 1F3DH 5HPOA 3IDJB 4QF1A 4UNTA 3BUYA 3GK8H 3RL1A 2XZAL 2XA8H 4X6EB 2BP3A 1WBXB 3MRLA 3SKNB 1BFOA 4NO2B 3V0VA 5KS9A 2F58H 1JPST 5CGYD 3VFSB 1HKFA 1YEJL 5KVEH 2AV1B 4D94A 4LPTA 4F57L 5GGUB 4L8SC 3MROA 1PVHA 2FL5B 2X89A 3CFJB 3O41A 5DMIL 4P23C 4U1GC 4J3OC 5E99H 4R96B 5E7BA 1GVIA 1M7XA 4Z76B 1UWGL 1IEHA 4K2UH 3IJYB 1KTDA 3SKMB 5M7QA 1BQLL 4LKXA 5IF0B 4P2QD 3CPLA 2KZWA 3GSXB 4Y16D 5FHAH 1ZHLB 4JG1H 3EOBB 1KIRB 4NN7C 4U7MA 3PP4L 2YPVH 3EGSA 4K7FB 2D4DA 4MXWL 5JA9A 4P9ML 4DW2L 4CRPA 4WI8A 1FNAA 3R4DA 4XCNA 4MJ6B 5JDSA 2R0KH 2EIEA 2E8YA 2DQDL 3BAEL 4OFVA 5D8JH 1DBAH 3FN0L 3O0RL 3K8LA 3IXTA 4I18B 1CD9B 1OARH 4PS4L 5ALBH 3KJ4C 3ZKSD 3GMRA 2OXHA 5IVOA 3EYVB 5C0BB 3CCHB 4QRTA 3G08A 5CEYB 5BCAA 3AVEA 2NZ9D 4ZUSB 5E6IB 1JNJA 3BVNA 1WZ1H 1KGCD 5DMKB 1TDQA 4J6RH 4XAKE 4HCRA 4RMSA 4CMMB 3VRJA 1FN4A 1GOHA 4UT6L 5C08A 2YZ1A 1J1PL 1WAAF 4LPUA 1HNFA 2CO6B 4JFED 1JP5A 4K55A 3OTTA 5E5RB 3RL2A 2EXWD 4UILL 1FAIL 4JVWA 4OF3A 4F33B 2WBJB 2WWMC 3OF6D 2M2DA 1YPZF 2BY3A 5EOQH 3ZKXC 5GIRA 4IRSB 4DN4H 1I8IA 1QYGH 2AGJH 5GZOD 3IF1B 1FP5A 1GCFA 3QXVA 1BF8A 2OI9C 1JCKA 1UB5A 3E6HA 1T2QH 3GMNA 4M7KH 4FTVD 1NQBA 2WINB 2HLAB 1G6VK 3V5HA 2GK2A 1K8IB 3V0AC 5J7CC 1Y6NR 4J3UA 2FCBA 4NJAH 1BGXH 5D71H 3C5ZC 3VU2A 5IOPB 5DTFB 1QFWM 4L9LA 5ITFA 1G7IB 4MD5B 1N5YH 5F1NA 1MCNA 2VXUL 4M8QB 4LPYA 4OV6F 3V5KB 5LXGH 3LD8C 4LSUL 4KKLC 5I1CH 2FJFA 3BRGC 1XH3A 2VLLA 3FQTB 1RZ7L 4G6AC 4PPTA 3E2HC 5IKCA 5C07E 4H5SA 2B20A 4EDWH 4FFVC 4F7EA 3VWKC 4AEIL 2VH5H 1L7IH 2VUOA 3NCYS 3BIKB 3I50H 4JM4L 2OZ4L 1NEZG 3QNZA 2APXA 1A3RH 1F90L 3MUHL 2X4OB 4PIRF 4TUKH 1RUPL 4JRYB 4M7ZB 5T1DH 5BZDB 1H3GA 3P4NB 1SJHB 1JF5A 4J23A 4D9LL 4NQED 4JHZA 4KK9C 1WK0A 5I8KH 4K3JL 4DUWA 1MFDL 4QHUA 5JIHA 2APVA 4R97C 4LLDA 1MFNA 3C09C 1FNSL 4FXGB 2HJLB 4NHUA 1NMBH 4KMTL 1V5JA 1IAIH 2AV7B 3I6GB 1RHHB 3RWJA 4RGMC 3SCMD 4XNQA 3H9HB 4JJ5B 5EUOF 2A6KA 2AS5M 3UBXB 4HH9A 4OZGE 5T5FH 3JUZA 5MENA 1WVZA 3MA9H 5FO7B 4ISVA 4FFYH 3IDGA 4WY7H 5EIVA 4XNMA 4BQCA 1MIEH 2Y4SA 3SGDH 3QUMH 5AYUL 4YDKH 2D7MA 1S9WB 4QWWC 1CLOH 1KTKE 1S7RA 2DQGH 5EUKB 2XY1A 5C0AE 1XF2A 1N59B 5ICZA 5DVOA 3ULSB 1NGXA 5F9OH 1QRNE 4Y0GA 4QRPA 1WT5A 1ZK9A 5E5MB 4AIZB 1G9ML 1MJJA 1QFUL 5DC0A 4U1IA 4ZSOB 4XB7A 3WIHH 2H9GA 1KN2L 4N9GA 5DDHA 3UJJL 3KPLB 2BK8A 4S2SA 4NSKA 5F6HJ 2R56L 3PWNA 4NO5A 4X6BB 1OP5K 3EDDA 4N0YH 5DUPL 3C60D 1X5LA 4FQHB 3AU1A 3DSFH 1OLLA 1A7NH 1PG7L 4Y19E 2CLVB 3FQWA 1JWSA 1NCWL 1JBJA 3OMZA 3I3EA 2XG4A 3DROB 3RGVC 1QUNA 4OT1H 1YN7B 3Q1SL 2JCCA 4MS8D 3IVKB 1T21A 1K8DA 4GG8A 4OQ1A 3CU1A 5DEFA 4XPHL 2R39A 4AM0B 2C3VA 2NZIA 2NQCA 3O3BA 3UO1L 1ZGLB 5E2WH 5IB1A 1B6UA 1F11A 1UKQA 4OUOA 4CL7A 2NY6B 4PJ5A 4YHPB 5IV2B 5D6CB 2A73A 1AD9A 3FRUA 5FUOL 3WNMA 2HT2C 1QRNB 4GW4A 1PEWA 3L95B 3PIQB 2ZSVB 1CFSA 1G9NH 4MNGA 5HVHB 4JFDB 4ZUVB 1C5BL 2DIJA 3UROR 3MRIA 5JW4R 4MDJA 5CZVH 2PCPB 4OCWH 3GI8H 3RWCB 3DV6B 2CKNA 4M1GL 5T33L 3TN0B 5BS0E 2E9WA 3B9KD 2WZPD 5HGHB 4Y4KD 5H37H 2HJKA 4KK8C 2G9HA 3FOMA 1RZFH 2L7JA 2YD1A 4LVHC 1HSBA 1IAOA 4PY7B 5C8JA 4WVRA 1OTSC 3W2DH 1S7XB 5GS0L 3SDXE 1KLGA 5C86A 1I9IH 1TFHA 3MO1B 4WU7B 3MRQA 3HAEG 2GW5A 32C2B 1IFHL 1AGBB 3S37L 2ADGA 3O9WC 5T1LA 3LRSA 4OI8A 4QTIH 3WFHA 1IM9B 1FIEA 3GUTB 1I8MA 4X4YA 1A6ZB 4XPAH 2SEBB 4FQ2H 1A1MB 1OGTB 4XBPB 1MUJA 1RZJL 3PABB 4K94L 2MQ3A 5F9WB 3MUGB 4GRWE 4XI5D 5CJXC 3V8OA 3QHFH 4E0RB 1A4JB 2OK0H 4XX1G 4KPHH 4U3XA 4LCYA 2ILLA 3REWA 4ORGB 4WHYH 5BS0B 5I1EL 4K9EL 3MACH 4UTAL 5L9DL 4BZYA 2BOBB 2OBGA 2OYPA 1PKOA 4GFTB 4Z95L 2PYEB 2H2SD 4PJIE 4HPOH 3CVHA 5IB3A 4GAYB 4OQTA 2FX7H 3P0YH 3BDYL 3BH8A 4B50A 2X4UB 4YHLL 5D2LB 2H41A 2P7TB 3R1GL 1IGIH 3WUWA 5IVXB 3MLTA 1CGWA 2BSTB 1EO8H 5DHYA 1NFDE 5D1XB 4DK6A 4WWKA 3KLHC 4FMKA 3MRJB 4MDIB 4KKBC 4HAFA 4KRPC 1VPOH 2VDOL 5EO9A 1E6OH 1K9TA 3TGXA 2GSIA 5A2FA 2FB4L 2AJVL 3LKQA 2YUVA 5E56A 5HHQA 4F37K 3U7WL 3JV6B 3DTXA 3MRBB 3MBED 3QG6A 3B2VH 4Q6YA 5DD6A 3ARFC 2PW1B 4DKFH 5KAQF 1F6FB 1FC1A 1I3RB 1Q0YH 1MAML 2CR3A 4UT7H 1AXSA 1SYSB 3S5LG 4ZFOA 3ZKXB 1CI5A 3U4BL 3NCJH 4LU5H 4M3JA 4LRNH 4MMZC 5HVFB 1PGRB 4HKZB 2HFEA 4K07A 3KS0H 1OD7A 4F9LA 2WIIA 4OLWH 5DFTA 4ZUTB 3MTRA 3P2TA 2YRZA 1Q94A 4UINL 2RB8A 3T2NH 3BT2L 4G9FA 4MNQD 5E2UL 4G8IA 1HE7A 1A7RL 5A40E 5D1QD 3MLWL 2W60A 3QEHA 4XHQA 1JNHB 1K6QH 3JTSB 4QRRA 3E2HB 4L1DA 4EDWL 4P2RA 3BQUB 1CDUA 3CFCL 3VE0B 3H6JA 4P2CG 2JELH 1XR8B 3VWKB 3JXAA 1MCSA 1HILB 3DVNB 4DVRH 5K9OB 3EJJX 5DQ9B 3U0PA 3LN4A 4N5EC 4HD9A 1UM4L 3ARBA 1EK3A 3OB0K 4JAMA 4POUB 1E4WL 1P7KB 4S0TD 5MEQA 4PJBE 4G6FB 1J1XL 1YECL 4XC1L 4Z7VA 4KUCD 5CEXA 3WS6C 3TT3H 3NIFF 5DZLA 2WSKA 2YC1A 3HI6L 1ED3B 5E4EC 4I2XA 2QSTA 3TBTA 1PSKL 3K1DA 1RUQL 1XR9B 1WITA 5L2KB 3KPRE 4P99A 4ODXB 4RGMB 3PWLB 1K5NA 1TITA 1MQ8A 5FDWB 3QUXC 3NAAH 3VFTA 3T3MF 5D7SH 3D85A 5HYSA 2F53A 5HHPA 2XWBA 1XGPA 3I6KA 4MA3B 4PJ7B 5HJ3A 2X4RB 1CDBA 1FZMB 3EBAA 4PJ8C 1G0YR 2YBRA 1X5AA 4HC1L 4NUGH 1I3UA 2MOVA 2NYYD 3FO1B 2CRMA 3BIBX 4KJYB 2C3WA 2NY1B 4QYOA 2DKUA 4M4PA 3PDGA 4HBCL 5A2JH 5FUCC 1EEYA 1ZHBA 4ZTPL 1NH6A 4PJEA 4QTHB 3MNWA 4OBSA 1BOYA 2B5IB 3VI3E 1NFIA 3AREA 2ATPA 3TBSA 4TUJB 3Q2CA 2HFFA 2P24A 1JTPA 4GRLB 2EEBA 3HZVB 1GHFL 5FOBA 1XZ0B 3PHSA 4G42A 3RTQB 3U36B 4FQXC 2VLRE 1U3YA 3UDWA 1HQ4A 2ZNXA 1IGML 4WEMB 4WHCA 5BW7C 4GRWH 4ZMAT 3GBLA 1FFOB 4KFZC 4OZFA 4LK4A 5SX4I 3VI4E 1XGRA 1AQKH 1M7IA 3C8HA 3SN6N 4EXKA 2X4NB 3C6LB 4JY6B 5DJAA 2APBA 1A6UH 2P8LA 3LKOB 1H3TA 4U49A 3AFLA 2QSVA 4FG6D 2AJZA 3W9EB 4P5KB 1NGZB 3RGVB 4G8GB 5FB8A 5E1AB 4DGIL 3D18B 3IXAA 4KZDL 2Y5TA 1T0MB 3DYOA 2Q6WA 1DVFB 1GGBH 4PGJA 3HC0B 1B88A 1TVHA 1GIGH 3QB7C 4ZDHA 3O6KH 1IE5A 5DD1L 1T1XA 2D7QA 1NGPL 1D5BB 3DX7B 3S34H 1EEUA 2BNQA 1EEQA 3IJHA 1WWWX 2H26B 2OL3B 2FRGP 2M8XA 3RPKA 2OR9H 1B0WA 1LO2H 2WV3A 5HYJE 3EYFA 1Q72H 1QQDA 4LVOC 1YNLL 3IDXH 2VLRB 5JO5A 4O4YL 5D1ZC 3FFDA 1XGTA 2APTA 4ZNEE 4FFZL 2VLKD 1NUDA 4NKQB 4LL9A 5DEGB 4F9PC 3GBML 4YXKL 43C9B 1S5IH 3BO8B 2YKLL 2YPLD 3D2UD 3W2DL 5TE4L 5KSUA 4ETQB 2HTLC 4FHBD 3SDAA 5GGRB 3HNTH 2H1PH 5I19H 3UTSE 3UYOD 1JFQH 4TSCH 2V2XB 2QSCL 3GJFB 2Z31C 3O9WB 4WEUD 4J3XA 4KQ4L 3CX5K 1CXEA 2X7LB 1NCNA 1YJDL 2XKNB 4JG0H 4Z8FH 5I71B 1UVQA 4NOFA 1U8HB 5IP4A 1SEQL 1CGYA 4Q6IC 2R4SL 1U92A 4RX4D 4NGHH 3QXDA 1Y0LB 2F54B 3SE3A 4Z0XB 1KOAA 1AHWA 3GB7B 3BKYH 1K3IA 1N4XL 3X17A 2I9LA 5ILTH 2LAGB 4A6YH 1FVEB 4Y8AA 4NDMA 1LP9A 2LTQB 5CZKA 5BOPA 3LKRB 3RBGA 5JLZA 4YDVA 2Q86B 4X6DF 3SJVE 4CVXB 1DLFH 3HI5L 4NWTL 3ZT7A 3W5MA 4ZXBA 2YA1A 3FKUS 4AEFA 1KACB 4IHOA 1QBBA 3B5HA 4LIQE 5F89A 5E9DB 1LO3H 3DETD 1LO4L 1AFVH 2JK5B 4NT6A 5ABDE 5IJVB 1T7XA 3CFIC 1KIPA 3DUUA 4G8FA 1DUZB 4UIMB 3G5XA 4BQ6A 3S96B 3QIWC 4X5XB 4KKCD 1CN4A 1DQLH 1C08A 3O6FB 4NBZB 3KYOA 1P6FA 4KRPB 2CQVA 1FG2B 4IMKC 3RX7A 4JO2L 2IPTL 3IFLH 1LEKB 1MCCA 4FMFA 3VXUA 4MA1C 3KG5A 5IFAL 4H0GA 4I48A 3B3IB 3V4PL 2DLGA 1AGEB 4IDJL 3M8OH 5FO8B 3FO9B 3KPMA 5KVDH 2DQFB 3WKMH 2VXQH 5AYQA 1J5OH 1CDCA 3OX8A 2E27H 1RJYA 5IESH 2NY2C 3QJHB 5H2BB 5CSGA 4KHXL 2R1WB 1G7JB 2JB5H 3WMSA 3VMPA 1AXIB 1NBZB 5D7JA 2WLYA 1GL4B 3GMLB 2FECL 2J4WL 3SJVB 3VD5A 5B4MC 2ZUQB 4PJDF 2VL4A 4OZIF 3A0OA 4Z6AT 2JCCF 3RHWK 3QWOB 3ZT6A 1EHAA 4PJFA 4ZTOH 5ICYB 5DC4B 4GAGH 3DVIA 3CDGB 3KYAA 1MVUA 3FQXB 3EHBC 3HR5B 1DFBH 1A4KA 3RVXC 3R06A 5D7IE 4FQIH 4RAUB 3RI5K 4X7FC 1XFPA 4ZAKA 3G6JE 3S7GA 1FV1A 4Z7OF 2CKBA 43CAB 1A14H 1D6EA 2AK1H 1FG9C 1PQZA 3TA3A 4TNWF 1H8SA 4YXHL 3L3OB 3KXFA 5DD5H 5DJZB 5DK2A 3HE7D 2AXGB 5IHZA 2HLFC 1YEHL 1I85C 1BD2B 5FKPB 4GXVL 1KNOA 4NZDA 4P4RA 4L4VB 5GGVY 2VE6A 3PWJB 4DVRL 4HFWA 1C16B 3O3AA 5IMOA 1FVCB 3TJEL 4LHJB 3KHQA 3NABL 4Y4FA 3ARGA 2CIIA 3GJFH 4Q7DA 4C56E 4WW1B 5E8DH 4TOYH 1OP9A 3H3PL 3VA6A 3WLBA 1VKXB 4XMPL 3BP7A 2JJSC 1A7PL 8FABB 1OSPL 1VACB 4JFPA 4UDTB 2DM4A 1OGAA 4QLRA 5F6IB 4P23D 1MHEB 3LHPH 3OKKA 5F3HA 4W4OA 3OR7A 4U2YA 1E28A 5D7LD 1H0DA 3HPLB 4GW5B 1KENL 3QDJE 5E4EB 2VIRA 2R15A 3L6FA 4NNYA 4OD2B 1LWRA 2JKXA 4XBGA 1MELA 3NA9L 3QUXB 3PWVA 5BRZE 1DLHA 3LVEA 3UJTL 1SM3H 4JGJA 2EIBA 4JPIA 3P4OB 5DT1L 4NKDB 4JFQB 4N0UE 3H9ZA 3M17A 3TO4B 5F1IA 4PJ8B 5IBUB 1T03L 5C0CE 4LPVA 4ZFFA 2CMRL 2W0FB 3MRNB 3HG1B 1F02I 1S3KH 4UIKL 1VEOA 3VRIB 4HFUH 3F7QA 2E7LC 1WBYA 5IQ9B 1FYTD 2R4RH 2X4SA 4C56B 3WN5B 5ICXA 1MWAH 3MC0A 3TZVA 1YY8A 2ICEB 5MEPA 1CLYH 1KT2A 4B7LA 4M6ML 4MJIA 4LPCA 3UPCA 4FFWC 3VFGH 2OJEB 5CBEB 3TVMC 4O51B 3UPAA 4NNPH 3MV9D 3R0MA 3MRRB 3QDJB 4RZCA 4EVNB 3IKCA 2NPLX 3JV4A 5E94B 2Z8WC 5CINH 4CVZB 5DK0B 2WWMD 3KHOA 3NCCB 2NXYB 1I8LC 3KPSB 3FONB 3KR3H 5BRZB 4P57A 3BKMH 4GRMB 4NRYA 2R23B 4PRIE 1Q9OA 1YPZB 4KDTA 4LIQH 4Y2OA 5JHDA 1RAMA 4BKLA 1G1CA 3OKLB 4NQDE 4XMLH 2DQTH 5C0CB 3RA7L 5EU3A 3ULVE 4NBYB 4JB9H 4R8WH 4PLNC 5JXED 2BSRB 3C5ZD 4UT9L 5TDOA 5JORB 3T0EA 4KY1L 1TTFA 4PUBH 2WW8A 4QRQB 4APQC 3FAXA 2AJYH 2A77H 2EKSA 5E6ZA 1Q72L 1MIMH 3K2UH 3MV8A 4RAVA 4G6AD 1MCOH 3U1SL 4WI3A 3QDME 4X8JB 1K4DB 4FFVD 3T1WA 3E6FB 1IAKB 1F3JB 5D1ZB 3AGVA 3O3DA 3OV6A 2B1HH 3CH1B 2BOCB 1OW0A 4PP1C 2Q7NA 4HJGA 4XVJL 1FPTL 2EH8L 4MAYA 5EU7C 1S7SA 3W81A 3T65A 2VJXA 1LNUA 2NY0C 2FX9H 4KK9D 1TQCC 4YGVA 4AJ0A 2G75A 5F88B 4TSAL 5F7DB 1X4YA 5I19L 5M95B 5ELIA 4TNVK 2ZCLH 2DYPD 2WM0A 2I60L 4KI5F 1CFQB 1T04A 4MYWB 3WHE0 5LCVL 1IC7H 2J88L 5CKGA 3MBXL 3NZHL 2Z31B 3L3IA 3IKKA 1JPFB 3MQIA 3W5NA 5MP6H 3OHXB 1NDGB 5I8OL 4CW1B 4KTYA 4Q6IB 3S4SB 3QUZB 4D9RD 4WDIA 1OP5H 4H1LA 2ZNWA 4RSVA 5EU4A 5KN5A 3P4LA 4Q0XH 2XTJE 3RVWC 1F6AB 4TVSa 3LKPA 5MERA 5EUOB 4YH6A 1RURL 2W38A 1D9KC 3VXMA 3QDMB 1NLBL 4KHTH 1FYHB 2D03L 2ZSWA 2LV4A 3MXVL 2R1YB 3BE1H 3DXAA 3U83A 4QWWD 1IEAB 4D0BB 1I3GH 1REIA 4NKOB 4C59B 4QRUB 1J1OH 3HNSH 2E6PA 3GRWA 3Q6GL 1F4AA 4E41E 3KDMA 2Z91A 4AYFA 4P2QA 2JF1A 4GBXC 1E27B 1MCIA 3QUYC 5GGTL 5J9PB 4KK6C 5TQ2L 2KBGA 2ZG1A 1P4IH 3QCTL 3HC3L 3IAPA 3QIWB 5TDNA 4G43A 4K71C 1OHQA 4PJEF 4WUUD 3TJHD 5C0EA 3SGJC 2VZ3A 4ZFZB 2A38A 5J56B 1BFVH 3VFRA 3BKJH 3P0VH 1OD9A 3QBTB 4HGWA 2RQ8A 4GKOA 1GPOH 2HAZA 3R0NA 3RNKA 5HHOB 1IL1B 4M7LL 1IAMA 3STLB 1RSFA 4G6KH 3UAJC 5EU6E 4R9HA 1LD9B 3MOQA 1JZ5A 4LLVB 4DEPC 3AC0A 2IQ9H 2NX5E 3DX8A 1JHTB 1LDSA 3I85A 2DLFH 3MLRH 4GG6F 3LS4H 2R0LH 3C08L 2NW2B 4OM1L 3HAEA 2VR4A 2OL3L 4U1MA 1OAQH 2XQBL 4NWUL 1I7TB 2CDFA 3MCKA 3TBWA 4AEHL 4JFEA 4OCSH 4OGAC 2LU3A 5C0NC 2VDRL 1KXVC 1J0IA 3DGGB 3FOLA 4JRXB 4FQJH 3PWPE 3M07A 2Q87A 3SGKC 4N0RA 2GJZB 2P8PB 4GKSA 1WV7T 3OF6A 4F8TA 3HC4H 4LVEA 4U6XB 2NTSP 2XQYG 1B3JA 4NPYB 4PTUA 4G6JH 3LN9A 3MJ9L 3NACH 1U8QB 2EE6A 1G7PA 3HE6C 1A6AA 2IAMC 4PB0H 1E6JH 1ZSDA 1GC1H 2DQCH 4GKNB 1ONQB 3NTCL 4KK8D 2GK0B 1HHIA 2NY5L 4O2EA 1OVZA 4PRPD 2YRPA 3IDMB 3VXSB 3LQAC 2IH1A 3NFSL 3BXNB 2FATL 1V7NL 2Q8BL 1X44A 2ZUYA 3KYNA 5F9AC 4KVNL 3C9NA 5F7NC 2AI0L 2VXSH 5GGVL 2NX5B 5B39A 4HG4K 5EBGA 3D5OF 2VSCA 4ODWA 4EN3A 2FR4B 3L9RA 2VAAA 1Q9LA 3CUPA 4ZOCA 3ULVH 4K8RC 2X9YA 4MHHI 5KOVC 1AIFB 5F93C 5ITBH 2HRLA 4Z7QF 2OQJA 3DSNA 2PXYC 3P77A 1FDLL 5FCUL 3S35H 2F54D 5J1SC 1MRDL 1ZE3C 2KDGA 4K23L 4X7TB 1HIMH 4D8PA 3GHEH 1ETZA 1N7ML 4G8EB 5ISZD 3GMOB 3QEQD 2HA1A 5INCA 5CP7A 5GS1A 4AENA 4QEGA 3NPZB 3AY4C 3G04B 4NQEA 1AGDB 1JPTL 3EZ8A 4ESKA 3KYKH 3A6BH 3MGAA 1X4ZA 1C5CL 4AZ8A 4NBXB 1BX2B 2WUCH 5ETUA 3GSQB 5JPNA 1N2RA 1LP9F 5J3HC 2PN5A 4LGSB 1S3KL 1IKFH 3SCMA 3O4LD 2LAAA 2UWEA 2OTUA 4M93C 3H2WA 2P5EE 1WICA 3WIFA 3FT2B 5I8EA 3MOBH 3SKJL 3IDIA 4OIIH 3L3KA 3CLFL 4UU9A 4KKBD 3A6CH 5E2JA 5LBSL 5SWQB 1A0QH 5MHSD 5D93C 2RIKA 1BLNB 3ILPA 1HCFX 5J13B 4FXKB 3MGTA 2BCKB 3SE8L 3ULUE 4GKZA 2Z8VC 1A7OL 4HUVB 4CNIB 2Z92B 4F7TB 1S7VB 3ARFD 4EUPG 1JGUL 4ELKB 1S7QA 1INDL 3OR6A 3OWEA 4JGMA 5BO1L 3T2OA 5E8PA 3V8CA 4ODSL 5HY9B 5J1AA 1LEGA 4WI6A 5KSVA 1DBJL 1F4XH 4I3SL 3RUGA 4HWBA 4ONHA 3PQYD 1QNZH 1YEDA 4YXLL 3C60A 1RD6A 1WEJL 1WCQA 1GZQB 1FH5H 2EYRB 3BD4A 4YIQA 3OB0H 3KWWA 3QQ3A 3FO0H 3NH7H 3W82A 3KLDA 3CVIL 4NQSB 5IMMA 1SY6L 1KBGH 5KS9E 5D6DC 3V6OC 1X5GA 2IC2A 3IS1X 4PRHA 4PJGA 1KG0B 3O11B 1W2KT 1A1OB 5C7XL 3QPXH 4NJ9H 2X1XR 1EA9C 4G80B 2DJ4A 2Q76B 4YPJA 4PJFF 4N1CA 1KJMB 3U0WL 1H5BA 2ZCKH 5EG6C 1NKOA 1RULH 2EDYA 2KH2B 5F7YC 3RDTB 5IR1B 1DN0A 4K3DL 2M26A 3HFML 2DRUA 3TCXA 5B3NA 3OXRB 1IGTB 5CMAB 3V4UH 4S1QH 4AIOA 5LVEA 3SKOA 1JZ8A 2FJHB 3OSKA 1RUKH 2XY2A 2EYSA 5CIPB 4F58H 4F8QA 4L3EE 3QR2A 3SDCC 2NY0B 4UQ3B 4P5TB 4U1NA 4BSVB 3ZDXE 4WFEE 5GGSY 2DQIL 1NAMB 3MR9B 4TULH 4YHKH 1HHKB 1QEWB 4IS6A 3WIIL 3BUYB 1RK1B 1IM3A 3SE4A 4MQXC 3MRLB 1MAKA 3PE9A 1BFOB 3V0VB 4ZNCD 4DKEL 1XT5A 3MV01 2YK1H 4M5ZH 2X5PA 2Y1VA 2V2TB 3MROB 1KCSH 2GSGB 1V7MH 3O41B 4YGAB 3ZL4H 3I9GL 2P45B 1MNUL 4OF5A 3QIUC 3L7EA 1FBIH 1GZPA 4ODBD 1KTDB 3VRLE 1EFXA 1J88A 4LKXB 4X8XA 3CPLB 4XVSL 3EFDL 4OD1L 3N1GC 2ICES 3IS0X 4H8WH 1CTNA 5DVLA 3FMGL 4YEEA 3QYCA 3Q3GA 4QXTA 1OAYH 1ZVSA 2P42B 2BY0A 5C92A 5K9JH 3EYUH 4Y5XA 1X3DA 4GBXB 3T0WA 2J5LC 4G3YH 2DIBA 4HMCA 4KROB 5JDSB 3QUYB 4FQXD 5D7KE 4GAJH 1LEIA 4HEPG 5C09A 4MLIA 4S1RH 4K71B 4XPGH 4KAQL 1A1NA 3U9UA 2Z93A 1I1AC 3LKSA 5A43C 4L4TD 1FAKT 5J1TC 4QRTB 3CX2A 3G08B 3T09A 4PTTA 3O3EB 1GOFA 5A3IC 1WFUA 5DHVB 2E7CA 1U3HC 4Z7WA 5BZWA 2FHBA 3VRJB 4DEPB 1FN4B 4JN1L 5C08B 3L3JA 4PJ9D 2O61B 4ZUWA 5IGXL 1QFWI 1KIQA 1OQXA 4LSVL 3MLYL 2QSQA 4QGTA 3RL2B 1HWGB 5F97E 3S88L 4NQTA 3U4EA 1I9JH 2BHYA 1O7VA 1G6RB 4ODTH 1FLTX 5GIRB 2OSLA 5CD3A 3MBEA 2R2HB 3WJJA 1A47A 1FRGL 1UB5B 4DAGH 2KQNA 3E6HB 3GMNB 4FN0A 3KVQA 3QH3A 4L8BB 3ULUH 5D1ZD 4X4ZA 3HE6B 1E4XI 5KSBA 5T5NG 5L6YL 2ZP0T 1BIIB 4MSWA 4D9QE 3P73A 2IF7A 4P59L 1JMZA 2A83A 2A9NL 2VRAA 4L9LB 4X9BA 3BDXA 4X5LA 2D9CA 5JXAH 4X99A 5EBLA 2FJFB 3UTQB 5I1AB 4DN3H 1XH3B 2VLLB 3BKCH 2HTLD 5T3XE 2PUQT 4GLRI 3T3PF 5IKCB 5GJTL 1QLRA 2X1QA 4F7EB 4WHTA 1DANT 4YHIB 4LDOB 3GJEB 5B3JF 3QNZB 3TH2T 4KI5C 4WUKH 5KJRH 4R4NC 1JRHL 4QRPE 3ARBC 1ACYH 3U2SA 3H9SD 3S97C 2PXYB 3IDYB 2VZSA 1WBXA 3PJSA 4NO2A 3TBYA 5J06A 1HXMA 1A6TB 4UMGA 3OAZK 2BNUA 4LLDB 5K93A 3CGTA 2AV1A 4JO4H 1NJ9A 4NHUB 4PRBA 3H7LA 3BWAB 4FZ8L 4MB4A 2FL5A 4RIRA 1A6WL 1ORQA 1DBBH 4QNPE 4R96A 1HI6B 1UCBL 3B6SB 3RWJB 3FQRB 4NZJA 5DYOA 4XNQB 4NFBA 4X6DB 3SKMA 5HGGS 2A6KB 2O5XH 3N1QC 4TVPL 5M94B 5IF0A 1Z0NA 1UWXK 4O2CB 4K7PY 5MENB 4ISVB 2DBJA 3IDGB 1HINL 4OZHF 1KIRA 4XNMB 1B2WL 5EA0L 5CJ5A 5FUZH 3MPCA 4K7FA 3ZE2E 3QUKA 2AJUL 4XCCH 1FLRL 1DE4A 4PJ5E 4LKCA 1S7RB 4MJ6A 1XF2B 2IPUG 2MWCA 5ICZB 1NGXB 2UVFA 1LO0L 2I26N 1A0QL 4HXAL 1A3LL 1QHOA 1UCTA 1V3JA 4I18A 3PGFH 4U1JA 4HC1A 4LSQH 4MNGE 4XCYB 4DVBB 1AE6L 1T0NB 2NXZC 4U1IB 4Y4HC 3CAFA 2H9GB 4HCRH 4ODVH 5DDHB 3GDBA 4I3GA 3CCHA 5C0BA 1VEMA 2NY2D 4S2SB 3OZ9L 3ARYA 4HKBA 5CEYA 4ZQKA 4ZUSA 2AEQL 3PWNB 2IGFH 4NO5B 3TV3H 5DMKA 4KGLA 3AAZB 4HIXL 5EOTB 3DMMC 3FQWB 1HKLH 2VDKH 1F42A 4YBLC 3TT1H 3LH2H 4LASH 2HWZL 4EI5C 1Z9SA 1PZ5A 1INEH 2AK4D 4D0CA 4WFHD 3UTTE 2JCCB 3O45B 4F33A 1T21B 4TRPL 1K8DB 3RVXD 4WW2F 1BF2A 2C3VB 4X83A 4UNVA 3O3BB 4PJXF 1JVKA 5IB1B 4IRSA 4LLYB 5C0FA 4PRNA 1F11B 4KJPD 1MCLA 1VADA 4O58H 4XAWH 5FM5M 3WFBH 3CLEH 2Y7QA 2A73B 1AD9B 3FRUB 4V1DD 3MYZA 1PLGH 4ZS6C 2ZCKL 4GW4B 4MD0B 4NYLB 2CO7B 1JWMB 5JW3L 4G5ZL 2LVEA 3MRDA 4JFOB 4HIJA 3VFOB 3ZKNC 2YD3A 1VFAA 3BW9B 4YHOL 5I1GL 4MD5A 4MDJB 2AQ3A 3WNKA 1RMFH 1YMMD 4JPKL 2RAMA 1DEDA 4KUZL 3SDYH 3CNKA 3OAYK 1DQML 5IIEA 4IJ3B 3ELAT 4Z7NF 5ADOH 5LGJA 2HJKB 3SQOL 1KEML 4LLWA 4X9FA 1RFDH 3CXDH 2HKHL 2QQLH 3FOMB 3MREA 4X7SH 2N7BA 3T1FA 4DGVL 1HSBB 1IAOB 1URLA 3VFNB 2VZUA 4ZD3H 5C8JB 4LFHG 4LMQI 3QZWG 2X4OA 1N0XL 3MV7E 4HS6A 2VLKA 1E4KA 4JRYA 1WIUA 3MUJA 2EDJA 4IRZH 3ZTNL 4LEOB 1MJ8H 3DECA 3D2UA 2ADGB 5CP3H 1I7ZB 3WO4B 3UZVB 3LRSB 4HT1L 3WFHB 2WUBH 4JR9L 1BAFL 1JE6A 1V7ML 1X5IA 3GNML 1I8MB 4X4YB 2LQRA 5SWSB 1EZVX 2HJLA 4X6CF 3VXRD 4URTB 4CKVX 2ORBL 5T3XH 1F4HA 3BD5A 1I3VA 4MJ5A 1RHHA 5FAAA 4OCNC 4R4FH 3BPLC 5TPWH 1DBKL 1RIVL 2DQUL 2Z4QB 2XZQH 5I18H 1WJ3A 4LCYB 3REWB 3GGWA 5FO7A 1T22B 3N9GL 4HMDA 1AI1H 5GRUL 3VXOA 4UV7L 5GS2H 1MQKH 1S9WA 3AB0B 3CVHB 4I3RH 5IB3B 4FFWD 2N4IA 4EJ1C 3TVMD 1QP1A 4S1RL 1D5IL 3RU8H 1F58L 1WZKA 1KTRL 5DJ8A 1PYWA 2UYLB 3WUWB 1I1AB 4MVBD 4G9FE 5E5MA 4N8PA 4AIZA 3NOIA 4JFXB 4YC2C 3W39A 4ZSOA 5F1SA 4NFDA 4WWKB 4XPFH 3IJSA 1HNGA 1IAIM 4HLZH 3IETA 2XT1B 1JYWA 2OX5A 3O8XC 4HDIB 5EO9B 5I8CA 4QRRE 3GI9H 4P2RE 3CDYA 4XAKD 2GSIB 1SYVB 1N64L 3LKQB 1CBVH 3ARSA 2JJTC 5HHQB 5D5MA 5I1HL 1KXQE 3L1OH 5EC1B 2CLVA 3WXVH 2V5SA 1CLZH 2B4CL 5DD6B 4R4BB 2JJVA 1TZGH 4MA8H 4XP1H 6FABL 3RUGF 2EDXA 5IROA 4ZFOB 3D39E 4APQD 4OKVA 4DFIA 5F7FA 4Z7VE 2YD6A 1KSRA 2HFEB 5D9SA 1MEXH 1MAJA 2WIIB 2VXVH 5SV4A 4ETYA 5IV2A 4PJGF 1MRFH 1Q94B 3MRHA 2JB6B 4G9FB 1B0GA 1Z3GH 3NN8B 1EEZB 4JFDA 4G8IB 3FFCB 4EBQH 4LQ1A 3MLUL 3UYRH 2Q3ZA 4F2MB 1LK3H 2W60B 3QEHB 2PCPA 5JOPE 2P5WE 1HQRA 2F53E 3RWCA 3DV6A 1F8TL 1NAML 4QRRB 2X4QA 3TN0A 4P2RB 2YPKA 4OTXL 5C07D 5HGHA 3C8KA 3ZTJH 5HSFA 5BOZG 1T5XB 2HVKB 2GTWB 1AR2A 3TC9A 4XNUL 4LOUD 5FYJE 1WCBB 3HE7A 3U0PB 1TJIH 2AJSH 4PY7A 4J1UA 5GPRA 2MQCA 4OLVL 3ARBB 5DFWH 3VG0H 2O5ZH 1IBGL 1N3NB 1H8OA 5MEQB 2CGRH 3MO1A 1T3FA 1YY9C 2FYYA 3IU4L 3RVWD 5DJCB 1AGBA 4ZO9A 5CEXB 4RDQG 4U1KA 1D9KD 2YHGA 4OGYL 3JWOH 4Y5VC 1GAFL 2VLME 3HTLX 4L8SA 3GUTA 5EB9A 3PDOB 5HDOA 1VGEH 4I2XB 2SEBA 4P23A 5GISH 1A1MA 2J6EL 3TBTB 3BEVA 3FT3B 4G7VH 2DTML 3SO3C 4WTWA 2VDLL 4LNRA 5F6HI 5D7LA 1UJ3C 2J8UF 4MAUH 1NSNH 3BHBA 3DX9A 5KVFL 4E0RA 4KDWA 3FHQA 3BGAA 3D85B 3IFOA 3U46A 5HYSB 5HHPB 4AG4L 1XGPB 3LZFH 4ORGA 5CCKH 2YBRB 4K7PL 1DBML 3W11D 4HJ0C 1RJZA 5ALCH 1TNNA 4XNXL 2EYTA 3F62A 2D0HA 1NC2B 5C0AD 1T6WA 2PYEA 3EZJB 1XF4A 1S78D 2BNQE 1EXUB 1EEYB 5DQJA 2XIDA 4EXPX 4JFZL 4P46C 2K1MA 1G1YA 4PJEB 2XXCB 3MNWB 4LSQL 2X4UA 3RFZC 1NFIB 2P7TA 2ATPB 3AREB 4J3SA 3TBSB 2C4FT 4U6VH 4LSPL 5IVXA 2P24B 1IQWH 1J7VR 2C3XA 3FJTA 2BSTA 3UAJD 1KIUA 3IFPA 4G42B 4R90L 5ERWA 1FYTA 1KN4H 4UV4L 3X3GH 4MDIA 4UDUA 4X5WA 4U05A 3ZYJA 1CZ8H 4OZ4B 1T4KA 1G6RL 3QAZC 4WO4C 1HK6A 4NQCB 1XGRB 2F19L 4N8CH 3DMMB 3GFUA 4Y19D 5DJAB 4GG6B 2P8LB 4N5UA 3JV6A 4YBLB 3EDEA 3MV9A 1AXTL 4ELME 5FHBL 3IFNH 1CT8B 1QPXA 2PW1A 5FB8B 3WD5H 1CD1A 2ESVB 3IXAB 1I3RA 5DC9B 3RNQA 5T3ZE 4AIXA 2J7LA 2Y5TB 3JWDH 3BP4B 1BQHG 1BQUA 1SYSA 1OCWL 4ZDHB 3C2AH 3LMJL 2J3SA 2IAMD 4O5LH 3QXAA 1T1XB 1JPSL 5FYLE 1DCLA 3PHQA 1I1YA 1AY1H 4XP4H 2BNQB 4AMKH 3LQAL 2Y25A 2EDFA 5DD0H 3IJHB 3KLAA 1OF2A 3QIBD 2QQNH 5DUML 3C5ZA 4W6XB 4TTDC 5I1KL 3V0WH 4TQEL 1XMWA 3EYFB 2W91A 2OJZH 1MFEH 1QVOB 1QQDB 3PP3K 4K8RL 2FH6A 5JO5B 4LHUD 1JNHA 1ZWIB 5CUSL 1XGTB 4L8CB 1RZGB 3HMXH 1ZT7B 3Q48A 1ZGLM 3CFDA 4GOSA 3VWKA 1CFBA 3P40A 5IWLA 1HILA 4NP4L 1VDGA 1TJGH 2AKRA 4WENB 4DQOL 2DAVA 2PO6D 4N1HB 4DOHE 1YDPB 1T66C 1U2HA 3DPBA 4C83A 2XPGA 4HIIA 3F7VA 4W6YB 4YQXL 3V4VL 5C70A 5DURB 2DYPA 3WNLA 4POZC 1UVQB 5H37G 4L5FL 3E8UL 1UT9A 4FP8L 1CXFA 1U92B 5T3XL 1FVDB 3EJYC 3V6ZA 1AHWB 3MLSH 5DSCA 2UZXB 3RKPA 2XZQL 1LP9B 4HXBH 1XIWC 4KUCF 3CFKA 3BYTA 1OPGL 5JLZB 4YDVB 2FIRT 1KB5B 4AEEA 5HDQL 1D6VH 2X4RA 5FYJH 4F3FA 1FZMA 1EPFA 4KXZH 4I9WE 5I1LA 1A3QA 4ZXBB 4O2FA 3UTPE 5E24E 4KJYA 2FH8A 1AO7B 3QDGB 4NT6B 1ZEAL 4Y16C 3UBXG 5J0BA 2HRPL 1KIPB 3S8WA 3MUY1 3LEXB 4TPRH 1K85A 3G5XB 4LQFL 3SO5A 5E2TL 4TUJA 4OZFH 4ODHL 3VW3L 1HEZA 1BM3H 1C08B 1PFCA 4HKJB 2ZZUT 3KYOB 3WFEH 4WJ5A 4WHYG 1GGUA 4JHAL 4R3SA 3VXUB 3KXFE 5E03A 5GGTA 1SJVA 1FFOA 5EC2A 4I48B 2V9TA 5D96C 3KPMB 3OKDA 3HCVA 3OX8B 1RJYB 4JY6A 3P9MB 4PGCA 3LOWA 4M48H 1H15A 2DKSA 1U8IB 1CE6A 1NGZA 3RGVA 4FABL 3BPOB 4WCYH 5E1AA 5D7JB 3D18A 4WW2C 5FK9A 1NCDL 1CDGA 2MCPH 3MJ7A 1FGNH 2FWOA 2JIXB 1OGAE 3EDKA 1XEDA 5I73C 1AGFB 1R24A 1T7YA 4KC3B 2VXVL 4YHML 2CR6A 4PJFB 5DRWB 4WIQA 2X44D 1D5BA 4XGZA 3WFCL 1DQDL 1JGVL 3D87B 4N90E 1A4KB 1MFCL 2H26A 4GMTH 4DTGL 5GZOC 1S7UA 4CU8A 1FV1B 1LK3L 3H3BC 3F7RA 5BVPL 2CKBB 4JDTL 5IQ7H 3SDCD 2WAHA 2ZG3A 3KAAA 3V6FA 2BVQA 1PQZB 4HK3N 3TA3B 5FGBC 4IOSD 2I5YH 4EIZC 3KXFB 4PJCA 3BP6B 5DK2B 3MMEA 3QFJB 1XAUA 5IW6A 5TF0A 1WC7B 4HWNA 2XG5A 3MJ9A 4P3CH 1KNOB 4Q9QH 5T3ZH 2VE6B 3RIAK 3L5WA 4YE4L 5IMOB 1BWMA 1TMCB 2ZOLA 5HHNB 4PRPA 3BO8A 2XN9D 3WE6A 4Y4FB 4IIQC 4CJ0A 3ARGB 1NBVH 1YEGL 4ZG1A 2I25N 1RJLA 3WLBB 1MCJA 2P47B 5FYLH 5GGRA 2EDEA 3BP7B 4HJJH 2FECI 2DQHH 2V17H 4JFPB 4MJIE 4OCYH 5HHXL 4EOWL 1KFAL 4RGNE 3O9WA 4I77H 1FE8L 4G6MH 3OKKB 3QIUD 4Y5VB 5F3HB 3OR7B 3G9VA 4J3WA 2X7LA 5DJYA 1E28B 2XKNA 1TPXC 4LEXL 5I17A 4LSTH 1U8HA 3QHZH 2VIRB 5JQ6H 4CVUA 4NNYB 5GRWA 1UADC 2HT4C 2MTPA 3KPRD 4X7EC 2F54A 4XBGB 1UJ3B 3PWVB 5CJXA 2I9TA 2BJML 2QEJA 1N8ZA 4O9HL 3VGGA 3ARDD 3B8SA 3CVHL 3QEQA 2ZJSL 1MRCL 4OQTL 4XWGL 5TDPA 1ZLVK 3M17B 3LKRA 5JHDE 3WSQH 2FGWH 4FQ1L 4LSRH 2FX8H 4CVXA 1YYML 1FC2D 4ZFFB 1JNNL 5CJQH 3U7YL 1YEIL 2VKWA 1C1EL 3WFDL 3MA7A 3T0EE 5E9DA 5EBWA 1J18A 2X4SB 2JK5A 4P46B 4LHUG 4NO3B 3TZVB 3OJVC 2D2OA 3O4LA 3HLAA 3C5JA 2A9ML 5A3ID 1KT2B 1U3HD 1GGIL 3S96A 4OLUH 4WHDA 3RQ3A 5D2NE 5K9QG 2YUZA 5CEZE 4OLZL 3UC0H 4OLXH 1MSPA 2G5BB 1FG2A 2DI9A 2D7TH 4KV5F 4RZCB 1KPVA 4OFYA 4WO4B 3IKCB 3JV4B 1BVKA 1QSFD 2BNRB 3NPSC 3FO2A 4M1DL 4OJFH 1NEZB 1MJ7L 4O02L 5E2VH 3TNNB 5H2BA 4P57B 3ARFA 4NRYB 1EHLL 1SQ2N 3S6CA 3W0WB 1Q9OB 3HN3A 5F71A 2DQEH 5SWZE 3EOAB 3GMLA 4BKLB 1TJHH 4QY8A 3EO9L 2CRZA 1OOAA 5EU3B 4X80H 4UUJA 3PQYA 3QWOA 2B0SH 5TDOB 3OPZH 2XZCH 4NCC2 4YBHA 3OAZH 5ICYA 1AR1C 3H9YA 2CH8A 5FYJU 3TWCH 4OD3L 3FQXA 1R3LB 2X4PA 5C3TA 2EKSB 2ARJQ 2ERJC 3MV8B 4RAUA 4UTBL 4RAVB 5HYJD 1JWUB 4BZ1L 4PJHF 3VXME 3MLZH 2VNCA 2MPAL 1QLEL 1SBSH 4JZJC 3AM8C 3DXAE 4RGOH 3O3DB 2NY3B 5I30L 1UWXH 4KI5D 4R4ND 1IGJB 5BV7B 3PHOB 4R6UA 4HJGB 5D72L 4NZTH 4MAYB 1S7SB 3T65B 1IC5L 4L4VA 2IFFH 3PWJA 2EDDA 5F7EL 4P2QE 1LNUB 2FD6H 3MGOA 4JO3L 5KVGH 1NLDH 2XXMB 4WW1A 1A9EB 3KYMA 3B9KC 4ZYKB 4ZO6A 1MOEA 2ZUXA 4Y4KC 2YN3A 4CMHC 1T04B 3UTSD 1R3KA 2R8SH 1YEKH 5JR1L 3L3IB 4ZS7H 1MHEA 1EGJL 1RIUH 2V5MA 2HKFH 5GHWL 3DUSA 1J0HA 3SHSA 3WS6A 5KZCB 2GT9A 3K8KA 3HPLA 1QO3B 4O00A 3BZFA 4H1LB 2YWZA 3O81A 5EU4B 1E4JA 4WWID 5KN5B 3LKPB 2VDQH 4XPBL 3QUXA 1VFBA 3L3GB 5DJ6A 3MRGA 5EWIH 3OQ3B 4JPVL 2ZSWB 1LE5A 4K3EL 3MJ6A 1L7TL 4NKDA 2V5YA 3P9WB 4G7YL 4PJ8A 3S36H 3VA2C 1JGLL 3D48R 1MHHA 4KVCL 1S9XB 4EUPH 3KDMB 3HG1A 3GIZH 2NXZD 3VRIA 4P2QB 4Z0BL 4Y4HD 2F15A 4Y16B 2DBLH 5I2IA 4YK4C 1NCAL 4NZRL 4YBQC 1F4YH 4NKMA 4PBXA 2CSPA 4OCRH 1NANH 1FQ9C 2ICEA 5TDNB 4G43B 3ARUA 1U6AL 3DI3B 2H2SC 4MA7L 3VFRB 5L88L 1NUNB 4FQXA 1KELH 5EOCH 5CBEA 4HGWB 1JHLL 5BW7A 5AG9A 5HHME 4BSJA 4EI5D 1KCVL 3CH8A 3OAYH 4L4TA 4EVNA 1WAAA 5HYFA 4XH2A 3KPOA 1YYLL 3CMOH 3FTGA 5K33A 4X4XB 3KPSA 4KWUA 3VWJD 2WP3T 3TO2B 1U91B 3QG7H 4GRMA 4C58B 4WFGE 4WW2B 4XMKH 4PJXB 3HAEB 3HUJF 5DD3L 1DL7L 3FB8B 1KCRL 3BSZH 3V52L 4ZS6D 2CDFB 1I4FB 3TBWB 1HH9A 4JFEB 3LAFA 3DHJA 1NL0L 3GHBL 2BSRA 1F4WL 1QR4A 2ZPKH 4XPTH 1YZZA 3HZKA 4L29B 5CEZH 4QRQA 4NQEE 5C0RH 4PTUB 3SOBH 4GQ9L 1VCAA 3DUHA 3LEVL 3ECBA 4L4JA 1G7PB 1A6AB 5HHVL 1I1CA 3MRFA 4FTVB 5CKAA 5DGQA 3MODL 1HHIB 4JLRA 4V2BA 2GY5A 3ZDYF 3EYQC 4O2EB 3E6FA 1IAKA 5D1ZA 3GKZA 1NGQL 2IH1B 1UWEH 3CH1A 4LAQH 2RCSH 3MOAL 2HFGL 2UWEE 1U8OA 4F9PA 3C9NB 3EYOA 1RZKH 5D1QC 8CGTA 5IFHH 5LJYH 4ODWB 5EZIH 4ALAH 5AEAA 2VAAB 1L0YA 3L9RB 4QHMA 3CUPB 3PDDA 1EHXA 2DLHA 3GO1L 5DQDH 2YZ8A 5F7DA 4B41A 2EIDA 3CSBA 1OAZL 4XNYL 1WWAX 3JV5A 3S3PA 4XCFH 2XKSA 4GMSH 4KTDL 4ERSL 2MQ0A 2KUTA 2Z31A 3INUL 4H1LH 3GZKA 3P77B 2XZAH 5AAWA 4X6CB 1YUHA 3QHZL 2O26U 3D9AL 5JIKA 1ETZB 4C4KO 4Q6IA 3B9DA 2VABB 1WSST 4FRWA 5INCB 3BX7C 5CP7B 4I8DA 4AENB 1KB5L 1YEJH 4NQEB 2OR8A 2RGSA 4I0PC 4F57H 4QRSA 1F6AA 5EUOA 3DBXA 5EZJA 3WFZA 5DMIH 2HH0L 1JK8B 1WZMA 3GRWH 3A6OA 4QXUL 4BELD 1WIOA 5ETUB 1IEAA 3TH4T 4NKOA 1BQLH 5DA0B 4QRUA 1JF1B 3SCMB 4GSDL 1UM5H 1Z2KA 4PRHE 1FL6A 1KJ2B 2V7HA 3A67L 5I8EB 1KB9K 3PP4H 5EZOL 3VFWA 4MXWH 3IDIB 2XYCA 4P9MH 4DW2H 3N1FC 4XCEA 3EAKA 2UVEA 4UU9B 4LGPB 5J9PA 3O8XD 5F1KC 2DQDH 3QIWA 3BAEH 3VGAB 3FN0H 4KDVA 2OXGA 1KCKA 3W9DA 3MGTB 5FGCE 4PS4H 1Q9WA 4GKZB 4RFNB 1IQDA 1RIHL 2IG2L 1NUFA 3DOSA 4IMKA 2AJ3A 4A2MA 1S7QB 1UZ6E 2IAND 1QBAA 3JBG7 2YMXL 3OR6B 4ONOA 3WXWL 3HPJA 1M05A 5HHOA 5E8PB 3STLA 2VLJD 3P11L 2WQRA 1LD9A 4TN9A 7FABL 1UYWL 4LLVA 5J1AB 3KLSA 1ZT1B 4CUCA 2APFA 1FNGA 3RUGB 4UT6H 4H88L 4PRID 1J1PH 4OLYL 1YEDB 3C60B 4BFBD 1Q9KA 3KWWB 3QQ3B 4KGJA 2OLDA 4UILH 1FAIH 4NQXA 5IMMB 3MRKA 4NQDD 3AS1A 1I7TA 1S9YB 4LCUA 4F15C 4M62L 4NC2B 4PJGB 2FDBP 2CKBL 1CGSL 3VXTB 2AK4A 2VDNL 4JRXA 5IB2A 4DGYL 3PL6C 1A5FL 3PXHA 4BUGA 2ERJB 4U6XA 3RZCD 5E8NA 1H5BB 1OTUC 2KL6A 1U8QA 1MPAL 4LLMA 4Z7UF 2UUDK 1NC4D 4Z77A 1UA6L 4QKXB 2HT3C 5FGCB 1FO0A 1DN0B 2A2QT 5K59E 1II4E 4V1DA 1HWHB 5C0GB 3IDMA 2B2XL 1PY4A 3SKOB 4JKKA 1V8HA 5I9QC 3BXNA 2VXUH 1I85A 4LSUH 5IBLC 3KPPA 3NIGE 4CADB 1HCVA 1RZ7H 1X5ZA 4PJCF 1ZLWK 1YMMA 1W72L 5ID1A 3T4AA 2FBJL 1N6UA 2AQ1A 4PGBA 4AEIH 5LWYL 3B9KB 4NQUA 1QSED 4Y4KB 4JM4H 2OZ4H 4OCXH 3OBAA 5TQ0L 5C09E 3NCFB 3OKNA 5CILL 2JJSA 1F90H 1CDYA 1IM3B 1RUPH 3CX5J 2BY2A 3QUMA 1TZHA 1SBBA 4YUEL 1DQQB 2Y72A 4K3JH 2VITA 3I75A 2Q20A 4Y2DC 4Z7WE 3RAJL 1MFDH 3BPCB 3K7UA 2J8UB 3G04A 4AY0A 2XTJD 3DURA 1AGDA 1FNSH 1NCCL 5KSAC 2BRQA 5JOEA 3L7EB 4HJ0D 1CXHA 4KMTH 2BVUA 2EH7L 1MI5E 4HUXA 2YA2A 3CZFA 3RVVC 1T1YA 4S10A 3VXRA 3GSQA 2FO4A 2X1WL 4QXTB 4E41D 1ZVSB 3TPUB 1HH6B 4XHJD 25C8L 1YEEL 2PW2A 1DZBA 4J8RA 2E7LA 3FT2A 1JJUA 4XNZB 5AYUH 2KKQA 3PNWA 2B7DT 1LEIB 4NIKB 5IBUG 3ZYOA 2JTDA 2O5YL 5KSBE 1A1NB 3U9UB 2Z93B 3LKSB 5T5NF 3DETC 4GS7B 3S35X 5GSRA 3PP3H 3TVMA 3F5WA 1G9MH 1QFUH 4FOMA 4HWZA 3MUZ1 1KN2H 4HUVA 2PKDA 1EHNA 4F7TA 1S7VA 3UJJH 5CJ8A 1UH4A 2R56H 5EU6D 5BZWB 4X7DC 4MCYA 1I8LA 3L3JB 5DUPH 5HY9A 4DCQB 4W4NA 1Z5LA 3QCUL 1KIQB 4NNXA 1PG7H 1NCWH 1OAKL 2VN7A 3U4EB 3EOYG 1P9MC 4Z78B 1YQVL 1RUML 4PGDB 4XRCA 3Q1SH 4NQSA 4M7JL 2IBGA 2OSLB 4ONFL 3MBEB 5CD3B 4DJMA 5I76A 5GRXG 1B0RA 4TTDD 3GSWB 4XPHH 3ZDZF 1KG0A 3PWPD 1QSVA 3O11A 1BBDL 3ES6A 3QH3B 3L3HA 4KK5C 3UO1H 3LDBC 4PB9L 4APQA 2EDNA 1VFMA 5BV7L 3QP3A 4QOKD 3VH8G 4JCLA 5KSBB 5FUOH 2A83B 3BZ4B 3FQUB 5BMFL 5FYKL 4M43L 1IC4L 1C12A 1FL3A 3SGEI 1C5BH 1J9CT 1MREL 5CMAA 4CJ1A 1NUGA 4H25A 3O4OB 1CXLA 4MNQB 2R1XB 1L4IA 2EE9A 4P4KC 4M1GH 5I74B 3X13A 5T33H 3U30C 1QLRB 5D1QB 4D3CL 5EZIL 4F7PA 4PP2A 2BXZA 5SV3A 2J8OA 3EO1B 2Z0BA 4HUNB 3HE7C 5C07A 4PRAB 1NAMA 1VGKA 5HYIA 4AQ1B 3U2SB 1HHKA 1RK1A 4M5YL 1IGCL 5GS0H 4RFEB 3PJSB 3EJYD 3TBYB 5C0BE 4EZMA 1HXMB 4PJAF 2K7PA 1MCPL 1IKNC 2ADJA 3AMLA 2VXTL 1IFHH 2BNUB 4H26A 4R26L 3S37H 1UH3A 2V2TA 3K46A 1XIWD 1FSKC 4HPYL 1NJ9B 4PRBB 2GSGA 2DQJL 1ORQB 4RIRB 1T7ZA 3BZEA 3UEZA 1R3IL 3GRWL 3RWHA 1D9KA 4KRMB 4RMWA 1N26A 1QFWL 1EAJA 1RZJH 4XWOC 5DYOB 4K94H 3S4SG 3CFBA 1UM5L 2J6EA 1CWVA 2P5ED 2VR9A 5I1EH 4K9EH 4C4KT 3QUKB 4UTAH 5L9DH 3ZSSA 1HYSD 1UJTA 1DE4B 4GBXA 4LKCB 3GJFK 3QUYA 3RKDC 5DRNA 4Z95H 4LCWD 4HF5H 3SEPA 1E4XL 1JRHI 3BDYH 4U1JB 5I66B 4YHLH 3SGJA 5TE6L 2XZZA 1UEYA 3R1GH 5C0AA 3FHAA 3SDDD 1ZLUK 3ULUD 5FGSA 1EJOL 4HKBB 4ZQKB 3RBSA 2EDRA 3O3EA 1OWWA 5DHVA 5GSVA 2VDOH 1UACL 2CK2A 4KTEL 2FB4H 3QXUA 2O61A 2AJVH 3U7WH 2L0DA 5HXMA 1KTLA 1PZ5B 4D0CB 1WZLA 2VLKE 3T77A 4GW1A 2XNAB 4NCC1 4JRYE 1G6RA 2RBLA 4Y19A 4WFFE 2VDML 2MHAA 1MAMH 4NO0D 2R2HA 5C0FB 4PRNB 1RPQA 3U4BH 3VFVA 1VADB 4U6TA 3SGKA 2QADC 4Z5RB 2Y7QB 4PR5A 1JZ3A 4RA0C 4L8BA 2WANA 1G9EA 2FEDC 2D0FA 3HE6A 2IAMA 5EDXA 3MRDB 1BIIA 4HIJB 3O2VL 4OM0L 2AP2A 4UINH 5JXEC 1VFAB 3QEUA 2P8MA 3BT2H 4YHZL 2X2YA 5E2UH 1A7RH 1ZLVH 3MLWH 4HBQA 3U4AA 1FORL 3UTQA 5I1AA 1JPGA 3QDAA 5F7UA 2DJSA 2YRLA 5IIEB 5CS7A 5HDBE 3BMWA 5LGJB 4L3ED 3AS3A 4LLWB 3CFCH 1X6LA 4Y1AD 3MREB 3EOTL 1XGUA 4LHUA 3T1FB 4YHIA 4OCXL 5IWLC 4WFED 5GZND 1MY7A 3GJEA 2C1OA 3OB8A 4Z9KB 4HS6B 2VLKB 1A6VL 1FCCA 4Q97A 1UM4H 5I75B 2PXYA 4ZSOE 2YPLB 5B38G 2HT4D 3D2UB 4M1CC 1BQSA 1E4WH 3L5HA 4OF7A 1J1XH 1YECH 1A6TA 4XC1H 1V3KA 1QBLL 4D2NA 5IEKB 3L5IA 4XP9L 3OL2A 1X7QB 2EICA 3AY4A 1U93B 3HI6H 1X6NA 5DFVD 3NCMA 3BWAA 4RGNC 1SHMA 5D5ME 3WO3B 1EAPB 3B4NA 1HI6A 1PSKH 1RUQH 1KJ2L 4MJ5B 1DEEA 3B6SA 3FQRA 5IFJA 3ZE1E 5DF0A 1IAII 4NC1C 4X6DA 4IOFC 5AZ2L 2NY7L 3D0VB 1BFSA 5L0QB 4L8DA 4O2CA 4R7NA 3F12A 3GGWB 3T8XA 4ZOEA 4ZPVA 4BQ8A 3VXOB 4HC1H 1NMCC 3SGDI 4OB5L 1F00I 5IMLB 1J8HD 3V9FA 5JPMA 3BEWB 3ZE0F 5DJ8B 1PYWB 2GJ6D 4HBCH 4ZTPH 5FF6A 1HHJA 2GJJA 4XCYA 2BFVL 5EIIB 3W39B 4JFDE 1T0NA 4DVBA 4Q9BA 5DWUL 4KMQA 3IJSB 4PG9A 1ULVA 1GHFH 4HWBL 2EEDA 4TSBL 3IETB 3B9VA 3OGOE 5I8CB 1IGMH 5D2NC 3TJHC 1IC1A 3AAZA 2UY6A 3UJIL 1ZMYA 5D5MB 2Q8AL 4WI5A 5EOTA 4WEBL 2EEAA 4E5XA 1YA5A 5CJOL 2I07B 4KI1A 4RISH 1KYOK 4OUUB 2BX5A 4PJDA 3FQNB 5BQ7A 3NFPA 4OZIA 2DM7A 2ARJB 1PAMA 1AR1D 5HD8C 3B2UC 3O45A 4DGIH 4BK4A 4OKVB 5I6XC 5D6DA 3V6OA 4KZDH 2NCMA 1AJ7L 1QD0A 1JNLL 4LLYA 4U6YA 1MCHA 5D9SB 5J6HA 2EZ0D 4RDQF 1RZKC 2DOCA 1K4CA 4P2OC 5DD1H 5MI0B 1VFUA 3MRHB 1DN2A 1NGPH 1LO5A 4YR6B 4MD0A 4NYLA 1JWMA 4D9QD 5HPMA 2F5BL 3IDUA 4JKMA 1B0GB 4JFOA 3VFOA 4YAQB 5D7LE 3BW9A 1I75A 1HQRB 1QKZL 1KLFA 4W68A 1YNLH 2X4QB 5L7XL 2VN4A 2YPKB 2FNBA 5F96L 1JGEA 2CJUL 4O4YH 5TFSL 3C8KB 4N8VG 3V5DA 4HG4J 1P2CB 1JL8A 4FFZH 3SDCA 1RUAL 1D5ZB 5I1DA 2W9EL 2G2RA 4EI6A 2PYEE 4OFDA 1CG9A 4JKWA 2W59A 4N0CD 3GBMH 3HE7B 3VFNA 4J1UB 4YXKH 4A6YA 3B5GA 2YKLH 5D2LE 5B22A 4QRPD 2RHEA 5TE4H 5GS2D 2FBOJ 5IVXE 1CQYA 5KBNC 1T3FB 5IG7B 4HZAA 2FYYB 1X4XA 2XN9A 4LEOA 1EUTA 3AS0A 4YZFF 3D3VD 4U1KB 1WLHA 1I7ZA 4HWEL 3ESUF 2QSCH 5HGDA 1YEFL 1FSKB 1O0VA 3CC5B 5JMRA 4KQ4H 4L8SB 4K3HA 1YJDH 2BSSB 4P23B 3Q5YA 4U1GB 5SWSA 3BEVB 3OXSA 1SEQH 1IMHC 3QIUA 2D3VA 2R4SH 2VQ1A 4LNRB 1AKJD 3MV9E 1AH1A 5D7LB 2R2CA 5DR5L 3BHBB 3DX9B 2P4AB 1FFNA 1EIBA 1OT1A 1N4XH 1FHGA 1JYNA 3IFOB 5H8DA 3U46B 5DO2C 3IU3A 2Z4QA 1ZHKA 2AEWA 3CDCA 4NN7B 4YBQD 3OKYA 1T22A 1RJZB 1P1ZB 1G0DA 1N6VA 5TF1L 2Y9RT 2RJMA 5CLWA 1W0WA 2EYTB 3HI5H 4NWTH 1LMKA 5HGBA 1B4JL 4PJ5D 1XF4B 2MSPA 3H42L 4HF5L 3LIZL 2XRAL 5ACMA 2JJWA 5DQJB 15C8L 1PEZA 1LO4H 1Z9MA 4GUPA 4PRDA 3QI9C 2UYLA 5FOJA 3KJ4B 1I1AA 1BZ9A 4JFXA 3IFPB 5ERWB 4Q9CA 1FYTB 3N1PC 4I0CC 2Y36L 2VDPL 5J11C 4UDUB 1I7RA 4X5WB 2GI7A 5F7LB 4PGEA 1KF9B 1NFKA 1T6VN 4B5EA 3PGCB 4HDIA 1ES0A 1U3HA 1T4KB 3U9PL 4JY5L 4JO2H 2IPTH 3RVTC 1SYVA 5IFAH 4CGTA 4RRPA 1PG7W 1SEBA 3V4PH 4LLUA 4IDJH 3MV9B 5EC1A 1IGYA 1W8NA 3HUJB 5DMGC 4YDIL 1CD1B 2ID5A 1QSFA 4R4BA 3MRCA 2QBWA 4KHXH 3RNQB 3UTTD 3SPVA 3WDIA 5DK3A 4LBEA 2YEZA 2Y6SC 3GKWL 4LNVA 5HI5C 2YN5A 2DD8L 2J4WH 3ILQC 5IK3A 5T1LD 1TETL 2OI9B 3VJ6A 1J86A 3QXAB 3RPIA 3PHQB 1I1YB 5LGHL 3EYQD 1JIBA 3KLAB 1OF2B 4X9GA 5C0DB 3S3JA 5L2KE 3C5ZB 2JB6A 3NFNB 4V2CB 4HS3A 5JOFA 1LE9A 3NN8A 1Q38A 1EEZA 3FFCA 4JM2C 4D9RE 4F2MA 3LD8B 4R7DA 4PJ7E 2VSDA 3CFDB 4L1HA 5E00A 4JKLA 4XP6L 3L5XL 1N0LA 1QFOA 4YXHH 1U95B 1R5VA 3G6AB 1YEHH 1T5XA 4GXVH 2HVKA 1VHPA 3KPNA 2AKRB 2GTWA 5F7KC 4ZNEA 3UZEA 1WCBA 3MV7D 3TJEH 1U42A 4UOJA 3NABH 5LQBH 2WQ8A 1T2XA 4ZODA 1N3NA 3ARQA 4C83B 3H3PH 4NZUL 4ZFGH 4XMPH 2XPGB 4HIIB 3F7VB 3KNBA 1A7PH 4I0PD 2HMID 5DJCA 5CHNA 1OSPH 1RVFL 1MFBL 3AXLA 2DYPB 5CSZA 3E3QC 2GUOA 4R97B 2X9XA 2VYRE 3C09B 3OAUL 1X5XA 3PDOA 3N06B 1KENH 1S5HA 4PBVC 5FA4A 3FT3A 4XBEL