3QP4A

Crystal structure of cvir ligand-binding domain bound to c10-hsl
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
178
structure length
178
Chain Sequence
b'MRPLPAGLTASQQWTLLEWIHMAGHIETENELKAFLDQVLSQAPSERLLLALGRLNNQNQIQRLERVLNVSYPSDWLDQYMKENYAQHDPILRIHLGQGPVMWEERFNRAKGAEEKRFIAEATQNGMGSGITFSAASERNNIGSILSIAGREPGRNAALVAMLNCLTPHLHQAAIRVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CviR transcriptional regulator
molecule tags Transcription
source organism Chromobacterium violaceum
publication title A strategy for antagonizing quorum sensing.
pubmed doi rcsb
total genus 57
structure length 178
sequence length 178
ec nomenclature
pdb deposition date 2011-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03472 Autoind_bind Autoinducer binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.80 Alpha Beta 2-Layer Sandwich Beta-Lactamase Transcription factor LuxR-like, autoinducer-binding domain 3qp4A00
1H0MA 4Y13A 4Y17A 3QP8A 2Q0OA 3IX4A 5L10A 4LFUA 3QP2A 1L3LA 4Y15A 4LGWA 2UV0E 3JPUA 3IX8A 3IX3A 3QP6A 5L07A 3QP1A 5L09A 2AVXA 4NG2A 3QP4A 3QP5A 3SZTA
chains in the Genus database with same CATH superfamily
4BJPA 4PPRA 2CMNA 1I2SA 5A93A 5KZHA 5DJUA 3Q1FA 2WKQA 1PNEA 4QD4A 1GA9A 3HUOA 4B9OA 4Q0HA 5GLDA 1TF1A 1LSWA 3JPUA 5DF7A 1SCWA 2Y4AA 3CJMA 3FYZA 2X71A 4MN7A 1DJBA 2Y2IA 4KQRA 4I3JA 2HP9A 4S2MA 2ZLYA 3LR4A 4KZ8A 3MZDA 2HJ9C 5EM1A 2R9XA 3E2KA 3G35A 1PZPA 2HDSA 4E04A 5M18A 1K56A 2ZD8A 4E3JA 4F3LB 1D06A 2WK0A 2QHKA 2ZJ9A 3ZVWA 1KVLA 2W3HA 2QZ6A 1LLBA 3V39A 2OLVA 3B47A 3SZTA 1P97A 3BFEA 5GLAA 2Q0OA 4Y0TA 3HLBA 3C4OA 3BJNA 4EU0A 1GSWA 3SOIA 1PWCA 3O3VA 3EWKA 4R4SA 4BQMA 4GDNA 4OQIA 4WLAA 1OJGA 4IBXA 3ZG5A 1JNUA 3B3XA 2KLIA 5EOEA 4YNRA 3DTIA 4ZAMA 1CF0A 4LRXC 4BD1A 3FPWA 4XT2B 1WA9A 3T1RA 3IXHA 1W7FA 3H82B 3E4PA 1FQGA 1ES2A 4PM9A 1PI5A 2ZQ8A 2WGIA 2M7VA 3S4XA 4EQIA 4FUWA 4ZRRA 1XJ6A 3ZG0A 4UQIM 4OLGA 2HV1A 2B95A 3C2WA 1K57A 2QPNA 2GZAA 2XEPA 3IX3A 3G2ZA 3EQUA 3W4QA 4Y7PA 3MJQA 5GLCA 1ES4A 3KO6A 1YAXA 1YKDA 2V2FF 5TBMA 3R7WA 3RTYA 2O9BA 4S2JA 2OOLA 4Q8IA 4OP5A 3FC7A 3IT9A 4YFMA 2NUPC 4EXOA 4KQOA 3ZG7B 1Y4OA 4DF6A 1FILA 2Y2LA 3F1PB 3ULFA 4WL9A 5AVEA 5EPHA 2HDUA 4K0WA 3N8LA 5HWTA 4U0XA 4HJ3A 5FEFA 4Y0OA 3SS4A 1XJ3A 3IH9A 1DJAA 4BENA 4ETZA 3OPHA 3VOLA 4QB8A 2P9VB 4RQ9A 2QMIA 3HLWA 1G6OA 1W79A 2Y2GA 1VHMA 2Z2LB 1L0GA 3E4QA 1IYPA 1H0MA 4DXBA 1PWGA 4KG2A 3UB7A 4CJNA 3LY3A 4WM9A 4JF4A 3MS6A 3Q7ZA 3R7WB 4GS9B 4L0LA 1L0EA 3HBRA 1Y54A 1CQAA 4KUKA 5CEBA 1NWZA 2J8YA 4U0TA 3D3OA 1BZAA 1XGIA 3GR2A 1XJ2A 3T4JA 2P7JA 3BECA 1YLJA 1GCEA 3P7NA 4B4XA 1L3LA 4WUJA 4N1XA 3AGFA 3LIEA 5J3WA 1K4EA 3O5YA 1K57C 4LV2A 3UMDA 3BFFA 4DMZA 2J9PA 1IEMA 3ITBA 1GSXA 5CEDA 4OQGA 1FR1A 2XA7S 3LIFA 2XF3A 1BULA 3SH8A 1TVFA 4HP4A 5FSRA 2VZWA 3EQVA 1K25A 3A3FA 1S1ZA 3K3DA 1XXMA 3FWLA 3NOUC 3PYPA 3LIAA 4WZ4A 2FZ0A 3NOTC 2K2NA 1LSXA 3MZEA 4BL2A 2JE5A 5AJGA 3PAEA 4QY6A 4C6YA 3HLEA 4H6JB 3GV9A 4R23A 1LSVA 3BY9A 4O8GA 1S4SA 3OZHA 5HWVA 1KVMA 1K6RA 5HSQA 2VGJA 3JYIA 2PYRA 1P0ZA 2J3WA 2XA7M 3UB9A 1PZOA 1MWUA 4R0QA 4WF0A 3TSGA 4N9LA 1PRQA 5EV0A 3A3JA 3HLGA 4P6ZS 3UPOA 4P87A 1MXOA 4MBKA 3NDEA 4EWFA 1IYQA 2VKSA 4GD6A 4ZDXA 4Q0JA 4CQHA 4DE1A 3ZDJA 5HAIA 5TGFA 3LO7A 4JXWA 1PW8A 3CPTB 5CTMA 3W8KA 3E98A 3WWXA 2XFSA 2V1AA 4K08A 4OVDA 2HP5A 3LY4A 1WYCA 2JN7A 3H7WB 1EROA 4S2NC 1ZG6A 3T4SA 3W4PA 2X01A 2VX8A 2ZM8A 4CPKA 2C6WB 3ZVTA 5FEGA 1K6SA 1T18A 2V9AA 5L10A 5G4YA 3VE4A 1X0OA 1YLYA 4OKPA 1W5DA 3HLFA 4N1HA 2HDRA 1NZOA 2HPBA 2W3GA 3UO9A 1BLCA 1NZUA 4XUZA 3KSIA 2OWJA 3HLDA 4H6JA 3NHQA 3D9YA 4L9GA 4UA7A 2EX8A 4FD8A 1LL8A 3ZNYA 4QU3A 1K38A 3JVVA 1OPXA 2VGLM 1NLYA 4GJ4A 4S2PA 5DKKA 2I72A 2INWA 1XA7A 2JC7A 3IBRA 2ZC4B 1MWRA 4FH2A 3NIAA 4PKYG 4YWZA 2H28A 2CC1A 4HP9A 4OQHA 5IHVA 4CLCA 2D02A 4NXGA 4MMNA 3IF6A 1V9ZA 1LL9A 3PAGA 1IYOA 2Y79A 3UB8A 4WMCD 4XT2A 1H8ZA 5HARA 2XD5A 3KSFA 4WZ5C 3DW0A 3BLMA 3GRJA 1TS6A 3S7OA 3VMAA 3UB5P 3VP1A 1P9WA 2O0YA 5EVEA 4GN2A 4OOMA 2XFTA 3BY8A 3BYDA 4JF6A 2BASA 4IEDA 3QP1A 4EEPA 4UA9A 1LHYA 4PM8A 5HAQA 4R3JA 1UWNX 3TJZC 3DTKA 5CGXA 1C3BA 4H8RA 4EV4A 5KIZA 5FL3A 4KZ7A 4Y5FA 3ZG9B 5DTTA 2W0NA 3HVFA 1YLPA 1FCNA 2EWVA 5AVFA 3UB6A 3S22A 4UA6A 3OPLA 1OT6A 1SKFA 5DVAA 5DJTA 1NRFA 4JGOA 3ZFZA 1EI5A 4OLDA 2XLNA 1A0KA 1JVJA 2RL3A 1UWPX 3P01A 3QNBA 4L9FA 4MDZA 3CMZA 2XK1A 4KZBA 5MC7A 1VETB 3L7HA 2PR5A 4LENA 3IF6B 4KQDA 3MF0A 3IF6C 3P09A 4L9EA 3IHBA 3Q82A 5TBMB 5FDSA 4A5RA 3UPPA 4LV0A 2HF6A 5IU1A 1SZVA 1S4RA 4R3BA 3F1NA 2Z6CA 4UHUA 1JWPA 3V3SA 3IH8A 4X6TA 5HX9A 3MMHA 2PU4A 1O07A 3CUEA 1BTLA 4JGPA 2XGNA 4JXVA 3MFXA 5EM0A 3O88A 3MZFA 3BW6A 3O86A 4OPZA 1ONGA 4DDYA 1W63Q 3S7NA 2WKPA 3FZCA 5TFQA 1NRJA 3VOYA 4NEED 3MQ0A 4S2IA 2HGVA 3C8CA 1IKIA 2XQZA 3G6OA 2PU2A 1SKOB 4P6ZM 2J80A 1SDEA 4KZ5A 3M2JA 1H8MA 2JKGA 5AQAA 1RGZA 4NXBA 2Y2HA 4B4ZA 3OPPA 3DTMA 1U60A 3CITA 1OMEA 4EERA 5F69A 2A2LA 4Y0UA 2R9WA 2ZC7A 1OTEA 4DKIA 3N8SA 1KE3A 3IWOA 3OLOA 2OSUA 1OTIA 3N4IA 1N4OA 4OPYA 4Z9QA 1CI8A 1T1CA 4ZJ1A 1HVBA 5AQBA 1V9YA 2WZXA 3VP2A 1LT0A 2K7SA 4BMWA 4E6WA 4O01A 4ZBEA 3W4OA 4DXCA 2WKEA 1MZUA 4G3WA 1PIOA 1CEFA 3GQZA 5EVIA 1FCOA 2A49A 4IJGA 2UWXA 3HUMA 2ZQDA 3E4OA 1O7EA 4KZ3A 3T12B 3GDIA 3T1SA 4NXFA 4GHIB 4E3IA 5FDHA 2PR6A 1BLSA 3ZCZA 3V3RA 3P98A 4EUZA 3N7WA 1IYSA 2PBYA 1P9RA 4OH0A 1FR6A 1TDGA 2J3TC 3GECA 1N9LA 2H10A 4I3IA 1F9IA 1XGJA 2ZQ9A 3RJUA 2B5RA 4ZJ3A 2VJWA 3MQOA 4GS9A 2WGWA 2WAFA 3A0RA 1K55C 5L07A 5AQ7A 1ES5A 1G68A 5CHJA 3GMWA 2VV6A 4HY8A 5DF9A 3OPRA 4GOGA 4II7A 5CRFA 2QJ5A 3KYEA 3LEQA 4KZAA 2A24B 2W1TA 4HH3A 5F1FA 1KGFA 3H9WA 2Y91A 3KYZA 4MCWA 3VFFA 4K0XA 3MXQA 4CLCD 5J8XA 4I39A 1ALQA 4ZTKA 5FQMA 1G28A 2JHEA 5CX7A 3IXDA 5EVID 1J9MA 5KSCA 3BLSA 5HDCA 3CAXA 4B88A 2Y2QA 1HLUP 5HL6A 2DRWA 2ZL1B 2ZOIA 4ZJ2A 1NYYA 3QP5A 2Y59A 3A3IA 1PFLA 1YM1A 4OQ0A 3E2LA 4OPQA 4WYYA 4JXSA 1S66L 4YINA 4MBFA 3B33A 2PDRA 3MFDA 3IX8A 4KG5A 4WELA 4BD0A 4UQIS 3N8RA 4OOYA 2V8CA 1DP9A 2QYBA 3PR6A 4QY5A 4X56A 2V20A 3LEZA 1Z6FA 5CHMA 3MKEA 2BTFP 2HP6A 1MC0A 1DP8A 3EGXC 4R4RA 5EFWA 2Y2MA 2PBDP 4E3KA 1XP4A 4HOIA 2JKRI 2O9AA 2A3UA 2W3DA 4Y2FA 3VP3A 3B42A 3MR0A 2EXAA 1HD8A 1F2KA 3NCKA 5M19A 4R70A 1I5QA 2BLSA 3VP4A 2VV7A 5L2FA 2OAP1 4PM6A 5FAPA 2KOIA 2IWDA 3G31A 4EBNA 3EGDC 3TOIA 2FFYA 5EVIC 2XR0A 2JCHA 4HESA 4S2LA 4BBUA 2V0UA 5A8BA 3QP4A 2ZBBA 1FIKA 1D7EA 3M6BA 5FI2A 2GDNA 2J9OA 4BBVA 1LI0A 2J7VA 5IT5A 2MJ6A 4RVAA 4I3AA 4EEUA 4HBUA 3VFHA 1F5MA 2W1RA 1XFNA 4E3NA 2EX2A 3FPVA 2Y2NA 2IA2A 4JF5A 3WS2A 5KMWA 1TS8A 2P74A 2Y2JA 2G2UA 3K2NA 1JTGA 3T50A 1ERQA 1G5UA 1VQQA 1RP5A 3UNWA 4KQQA 1GSVA 2WKRA 3IXBA 4JGQA 3U2AA 3DBAA 5GL9A 3FV7A 3A3EA 4X53A 4C75A 1VETA 2D01A 2C5WB 3IX4A 1DP6A 3JVUA 2BG1A 1S0WA 4LGWA 3I7JA 2WGWB 3T4QA 1ZG4A 4F3LA 3IS2A 5E2GA 5EUAA 3SH7A 1OTAA 3NI9A 3UY6A 1K54A 3CZDA 3E0YA 2PHYA 2EFUA 2QJ7A 4N92A 2M1CA 4HBTA 1IELA 2JBFA 1TS0A 1YSPA 3NOPC 1VEUB 3Q81A 5FQIA 3SS5A 3LCEA 3UN7A 5GHYA 2WKIA 1DRMA 3EEHA 4S2OA 1ZC2A 2EX9A 4R3AA 1GHIA 2DNSA 2EX6A 1MY8A 4MN5A 4QPRA 5HPFA 1KDWA 1STZA 4GZBA 1KE0A 5M1AA 3DWZA 3OC2A 3LICA 2VGLS 3OBFA 4U3TA 1ESIA 4KUOA 4JGRA 5LBRA 3HJIA 1KE4A 2KDKA 3MKFA 1SHVA 1WYBA 3A0SA 3CWFA 2O99A 5GLBA 2OAQ1 3UE6A 3TW8A 4FH4A 4PKYA 1BUEA 2P04A 3T4TA 4S2NA 4LV1A 4XUXA 3C5AA 1M6KA 3GVBA 2PYPA 2WKHA 5F5YA 4R1GA 3LR3A 3LR5A 4Z1WA 5J7EA 2W27A 3BFDA 4R6LA 2M7UA 3NECA 3QP6A 3KSHA 4FSFA 4WN5A 4EESA 4D2OA 1YSQA 4O7DA 1MKMA 3A3DA 4JXGA 1XX2A 4E6XA 2G2WA 5EECA 1DJCA 4E3LA 4CLCE 1W63M 4NK3A 1BYWA 1I2WA 3G30A 2QWSA 3DAVA 5DTKA 5FI6A 4EBPA 1IFQA 1XPBA 2VK3A 1JWVA 3IHAA 4WEJA 5FQQA 4DE2A 3CHWP 1D1JA 3M2KA 3V67A 2L4RA 3T1XA 3IWQA 3S7QA 3OOVA 4M3KA 3WS5A 4R38A 4NXEA 2XH9A 1N9BA 2HJEA 3NJAA 1JTDA 2VLGA 5A91A 2ZMFA 3S7PA 5EVIB 4EQ1A 2OLUA 4Q0IA 3SH9A 1JWZA 5EOOA 3V50A 1T1BA 1F98A 2V8FA 4BLMA 3N6IA 3LIDA 1H5XA 1PYYA 2GJ3A 2XD1A 1YLTA 4YOFA 2E8JA 2YKFA 3NY4A 1E3UD 3PBQA 4IBRA 3TE8A 2ZM0A 2B02A 4DJ3A 3T4LA 3FKWA 2K31A 4F94A 4Y17A 3VV4A 4PM5A 3O87A 3Q07A 4K91A 4BBTA 4D60A 3NULA 3BRMA 5TR7A 2HZ5A 3MSHA 4ARZB 4IVIA 3F1NB 4ESPA 4P0MA 1E3UA 5E2EA 4DN0A 2ZQAA 3BFGA 3CPTA 3MBZA 3T4KA 4LCLA 2X02A 1ERMA 2PD7A 5HDDA 2ZC5B 2H0TA 1W8YA 3IS2B 2Y55A 3KX0X 1GHPA 1RCJA 2L0WA 2ACGA 3H7WA 1ONHA 1ZKJA 3VP0A 3R4KA 2VV8A 5L09A 4WMCA 1NJ4A 4E3OA 1ACFA 4G3VA 2XROA 3OCLA 3NBLA 2VEAA 1M40A 5F1GA 5F83A 5FAQA 3KYQA 3LFVA 4B93A 1NLZA 2W3FA 1ZHHB 4DJ2A 2FH5A 1T19A 3ZQ5A 3L9KA 1IKGA 2QKPA 1AWIA 2PRFA 2IWBA 4GDBA 3QHYA 2KX6A 1KGGA 4ME4A 2P9VA 1S67L 2ZM2A 3BM6A 3PBOA 3LI8A 4WBGA 2J3TD 1E25A 2JKTM 2EXBA 4FTXA 1K56D 5E2FA 1YPRA 4ARZA 4KZ6A 3G32A 4AFIA 2EA9A 2LB5A 4M4XA 1CEGA 3OCNA 2I9VA 4HH2A 4NETA 1XA1A 5D3OA 1MWSA 4MBHA 5CHUA 3LIBA 5CXWA 1BLHA 3EOIA 4KZ4A 2WGVA 2Y2PA 2XSSA 3WRZA 1K4FA 1K54C 1GHMA 3F1PA 3LUQA 3UDXA 3VSKA 3C7VA 4DE0A 2P08A 3W2ZA 4CLCB 5CGWA 1NXYA 4QWOA 3UPNA 3FG8A 1G6AA 1GA0A 5TJJA 1MKIA 3MQQA 3AGEA 3PTEA 4O0PA 3LR0A 3GTCA 4GW9A 5F82A 3UE3A 3BEBA 2ZC3B 2OWHA 4WZ5A 5BOHA 1FSWA 3CLOA 2ZQCA 2XRNA 2PD8A 4QHCA 1ESUA 4KZ9A 4X55A 4GCZA 5FQJA 4OP8A 3F1OB 3LI9A 3BQ8A 4RX2A 3U4LP 2ZL1A 3Q7VA 4ID4A 2W3EA 1EW0A 2UV0E 4RYEA 3PXPA 4LCMA 5HFOA 4CLCC 5EE8A 4MNRA 3MXRA 1XKZA 3G34A 3CUEC 3FKVA 4LRYC 3LGOA 1OJ5A 5DKLA 4Y3IA 4GD8A 1L0DA 2EFXA 1FOFA 4LFUA 5DTSA 5FQKA 1QMFA 2ZMVA 4I5SA 3M6HA 3UDIA 3AGDA 4DE3A 4DRTA 3HLCA 3BFCA 1Q2QA 1TEMA 1OTBA 3ZGAB 3PBSA 3WRTA 5JYOA 5JYPA 5I94A 5DFYA 3NDGA 2Q9NA 4OONA 2H0YA 5HD5A 3CI6A 2L1MA 3KSGA 1VM1A 4HHDA 3UE0A 2Q9MA 5HAPA 4X25A 3DWKA 1ODVA 2HDQA 2RCXA 1WE4A 3IQAA 2Y2OA 2YKHA 1ZTUA 5U47A 4UAAA 3SW1A 5EVLA 4OPRA 1Q2PA 2WYXA 5GHXA 1OT9A 4JKTA 1N9NA 5L8MA 1IOUA 4RA7A 1CJFA 2ZOHA 2WUQA 4X1LA 4EBLA 4S2KA 4QJGA 1EWZA 3H82A 1J3WA 4NKPA 3VE3A 1QMEA 5HL1A 3IBJA 3SS3A 5GHZA 3C38A 3UE1A 4HI4A 3ISGA 5G18A 2VA0A 3RFBA 1LL5A 3C4PA 3EEAA 5DF8A 4MN6A 3ZNTA 3MXSA 2JKTI 5C5KA 2DMWA 2Y8HA 2EWWA 1H3QA 1FSYA 3BWLA 1UGUA 3G4PA 3HUNA 4EETB 4KENB 3QP8A 5CGSA 3ZHHA 1YT4A 4X1MA 3WS1A 1PWDA 1K0KA 1ES3A 1T1AA 1OTDA 1MPLA 2O9CA 3T4OA 3PBNA 4N9KA 4LLOB 1TS7A 2IWCA 2V1ZA 3LYXA 4GB7A 4HQAA 1CI9A 3QP2A 3ZYTA 4HJ6A 5IS1A 2JKRM 3HCYA 5HW3A 3K3CA 1PI4A 2GX5A 2PT7A 5HWWA 5KSHA 1L2SA 3VOZA 1SKOA 4EUVA 4HJ4A 4JPMA 1VB6A 3C7UA 4GKUA 3HL9A 3IF5A 1PW1A 1K55A 1MWTA 2GNXA 5CERA 5A90A 4FCFA 1HZOA 4FOFA 2V1BA 4I38A 5FQ9A 1Z09A 3RXWA 3G2YA 2ZMAA 5FA7A 4LRZE 3ICYA 1N9OA 4DDSA 1YMXA 1BT5A 4XXRA 3TG9A 1AXBA 3F1OA 3A0VA 3CG5A 3GSGA 4JBFA 1YLZA 3WS4A 5HD3A 3C30A 2NUTC 4E3MA 1TDLA 5J4EA 1SDNA 4BWIA 4C3QA 1BSGA 5FAOA 3D72A 2E8IA 1LI9A 2WAEA 5G4ZA 4IUKA 2LB9A 4GHIA 4MEZA 4X68A 2G7UA 2OV5A 2B18A 2FFFB 3ITAA 4MLLA 4NG2A 5FI7A 3RH8B 5E43A 5HDSA 5CTNA 5F68A 3HREA 4Y13A 3PBRA 5HZHA 4RX3A 1E4DA 2ZC6B 3IWIA 1XFQA 5K5BA 3WS0A 1BLPA 1YLWA 3S1YA 3Q7VB 2ZQ7A 1L0FA 2Y2KA 3VSLA 4X69A 2WZZA 4P6BA 4P85A 3PHYA 3QNCA 5DFXA 2A24A 2W1TB 5E2HA 5I5LA 2PAVP 1TD5A 2V0WA 1KDSA 1VEUA 3D4FA 3V5MA 2XDMA 4EW7A 5FASA 1CK3A 3UMEA 5CECA 3NC8A 3DTEA 1HTZA 2Z2MB 4PMAA 1DY6A 4Y15A 4HNBA 2H5SA 2JKFA 1KOUA 4GLQA 5AQ9A 2Z6DA 3TRCA 1NY0A 4LPZA 1H8YA 4PM7A 2VGKA 1YMSA 1KGEA 2DCFA 2WADA 4PAUA 4BL3A 4HIAA 5FATA 4IHQA 4PHTA 3UDFA 5F6AA 4ETXA 5HPIA 4IUHA 2AVXA 1W8QA 1S6RA 4KG6A 1FCMA 3PBTA 2R78A 1MBLA 4GNUA 4IVKA 1NYMA 3T1QB 1YQSA 4UEYA 3IXGA 1Y28A 5A92A 3HJKA 4OOLA 1XJ4A 3RXXA 3BQAA 1S1YA 1RGYA 4JLFA 4WEKA 4G3KA 3ZG8B 4LV3A 4HEFA
chains in the Genus database with same CATH topology
1H0MA 4Y13A 4Y17A 3QP8A 2Q0OA 3IX4A 5L10A 4LFUA 3QP2A 1L3LA 4Y15A 4LGWA 2UV0E 3JPUA 3IX8A 3IX3A 3QP6A 5L07A 3QP1A 5L09A 2AVXA 4NG2A 3QP4A 3QP5A 3SZTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H0M A;  4Y13 A;  4Y17 A;  3QP8 A;  2Q0O A;  3IX4 A;  5L10 A;  4LFU A;  3QP2 A;  1L3L A;  4Y15 A;  4LGW A;  2UV0 E;  3JPU A;  3IX8 A;  3IX3 A;  3QP6 A;  5L07 A;  3QP1 A;  5L09 A;  2AVX A;  4NG2 A;  3QP4 A;  3QP5 A;  3SZT A; 
#chains in the Genus database with same CATH topology
 4BJP A;  4PPR A;  2CMN A;  1I2S A;  5A93 A;  5KZH A;  5DJU A;  3Q1F A;  2WKQ A;  1PNE A;  4QD4 A;  1GA9 A;  3HUO A;  4B9O A;  4Q0H A;  5GLD A;  1TF1 A;  1LSW A;  3JPU A;  5DF7 A;  1SCW A;  2Y4A A;  3CJM A;  3FYZ A;  2X71 A;  4MN7 A;  1DJB A;  2Y2I A;  4KQR A;  4I3J A;  2HP9 A;  4S2M A;  2ZLY A;  3LR4 A;  4KZ8 A;  3MZD A;  2HJ9 C;  5EM1 A;  2R9X A;  3E2K A;  3G35 A;  1PZP A;  2HDS A;  4E04 A;  5M18 A;  1K56 A;  2ZD8 A;  4E3J A;  4F3L B;  1D06 A;  2WK0 A;  2QHK A;  2ZJ9 A;  3ZVW A;  1KVL A;  2W3H A;  2QZ6 A;  1LLB A;  3V39 A;  2OLV A;  3B47 A;  3SZT A;  1P97 A;  3BFE A;  5GLA A;  2Q0O A;  4Y0T A;  3HLB A;  3C4O A;  3BJN A;  4EU0 A;  1GSW A;  3SOI A;  1PWC A;  3O3V A;  3EWK A;  4R4S A;  4BQM A;  4GDN A;  4OQI A;  4WLA A;  1OJG A;  4IBX A;  3ZG5 A;  1JNU A;  3B3X A;  2KLI A;  5EOE A;  4YNR A;  3DTI A;  4ZAM A;  1CF0 A;  4LRX C;  4BD1 A;  3FPW A;  4XT2 B;  1WA9 A;  3T1R A;  3IXH A;  1W7F A;  3H82 B;  3E4P A;  1FQG A;  1ES2 A;  4PM9 A;  1PI5 A;  2ZQ8 A;  2WGI A;  2M7V A;  3S4X A;  4EQI A;  4FUW A;  4ZRR A;  1XJ6 A;  3ZG0 A;  4UQI M;  4OLG A;  2HV1 A;  2B95 A;  3C2W A;  1K57 A;  2QPN A;  2GZA A;  2XEP A;  3IX3 A;  3G2Z A;  3EQU A;  3W4Q A;  4Y7P A;  3MJQ A;  5GLC A;  1ES4 A;  3KO6 A;  1YAX A;  1YKD A;  2V2F F;  5TBM A;  3R7W A;  3RTY A;  2O9B A;  4S2J A;  2OOL A;  4Q8I A;  4OP5 A;  3FC7 A;  3IT9 A;  4YFM A;  2NUP C;  4EXO A;  4KQO A;  3ZG7 B;  1Y4O A;  4DF6 A;  1FIL A;  2Y2L A;  3F1P B;  3ULF A;  4WL9 A;  5AVE A;  5EPH A;  2HDU A;  4K0W A;  3N8L A;  5HWT A;  4U0X A;  4HJ3 A;  5FEF A;  4Y0O A;  3SS4 A;  1XJ3 A;  3IH9 A;  1DJA A;  4BEN A;  4ETZ A;  3OPH A;  3VOL A;  4QB8 A;  2P9V B;  4RQ9 A;  2QMI A;  3HLW A;  1G6O A;  1W79 A;  2Y2G A;  1VHM A;  2Z2L B;  1L0G A;  3E4Q A;  1IYP A;  1H0M A;  4DXB A;  1PWG A;  4KG2 A;  3UB7 A;  4CJN A;  3LY3 A;  4WM9 A;  4JF4 A;  3MS6 A;  3Q7Z A;  3R7W B;  4GS9 B;  4L0L A;  1L0E A;  3HBR A;  1Y54 A;  1CQA A;  4KUK A;  5CEB A;  1NWZ A;  2J8Y A;  4U0T A;  3D3O A;  1BZA A;  1XGI A;  3GR2 A;  1XJ2 A;  3T4J A;  2P7J A;  3BEC A;  1YLJ A;  1GCE A;  3P7N A;  4B4X A;  1L3L A;  4WUJ A;  4N1X A;  3AGF A;  3LIE A;  5J3W A;  1K4E A;  3O5Y A;  1K57 C;  4LV2 A;  3UMD A;  3BFF A;  4DMZ A;  2J9P A;  1IEM A;  3ITB A;  1GSX A;  5CED A;  4OQG A;  1FR1 A;  2XA7 S;  3LIF A;  2XF3 A;  1BUL A;  3SH8 A;  1TVF A;  4HP4 A;  5FSR A;  2VZW A;  3EQV A;  1K25 A;  3A3F A;  1S1Z A;  3K3D A;  1XXM A;  3FWL A;  3NOU C;  3PYP A;  3LIA A;  4WZ4 A;  2FZ0 A;  3NOT C;  2K2N A;  1LSX A;  3MZE A;  4BL2 A;  2JE5 A;  5AJG A;  3PAE A;  4QY6 A;  4C6Y A;  3HLE A;  4H6J B;  3GV9 A;  4R23 A;  1LSV A;  3BY9 A;  4O8G A;  1S4S A;  3OZH A;  5HWV A;  1KVM A;  1K6R A;  5HSQ A;  2VGJ A;  3JYI A;  2PYR A;  1P0Z A;  2J3W A;  2XA7 M;  3UB9 A;  1PZO A;  1MWU A;  4R0Q A;  4WF0 A;  3TSG A;  4N9L A;  1PRQ A;  5EV0 A;  3A3J A;  3HLG A;  4P6Z S;  3UPO A;  4P87 A;  1MXO A;  4MBK A;  3NDE A;  4EWF A;  1IYQ A;  2VKS A;  4GD6 A;  4ZDX A;  4Q0J A;  4CQH A;  4DE1 A;  3ZDJ A;  5HAI A;  5TGF A;  3LO7 A;  4JXW A;  1PW8 A;  3CPT B;  5CTM A;  3W8K A;  3E98 A;  3WWX A;  2XFS A;  2V1A A;  4K08 A;  4OVD A;  2HP5 A;  3LY4 A;  1WYC A;  2JN7 A;  3H7W B;  1ERO A;  4S2N C;  1ZG6 A;  3T4S A;  3W4P A;  2X01 A;  2VX8 A;  2ZM8 A;  4CPK A;  2C6W B;  3ZVT A;  5FEG A;  1K6S A;  1T18 A;  2V9A A;  5L10 A;  5G4Y A;  3VE4 A;  1X0O A;  1YLY A;  4OKP A;  1W5D A;  3HLF A;  4N1H A;  2HDR A;  1NZO A;  2HPB A;  2W3G A;  3UO9 A;  1BLC A;  1NZU A;  4XUZ A;  3KSI A;  2OWJ A;  3HLD A;  4H6J A;  3NHQ A;  3D9Y A;  4L9G A;  4UA7 A;  2EX8 A;  4FD8 A;  1LL8 A;  3ZNY A;  4QU3 A;  1K38 A;  3JVV A;  1OPX A;  2VGL M;  1NLY A;  4GJ4 A;  4S2P A;  5DKK A;  2I72 A;  2INW A;  1XA7 A;  2JC7 A;  3IBR A;  2ZC4 B;  1MWR A;  4FH2 A;  3NIA A;  4PKY G;  4YWZ A;  2H28 A;  2CC1 A;  4HP9 A;  4OQH A;  5IHV A;  4CLC A;  2D02 A;  4NXG A;  4MMN A;  3IF6 A;  1V9Z A;  1LL9 A;  3PAG A;  1IYO A;  2Y79 A;  3UB8 A;  4WMC D;  4XT2 A;  1H8Z A;  5HAR A;  2XD5 A;  3KSF A;  4WZ5 C;  3DW0 A;  3BLM A;  3GRJ A;  1TS6 A;  3S7O A;  3VMA A;  3UB5 P;  3VP1 A;  1P9W A;  2O0Y A;  5EVE A;  4GN2 A;  4OOM A;  2XFT A;  3BY8 A;  3BYD A;  4JF6 A;  2BAS A;  4IED A;  3QP1 A;  4EEP A;  4UA9 A;  1LHY A;  4PM8 A;  5HAQ A;  4R3J A;  1UWN X;  3TJZ C;  3DTK A;  5CGX A;  1C3B A;  4H8R A;  4EV4 A;  5KIZ A;  5FL3 A;  4KZ7 A;  4Y5F A;  3ZG9 B;  5DTT A;  2W0N A;  3HVF A;  1YLP A;  1FCN A;  2EWV A;  5AVF A;  3UB6 A;  3S22 A;  4UA6 A;  3OPL A;  1OT6 A;  1SKF A;  5DVA A;  5DJT A;  1NRF A;  4JGO A;  3ZFZ A;  1EI5 A;  4OLD A;  2XLN A;  1A0K A;  1JVJ A;  2RL3 A;  1UWP X;  3P01 A;  3QNB A;  4L9F A;  4MDZ A;  3CMZ A;  2XK1 A;  4KZB A;  5MC7 A;  1VET B;  3L7H A;  2PR5 A;  4LEN A;  3IF6 B;  4KQD A;  3MF0 A;  3IF6 C;  3P09 A;  4L9E A;  3IHB A;  3Q82 A;  5TBM B;  5FDS A;  4A5R A;  3UPP A;  4LV0 A;  2HF6 A;  5IU1 A;  1SZV A;  1S4R A;  4R3B A;  3F1N A;  2Z6C A;  4UHU A;  1JWP A;  3V3S A;  3IH8 A;  4X6T A;  5HX9 A;  3MMH A;  2PU4 A;  1O07 A;  3CUE A;  1BTL A;  4JGP A;  2XGN A;  4JXV A;  3MFX A;  5EM0 A;  3O88 A;  3MZF A;  3BW6 A;  3O86 A;  4OPZ A;  1ONG A;  4DDY A;  1W63 Q;  3S7N A;  2WKP A;  3FZC A;  5TFQ A;  1NRJ A;  3VOY A;  4NEE D;  3MQ0 A;  4S2I A;  2HGV A;  3C8C A;  1IKI A;  2XQZ A;  3G6O A;  2PU2 A;  1SKO B;  4P6Z M;  2J80 A;  1SDE A;  4KZ5 A;  3M2J A;  1H8M A;  2JKG A;  5AQA A;  1RGZ A;  4NXB A;  2Y2H A;  4B4Z A;  3OPP A;  3DTM A;  1U60 A;  3CIT A;  1OME A;  4EER A;  5F69 A;  2A2L A;  4Y0U A;  2R9W A;  2ZC7 A;  1OTE A;  4DKI A;  3N8S A;  1KE3 A;  3IWO A;  3OLO A;  2OSU A;  1OTI A;  3N4I A;  1N4O A;  4OPY A;  4Z9Q A;  1CI8 A;  1T1C A;  4ZJ1 A;  1HVB A;  5AQB A;  1V9Y A;  2WZX A;  3VP2 A;  1LT0 A;  2K7S A;  4BMW A;  4E6W A;  4O01 A;  4ZBE A;  3W4O A;  4DXC A;  2WKE A;  1MZU A;  4G3W A;  1PIO A;  1CEF A;  3GQZ A;  5EVI A;  1FCO A;  2A49 A;  4IJG A;  2UWX A;  3HUM A;  2ZQD A;  3E4O A;  1O7E A;  4KZ3 A;  3T12 B;  3GDI A;  3T1S A;  4NXF A;  4GHI B;  4E3I A;  5FDH A;  2PR6 A;  1BLS A;  3ZCZ A;  3V3R A;  3P98 A;  4EUZ A;  3N7W A;  1IYS A;  2PBY A;  1P9R A;  4OH0 A;  1FR6 A;  1TDG A;  2J3T C;  3GEC A;  1N9L A;  2H10 A;  4I3I A;  1F9I A;  1XGJ A;  2ZQ9 A;  3RJU A;  2B5R A;  4ZJ3 A;  2VJW A;  3MQO A;  4GS9 A;  2WGW A;  2WAF A;  3A0R A;  1K55 C;  5L07 A;  5AQ7 A;  1ES5 A;  1G68 A;  5CHJ A;  3GMW A;  2VV6 A;  4HY8 A;  5DF9 A;  3OPR A;  4GOG A;  4II7 A;  5CRF A;  2QJ5 A;  3KYE A;  3LEQ A;  4KZA A;  2A24 B;  2W1T A;  4HH3 A;  5F1F A;  1KGF A;  3H9W A;  2Y91 A;  3KYZ A;  4MCW A;  3VFF A;  4K0X A;  3MXQ A;  4CLC D;  5J8X A;  4I39 A;  1ALQ A;  4ZTK A;  5FQM A;  1G28 A;  2JHE A;  5CX7 A;  3IXD A;  5EVI D;  1J9M A;  5KSC A;  3BLS A;  5HDC A;  3CAX A;  4B88 A;  2Y2Q A;  1HLU P;  5HL6 A;  2DRW A;  2ZL1 B;  2ZOI A;  4ZJ2 A;  1NYY A;  3QP5 A;  2Y59 A;  3A3I A;  1PFL A;  1YM1 A;  4OQ0 A;  3E2L A;  4OPQ A;  4WYY A;  4JXS A;  1S66 L;  4YIN A;  4MBF A;  3B33 A;  2PDR A;  3MFD A;  3IX8 A;  4KG5 A;  4WEL A;  4BD0 A;  4UQI S;  3N8R A;  4OOY A;  2V8C A;  1DP9 A;  2QYB A;  3PR6 A;  4QY5 A;  4X56 A;  2V20 A;  3LEZ A;  1Z6F A;  5CHM A;  3MKE A;  2BTF P;  2HP6 A;  1MC0 A;  1DP8 A;  3EGX C;  4R4R A;  5EFW A;  2Y2M A;  2PBD P;  4E3K A;  1XP4 A;  4HOI A;  2JKR I;  2O9A A;  2A3U A;  2W3D A;  4Y2F A;  3VP3 A;  3B42 A;  3MR0 A;  2EXA A;  1HD8 A;  1F2K A;  3NCK A;  5M19 A;  4R70 A;  1I5Q A;  2BLS A;  3VP4 A;  2VV7 A;  5L2F A;  2OAP 1;  4PM6 A;  5FAP A;  2KOI A;  2IWD A;  3G31 A;  4EBN A;  3EGD C;  3TOI A;  2FFY A;  5EVI C;  2XR0 A;  2JCH A;  4HES A;  4S2L A;  4BBU A;  2V0U A;  5A8B A;  3QP4 A;  2ZBB A;  1FIK A;  1D7E A;  3M6B A;  5FI2 A;  2GDN A;  2J9O A;  4BBV A;  1LI0 A;  2J7V A;  5IT5 A;  2MJ6 A;  4RVA A;  4I3A A;  4EEU A;  4HBU A;  3VFH A;  1F5M A;  2W1R A;  1XFN A;  4E3N A;  2EX2 A;  3FPV A;  2Y2N A;  2IA2 A;  4JF5 A;  3WS2 A;  5KMW A;  1TS8 A;  2P74 A;  2Y2J A;  2G2U A;  3K2N A;  1JTG A;  3T50 A;  1ERQ A;  1G5U A;  1VQQ A;  1RP5 A;  3UNW A;  4KQQ A;  1GSV A;  2WKR A;  3IXB A;  4JGQ A;  3U2A A;  3DBA A;  5GL9 A;  3FV7 A;  3A3E A;  4X53 A;  4C75 A;  1VET A;  2D01 A;  2C5W B;  3IX4 A;  1DP6 A;  3JVU A;  2BG1 A;  1S0W A;  4LGW A;  3I7J A;  2WGW B;  3T4Q A;  1ZG4 A;  4F3L A;  3IS2 A;  5E2G A;  5EUA A;  3SH7 A;  1OTA A;  3NI9 A;  3UY6 A;  1K54 A;  3CZD A;  3E0Y A;  2PHY A;  2EFU A;  2QJ7 A;  4N92 A;  2M1C A;  4HBT A;  1IEL A;  2JBF A;  1TS0 A;  1YSP A;  3NOP C;  1VEU B;  3Q81 A;  5FQI A;  3SS5 A;  3LCE A;  3UN7 A;  5GHY A;  2WKI A;  1DRM A;  3EEH A;  4S2O A;  1ZC2 A;  2EX9 A;  4R3A A;  1GHI A;  2DNS A;  2EX6 A;  1MY8 A;  4MN5 A;  4QPR A;  5HPF A;  1KDW A;  1STZ A;  4GZB A;  1KE0 A;  5M1A A;  3DWZ A;  3OC2 A;  3LIC A;  2VGL S;  3OBF A;  4U3T A;  1ESI A;  4KUO A;  4JGR A;  5LBR A;  3HJI A;  1KE4 A;  2KDK A;  3MKF A;  1SHV A;  1WYB A;  3A0S A;  3CWF A;  2O99 A;  5GLB A;  2OAQ 1;  3UE6 A;  3TW8 A;  4FH4 A;  4PKY A;  1BUE A;  2P04 A;  3T4T A;  4S2N A;  4LV1 A;  4XUX A;  3C5A A;  1M6K A;  3GVB A;  2PYP A;  2WKH A;  5F5Y A;  4R1G A;  3LR3 A;  3LR5 A;  4Z1W A;  5J7E A;  2W27 A;  3BFD A;  4R6L A;  2M7U A;  3NEC A;  3QP6 A;  3KSH A;  4FSF A;  4WN5 A;  4EES A;  4D2O A;  1YSQ A;  4O7D A;  1MKM A;  3A3D A;  4JXG A;  1XX2 A;  4E6X A;  2G2W A;  5EEC A;  1DJC A;  4E3L A;  4CLC E;  1W63 M;  4NK3 A;  1BYW A;  1I2W A;  3G30 A;  2QWS A;  3DAV A;  5DTK A;  5FI6 A;  4EBP A;  1IFQ A;  1XPB A;  2VK3 A;  1JWV A;  3IHA A;  4WEJ A;  5FQQ A;  4DE2 A;  3CHW P;  1D1J A;  3M2K A;  3V67 A;  2L4R A;  3T1X A;  3IWQ A;  3S7Q A;  3OOV A;  4M3K A;  3WS5 A;  4R38 A;  4NXE A;  2XH9 A;  1N9B A;  2HJE A;  3NJA A;  1JTD A;  2VLG A;  5A91 A;  2ZMF A;  3S7P A;  5EVI B;  4EQ1 A;  2OLU A;  4Q0I A;  3SH9 A;  1JWZ A;  5EOO A;  3V50 A;  1T1B A;  1F98 A;  2V8F A;  4BLM A;  3N6I A;  3LID A;  1H5X A;  1PYY A;  2GJ3 A;  2XD1 A;  1YLT A;  4YOF A;  2E8J A;  2YKF A;  3NY4 A;  1E3U D;  3PBQ A;  4IBR A;  3TE8 A;  2ZM0 A;  2B02 A;  4DJ3 A;  3T4L A;  3FKW A;  2K31 A;  4F94 A;  4Y17 A;  3VV4 A;  4PM5 A;  3O87 A;  3Q07 A;  4K91 A;  4BBT A;  4D60 A;  3NUL A;  3BRM A;  5TR7 A;  2HZ5 A;  3MSH A;  4ARZ B;  4IVI A;  3F1N B;  4ESP A;  4P0M A;  1E3U A;  5E2E A;  4DN0 A;  2ZQA A;  3BFG A;  3CPT A;  3MBZ A;  3T4K A;  4LCL A;  2X02 A;  1ERM A;  2PD7 A;  5HDD A;  2ZC5 B;  2H0T A;  1W8Y A;  3IS2 B;  2Y55 A;  3KX0 X;  1GHP A;  1RCJ A;  2L0W A;  2ACG A;  3H7W A;  1ONH A;  1ZKJ A;  3VP0 A;  3R4K A;  2VV8 A;  5L09 A;  4WMC A;  1NJ4 A;  4E3O A;  1ACF A;  4G3V A;  2XRO A;  3OCL A;  3NBL A;  2VEA A;  1M40 A;  5F1G A;  5F83 A;  5FAQ A;  3KYQ A;  3LFV A;  4B93 A;  1NLZ A;  2W3F A;  1ZHH B;  4DJ2 A;  2FH5 A;  1T19 A;  3ZQ5 A;  3L9K A;  1IKG A;  2QKP A;  1AWI A;  2PRF A;  2IWB A;  4GDB A;  3QHY A;  2KX6 A;  1KGG A;  4ME4 A;  2P9V A;  1S67 L;  2ZM2 A;  3BM6 A;  3PBO A;  3LI8 A;  4WBG A;  2J3T D;  1E25 A;  2JKT M;  2EXB A;  4FTX A;  1K56 D;  5E2F A;  1YPR A;  4ARZ A;  4KZ6 A;  3G32 A;  4AFI A;  2EA9 A;  2LB5 A;  4M4X A;  1CEG A;  3OCN A;  2I9V A;  4HH2 A;  4NET A;  1XA1 A;  5D3O A;  1MWS A;  4MBH A;  5CHU A;  3LIB A;  5CXW A;  1BLH A;  3EOI A;  4KZ4 A;  2WGV A;  2Y2P A;  2XSS A;  3WRZ A;  1K4F A;  1K54 C;  1GHM A;  3F1P A;  3LUQ A;  3UDX A;  3VSK A;  3C7V A;  4DE0 A;  2P08 A;  3W2Z A;  4CLC B;  5CGW A;  1NXY A;  4QWO A;  3UPN A;  3FG8 A;  1G6A A;  1GA0 A;  5TJJ A;  1MKI A;  3MQQ A;  3AGE A;  3PTE A;  4O0P A;  3LR0 A;  3GTC A;  4GW9 A;  5F82 A;  3UE3 A;  3BEB A;  2ZC3 B;  2OWH A;  4WZ5 A;  5BOH A;  1FSW A;  3CLO A;  2ZQC A;  2XRN A;  2PD8 A;  4QHC A;  1ESU A;  4KZ9 A;  4X55 A;  4GCZ A;  5FQJ A;  4OP8 A;  3F1O B;  3LI9 A;  3BQ8 A;  4RX2 A;  3U4L P;  2ZL1 A;  3Q7V A;  4ID4 A;  2W3E A;  1EW0 A;  2UV0 E;  4RYE A;  3PXP A;  4LCM A;  5HFO A;  4CLC C;  5EE8 A;  4MNR A;  3MXR A;  1XKZ A;  3G34 A;  3CUE C;  3FKV A;  4LRY C;  3LGO A;  1OJ5 A;  5DKL A;  4Y3I A;  4GD8 A;  1L0D A;  2EFX A;  1FOF A;  4LFU A;  5DTS A;  5FQK A;  1QMF A;  2ZMV A;  4I5S A;  3M6H A;  3UDI A;  3AGD A;  4DE3 A;  4DRT A;  3HLC A;  3BFC A;  1Q2Q A;  1TEM A;  1OTB A;  3ZGA B;  3PBS A;  3WRT A;  5JYO A;  5JYP A;  5I94 A;  5DFY A;  3NDG A;  2Q9N A;  4OON A;  2H0Y A;  5HD5 A;  3CI6 A;  2L1M A;  3KSG A;  1VM1 A;  4HHD A;  3UE0 A;  2Q9M A;  5HAP A;  4X25 A;  3DWK A;  1ODV A;  2HDQ A;  2RCX A;  1WE4 A;  3IQA A;  2Y2O A;  2YKH A;  1ZTU A;  5U47 A;  4UAA A;  3SW1 A;  5EVL A;  4OPR A;  1Q2P A;  2WYX A;  5GHX A;  1OT9 A;  4JKT A;  1N9N A;  5L8M A;  1IOU A;  4RA7 A;  1CJF A;  2ZOH A;  2WUQ A;  4X1L A;  4EBL A;  4S2K A;  4QJG A;  1EWZ A;  3H82 A;  1J3W A;  4NKP A;  3VE3 A;  1QME A;  5HL1 A;  3IBJ A;  3SS3 A;  5GHZ A;  3C38 A;  3UE1 A;  4HI4 A;  3ISG A;  5G18 A;  2VA0 A;  3RFB A;  1LL5 A;  3C4P A;  3EEA A;  5DF8 A;  4MN6 A;  3ZNT A;  3MXS A;  2JKT I;  5C5K A;  2DMW A;  2Y8H A;  2EWW A;  1H3Q A;  1FSY A;  3BWL A;  1UGU A;  3G4P A;  3HUN A;  4EET B;  4KEN B;  3QP8 A;  5CGS A;  3ZHH A;  1YT4 A;  4X1M A;  3WS1 A;  1PWD A;  1K0K A;  1ES3 A;  1T1A A;  1OTD A;  1MPL A;  2O9C A;  3T4O A;  3PBN A;  4N9K A;  4LLO B;  1TS7 A;  2IWC A;  2V1Z A;  3LYX A;  4GB7 A;  4HQA A;  1CI9 A;  3QP2 A;  3ZYT A;  4HJ6 A;  5IS1 A;  2JKR M;  3HCY A;  5HW3 A;  3K3C A;  1PI4 A;  2GX5 A;  2PT7 A;  5HWW A;  5KSH A;  1L2S A;  3VOZ A;  1SKO A;  4EUV A;  4HJ4 A;  4JPM A;  1VB6 A;  3C7U A;  4GKU A;  3HL9 A;  3IF5 A;  1PW1 A;  1K55 A;  1MWT A;  2GNX A;  5CER A;  5A90 A;  4FCF A;  1HZO A;  4FOF A;  2V1B A;  4I38 A;  5FQ9 A;  1Z09 A;  3RXW A;  3G2Y A;  2ZMA A;  5FA7 A;  4LRZ E;  3ICY A;  1N9O A;  4DDS A;  1YMX A;  1BT5 A;  4XXR A;  3TG9 A;  1AXB A;  3F1O A;  3A0V A;  3CG5 A;  3GSG A;  4JBF A;  1YLZ A;  3WS4 A;  5HD3 A;  3C30 A;  2NUT C;  4E3M A;  1TDL A;  5J4E A;  1SDN A;  4BWI A;  4C3Q A;  1BSG A;  5FAO A;  3D72 A;  2E8I A;  1LI9 A;  2WAE A;  5G4Z A;  4IUK A;  2LB9 A;  4GHI A;  4MEZ A;  4X68 A;  2G7U A;  2OV5 A;  2B18 A;  2FFF B;  3ITA A;  4MLL A;  4NG2 A;  5FI7 A;  3RH8 B;  5E43 A;  5HDS A;  5CTN A;  5F68 A;  3HRE A;  4Y13 A;  3PBR A;  5HZH A;  4RX3 A;  1E4D A;  2ZC6 B;  3IWI A;  1XFQ A;  5K5B A;  3WS0 A;  1BLP A;  1YLW A;  3S1Y A;  3Q7V B;  2ZQ7 A;  1L0F A;  2Y2K A;  3VSL A;  4X69 A;  2WZZ A;  4P6B A;  4P85 A;  3PHY A;  3QNC A;  5DFX A;  2A24 A;  2W1T B;  5E2H A;  5I5L A;  2PAV P;  1TD5 A;  2V0W A;  1KDS A;  1VEU A;  3D4F A;  3V5M A;  2XDM A;  4EW7 A;  5FAS A;  1CK3 A;  3UME A;  5CEC A;  3NC8 A;  3DTE A;  1HTZ A;  2Z2M B;  4PMA A;  1DY6 A;  4Y15 A;  4HNB A;  2H5S A;  2JKF A;  1KOU A;  4GLQ A;  5AQ9 A;  2Z6D A;  3TRC A;  1NY0 A;  4LPZ A;  1H8Y A;  4PM7 A;  2VGK A;  1YMS A;  1KGE A;  2DCF A;  2WAD A;  4PAU A;  4BL3 A;  4HIA A;  5FAT A;  4IHQ A;  4PHT A;  3UDF A;  5F6A A;  4ETX A;  5HPI A;  4IUH A;  2AVX A;  1W8Q A;  1S6R A;  4KG6 A;  1FCM A;  3PBT A;  2R78 A;  1MBL A;  4GNU A;  4IVK A;  1NYM A;  3T1Q B;  1YQS A;  4UEY A;  3IXG A;  1Y28 A;  5A92 A;  3HJK A;  4OOL A;  1XJ4 A;  3RXX A;  3BQA A;  1S1Y A;  1RGY A;  4JLF A;  4WEK A;  4G3K A;  3ZG8 B;  4LV3 A;  4HEF A; 
#chains in the Genus database with same CATH homology
 1H0M A;  4Y13 A;  4Y17 A;  3QP8 A;  2Q0O A;  3IX4 A;  5L10 A;  4LFU A;  3QP2 A;  1L3L A;  4Y15 A;  4LGW A;  2UV0 E;  3JPU A;  3IX8 A;  3IX3 A;  3QP6 A;  5L07 A;  3QP1 A;  5L09 A;  2AVX A;  4NG2 A;  3QP4 A;  3QP5 A;  3SZT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...