3QP8A

Crystal structure of cvir (chromobacterium violaceum 12472) ligand-binding domain bound to c10-hsl
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
179
structure length
179
Chain Sequence
b'ARPLPAGLTASQQWTLLEWIHMAGHIETEGELKAFLDNILSQAPSDRIILVLGRLNNQNQIQRMEKVLNVSYPSDWLNQYSQENFAQHDPIMRIHLGQGPVIWEERFSRAKGSEEKRFIAEASSNGMGSGITFSAASDRNNVGSILSIGGKEPGRNAALVAMLNCLTPHLHQAAVRIAN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CviR transcriptional regulator
publication title A strategy for antagonizing quorum sensing.
pubmed doi rcsb
source organism Chromobacterium violaceum
molecule tags Transcription
total genus 54
structure length 179
sequence length 179
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03472 Autoind_bind Autoinducer binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.80 Alpha Beta 2-Layer Sandwich Beta-Lactamase Transcription factor LuxR-like, autoinducer-binding domain 3qp8A00
3IX4A 3QP2A 3SZTA 2UV0E 3QP6A 4NG2A 1L3LA 3IX8A 4LGWA 2Q0OA 3QP1A 4Y15A 3QP5A 5L10A 3QP8A 3JPUA 5L07A 5L09A 4Y17A 3QP4A 4Y13A 4LFUA 1H0MA 3IX3A 2AVXA
chains in the Genus database with same CATH superfamily
1MKMA 4GOGA 1FR6A 1OJ5A 2C5WB 2IWDA 2WKRA 3G6OA 1EWZA 1V9YA 5EOEA 2A24A 1SDNA 3IX3A 4NXGA 2DCFA 3S7OA 3BWLA 1BZAA 4O7DA 5KIZA 4M3KA 3VP3A 1TDGA 2OWHA 3KSIA 3PBOA 2K31A 5EOOA 1MWUA 3UDXA 2Z6DA 1C3BA 3IXGA 3JPUA 4HHDA 5GHXA 5LBRA 5EVIC 5HPIA 1NXYA 3G4PA 2V8CA 5MC7A 3VP4A 5EM0A 4S2KA 3E4QA 3HUMA 2HV1A 3HUOA 1NLZA 4HEFA 5E2FA 4S2NA 4H6JA 3FZCA 2B18A 2Y2GA 2WZXA 1JWZA 5HARA 1VB6A 4O01A 2QWSA 3A0VA 4S2PA 3W4OA 4XT2B 1NZUA 1YLTA 1JWPA 2DNSA 2H0YA 3M6BA 4GDBA 3EOIA 4CLCC 4ETZA 1YLPA 3S7QA 2VEAA 2Y2IA 1G68A 2Y59A 3FG8A 3UE1A 3U4LP 5CX7A 2QJ5A 1H0MA 4PKYG 1JWVA 2VJWA 3WS0A 4DN0A 1ZC2A 1K54C 5AVEA 2Y55A 1GHMA 1G6AA 2WADA 3C38A 2PU2A 1IELA 2XD5A 3T4SA 3ZGAB 4BWIA 3SS3A 3IF6C 1PIOA 3VOLA 4FSFA 2GJ3A 1LSXA 1L0EA 3T4LA 3GQZA 4B4XA 3C4PA 3UB6A 3EEHA 1O07A 5F83A 5HX9A 5M1AA 4KUKA 5CTMA 4GZBA 2ZC7A 1ZG4A 3DAVA 3QHYA 4Y5FA 2O0YA 3HJKA 1W7FA 3LY3A 4Y17A 3D72A 2Y91A 1QMFA 5CERA 4UAAA 3O88A 1PYYA 3ZHHA 1BTLA 3MKFA 4R23A 3IS2B 2P9VB 1XJ3A 4RQ9A 1XA1A 5IU1A 3OBFA 5F5YA 2HPBA 5L2FA 4C75A 4QJGA 3KX0X 2QYBA 2HP6A 2KDKA 5FAPA 1WE4A 3IQAA 1XJ4A 4HH3A 1YLYA 4KQRA 5FQIA 4JGOA 1W8YA 4S2JA 2EXBA 4EETB 2KX6A 4I3AA 1KDWA 3TRCA 1S66L 1VQQA 2PU4A 4R0QA 2HDQA 2PBYA 1T1BA 3QP8A 1GSWA 3WS2A 3IXHA 3C4OA 2W27A 3O5YA 4XXRA 2Q9MA 3H7WA 4X55A 1G6OA 3IH9A 5L8MA 3BFCA 5FQKA 5DJUA 3FV7A 4HOIA 3C5AA 2PBDP 4LGWA 4EQ1A 1ALQA 1S6RA 1SZVA 2WGWA 4PPRA 1Z6FA 3D9YA 1TDLA 1S1YA 2V20A 2WGIA 4PAUA 2PD8A 4OLDA 1HZOA 1SDEA 3PTEA 1J3WA 1NYMA 2Y2NA 3EWKA 3A0RA 3B42A 1AXBA 4EBNA 4OQ0A 1IYOA 3FC7A 1VETB 4K0XA 2W3GA 4ETXA 2JKRM 4DE3A 4NEED 3E4OA 1S0WA 2V9AA 2Y2LA 2PRFA 1UGUA 1CI8A 3VSKA 5A92A 1JTGA 5F1GA 1K55C 3PHYA 3FPVA 2DRWA 4MBFA 2J9PA 1ZG6A 4XUZA 5J4EA 3LR4A 1OT6A 5FQMA 2HGVA 4EWFA 4YNRA 3ZVTA 4CQHA 2FFFB 3PBTA 2V2FF 4DE2A 2EWWA 3N4IA 1VM1A 4HI4A 2XF3A 3SZTA 1HTZA 3CI6A 5AVFA 2L4RA 1NRJA 3MSHA 1PRQA 3ZYTA 2JBFA 3LEZA 3GRJA 4F94A 4F3LB 3VFFA 4E3OA 3BRMA 4U0XA 1RGZA 5F68A 2V1BA 3W2ZA 5CHJA 4YWZA 2VV7A 3R7WA 4KZ7A 5FAQA 5TFQA 2Y2OA 3LICA 2GDNA 1BUEA 3RJUA 1SHVA 2JE5A 1P9RA 1RGYA 1N9NA 1TS0A 1BLHA 1X0OA 4ME4A 5D3OA 4EV4A 2UV0E 1DJAA 4HQAA 2OOLA 4E3MA 1IYPA 2GNXA 4CPKA 3ZG7B 2ZQCA 3L9KA 3CITA 2JN7A 4MCWA 4GW9A 3GMWA 2XRNA 1OTDA 5FA7A 2WGVA 3E98A 1CQAA 5A93A 5E2HA 3CUEC 2WK0A 4RVAA 3CPTA 2KLIA 4PM5A 1STZA 3RH8B 3WWXA 2K2NA 3P09A 3T4TA 5CRFA 2BLSA 2H10A 5FEGA 5A90A 1K0KA 1ACFA 2ZMFA 4MBHA 5JYPA 2JKFA 1V9ZA 3PAGA 4NXBA 4NXEA 4X1MA 4GJ4A 2J3TC 5FI2A 1F2KA 4E3IA 2PAVP 4BMWA 1D1JA 3LI9A 3HREA 1MZUA 4DJ3A 4LLOB 3UE6A 3E2KA 3KYEA 1OT9A 4BD1A 4I39A 5DFXA 4QPRA 2D01A 3T1XA 1KGGA 3NC8A 4PMAA 4WEJA 3DBAA 3A3EA 1SKOA 1SKFA 3FPWA 1BLPA 3FKWA 4WBGA 4N92A 4ZJ1A 2L1MA 1WYCA 4WYYA 1NWZA 4LCMA 5F82A 4BLMA 3NULA 3M6HA 4KZ9A 4R70A 5EVIB 2XSSA 1CEFA 5CGWA 1XPBA 1JTDA 4KZAA 4FUWA 4P0MA 2HF6A 2XLNA 1AWIA 4BENA 5FI6A 4YFMA 5HDDA 1BSGA 3P98A 3QP6A 4OOYA 5FDHA 2OV5A 1IFQA 1NRFA 4ZJ2A 4LENA 4DJ2A 4DE0A 1HVBA 3GV9A 2E8IA 2W3FA 4EBPA 2I72A 5CTNA 3HBRA 1W8QA 4FH4A 4WZ5A 1FILA 4GCZA 3G31A 4X1LA 4CLCB 3UB8A 4JGPA 5E2GA 4FTXA 3UO9A 1XGJA 1K57A 4MEZA 1VEUA 3F1PA 5HWWA 2JKRI 3V67A 4KZ3A 4Y0TA 3D3OA 3HL9A 3O87A 4DDYA 3IF6B 5DJTA 2GZAA 4PM9A 3DWZA 1RP5A 3WS5A 4LCLA 4NXFA 3ISGA 4JBFA 5GHZA 5FATA 3HCYA 2A2LA 4MLLA 1KE4A 1KOUA 2B95A 3NECA 5DKKA 2AVXA 5AJGA 2ZC6B 3H82B 1I2SA 1D7EA 1MBLA 3BLMA 3OPRA 3LO7A 4FH2A 4I5SA 1K57C 3NHQA 5GLAA 5DF9A 3DTIA 3WS4A 3K2NA 1ONHA 1JNUA 1ONGA 4IBRA 1YMXA 2IA2A 3TOIA 1KDSA 5FDSA 1BYWA 3HLGA 4KZ8A 2YKFA 4OONA 1P97A 3AGFA 3EEAA 3EQUA 3QNBA 4CJNA 3E0YA 2JKTI 5HAPA 1K6RA 2VV8A 1NZOA 3KYZA 1QMEA 5FEFA 2ZL1B 4ID4A 1KVLA 4Y7PA 2XD1A 2ZC3B 2V8FA 1I5QA 4HJ6A 1IKIA 4OPQA 2HDRA 1UWNX 2IWCA 3MQOA 4X56A 2EX9A 1ZTUA 5GL9A 4X6TA 4E3KA 2XFTA 4Y0UA 1ERQA 3OCNA 4GKUA 1YM1A 3LI8A 3OPHA 4Q0JA 3NJAA 4OH0A 2XA7S 4JF4A 2HZ5A 4JXWA 4OP5A 3NDGA 4KZ4A 3QP4A 1H3QA 4QY6A 3E2LA 3VP0A 3N8LA 4HESA 1DY6A 2FZ0A 3MJQA 2WKHA 4XUXA 1YLJA 4S2NC 3V50A 1BULA 4LRZE 2PYRA 5DTSA 1ZKJA 2HDUA 3H9WA 1P9WA 3TSGA 4P6BA 3BQAA 3LY4A 5TR7A 2ZLYA 1DP9A 3F1NB 5F69A 3Q7VB 1PW1A 4HIAA 1S67L 1DP6A 2ZOHA 4IVKA 4JGQA 1LSWA 1CK3A 2VZWA 3M2KA 1MY8A 4XT2A 1OTAA 1K56D 3LIEA 3WS1A 2VLGA 4E3NA 1XFNA 5GLCA 4BQMA 4E6WA 4E6XA 5J7EA 4ZBEA 5GLBA 3I7JA 3T50A 3NIAA 3NI9A 5DFYA 5CXWA 1K4EA 2PHYA 2X71A 5DTKA 1L0GA 1KE3A 2NUPC 3T4KA 5FASA 1T19A 2H28A 3HLFA 1H8ZA 1OTBA 1Q2QA 1K4FA 1IOUA 4ZAMA 2EA9A 3BFDA 4K91A 1T1CA 4X53A 5TJJA 4EERA 1L0DA 1M40A 5HAQA 2ZQ9A 5J8XA 5IT5A 4PM6A 3HJIA 4YOFA 1ES5A 3LIDA 4JPMA 4L9FA 4IUKA 3UMEA 5TBMB 4DE1A 4WELA 2BASA 3QP5A 3KO6A 1H8YA 3IHAA 3IWIA 3PBQA 3SH9A 3ZG0A 5HDCA 4Y3IA 2QZ6A 4ARZB 5DTTA 5EE8A 5CEDA 3G35A 3G2YA 2Y2JA 1BLCA 1IYQA 1YSQA 4OQGA 4MN6A 3C2WA 2W1RA 3MZEA 4JXGA 3NDEA 3JVVA 3IS2A 2P9VA 3Q07A 3N6IA 3KSGA 1Z09A 2H5SA 4EEPA 3Q7ZA 4I3JA 4KG2A 4Y2FA 2ZMVA 4BL2A 1W63Q 3VE3A 3IWOA 2XGNA 1K6SA 3CAXA 1EI5A 5HL6A 2M7UA 4IHQA 1YSPA 4R3AA 5C5KA 3VMAA 4OPRA 2XA7M 3HLBA 5F6AA 4PM8A 2G2WA 3G34A 4R3JA 3CHWP 4G3VA 1CI9A 4UHUA 2QPNA 4KZBA 3LGOA 2LB5A 4MMNA 3HLCA 4Z9QA 4E3LA 1LHYA 3LFVA 5CGXA 4DKIA 1F9IA 5IS1A 4IEDA 1N9BA 4DXCA 3BW6A 4QU3A 2ZM0A 4O0PA 3ZG8B 1OJGA 5L10A 2V1AA 4QB8A 1MPLA 2BTFP 4R6LA 4C3QA 4OQIA 5G18A 2A3UA 2Y8HA 1XGIA 2JCHA 2WKIA 3MFDA 1VETA 1NJ4A 3OZHA 3P01A 2W1TB 1W5DA 3FWLA 2KOIA 2Q0OA 2R9WA 4II7A 5HFOA 3D4FA 3ITBA 1LL8A 5HD5A 5EM1A 3T1QB 2V0WA 4FD8A 3HUNA 3W4QA 2XH9A 1MXOA 3UNWA 3AGEA 2Q9NA 1PI4A 2M1CA 4LV1A 1PNEA 2R9XA 5U47A 4FCFA 3TJZC 3K3CA 3P7NA 3HLWA 4JKTA 3MXRA 3LUQA 4OVDA 3MQ0A 4GD8A 5KZHA 3Q81A 4Z1WA 2OWJA 3VFHA 5CGSA 4FOFA 3CMZA 3KSHA 4F3LA 4JF5A 1BLSA 1OTEA 4KQOA 3VSLA 4WUJA 3F1OB 2OSUA 3SOIA 4MDZA 1DRMA 1P0ZA 3BQ8A 1PFLA 2P74A 1MWTA 2HJEA 1FSWA 1XKZA 4IUHA 3W4PA 2ZQ7A 4BBVA 3S22A 3BY9A 4LV3A 5M19A 1LT0A 3N7WA 2WAFA 2ZM8A 3WRZA 2X01A 5GHYA 3UB5P 4KZ5A 3GSGA 1E4DA 4OP8A 3R4KA 1LI9A 2FH5A 3GVBA 3G2ZA 5I94A 1ZHHB 3LEQA 3B33A 4GHIB 1FCMA 4WLAA 3ZG5A 5J3WA 4GB7A 3LIBA 2NUTC 2EX2A 2WYXA 1GA9A 1KGEA 1CEGA 3FYZA 3ITAA 4GS9B 2HP5A 3UPPA 1L3LA 5KSCA 3L7HA 1S4RA 4KG5A 5FL3A 1MKIA 5HSQA 1YQSA 5HAIA 2V0UA 3PBRA 3LR5A 3HVFA 3MXSA 1CF0A 2C6WB 4LRYC 1ODVA 4AFIA 3UB9A 1XP4A 2A24B 3MS6A 3CG5A 3V5MA 1S4SA 4LPZA 2ZMAA 4KUOA 2Y4AA 4N1XA 1G28A 3IH8A 4NETA 4PKYA 4ZRRA 2J3WA 5EECA 2QMIA 3MMHA 1O7EA 3UPOA 1YAXA 1FOFA 2E8JA 2I9VA 5HPFA 2WUQA 2ZQDA 4MN5A 2VGLM 2JC7A 5M18A 2VA0A 3T12B 3QP1A 2O9AA 4PHTA 5FQJA 3QNCA 2J7VA 4HH2A 3C7UA 4S2IA 4I3IA 3NOUC 4X68A 4H6JB 4X69A 1EROA 1CJFA 5EVIA 3DTMA 2EX6A 2Y2KA 3RXXA 1N9OA 3OPPA 1YKDA 2HDSA 4E04A 1XJ2A 5FQQA 2Y79A 4OOLA 1VHMA 2EFXA 1WYBA 4WZ4A 2VK3A 4WZ5C 1E25A 1FSYA 3T4QA 3NBLA 1KVMA 2ZD8A 4E3JA 4KG6A 3ZVWA 5KSHA 2ZJ9A 3CWFA 5EVLA 3TW8A 3RFBA 5K5BA 2HP9A 3E4PA 2FFYA 2QKPA 4Q0HA 2VKSA 1XXMA 3K3DA 1XFQA 4CLCA 1DJCA 3A3IA 3JYIA 3RTYA 1E3UA 5DF8A 2P04A 1ES4A 2J8YA 4HBTA 3UY6A 4WMCA 3S1YA 4NKPA 4MNRA 4I38A 3WRTA 1K54A 4KZ6A 4WL9A 5HWTA 3PBSA 5EVID 5CHUA 1HLUP 3JVUA 2ZBBA 2K7SA 4P6ZM 4B88A 4JXSA 2VGKA 4DXBA 1RCJA 1NY0A 3IF6A 1GHIA 3MKEA 1IKGA 5HW3A 1S1ZA 2JKGA 3BY8A 4G3WA 3SW1A 1TD5A 3T1SA 4S2MA 1KGFA 2IWBA 3MBZA 4X25A 2RL3A 4ESPA 3ZG9B 3DTKA 2G7UA 2Y2MA 2Z2LB 1PWDA 3C7VA 4GDNA 4D60A 1LL5A 5I5LA 1K56A 1XA7A 4CLCD 3DTEA 2OAQ1 3IWQA 4K08A 3LCEA 4Y0OA 3H82A 1U60A 1E3UD 3TE8A 4NK3A 4R4SA 2Y2QA 4KENB 1ESIA 1TS7A 4WMCD 2PT7A 4C6YA 2V1ZA 3GTCA 1FQGA 5EVEA 1XX2A 1TEMA 4N9LA 1MWSA 3GECA 4PM7A 1IEMA 1G5UA 3BFGA 5HD3A 4G3KA 3PAEA 3H7WB 3IF5A 1A0KA 5TGFA 3MZDA 3IXBA 3T4OA 1DJBA 4R1GA 2RCXA 3MFXA 1ES3A 3C8CA 4BD0A 4BL3A 2WGWB 4BBTA 3QP2A 4L9EA 2EX8A 1FCNA 1XJ6A 3IHBA 2ZL1A 4EBLA 2HJ9C 3PYPA 4U3TA 3UB7A 1GCEA 4LRXC 2VGJA 4Y13A 1GA0A 3TG9A 1ERMA 4N1HA 1FR1A 4OOMA 1GSXA 4BJPA 4EEUA 1Q2PA 3UDFA 3LIFA 3A3FA 3IXDA 1TS8A 3UE0A 5FSRA 3UMDA 1IYSA 3MR0A 2J80A 1LSVA 4LV0A 2ZOIA 4RX2A 3A3DA 2ACGA 2ZQAA 2G2UA 2XEPA 3LR0A 3SS5A 4OQHA 5F1FA 4L9GA 3VP2A 2XFSA 5AQAA 4IVIA 1F5MA 1TS6A 2D02A 1K55A 4EUVA 4Q0IA 4S2LA 2EXAA 4R3BA 3PR6A 3O86A 3MXQA 3VV4A 2PD7A 2YKHA 1LLBA 3IBJA 4HJ4A 5HL1A 5DF7A 1ES2A 4K0WA 3F1NA 2XDMA 3Q7VA 5AQ9A 1FIKA 1GHPA 4BBUA 3OCLA 3LR3A 4U0TA 1N9LA 5A91A 2P7JA 5DVAA 3LIAA 1M6KA 2J9OA 3Q82A 4MN7A 2PDRA 2W0NA 2WKEA 3IT9A 4YINA 4OLGA 2ZQ8A 3R7WB 2Z6CA 4S2OA 4NG2A 2Y2PA 1H8MA 2VV6A 1YT4A 3V3RA 4DMZA 4Y15A 4IJGA 3ZDJA 2LB9A 3ULFA 2Z2MB 2W3HA 3KSFA 5FQ9A 3HLDA 4B93A 1OMEA 3ZNTA 5JYOA 3PBNA 4KQDA 3B47A 4L0LA 4H8RA 1HD8A 3A3JA 5TBMA 4HBUA 2CC1A 4O8GA 1UWPX 4OPYA 1GSVA 1PW8A 3V39A 3M2JA 2INWA 4WN5A 4WEKA 2OLVA 2ZC5B 4ZJ3A 3B3XA 5CHMA 1PWCA 3CPTB 3PXPA 4WM9A 4ARZA 3VE4A 3ZFZA 3U2AA 4HJ3A 2GX5A 1MWRA 4IBXA 2EFUA 3RXWA 3N8RA 3S7NA 3BFFA 4JLFA 3V3SA 3CUEA 4EUZA 3W8KA 1D06A 1N4OA 4UEYA 3CJMA 3AGDA 3ZCZA 4UQIS 5AQBA 4B4ZA 5G4YA 2VGLS 1H5XA 2B5RA 4ZTKA 2JKTM 1LI0A 3DWKA 2BG1A 1FCOA 1JVJA 5CEBA 4P85A 4D2OA 1SCWA 1ESUA 1PZOA 3IX8A 2O99A 4A5RA 3FKVA 3G30A 5A8BA 2QJ7A 4EW7A 1SKOB 2PR5A 2W3EA 3BEBA 2DMWA 4N9KA 4UA7A 3MQQA 1YMSA 1F98A 2WZZA 4EU0A 3ZNYA 1PWGA 2B02A 1KE0A 2OLUA 1Y28A 2WAEA 2O9BA 4GNUA 3GDIA 2W3DA 3SH7A 3ICYA 1OPXA 4LFUA 3CLOA 3S4XA 4QD4A 3OOVA 3UE3A 4M4XA 4OKPA 4GD6A 1MC0A 3OPLA 3A0SA 1W79A 5IHVA 2ZM2A 4HNBA 3G32A 2W1TA 4P87A 4QWOA 4R38A 3ZQ5A 2MJ6A 2OAP1 4EESA 3SS4A 1J9MA 2XR0A 3OLOA 1W63M 4EQIA 2J3TD 1NYYA 5AQ7A 3Q1FA 5EUAA 5FI7A 4P6ZS 3MZFA 3IX4A 4GLQA 3N8SA 3BJNA 1BT5A 4ZDXA 2EWVA 3HLEA 4CLCE 4DDSA 1YLZA 4MBKA 2UWXA 3UDIA 1VEUB 5BOHA 5L09A 5KMWA 1YLWA 2P08A 3NCKA 3F1PB 3EQVA 2PYPA 4RA7A 3GR2A 5E43A 1EW0A 2XROA 4B9OA 2JHEA 1YPRA 1LL9A 5FAOA 3VOZA 4R4RA 5GLDA 2L0WA 4OPZA 4HY8A 2WKQA 4JGRA 4RX3A 3IBRA 3O3VA 4LV2A 3EGDC 1NLYA 3KYQA 3BECA 4EXOA 2Y2HA 4QHCA 5HWVA 1I2WA 3F1OA 5CECA 4QY5A 1Y4OA 5G4ZA 1T18A 3UPNA 2R78A 1TF1A 2XK1A 3MF0A 5EPHA 4KQQA 1L0FA 2CMNA 3NOPC 3UN7A 1PZPA 5L07A 5EFWA 2QHKA 4DRTA 2ZC4B 3NOTC 5E2EA 1Y54A 3BM6A 5HDSA 1TVFA 2PR6A 1K38A 4UQIM 4GN2A 1T1AA 4UA9A 3VOYA 4WF0A 1WA9A 1K25A 4HP4A 3BFEA 3T1RA 1PI5A 2XQZA 4UA6A 1OTIA 3DW0A 2X02A 5HZHA 3SH8A 2VX8A 1L2SA 4GHIA 4HP9A 4Q8IA 3S7PA 3OC2A 3VP1A 2M7VA 3BLSA 3EGXC 2WKPA 5DKLA 1DP8A 3C30A 4JXVA 3BYDA 4DF6A 4GS9A 3T4JA 2A49A 5EV0A 3NY4A 3CZDA 2O9CA 4JF6A 4RYEA 2H0TA 3LYXA
chains in the Genus database with same CATH topology
3IX4A 3QP2A 3SZTA 2UV0E 3QP6A 4NG2A 1L3LA 3IX8A 4LGWA 2Q0OA 3QP1A 4Y15A 3QP5A 5L10A 3QP8A 3JPUA 5L07A 5L09A 4Y17A 3QP4A 4Y13A 4LFUA 1H0MA 3IX3A 2AVXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IX4 A;  3QP2 A;  3SZT A;  2UV0 E;  3QP6 A;  4NG2 A;  1L3L A;  3IX8 A;  4LGW A;  2Q0O A;  3QP1 A;  4Y15 A;  3QP5 A;  5L10 A;  3QP8 A;  3JPU A;  5L07 A;  5L09 A;  4Y17 A;  3QP4 A;  4Y13 A;  4LFU A;  1H0M A;  3IX3 A;  2AVX A; 
#chains in the Genus database with same CATH topology
 1MKM A;  4GOG A;  1FR6 A;  1OJ5 A;  2C5W B;  2IWD A;  2WKR A;  3G6O A;  1EWZ A;  1V9Y A;  5EOE A;  2A24 A;  1SDN A;  3IX3 A;  4NXG A;  2DCF A;  3S7O A;  3BWL A;  1BZA A;  4O7D A;  5KIZ A;  4M3K A;  3VP3 A;  1TDG A;  2OWH A;  3KSI A;  3PBO A;  2K31 A;  5EOO A;  1MWU A;  3UDX A;  2Z6D A;  1C3B A;  3IXG A;  3JPU A;  4HHD A;  5GHX A;  5LBR A;  5EVI C;  5HPI A;  1NXY A;  3G4P A;  2V8C A;  5MC7 A;  3VP4 A;  5EM0 A;  4S2K A;  3E4Q A;  3HUM A;  2HV1 A;  3HUO A;  1NLZ A;  4HEF A;  5E2F A;  4S2N A;  4H6J A;  3FZC A;  2B18 A;  2Y2G A;  2WZX A;  1JWZ A;  5HAR A;  1VB6 A;  4O01 A;  2QWS A;  3A0V A;  4S2P A;  3W4O A;  4XT2 B;  1NZU A;  1YLT A;  1JWP A;  2DNS A;  2H0Y A;  3M6B A;  4GDB A;  3EOI A;  4CLC C;  4ETZ A;  1YLP A;  3S7Q A;  2VEA A;  2Y2I A;  1G68 A;  2Y59 A;  3FG8 A;  3UE1 A;  3U4L P;  5CX7 A;  2QJ5 A;  1H0M A;  4PKY G;  1JWV A;  2VJW A;  3WS0 A;  4DN0 A;  1ZC2 A;  1K54 C;  5AVE A;  2Y55 A;  1GHM A;  1G6A A;  2WAD A;  3C38 A;  2PU2 A;  1IEL A;  2XD5 A;  3T4S A;  3ZGA B;  4BWI A;  3SS3 A;  3IF6 C;  1PIO A;  3VOL A;  4FSF A;  2GJ3 A;  1LSX A;  1L0E A;  3T4L A;  3GQZ A;  4B4X A;  3C4P A;  3UB6 A;  3EEH A;  1O07 A;  5F83 A;  5HX9 A;  5M1A A;  4KUK A;  5CTM A;  4GZB A;  2ZC7 A;  1ZG4 A;  3DAV A;  3QHY A;  4Y5F A;  2O0Y A;  3HJK A;  1W7F A;  3LY3 A;  4Y17 A;  3D72 A;  2Y91 A;  1QMF A;  5CER A;  4UAA A;  3O88 A;  1PYY A;  3ZHH A;  1BTL A;  3MKF A;  4R23 A;  3IS2 B;  2P9V B;  1XJ3 A;  4RQ9 A;  1XA1 A;  5IU1 A;  3OBF A;  5F5Y A;  2HPB A;  5L2F A;  4C75 A;  4QJG A;  3KX0 X;  2QYB A;  2HP6 A;  2KDK A;  5FAP A;  1WE4 A;  3IQA A;  1XJ4 A;  4HH3 A;  1YLY A;  4KQR A;  5FQI A;  4JGO A;  1W8Y A;  4S2J A;  2EXB A;  4EET B;  2KX6 A;  4I3A A;  1KDW A;  3TRC A;  1S66 L;  1VQQ A;  2PU4 A;  4R0Q A;  2HDQ A;  2PBY A;  1T1B A;  3QP8 A;  1GSW A;  3WS2 A;  3IXH A;  3C4O A;  2W27 A;  3O5Y A;  4XXR A;  2Q9M A;  3H7W A;  4X55 A;  1G6O A;  3IH9 A;  5L8M A;  3BFC A;  5FQK A;  5DJU A;  3FV7 A;  4HOI A;  3C5A A;  2PBD P;  4LGW A;  4EQ1 A;  1ALQ A;  1S6R A;  1SZV A;  2WGW A;  4PPR A;  1Z6F A;  3D9Y A;  1TDL A;  1S1Y A;  2V20 A;  2WGI A;  4PAU A;  2PD8 A;  4OLD A;  1HZO A;  1SDE A;  3PTE A;  1J3W A;  1NYM A;  2Y2N A;  3EWK A;  3A0R A;  3B42 A;  1AXB A;  4EBN A;  4OQ0 A;  1IYO A;  3FC7 A;  1VET B;  4K0X A;  2W3G A;  4ETX A;  2JKR M;  4DE3 A;  4NEE D;  3E4O A;  1S0W A;  2V9A A;  2Y2L A;  2PRF A;  1UGU A;  1CI8 A;  3VSK A;  5A92 A;  1JTG A;  5F1G A;  1K55 C;  3PHY A;  3FPV A;  2DRW A;  4MBF A;  2J9P A;  1ZG6 A;  4XUZ A;  5J4E A;  3LR4 A;  1OT6 A;  5FQM A;  2HGV A;  4EWF A;  4YNR A;  3ZVT A;  4CQH A;  2FFF B;  3PBT A;  2V2F F;  4DE2 A;  2EWW A;  3N4I A;  1VM1 A;  4HI4 A;  2XF3 A;  3SZT A;  1HTZ A;  3CI6 A;  5AVF A;  2L4R A;  1NRJ A;  3MSH A;  1PRQ A;  3ZYT A;  2JBF A;  3LEZ A;  3GRJ A;  4F94 A;  4F3L B;  3VFF A;  4E3O A;  3BRM A;  4U0X A;  1RGZ A;  5F68 A;  2V1B A;  3W2Z A;  5CHJ A;  4YWZ A;  2VV7 A;  3R7W A;  4KZ7 A;  5FAQ A;  5TFQ A;  2Y2O A;  3LIC A;  2GDN A;  1BUE A;  3RJU A;  1SHV A;  2JE5 A;  1P9R A;  1RGY A;  1N9N A;  1TS0 A;  1BLH A;  1X0O A;  4ME4 A;  5D3O A;  4EV4 A;  2UV0 E;  1DJA A;  4HQA A;  2OOL A;  4E3M A;  1IYP A;  2GNX A;  4CPK A;  3ZG7 B;  2ZQC A;  3L9K A;  3CIT A;  2JN7 A;  4MCW A;  4GW9 A;  3GMW A;  2XRN A;  1OTD A;  5FA7 A;  2WGV A;  3E98 A;  1CQA A;  5A93 A;  5E2H A;  3CUE C;  2WK0 A;  4RVA A;  3CPT A;  2KLI A;  4PM5 A;  1STZ A;  3RH8 B;  3WWX A;  2K2N A;  3P09 A;  3T4T A;  5CRF A;  2BLS A;  2H10 A;  5FEG A;  5A90 A;  1K0K A;  1ACF A;  2ZMF A;  4MBH A;  5JYP A;  2JKF A;  1V9Z A;  3PAG A;  4NXB A;  4NXE A;  4X1M A;  4GJ4 A;  2J3T C;  5FI2 A;  1F2K A;  4E3I A;  2PAV P;  4BMW A;  1D1J A;  3LI9 A;  3HRE A;  1MZU A;  4DJ3 A;  4LLO B;  3UE6 A;  3E2K A;  3KYE A;  1OT9 A;  4BD1 A;  4I39 A;  5DFX A;  4QPR A;  2D01 A;  3T1X A;  1KGG A;  3NC8 A;  4PMA A;  4WEJ A;  3DBA A;  3A3E A;  1SKO A;  1SKF A;  3FPW A;  1BLP A;  3FKW A;  4WBG A;  4N92 A;  4ZJ1 A;  2L1M A;  1WYC A;  4WYY A;  1NWZ A;  4LCM A;  5F82 A;  4BLM A;  3NUL A;  3M6H A;  4KZ9 A;  4R70 A;  5EVI B;  2XSS A;  1CEF A;  5CGW A;  1XPB A;  1JTD A;  4KZA A;  4FUW A;  4P0M A;  2HF6 A;  2XLN A;  1AWI A;  4BEN A;  5FI6 A;  4YFM A;  5HDD A;  1BSG A;  3P98 A;  3QP6 A;  4OOY A;  5FDH A;  2OV5 A;  1IFQ A;  1NRF A;  4ZJ2 A;  4LEN A;  4DJ2 A;  4DE0 A;  1HVB A;  3GV9 A;  2E8I A;  2W3F A;  4EBP A;  2I72 A;  5CTN A;  3HBR A;  1W8Q A;  4FH4 A;  4WZ5 A;  1FIL A;  4GCZ A;  3G31 A;  4X1L A;  4CLC B;  3UB8 A;  4JGP A;  5E2G A;  4FTX A;  3UO9 A;  1XGJ A;  1K57 A;  4MEZ A;  1VEU A;  3F1P A;  5HWW A;  2JKR I;  3V67 A;  4KZ3 A;  4Y0T A;  3D3O A;  3HL9 A;  3O87 A;  4DDY A;  3IF6 B;  5DJT A;  2GZA A;  4PM9 A;  3DWZ A;  1RP5 A;  3WS5 A;  4LCL A;  4NXF A;  3ISG A;  4JBF A;  5GHZ A;  5FAT A;  3HCY A;  2A2L A;  4MLL A;  1KE4 A;  1KOU A;  2B95 A;  3NEC A;  5DKK A;  2AVX A;  5AJG A;  2ZC6 B;  3H82 B;  1I2S A;  1D7E A;  1MBL A;  3BLM A;  3OPR A;  3LO7 A;  4FH2 A;  4I5S A;  1K57 C;  3NHQ A;  5GLA A;  5DF9 A;  3DTI A;  3WS4 A;  3K2N A;  1ONH A;  1JNU A;  1ONG A;  4IBR A;  1YMX A;  2IA2 A;  3TOI A;  1KDS A;  5FDS A;  1BYW A;  3HLG A;  4KZ8 A;  2YKF A;  4OON A;  1P97 A;  3AGF A;  3EEA A;  3EQU A;  3QNB A;  4CJN A;  3E0Y A;  2JKT I;  5HAP A;  1K6R A;  2VV8 A;  1NZO A;  3KYZ A;  1QME A;  5FEF A;  2ZL1 B;  4ID4 A;  1KVL A;  4Y7P A;  2XD1 A;  2ZC3 B;  2V8F A;  1I5Q A;  4HJ6 A;  1IKI A;  4OPQ A;  2HDR A;  1UWN X;  2IWC A;  3MQO A;  4X56 A;  2EX9 A;  1ZTU A;  5GL9 A;  4X6T A;  4E3K A;  2XFT A;  4Y0U A;  1ERQ A;  3OCN A;  4GKU A;  1YM1 A;  3LI8 A;  3OPH A;  4Q0J A;  3NJA A;  4OH0 A;  2XA7 S;  4JF4 A;  2HZ5 A;  4JXW A;  4OP5 A;  3NDG A;  4KZ4 A;  3QP4 A;  1H3Q A;  4QY6 A;  3E2L A;  3VP0 A;  3N8L A;  4HES A;  1DY6 A;  2FZ0 A;  3MJQ A;  2WKH A;  4XUX A;  1YLJ A;  4S2N C;  3V50 A;  1BUL A;  4LRZ E;  2PYR A;  5DTS A;  1ZKJ A;  2HDU A;  3H9W A;  1P9W A;  3TSG A;  4P6B A;  3BQA A;  3LY4 A;  5TR7 A;  2ZLY A;  1DP9 A;  3F1N B;  5F69 A;  3Q7V B;  1PW1 A;  4HIA A;  1S67 L;  1DP6 A;  2ZOH A;  4IVK A;  4JGQ A;  1LSW A;  1CK3 A;  2VZW A;  3M2K A;  1MY8 A;  4XT2 A;  1OTA A;  1K56 D;  3LIE A;  3WS1 A;  2VLG A;  4E3N A;  1XFN A;  5GLC A;  4BQM A;  4E6W A;  4E6X A;  5J7E A;  4ZBE A;  5GLB A;  3I7J A;  3T50 A;  3NIA A;  3NI9 A;  5DFY A;  5CXW A;  1K4E A;  2PHY A;  2X71 A;  5DTK A;  1L0G A;  1KE3 A;  2NUP C;  3T4K A;  5FAS A;  1T19 A;  2H28 A;  3HLF A;  1H8Z A;  1OTB A;  1Q2Q A;  1K4F A;  1IOU A;  4ZAM A;  2EA9 A;  3BFD A;  4K91 A;  1T1C A;  4X53 A;  5TJJ A;  4EER A;  1L0D A;  1M40 A;  5HAQ A;  2ZQ9 A;  5J8X A;  5IT5 A;  4PM6 A;  3HJI A;  4YOF A;  1ES5 A;  3LID A;  4JPM A;  4L9F A;  4IUK A;  3UME A;  5TBM B;  4DE1 A;  4WEL A;  2BAS A;  3QP5 A;  3KO6 A;  1H8Y A;  3IHA A;  3IWI A;  3PBQ A;  3SH9 A;  3ZG0 A;  5HDC A;  4Y3I A;  2QZ6 A;  4ARZ B;  5DTT A;  5EE8 A;  5CED A;  3G35 A;  3G2Y A;  2Y2J A;  1BLC A;  1IYQ A;  1YSQ A;  4OQG A;  4MN6 A;  3C2W A;  2W1R A;  3MZE A;  4JXG A;  3NDE A;  3JVV A;  3IS2 A;  2P9V A;  3Q07 A;  3N6I A;  3KSG A;  1Z09 A;  2H5S A;  4EEP A;  3Q7Z A;  4I3J A;  4KG2 A;  4Y2F A;  2ZMV A;  4BL2 A;  1W63 Q;  3VE3 A;  3IWO A;  2XGN A;  1K6S A;  3CAX A;  1EI5 A;  5HL6 A;  2M7U A;  4IHQ A;  1YSP A;  4R3A A;  5C5K A;  3VMA A;  4OPR A;  2XA7 M;  3HLB A;  5F6A A;  4PM8 A;  2G2W A;  3G34 A;  4R3J A;  3CHW P;  4G3V A;  1CI9 A;  4UHU A;  2QPN A;  4KZB A;  3LGO A;  2LB5 A;  4MMN A;  3HLC A;  4Z9Q A;  4E3L A;  1LHY A;  3LFV A;  5CGX A;  4DKI A;  1F9I A;  5IS1 A;  4IED A;  1N9B A;  4DXC A;  3BW6 A;  4QU3 A;  2ZM0 A;  4O0P A;  3ZG8 B;  1OJG A;  5L10 A;  2V1A A;  4QB8 A;  1MPL A;  2BTF P;  4R6L A;  4C3Q A;  4OQI A;  5G18 A;  2A3U A;  2Y8H A;  1XGI A;  2JCH A;  2WKI A;  3MFD A;  1VET A;  1NJ4 A;  3OZH A;  3P01 A;  2W1T B;  1W5D A;  3FWL A;  2KOI A;  2Q0O A;  2R9W A;  4II7 A;  5HFO A;  3D4F A;  3ITB A;  1LL8 A;  5HD5 A;  5EM1 A;  3T1Q B;  2V0W A;  4FD8 A;  3HUN A;  3W4Q A;  2XH9 A;  1MXO A;  3UNW A;  3AGE A;  2Q9N A;  1PI4 A;  2M1C A;  4LV1 A;  1PNE A;  2R9X A;  5U47 A;  4FCF A;  3TJZ C;  3K3C A;  3P7N A;  3HLW A;  4JKT A;  3MXR A;  3LUQ A;  4OVD A;  3MQ0 A;  4GD8 A;  5KZH A;  3Q81 A;  4Z1W A;  2OWJ A;  3VFH A;  5CGS A;  4FOF A;  3CMZ A;  3KSH A;  4F3L A;  4JF5 A;  1BLS A;  1OTE A;  4KQO A;  3VSL A;  4WUJ A;  3F1O B;  2OSU A;  3SOI A;  4MDZ A;  1DRM A;  1P0Z A;  3BQ8 A;  1PFL A;  2P74 A;  1MWT A;  2HJE A;  1FSW A;  1XKZ A;  4IUH A;  3W4P A;  2ZQ7 A;  4BBV A;  3S22 A;  3BY9 A;  4LV3 A;  5M19 A;  1LT0 A;  3N7W A;  2WAF A;  2ZM8 A;  3WRZ A;  2X01 A;  5GHY A;  3UB5 P;  4KZ5 A;  3GSG A;  1E4D A;  4OP8 A;  3R4K A;  1LI9 A;  2FH5 A;  3GVB A;  3G2Z A;  5I94 A;  1ZHH B;  3LEQ A;  3B33 A;  4GHI B;  1FCM A;  4WLA A;  3ZG5 A;  5J3W A;  4GB7 A;  3LIB A;  2NUT C;  2EX2 A;  2WYX A;  1GA9 A;  1KGE A;  1CEG A;  3FYZ A;  3ITA A;  4GS9 B;  2HP5 A;  3UPP A;  1L3L A;  5KSC A;  3L7H A;  1S4R A;  4KG5 A;  5FL3 A;  1MKI A;  5HSQ A;  1YQS A;  5HAI A;  2V0U A;  3PBR A;  3LR5 A;  3HVF A;  3MXS A;  1CF0 A;  2C6W B;  4LRY C;  1ODV A;  4AFI A;  3UB9 A;  1XP4 A;  2A24 B;  3MS6 A;  3CG5 A;  3V5M A;  1S4S A;  4LPZ A;  2ZMA A;  4KUO A;  2Y4A A;  4N1X A;  1G28 A;  3IH8 A;  4NET A;  4PKY A;  4ZRR A;  2J3W A;  5EEC A;  2QMI A;  3MMH A;  1O7E A;  3UPO A;  1YAX A;  1FOF A;  2E8J A;  2I9V A;  5HPF A;  2WUQ A;  2ZQD A;  4MN5 A;  2VGL M;  2JC7 A;  5M18 A;  2VA0 A;  3T12 B;  3QP1 A;  2O9A A;  4PHT A;  5FQJ A;  3QNC A;  2J7V A;  4HH2 A;  3C7U A;  4S2I A;  4I3I A;  3NOU C;  4X68 A;  4H6J B;  4X69 A;  1ERO A;  1CJF A;  5EVI A;  3DTM A;  2EX6 A;  2Y2K A;  3RXX A;  1N9O A;  3OPP A;  1YKD A;  2HDS A;  4E04 A;  1XJ2 A;  5FQQ A;  2Y79 A;  4OOL A;  1VHM A;  2EFX A;  1WYB A;  4WZ4 A;  2VK3 A;  4WZ5 C;  1E25 A;  1FSY A;  3T4Q A;  3NBL A;  1KVM A;  2ZD8 A;  4E3J A;  4KG6 A;  3ZVW A;  5KSH A;  2ZJ9 A;  3CWF A;  5EVL A;  3TW8 A;  3RFB A;  5K5B A;  2HP9 A;  3E4P A;  2FFY A;  2QKP A;  4Q0H A;  2VKS A;  1XXM A;  3K3D A;  1XFQ A;  4CLC A;  1DJC A;  3A3I A;  3JYI A;  3RTY A;  1E3U A;  5DF8 A;  2P04 A;  1ES4 A;  2J8Y A;  4HBT A;  3UY6 A;  4WMC A;  3S1Y A;  4NKP A;  4MNR A;  4I38 A;  3WRT A;  1K54 A;  4KZ6 A;  4WL9 A;  5HWT A;  3PBS A;  5EVI D;  5CHU A;  1HLU P;  3JVU A;  2ZBB A;  2K7S A;  4P6Z M;  4B88 A;  4JXS A;  2VGK A;  4DXB A;  1RCJ A;  1NY0 A;  3IF6 A;  1GHI A;  3MKE A;  1IKG A;  5HW3 A;  1S1Z A;  2JKG A;  3BY8 A;  4G3W A;  3SW1 A;  1TD5 A;  3T1S A;  4S2M A;  1KGF A;  2IWB A;  3MBZ A;  4X25 A;  2RL3 A;  4ESP A;  3ZG9 B;  3DTK A;  2G7U A;  2Y2M A;  2Z2L B;  1PWD A;  3C7V A;  4GDN A;  4D60 A;  1LL5 A;  5I5L A;  1K56 A;  1XA7 A;  4CLC D;  3DTE A;  2OAQ 1;  3IWQ A;  4K08 A;  3LCE A;  4Y0O A;  3H82 A;  1U60 A;  1E3U D;  3TE8 A;  4NK3 A;  4R4S A;  2Y2Q A;  4KEN B;  1ESI A;  1TS7 A;  4WMC D;  2PT7 A;  4C6Y A;  2V1Z A;  3GTC A;  1FQG A;  5EVE A;  1XX2 A;  1TEM A;  4N9L A;  1MWS A;  3GEC A;  4PM7 A;  1IEM A;  1G5U A;  3BFG A;  5HD3 A;  4G3K A;  3PAE A;  3H7W B;  3IF5 A;  1A0K A;  5TGF A;  3MZD A;  3IXB A;  3T4O A;  1DJB A;  4R1G A;  2RCX A;  3MFX A;  1ES3 A;  3C8C A;  4BD0 A;  4BL3 A;  2WGW B;  4BBT A;  3QP2 A;  4L9E A;  2EX8 A;  1FCN A;  1XJ6 A;  3IHB A;  2ZL1 A;  4EBL A;  2HJ9 C;  3PYP A;  4U3T A;  3UB7 A;  1GCE A;  4LRX C;  2VGJ A;  4Y13 A;  1GA0 A;  3TG9 A;  1ERM A;  4N1H A;  1FR1 A;  4OOM A;  1GSX A;  4BJP A;  4EEU A;  1Q2P A;  3UDF A;  3LIF A;  3A3F A;  3IXD A;  1TS8 A;  3UE0 A;  5FSR A;  3UMD A;  1IYS A;  3MR0 A;  2J80 A;  1LSV A;  4LV0 A;  2ZOI A;  4RX2 A;  3A3D A;  2ACG A;  2ZQA A;  2G2U A;  2XEP A;  3LR0 A;  3SS5 A;  4OQH A;  5F1F A;  4L9G A;  3VP2 A;  2XFS A;  5AQA A;  4IVI A;  1F5M A;  1TS6 A;  2D02 A;  1K55 A;  4EUV A;  4Q0I A;  4S2L A;  2EXA A;  4R3B A;  3PR6 A;  3O86 A;  3MXQ A;  3VV4 A;  2PD7 A;  2YKH A;  1LLB A;  3IBJ A;  4HJ4 A;  5HL1 A;  5DF7 A;  1ES2 A;  4K0W A;  3F1N A;  2XDM A;  3Q7V A;  5AQ9 A;  1FIK A;  1GHP A;  4BBU A;  3OCL A;  3LR3 A;  4U0T A;  1N9L A;  5A91 A;  2P7J A;  5DVA A;  3LIA A;  1M6K A;  2J9O A;  3Q82 A;  4MN7 A;  2PDR A;  2W0N A;  2WKE A;  3IT9 A;  4YIN A;  4OLG A;  2ZQ8 A;  3R7W B;  2Z6C A;  4S2O A;  4NG2 A;  2Y2P A;  1H8M A;  2VV6 A;  1YT4 A;  3V3R A;  4DMZ A;  4Y15 A;  4IJG A;  3ZDJ A;  2LB9 A;  3ULF A;  2Z2M B;  2W3H A;  3KSF A;  5FQ9 A;  3HLD A;  4B93 A;  1OME A;  3ZNT A;  5JYO A;  3PBN A;  4KQD A;  3B47 A;  4L0L A;  4H8R A;  1HD8 A;  3A3J A;  5TBM A;  4HBU A;  2CC1 A;  4O8G A;  1UWP X;  4OPY A;  1GSV A;  1PW8 A;  3V39 A;  3M2J A;  2INW A;  4WN5 A;  4WEK A;  2OLV A;  2ZC5 B;  4ZJ3 A;  3B3X A;  5CHM A;  1PWC A;  3CPT B;  3PXP A;  4WM9 A;  4ARZ A;  3VE4 A;  3ZFZ A;  3U2A A;  4HJ3 A;  2GX5 A;  1MWR A;  4IBX A;  2EFU A;  3RXW A;  3N8R A;  3S7N A;  3BFF A;  4JLF A;  3V3S A;  3CUE A;  4EUZ A;  3W8K A;  1D06 A;  1N4O A;  4UEY A;  3CJM A;  3AGD A;  3ZCZ A;  4UQI S;  5AQB A;  4B4Z A;  5G4Y A;  2VGL S;  1H5X A;  2B5R A;  4ZTK A;  2JKT M;  1LI0 A;  3DWK A;  2BG1 A;  1FCO A;  1JVJ A;  5CEB A;  4P85 A;  4D2O A;  1SCW A;  1ESU A;  1PZO A;  3IX8 A;  2O99 A;  4A5R A;  3FKV A;  3G30 A;  5A8B A;  2QJ7 A;  4EW7 A;  1SKO B;  2PR5 A;  2W3E A;  3BEB A;  2DMW A;  4N9K A;  4UA7 A;  3MQQ A;  1YMS A;  1F98 A;  2WZZ A;  4EU0 A;  3ZNY A;  1PWG A;  2B02 A;  1KE0 A;  2OLU A;  1Y28 A;  2WAE A;  2O9B A;  4GNU A;  3GDI A;  2W3D A;  3SH7 A;  3ICY A;  1OPX A;  4LFU A;  3CLO A;  3S4X A;  4QD4 A;  3OOV A;  3UE3 A;  4M4X A;  4OKP A;  4GD6 A;  1MC0 A;  3OPL A;  3A0S A;  1W79 A;  5IHV A;  2ZM2 A;  4HNB A;  3G32 A;  2W1T A;  4P87 A;  4QWO A;  4R38 A;  3ZQ5 A;  2MJ6 A;  2OAP 1;  4EES A;  3SS4 A;  1J9M A;  2XR0 A;  3OLO A;  1W63 M;  4EQI A;  2J3T D;  1NYY A;  5AQ7 A;  3Q1F A;  5EUA A;  5FI7 A;  4P6Z S;  3MZF A;  3IX4 A;  4GLQ A;  3N8S A;  3BJN A;  1BT5 A;  4ZDX A;  2EWV A;  3HLE A;  4CLC E;  4DDS A;  1YLZ A;  4MBK A;  2UWX A;  3UDI A;  1VEU B;  5BOH A;  5L09 A;  5KMW A;  1YLW A;  2P08 A;  3NCK A;  3F1P B;  3EQV A;  2PYP A;  4RA7 A;  3GR2 A;  5E43 A;  1EW0 A;  2XRO A;  4B9O A;  2JHE A;  1YPR A;  1LL9 A;  5FAO A;  3VOZ A;  4R4R A;  5GLD A;  2L0W A;  4OPZ A;  4HY8 A;  2WKQ A;  4JGR A;  4RX3 A;  3IBR A;  3O3V A;  4LV2 A;  3EGD C;  1NLY A;  3KYQ A;  3BEC A;  4EXO A;  2Y2H A;  4QHC A;  5HWV A;  1I2W A;  3F1O A;  5CEC A;  4QY5 A;  1Y4O A;  5G4Z A;  1T18 A;  3UPN A;  2R78 A;  1TF1 A;  2XK1 A;  3MF0 A;  5EPH A;  4KQQ A;  1L0F A;  2CMN A;  3NOP C;  3UN7 A;  1PZP A;  5L07 A;  5EFW A;  2QHK A;  4DRT A;  2ZC4 B;  3NOT C;  5E2E A;  1Y54 A;  3BM6 A;  5HDS A;  1TVF A;  2PR6 A;  1K38 A;  4UQI M;  4GN2 A;  1T1A A;  4UA9 A;  3VOY A;  4WF0 A;  1WA9 A;  1K25 A;  4HP4 A;  3BFE A;  3T1R A;  1PI5 A;  2XQZ A;  4UA6 A;  1OTI A;  3DW0 A;  2X02 A;  5HZH A;  3SH8 A;  2VX8 A;  1L2S A;  4GHI A;  4HP9 A;  4Q8I A;  3S7P A;  3OC2 A;  3VP1 A;  2M7V A;  3BLS A;  3EGX C;  2WKP A;  5DKL A;  1DP8 A;  3C30 A;  4JXV A;  3BYD A;  4DF6 A;  4GS9 A;  3T4J A;  2A49 A;  5EV0 A;  3NY4 A;  3CZD A;  2O9C A;  4JF6 A;  4RYE A;  2H0T A;  3LYX A; 
#chains in the Genus database with same CATH homology
 3IX4 A;  3QP2 A;  3SZT A;  2UV0 E;  3QP6 A;  4NG2 A;  1L3L A;  3IX8 A;  4LGW A;  2Q0O A;  3QP1 A;  4Y15 A;  3QP5 A;  5L10 A;  3QP8 A;  3JPU A;  5L07 A;  5L09 A;  4Y17 A;  3QP4 A;  4Y13 A;  4LFU A;  1H0M A;  3IX3 A;  2AVX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...