3QP8A

Crystal structure of cvir (chromobacterium violaceum 12472) ligand-binding domain bound to c10-hsl
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
179
structure length
179
Chain Sequence
ARPLPAGLTASQQWTLLEWIHMAGHIETEGELKAFLDNILSQAPSDRIILVLGRLNNQNQIQRMEKVLNVSYPSDWLNQYSQENFAQHDPIMRIHLGQGPVIWEERFSRAKGSEEKRFIAEASSNGMGSGITFSAASDRNNVGSILSIGGKEPGRNAALVAMLNCLTPHLHQAAVRIAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A strategy for antagonizing quorum sensing.
pubmed doi rcsb
source organism Chromobacterium violaceum
molecule tags Transcription
molecule keywords CviR transcriptional regulator
total genus 54
structure length 179
sequence length 179
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03472 Autoind_bind Autoinducer binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.80 Alpha Beta 2-Layer Sandwich Beta-Lactamase Transcription factor LuxR-like, autoinducer-binding domain 3qp8A00
3JPUA 3QP4A 5L07A 3QP1A 2Q0OA 3QP6A 3QP8A 3IX4A 1H0MA 4NG2A 3SZTA 3IX8A 3QP5A 3QP2A 5L09A 5L10A 4LFUA 1L3LA 2AVXA 4Y15A 2UV0E 3IX3A 4Y13A 4LGWA 4Y17A
chains in the Genus database with same CATH superfamily
3KSHA 1YPRA 1AXBA 4PKYA 2PDRA 3PBRA 3VP4A 4DDSA 2PRFA 3E2LA 4WZ5C 5J8XA 3VSKA 2E8JA 4ZBEA 1DP6A 4LPZA 4LLOB 4S2IA 2EX6A 4ETZA 3QNCA 3DTEA 2JHEA 5GHXA 3H7WA 3NIAA 3C7VA 3EGXC 3JYIA 1TF1A 1LL8A 3IBRA 1FCNA 2VX8A 2VEAA 1K55A 4OLDA 4DXBA 1LL5A 5F5YA 2LB9A 4HBTA 4BQMA 3CPTA 2KDKA 2HJEA 3LR0A 5DF7A 4RA7A 1CF0A 3N8SA 2XLNA 4Y3IA 3EWKA 1YLZA 4CLCB 3LR3A 2ZL1A 3GQZA 1RGYA 2HV1A 4I5SA 5FL3A 5FQIA 3LI8A 3PBOA 1K25A 2J8YA 3M2KA 5KSHA 2J3TC 2O9AA 4NXGA 4YFMA 1J3WA 4A5RA 2WGWA 3WWXA 2XD5A 5CEDA 2HP6A 3TSGA 3T1QB 2Y2HA 2OLUA 3SH8A 5TBMA 4Z1WA 3ZGAB 3OPRA 2Z2MB 3F1PA 3PBQA 2HGVA 1F9IA 4DN0A 4HJ6A 2JN7A 2ZMAA 4MCWA 5EVEA 2PD8A 2JKRM 2RCXA 3LY3A 2Y2KA 4BLMA 1BT5A 5CHMA 4HQAA 5CX7A 2QKPA 1SDEA 1LLBA 3MMHA 5CERA 4KZAA 2JBFA 4PHTA 4WF0A 2ZC4B 4X56A 5HL6A 1NY0A 4O7DA 1M40A 4HH3A 5HDCA 1MY8A 3OCLA 2HDQA 2P04A 5FQKA 2B02A 2V1ZA 3KYEA 3T4KA 3A0VA 3QNBA 1TVFA 3MSHA 3UB7A 4I3AA 3NHQA 4UEYA 3IF6B 1ES5A 5HL1A 5HZHA 1S66L 3B3XA 3QP6A 1K6SA 3Q81A 1YT4A 1KGFA 1PWDA 2ZQ9A 1VQQA 4EQ1A 5HAPA 1E25A 2Y2LA 2VZWA 4ME4A 4JF5A 2PAVP 3G31A 5HWVA 4ETXA 4GCZA 5DKLA 1YQSA 5M1AA 3VP2A 4R3JA 4IVKA 5GLDA 4YINA 3ZG5A 3B47A 1L0GA 2ZC7A 1NLZA 3UB6A 3F1NA 2Z2LB 3G32A 4N1XA 5C5KA 1ESUA 1KE0A 4P6ZM 3VOZA 2EXAA 3QP8A 2W1TB 3V5MA 4HESA 2QMIA 4X6TA 4KQDA 3S1YA 4ZJ1A 2V20A 2J7VA 3C7UA 4GZBA 4NKPA 2P9VA 1H5XA 1LSWA 4JBFA 3UB8A 4ZAMA 1TS0A 5JYOA 4DXCA 3E4QA 4ID4A 3V3RA 3VP3A 4R0QA 3BLMA 4WEJA 4E6XA 3LYXA 4FSFA 3MZDA 2WYXA 1KDWA 2ZOHA 1UWPX 3NC8A 3OPHA 3P98A 3K2NA 4WZ5A 3A3IA 3IXGA 4E6WA 3MF0A 5HD5A 4RVAA 2XGNA 5E43A 3OPLA 3RXXA 5LBRA 1GCEA 4HBUA 4G3WA 2VKSA 3T4QA 4MN5A 3KX0X 1Z09A 1DY6A 4WUJA 3C30A 1E3UD 2XQZA 3GSGA 4DDYA 3LO7A 3UE3A 3S7NA 5M19A 4Y15A 3TJZC 3LY4A 3PBNA 3ZHHA 4OVDA 1YLTA 4UA9A 5EM1A 4UAAA 4KZ9A 3V50A 3UDIA 1A0KA 1OTDA 1OTBA 3MZEA 4MBKA 4KZ3A 3BFEA 3T4JA 1IEMA 4S2KA 4XT2A 4CQHA 1FSYA 3HUNA 4KUOA 1LSVA 3MKFA 4S2NA 2DRWA 3H82A 1UWNX 4NXEA 3AGDA 3JVVA 3C38A 2XF3A 4Q0JA 2PBDP 2OV5A 3T4TA 3K3DA 4EU0A 4E3OA 3N4IA 2G2UA 3UPPA 4X69A 2K2NA 1I2WA 4BBTA 4JXSA 3BEBA 2ZQAA 3S22A 1Q2QA 1OT6A 3T4SA 2INWA 1D06A 3EOIA 2VLGA 3RFBA 4U0XA 1KGGA 2WKQA 2PYPA 2Z6DA 4N9KA 2Y2MA 1GSVA 5F1GA 4LV2A 2OLVA 4OP5A 3O3VA 4R3AA 1F5MA 1MPLA 2DMWA 3BFCA 3KYZA 3GTCA 4WYYA 2ZL1B 4LGWA 1KVMA 4X53A 1L0DA 1W8QA 4X55A 1WYCA 1ZKJA 2A3UA 3N6IA 4PAUA 2YKFA 1K57C 3HL9A 5A91A 3BY9A 1BZAA 1YSPA 3ULFA 1PW8A 2XFTA 2G2WA 2C5WB 4PMAA 4DF6A 5FQ9A 4BL2A 4Q8IA 4KZ7A 4Y0TA 2OAP1 3RH8B 4OQ0A 1NYMA 1NRJA 1NZUA 1K55C 4E04A 1HD8A 5K5BA 1K54A 4LENA 5GHZA 1BLCA 4M4XA 3ITAA 3IS2A 2BASA 2J9OA 4L9EA 1CEGA 3UNWA 3EQUA 4MBHA 3IQAA 2VGKA 2L0WA 4EUZA 4LV1A 4EBNA 2B5RA 5IS1A 2JKRI 4EW7A 3MBZA 1TS8A 3SH7A 2V8FA 4WN5A 5F1FA 4OOLA 2LB5A 3QP2A 3ZG9B 2QWSA 1FILA 5DTKA 4PKYG 4C75A 4EEPA 5MC7A 3F1OB 5FEFA 2ZM8A 2D02A 4S2NC 4GOGA 1E3UA 2WGIA 3FC7A 5HWTA 5DTTA 3WS0A 3KYQA 4X1MA 2A24A 4NG2A 2HDSA 3O5YA 3NI9A 1FCMA 1K56D 2ZOIA 1ONGA 2PBYA 2K31A 4OOMA 3V39A 4UA7A 2V9AA 3PYPA 2K7SA 1JNUA 3V3SA 5FASA 3KSFA 5TR7A 1FSWA 3LIEA 4B4ZA 3RXWA 1ONHA 1VM1A 3UDXA 1M6KA 2ZBBA 3BFGA 3LIAA 5L09A 1N4OA 3L9KA 4OPYA 4JGPA 5TFQA 2OOLA 1RP5A 4B93A 4O0PA 4PM7A 4HJ4A 4K91A 5CRFA 2EXBA 4R4SA 2GJ3A 5EV0A 3VOYA 3IXBA 1DP8A 1XGIA 4Z9QA 4IBRA 2FFFB 3BFFA 5F6AA 2CMNA 1K57A 3HCYA 4G3VA 4X1LA 3MXRA 1J9MA 4Y13A 1BTLA 4NEED 1RCJA 5GHYA 5CEBA 3SOIA 4KQQA 3UE1A 2PR6A 4PM8A 3BQAA 4OOYA 1I5QA 4RQ9A 5FDSA 5IU1A 5EECA 2JKFA 2V0UA 3HLEA 4MN7A 3C4OA 3HJIA 4KG2A 5HAQA 4DE1A 1Y4OA 1Z6FA 3VP1A 3A0SA 4P0MA 1SKOB 3RTYA 4I38A 3R7WB 3UPNA 5TBMB 5EE8A 3ZVTA 5DJTA 1CQAA 1NXYA 5A93A 5HD3A 2KOIA 2HDRA 5BOHA 1YSQA 5GLBA 4JKTA 3NECA 3IS2B 3BQ8A 1UGUA 3PXPA 2C6WB 1PRQA 2EX2A 3PBSA 4WZ4A 3CMZA 3V67A 4WL9A 1QMEA 2ZC5B 3H7WB 1ZG6A 4CLCA 5KMWA 2D01A 3IHBA 5FEGA 1S4RA 2VK3A 1W8YA 3PBTA 3NBLA 4EETB 3MQQA 3MR0A 4K0XA 2A2LA 2Y55A 1W63M 1YAXA 2OWHA 1NRFA 3LGOA 1ALQA 2ZD8A 3SS5A 1F98A 2NUTC 3N7WA 3VE3A 5FATA 1PI5A 3E0YA 3A3EA 3HLDA 3HUMA 3IWIA 2JKTM 1T1CA 5IHVA 4QY6A 2WKEA 5HWWA 4FCFA 3OZHA 4GB7A 1XFNA 1L0FA 3O88A 1VHMA 2PU4A 5HSQA 3IXDA 3DTMA 2WAFA 3KO6A 3T4LA 2W0NA 3NOUC 5GLAA 3L7HA 4L0LA 4IEDA 2BG1A 5G4YA 1G6OA 2O99A 4UA6A 3KSGA 4Y0OA 2Y2PA 2J9PA 4MNRA 3CWFA 2WAEA 2J3WA 2PYRA 4I39A 4FD8A 1NJ4A 5E2FA 3U2AA 4GS9A 4IUKA 4HNBA 4U0TA 4R3BA 5D3OA 3S7OA 1V9YA 2VV8A 4O8GA 2B95A 5FSRA 2H0TA 1TD5A 4OPZA 1S0WA 3BWLA 1KE3A 3CI6A 2EWWA 3D9YA 4LRYC 1T1BA 4Y7PA 1BLHA 5FI6A 3MFDA 1IYSA 4EV4A 3VSLA 4BL3A 2QPNA 3A3JA 5FAPA 4KG6A 4MLLA 5EM0A 1IOUA 1MWUA 4H8RA 5FAOA 2QJ7A 2WKPA 2WKHA 3Q7ZA 1ES4A 4RYEA 1N9NA 5GL9A 3PAGA 3TG9A 5E2HA 4FUWA 3LEZA 1JWVA 4E3NA 4E3IA 4GW9A 1H8YA 1FIKA 3TOIA 4XT2B 5FA7A 2Y2QA 3LR4A 4Q0HA 1G5UA 4FH2A 4QWOA 3T1XA 3G35A 2ACGA 4GKUA 4YNRA 4EESA 1LI0A 5EUAA 3OCNA 1MWSA 1KOUA 2ZQ7A 3DAVA 3BJNA 4GDBA 4Y17A 4Q0IA 1G6AA 5EVIB 2EWVA 1GHIA 1PYYA 4KZ8A 4UQIM 4HOIA 2XEPA 2XSSA 3SZTA 1XA7A 3UB5P 1HZOA 4KZ5A 4YWZA 4ARZA 5HPFA 3EEHA 5CGSA 4QY5A 3R4KA 4WM9A 2KX6A 2VV7A 1ODVA 1E4DA 1GSWA 1KGEA 3S7QA 1VB6A 1L0EA 3IBJA 3E4OA 1NYYA 1OPXA 2QYBA 4EWFA 3UPOA 3AGFA 2VGLS 3GECA 4BENA 4MEZA 5TGFA 3GDIA 4KENB 3OOVA 5G4ZA 5I94A 5A92A 3VE4A 3G30A 1DRMA 1JTDA 1LSXA 5EVIA 5HW3A 5DF9A 4JXVA 1U60A 1W7FA 2IWBA 2HP9A 4LV3A 5CTNA 1VEUB 3K3CA 4FH4A 1YLJA 1IELA 1PW1A 1HLUP 3SS3A 2IA2A 3DTIA 4KQRA 3W2ZA 2GNXA 1LHYA 2M7UA 2VV6A 2W3HA 2Y8HA 1STZA 4WELA 1SKOA 2W3DA 2OWJA 5DTSA 3BRMA 5F82A 1V9ZA 3MS6A 4CJNA 3N8LA 5FAQA 4EBLA 3DWKA 1PI4A 5DFYA 1P0ZA 2ZMVA 2EX9A 2JKTI 4DRTA 2R9XA 5EVLA 3CUEA 3R7WA 2JE5A 2Y4AA 3MJQA 4R1GA 1WE4A 4BD0A 1BUEA 3PTEA 2AVXA 2Q9NA 4GD8A 3VMAA 3IF6A 5CHUA 2JCHA 3B42A 3A3DA 4GDNA 2Z6CA 3HLCA 1ES2A 4GHIA 4X68A 4R4RA 4R6LA 4BBVA 3UO9A 3GVBA 1IFQA 3H9WA 3P7NA 5EOOA 4WEKA 4JGRA 1VEUA 3B33A 1S1ZA 1LI9A 3LICA 4JLFA 3W8KA 3C8CA 5EPHA 2VJWA 3T1RA 4P87A 1G28A 3F1PB 1EROA 2VGJA 3FYZA 1K56A 2FFYA 2HJ9C 3O87A 4IBXA 4JF4A 3DTKA 3LIBA 3BECA 3CLOA 4IUHA 4PM5A 1H3QA 5AVEA 1TS7A 1W63Q 3MZFA 2WGVA 2QHKA 4I3IA 1T19A 4JXGA 5FQQA 3ZQ5A 3FPWA 2FH5A 2WZXA 2W1TA 2PU2A 3BM6A 3NY4A 4DE3A 2BTFP 1WYBA 5DFXA 4O01A 1IYQA 4GLQA 2CC1A 3HLBA 1SKFA 3NJAA 1YLWA 4RX2A 3C4PA 3WS5A 4NK3A 3MKEA 3F1NB 3KSIA 4QB8A 4FOFA 2R78A 1PWCA 1XX2A 3Q7VA 4GS9B 4QPRA 5EVID 3CG5A 4OKPA 4ZTKA 4HI4A 1YKDA 2R9WA 4H6JB 1BSGA 1MWRA 2XA7S 1CI9A 1YMSA 1S4SA 3JPUA 4ZJ2A 3FZCA 2FZ0A 3ZG8B 1TEMA 2HPBA 1XJ4A 4AFIA 2J3TD 5DF8A 4BJPA 3BFDA 1EWZA 3UY6A 4S2OA 3IF6C 3WS4A 3PAEA 3Q07A 2X01A 1W79A 3NOPC 2W1RA 1YLPA 1XXMA 3VV4A 3N8RA 5AQAA 3CHWP 2ZC6B 2DCFA 1K6RA 1K4EA 1NWZA 2P08A 1XJ6A 2M1CA 5I5LA 1SDNA 2Y2JA 3LIDA 2ZLYA 1YMXA 1MBLA 2WADA 2H0YA 3IH9A 3OPPA 5JYPA 1ZC2A 1TDGA 2YKHA 5DKKA 5KSCA 1MXOA 4E3LA 1LL9A 4PPRA 3CAXA 3QP5A 4C3QA 1VETA 1DP9A 4OQIA 4UQIS 3UE6A 1PZOA 2XRNA 4N92A 1OTIA 2J80A 1JVJA 2V8CA 5E2EA 3MFXA 4OQGA 4E3MA 4GHIB 5CGXA 3MXQA 2X02A 2V1BA 4UHUA 2B18A 1CJFA 2PHYA 3HJKA 1KDSA 1ACFA 3UMDA 3SW1A 4HEFA 1DJBA 4S2PA 1L2SA 4CLCD 5EOEA 4RX3A 3T12B 3MQOA 1D7EA 4LRZE 1H8MA 1K0KA 2GDNA 2HF6A 2E8IA 4CLCC 2Y2GA 3HLFA 4Y5FA 4C6YA 2L4RA 2Y2OA 5HFOA 1NLYA 1FCOA 3BW6A 4JGQA 2O9BA 1S1YA 5CTMA 4JXWA 1OTEA 5F68A 1N9LA 4KZBA 4U3TA 2W3GA 2W3FA 3G6OA 1HVBA 1JWPA 2O0YA 4HIAA 5G18A 2Y2NA 2WK0A 5AQ9A 4GNUA 4H6JA 2PT7A 5DVAA 4ZDXA 4D60A 3EGDC 2IWCA 3EQVA 3M6HA 4PM9A 3TRCA 2P9VB 1MZUA 2OAQ1 3G4PA 4OH0A 4NETA 5AVFA 3BY8A 5CXWA 5DJUA 5A90A 1OT9A 2WKRA 3FWLA 4D2OA 3HVFA 4JPMA 3NDGA 3TW8A 3FKWA 4WLAA 1DJAA 4FTXA 2WZZA 3ZFZA 4JF6A 2V1AA 3UN7A 3LIFA 4F3LB 1X0OA 3ICYA 5CGWA 3T50A 1TS6A 2ZQ8A 3LFVA 2A49A 2EA9A 4B4XA 4KG5A 5GLCA 1PFLA 3SS4A 3ZNTA 1IYOA 5FQJA 4L9GA 1I2SA 5E2GA 5TJJA 5HPIA 2WUQA 1S6RA 3FV7A 3IHAA 1SCWA 1Y28A 3UDFA 4F3LA 4EUVA 1ZHHB 3PHYA 1N9OA 5U47A 5CHJA 2V0WA 5L10A 2QZ6A 3ZVWA 4GN2A 3GR2A 2ZJ9A 2DNSA 3OC2A 5L07A 2I9VA 4QU3A 4QHCA 2ZQCA 1YM1A 1SHVA 2W3EA 4EQIA 3IXHA 1ES3A 1XPBA 3F1OA 5FI7A 4LRXC 1GA0A 2XK1A 4B9OA 4ZRRA 3HUOA 4HP9A 3VOLA 2XH9A 1H0MA 3IWQA 4XUZA 4PM6A 3WS2A 1IKIA 3P09A 2XROA 1GHMA 4M3KA 2OSUA 3LUQA 4WBGA 5CECA 4MDZA 2Y59A 1SZVA 3S4XA 3HREA 2WGWB 3SH9A 2IWDA 3LI9A 1MKIA 1LT0A 3VP0A 4HP4A 1PIOA 3QP4A 3P01A 2Q0OA 2XD1A 4EXOA 2Y2IA 1HTZA 1WA9A 4IJGA 5J4EA 3HBRA 3W4QA 4L9FA 5AQ7A 4QD4A 3TE8A 3HLWA 2ZM2A 3ITBA 2EFXA 3DWZA 5AQBA 4S2LA 2NUPC 1S67L 3HLGA 4OONA 4DJ3A 4EEUA 2P74A 4LFUA 4OPQA 5HARA 4GJ4A 1K38A 3PR6A 2RL3A 2UWXA 4OPRA 3CITA 4BMWA 4P6BA 4OLGA 4WMCA 4S2MA 2JKGA 3RJUA 4E3JA 1GSXA 2XA7M 1F2KA 2X71A 4P6ZS 1H8ZA 4IHQA 4HJ3A 3ZCZA 4KUKA 4GD6A 4HHDA 4Y2FA 1QMFA 2ZQDA 2I72A 3IH8A 3D72A 4YOFA 3M2JA 4N1HA 5KZHA 4QJGA 2ZMFA 2ZM0A 3C2WA 3CPTB 3CUEC 1G68A 3QHYA 4II7A 4KQOA 1EW0A 3OLOA 2BLSA 2H10A 4BD1A 2W27A 1ZTUA 4LV0A 1JWZA 2XR0A 1O07A 3G2YA 1CK3A 1XJ3A 1XFQA 2VA0A 5AJGA 5IT5A 2HP5A 2L1MA 1NZOA 3BLSA 4HY8A 2V2FF 1XKZA 1P97A 1FR1A 1IKGA 3WS1A 2QJ5A 4BBUA 1MC0A 2VGLM 1RGZA 2Y79A 3NCKA 4MN6A 4R38A 1XGJA 3CZDA 1KVLA 1O7EA 1MWTA 4LCMA 3AGEA 2PD7A 3UMEA 3GV9A 2EX8A 3W4PA 4DE2A 3QP1A 3E98A 4EERA 1BULA 4X25A 2ZC3B 1YLYA 4DE0A 3I7JA 1P9RA 1OJGA 3IX8A 2Y91A 1L3LA 3Q82A 4DMZA 4XUXA 3ISGA 4G3KA 5F69A 3M6BA 5EFWA 1C3BA 3FPVA 1ERMA 3EEAA 5A8BA 5HDSA 2XFSA 2UV0E 2O9CA 4B88A 3NOTC 3UE0A 3A3FA 3D4FA 1W5DA 3LCEA 4ARZB 4DJ2A 3A0RA 1K4FA 3E4PA 3JVUA 3UB9A 4K0WA 5KIZA 3T1SA 1K54C 1FR6A 1KE4A 3OBFA 3CJMA 2M7VA 1OMEA 5FQMA 4OQHA 2JC7A 3LEQA 5FDHA 5EVIC 4Y0UA 1BYWA 4F94A 3FG8A 3D3OA 2H5SA 4MBFA 5FI2A 3ZG7B 4P85A 4EBPA 3VFHA 4I3JA 4NXFA 2A24B 3S7PA 1JTGA 4CPKA 2HZ5A 3G2ZA 4OP8A 4R23A 1ERQA 4HH2A 5L8MA 1D1JA 1T1AA 1FOFA 3DW0A 3IT9A 1PZPA 3NDEA 5HAIA 3ZG0A 2GZAA 3ZDJA 5HX9A 3ZNYA 4XXRA 1BLSA 1GA9A 4N9LA 5F83A 4BWIA 3WRZA 1Q2PA 3NULA 3DBAA 3G34A 1BLPA 3U4LP 5HDDA 3IWOA 3WRTA 1ESIA 1TDLA 1IYPA 3Q1FA 2EFUA 1DJCA 1P9WA 3Q7VB 3IX4A 3FKVA 4JGOA 1CI8A 4MMNA 1XA1A 3LR5A 2H28A 5L2FA 2P7JA 4K08A 3T4OA 2PR5A 1MKMA 1XP4A 3GMWA 1ZG4A 2WKIA 5M18A 1PNEA 3W4OA 5J3WA 4IVIA 4KZ4A 3GRJA 2XDMA 3IF5A 4E3KA 3E2KA 1GHPA 3MQ0A 4ESPA 3O86A 1Y54A 1EI5A 4CLCE 4ZJ3A 3IX3A 4DKIA 2HDUA 2G7UA 1AWIA 1N9BA 3ZYTA 4S2JA 1XJ2A 1VETB 3BYDA 5J7EA 1T18A 2GX5A 1OJ5A 4KZ6A 2Q9MA 4LCLA 2KLIA 1FQGA 1OTAA 3H82B 4NXBA 3MXSA 3VFFA 4R70A 2MJ6A 3C5AA 1CEFA 1PWGA 4WMCD
chains in the Genus database with same CATH topology
3JPUA 3QP4A 5L07A 3QP1A 2Q0OA 3QP6A 3QP8A 3IX4A 1H0MA 4NG2A 3SZTA 3IX8A 3QP5A 3QP2A 5L09A 5L10A 4LFUA 1L3LA 2AVXA 4Y15A 2UV0E 3IX3A 4Y13A 4LGWA 4Y17A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JPU A;  3QP4 A;  5L07 A;  3QP1 A;  2Q0O A;  3QP6 A;  3QP8 A;  3IX4 A;  1H0M A;  4NG2 A;  3SZT A;  3IX8 A;  3QP5 A;  3QP2 A;  5L09 A;  5L10 A;  4LFU A;  1L3L A;  2AVX A;  4Y15 A;  2UV0 E;  3IX3 A;  4Y13 A;  4LGW A;  4Y17 A; 
#chains in the Genus database with same CATH topology
 3KSH A;  1YPR A;  1AXB A;  4PKY A;  2PDR A;  3PBR A;  3VP4 A;  4DDS A;  2PRF A;  3E2L A;  4WZ5 C;  5J8X A;  3VSK A;  2E8J A;  4ZBE A;  1DP6 A;  4LPZ A;  4LLO B;  4S2I A;  2EX6 A;  4ETZ A;  3QNC A;  3DTE A;  2JHE A;  5GHX A;  3H7W A;  3NIA A;  3C7V A;  3EGX C;  3JYI A;  1TF1 A;  1LL8 A;  3IBR A;  1FCN A;  2VX8 A;  2VEA A;  1K55 A;  4OLD A;  4DXB A;  1LL5 A;  5F5Y A;  2LB9 A;  4HBT A;  4BQM A;  3CPT A;  2KDK A;  2HJE A;  3LR0 A;  5DF7 A;  4RA7 A;  1CF0 A;  3N8S A;  2XLN A;  4Y3I A;  3EWK A;  1YLZ A;  4CLC B;  3LR3 A;  2ZL1 A;  3GQZ A;  1RGY A;  2HV1 A;  4I5S A;  5FL3 A;  5FQI A;  3LI8 A;  3PBO A;  1K25 A;  2J8Y A;  3M2K A;  5KSH A;  2J3T C;  2O9A A;  4NXG A;  4YFM A;  1J3W A;  4A5R A;  2WGW A;  3WWX A;  2XD5 A;  5CED A;  2HP6 A;  3TSG A;  3T1Q B;  2Y2H A;  2OLU A;  3SH8 A;  5TBM A;  4Z1W A;  3ZGA B;  3OPR A;  2Z2M B;  3F1P A;  3PBQ A;  2HGV A;  1F9I A;  4DN0 A;  4HJ6 A;  2JN7 A;  2ZMA A;  4MCW A;  5EVE A;  2PD8 A;  2JKR M;  2RCX A;  3LY3 A;  2Y2K A;  4BLM A;  1BT5 A;  5CHM A;  4HQA A;  5CX7 A;  2QKP A;  1SDE A;  1LLB A;  3MMH A;  5CER A;  4KZA A;  2JBF A;  4PHT A;  4WF0 A;  2ZC4 B;  4X56 A;  5HL6 A;  1NY0 A;  4O7D A;  1M40 A;  4HH3 A;  5HDC A;  1MY8 A;  3OCL A;  2HDQ A;  2P04 A;  5FQK A;  2B02 A;  2V1Z A;  3KYE A;  3T4K A;  3A0V A;  3QNB A;  1TVF A;  3MSH A;  3UB7 A;  4I3A A;  3NHQ A;  4UEY A;  3IF6 B;  1ES5 A;  5HL1 A;  5HZH A;  1S66 L;  3B3X A;  3QP6 A;  1K6S A;  3Q81 A;  1YT4 A;  1KGF A;  1PWD A;  2ZQ9 A;  1VQQ A;  4EQ1 A;  5HAP A;  1E25 A;  2Y2L A;  2VZW A;  4ME4 A;  4JF5 A;  2PAV P;  3G31 A;  5HWV A;  4ETX A;  4GCZ A;  5DKL A;  1YQS A;  5M1A A;  3VP2 A;  4R3J A;  4IVK A;  5GLD A;  4YIN A;  3ZG5 A;  3B47 A;  1L0G A;  2ZC7 A;  1NLZ A;  3UB6 A;  3F1N A;  2Z2L B;  3G32 A;  4N1X A;  5C5K A;  1ESU A;  1KE0 A;  4P6Z M;  3VOZ A;  2EXA A;  3QP8 A;  2W1T B;  3V5M A;  4HES A;  2QMI A;  4X6T A;  4KQD A;  3S1Y A;  4ZJ1 A;  2V20 A;  2J7V A;  3C7U A;  4GZB A;  4NKP A;  2P9V A;  1H5X A;  1LSW A;  4JBF A;  3UB8 A;  4ZAM A;  1TS0 A;  5JYO A;  4DXC A;  3E4Q A;  4ID4 A;  3V3R A;  3VP3 A;  4R0Q A;  3BLM A;  4WEJ A;  4E6X A;  3LYX A;  4FSF A;  3MZD A;  2WYX A;  1KDW A;  2ZOH A;  1UWP X;  3NC8 A;  3OPH A;  3P98 A;  3K2N A;  4WZ5 A;  3A3I A;  3IXG A;  4E6W A;  3MF0 A;  5HD5 A;  4RVA A;  2XGN A;  5E43 A;  3OPL A;  3RXX A;  5LBR A;  1GCE A;  4HBU A;  4G3W A;  2VKS A;  3T4Q A;  4MN5 A;  3KX0 X;  1Z09 A;  1DY6 A;  4WUJ A;  3C30 A;  1E3U D;  2XQZ A;  3GSG A;  4DDY A;  3LO7 A;  3UE3 A;  3S7N A;  5M19 A;  4Y15 A;  3TJZ C;  3LY4 A;  3PBN A;  3ZHH A;  4OVD A;  1YLT A;  4UA9 A;  5EM1 A;  4UAA A;  4KZ9 A;  3V50 A;  3UDI A;  1A0K A;  1OTD A;  1OTB A;  3MZE A;  4MBK A;  4KZ3 A;  3BFE A;  3T4J A;  1IEM A;  4S2K A;  4XT2 A;  4CQH A;  1FSY A;  3HUN A;  4KUO A;  1LSV A;  3MKF A;  4S2N A;  2DRW A;  3H82 A;  1UWN X;  4NXE A;  3AGD A;  3JVV A;  3C38 A;  2XF3 A;  4Q0J A;  2PBD P;  2OV5 A;  3T4T A;  3K3D A;  4EU0 A;  4E3O A;  3N4I A;  2G2U A;  3UPP A;  4X69 A;  2K2N A;  1I2W A;  4BBT A;  4JXS A;  3BEB A;  2ZQA A;  3S22 A;  1Q2Q A;  1OT6 A;  3T4S A;  2INW A;  1D06 A;  3EOI A;  2VLG A;  3RFB A;  4U0X A;  1KGG A;  2WKQ A;  2PYP A;  2Z6D A;  4N9K A;  2Y2M A;  1GSV A;  5F1G A;  4LV2 A;  2OLV A;  4OP5 A;  3O3V A;  4R3A A;  1F5M A;  1MPL A;  2DMW A;  3BFC A;  3KYZ A;  3GTC A;  4WYY A;  2ZL1 B;  4LGW A;  1KVM A;  4X53 A;  1L0D A;  1W8Q A;  4X55 A;  1WYC A;  1ZKJ A;  2A3U A;  3N6I A;  4PAU A;  2YKF A;  1K57 C;  3HL9 A;  5A91 A;  3BY9 A;  1BZA A;  1YSP A;  3ULF A;  1PW8 A;  2XFT A;  2G2W A;  2C5W B;  4PMA A;  4DF6 A;  5FQ9 A;  4BL2 A;  4Q8I A;  4KZ7 A;  4Y0T A;  2OAP 1;  3RH8 B;  4OQ0 A;  1NYM A;  1NRJ A;  1NZU A;  1K55 C;  4E04 A;  1HD8 A;  5K5B A;  1K54 A;  4LEN A;  5GHZ A;  1BLC A;  4M4X A;  3ITA A;  3IS2 A;  2BAS A;  2J9O A;  4L9E A;  1CEG A;  3UNW A;  3EQU A;  4MBH A;  3IQA A;  2VGK A;  2L0W A;  4EUZ A;  4LV1 A;  4EBN A;  2B5R A;  5IS1 A;  2JKR I;  4EW7 A;  3MBZ A;  1TS8 A;  3SH7 A;  2V8F A;  4WN5 A;  5F1F A;  4OOL A;  2LB5 A;  3QP2 A;  3ZG9 B;  2QWS A;  1FIL A;  5DTK A;  4PKY G;  4C75 A;  4EEP A;  5MC7 A;  3F1O B;  5FEF A;  2ZM8 A;  2D02 A;  4S2N C;  4GOG A;  1E3U A;  2WGI A;  3FC7 A;  5HWT A;  5DTT A;  3WS0 A;  3KYQ A;  4X1M A;  2A24 A;  4NG2 A;  2HDS A;  3O5Y A;  3NI9 A;  1FCM A;  1K56 D;  2ZOI A;  1ONG A;  2PBY A;  2K31 A;  4OOM A;  3V39 A;  4UA7 A;  2V9A A;  3PYP A;  2K7S A;  1JNU A;  3V3S A;  5FAS A;  3KSF A;  5TR7 A;  1FSW A;  3LIE A;  4B4Z A;  3RXW A;  1ONH A;  1VM1 A;  3UDX A;  1M6K A;  2ZBB A;  3BFG A;  3LIA A;  5L09 A;  1N4O A;  3L9K A;  4OPY A;  4JGP A;  5TFQ A;  2OOL A;  1RP5 A;  4B93 A;  4O0P A;  4PM7 A;  4HJ4 A;  4K91 A;  5CRF A;  2EXB A;  4R4S A;  2GJ3 A;  5EV0 A;  3VOY A;  3IXB A;  1DP8 A;  1XGI A;  4Z9Q A;  4IBR A;  2FFF B;  3BFF A;  5F6A A;  2CMN A;  1K57 A;  3HCY A;  4G3V A;  4X1L A;  3MXR A;  1J9M A;  4Y13 A;  1BTL A;  4NEE D;  1RCJ A;  5GHY A;  5CEB A;  3SOI A;  4KQQ A;  3UE1 A;  2PR6 A;  4PM8 A;  3BQA A;  4OOY A;  1I5Q A;  4RQ9 A;  5FDS A;  5IU1 A;  5EEC A;  2JKF A;  2V0U A;  3HLE A;  4MN7 A;  3C4O A;  3HJI A;  4KG2 A;  5HAQ A;  4DE1 A;  1Y4O A;  1Z6F A;  3VP1 A;  3A0S A;  4P0M A;  1SKO B;  3RTY A;  4I38 A;  3R7W B;  3UPN A;  5TBM B;  5EE8 A;  3ZVT A;  5DJT A;  1CQA A;  1NXY A;  5A93 A;  5HD3 A;  2KOI A;  2HDR A;  5BOH A;  1YSQ A;  5GLB A;  4JKT A;  3NEC A;  3IS2 B;  3BQ8 A;  1UGU A;  3PXP A;  2C6W B;  1PRQ A;  2EX2 A;  3PBS A;  4WZ4 A;  3CMZ A;  3V67 A;  4WL9 A;  1QME A;  2ZC5 B;  3H7W B;  1ZG6 A;  4CLC A;  5KMW A;  2D01 A;  3IHB A;  5FEG A;  1S4R A;  2VK3 A;  1W8Y A;  3PBT A;  3NBL A;  4EET B;  3MQQ A;  3MR0 A;  4K0X A;  2A2L A;  2Y55 A;  1W63 M;  1YAX A;  2OWH A;  1NRF A;  3LGO A;  1ALQ A;  2ZD8 A;  3SS5 A;  1F98 A;  2NUT C;  3N7W A;  3VE3 A;  5FAT A;  1PI5 A;  3E0Y A;  3A3E A;  3HLD A;  3HUM A;  3IWI A;  2JKT M;  1T1C A;  5IHV A;  4QY6 A;  2WKE A;  5HWW A;  4FCF A;  3OZH A;  4GB7 A;  1XFN A;  1L0F A;  3O88 A;  1VHM A;  2PU4 A;  5HSQ A;  3IXD A;  3DTM A;  2WAF A;  3KO6 A;  3T4L A;  2W0N A;  3NOU C;  5GLA A;  3L7H A;  4L0L A;  4IED A;  2BG1 A;  5G4Y A;  1G6O A;  2O99 A;  4UA6 A;  3KSG A;  4Y0O A;  2Y2P A;  2J9P A;  4MNR A;  3CWF A;  2WAE A;  2J3W A;  2PYR A;  4I39 A;  4FD8 A;  1NJ4 A;  5E2F A;  3U2A A;  4GS9 A;  4IUK A;  4HNB A;  4U0T A;  4R3B A;  5D3O A;  3S7O A;  1V9Y A;  2VV8 A;  4O8G A;  2B95 A;  5FSR A;  2H0T A;  1TD5 A;  4OPZ A;  1S0W A;  3BWL A;  1KE3 A;  3CI6 A;  2EWW A;  3D9Y A;  4LRY C;  1T1B A;  4Y7P A;  1BLH A;  5FI6 A;  3MFD A;  1IYS A;  4EV4 A;  3VSL A;  4BL3 A;  2QPN A;  3A3J A;  5FAP A;  4KG6 A;  4MLL A;  5EM0 A;  1IOU A;  1MWU A;  4H8R A;  5FAO A;  2QJ7 A;  2WKP A;  2WKH A;  3Q7Z A;  1ES4 A;  4RYE A;  1N9N A;  5GL9 A;  3PAG A;  3TG9 A;  5E2H A;  4FUW A;  3LEZ A;  1JWV A;  4E3N A;  4E3I A;  4GW9 A;  1H8Y A;  1FIK A;  3TOI A;  4XT2 B;  5FA7 A;  2Y2Q A;  3LR4 A;  4Q0H A;  1G5U A;  4FH2 A;  4QWO A;  3T1X A;  3G35 A;  2ACG A;  4GKU A;  4YNR A;  4EES A;  1LI0 A;  5EUA A;  3OCN A;  1MWS A;  1KOU A;  2ZQ7 A;  3DAV A;  3BJN A;  4GDB A;  4Y17 A;  4Q0I A;  1G6A A;  5EVI B;  2EWV A;  1GHI A;  1PYY A;  4KZ8 A;  4UQI M;  4HOI A;  2XEP A;  2XSS A;  3SZT A;  1XA7 A;  3UB5 P;  1HZO A;  4KZ5 A;  4YWZ A;  4ARZ A;  5HPF A;  3EEH A;  5CGS A;  4QY5 A;  3R4K A;  4WM9 A;  2KX6 A;  2VV7 A;  1ODV A;  1E4D A;  1GSW A;  1KGE A;  3S7Q A;  1VB6 A;  1L0E A;  3IBJ A;  3E4O A;  1NYY A;  1OPX A;  2QYB A;  4EWF A;  3UPO A;  3AGF A;  2VGL S;  3GEC A;  4BEN A;  4MEZ A;  5TGF A;  3GDI A;  4KEN B;  3OOV A;  5G4Z A;  5I94 A;  5A92 A;  3VE4 A;  3G30 A;  1DRM A;  1JTD A;  1LSX A;  5EVI A;  5HW3 A;  5DF9 A;  4JXV A;  1U60 A;  1W7F A;  2IWB A;  2HP9 A;  4LV3 A;  5CTN A;  1VEU B;  3K3C A;  4FH4 A;  1YLJ A;  1IEL A;  1PW1 A;  1HLU P;  3SS3 A;  2IA2 A;  3DTI A;  4KQR A;  3W2Z A;  2GNX A;  1LHY A;  2M7U A;  2VV6 A;  2W3H A;  2Y8H A;  1STZ A;  4WEL A;  1SKO A;  2W3D A;  2OWJ A;  5DTS A;  3BRM A;  5F82 A;  1V9Z A;  3MS6 A;  4CJN A;  3N8L A;  5FAQ A;  4EBL A;  3DWK A;  1PI4 A;  5DFY A;  1P0Z A;  2ZMV A;  2EX9 A;  2JKT I;  4DRT A;  2R9X A;  5EVL A;  3CUE A;  3R7W A;  2JE5 A;  2Y4A A;  3MJQ A;  4R1G A;  1WE4 A;  4BD0 A;  1BUE A;  3PTE A;  2AVX A;  2Q9N A;  4GD8 A;  3VMA A;  3IF6 A;  5CHU A;  2JCH A;  3B42 A;  3A3D A;  4GDN A;  2Z6C A;  3HLC A;  1ES2 A;  4GHI A;  4X68 A;  4R4R A;  4R6L A;  4BBV A;  3UO9 A;  3GVB A;  1IFQ A;  3H9W A;  3P7N A;  5EOO A;  4WEK A;  4JGR A;  1VEU A;  3B33 A;  1S1Z A;  1LI9 A;  3LIC A;  4JLF A;  3W8K A;  3C8C A;  5EPH A;  2VJW A;  3T1R A;  4P87 A;  1G28 A;  3F1P B;  1ERO A;  2VGJ A;  3FYZ A;  1K56 A;  2FFY A;  2HJ9 C;  3O87 A;  4IBX A;  4JF4 A;  3DTK A;  3LIB A;  3BEC A;  3CLO A;  4IUH A;  4PM5 A;  1H3Q A;  5AVE A;  1TS7 A;  1W63 Q;  3MZF A;  2WGV A;  2QHK A;  4I3I A;  1T19 A;  4JXG A;  5FQQ A;  3ZQ5 A;  3FPW A;  2FH5 A;  2WZX A;  2W1T A;  2PU2 A;  3BM6 A;  3NY4 A;  4DE3 A;  2BTF P;  1WYB A;  5DFX A;  4O01 A;  1IYQ A;  4GLQ A;  2CC1 A;  3HLB A;  1SKF A;  3NJA A;  1YLW A;  4RX2 A;  3C4P A;  3WS5 A;  4NK3 A;  3MKE A;  3F1N B;  3KSI A;  4QB8 A;  4FOF A;  2R78 A;  1PWC A;  1XX2 A;  3Q7V A;  4GS9 B;  4QPR A;  5EVI D;  3CG5 A;  4OKP A;  4ZTK A;  4HI4 A;  1YKD A;  2R9W A;  4H6J B;  1BSG A;  1MWR A;  2XA7 S;  1CI9 A;  1YMS A;  1S4S A;  3JPU A;  4ZJ2 A;  3FZC A;  2FZ0 A;  3ZG8 B;  1TEM A;  2HPB A;  1XJ4 A;  4AFI A;  2J3T D;  5DF8 A;  4BJP A;  3BFD A;  1EWZ A;  3UY6 A;  4S2O A;  3IF6 C;  3WS4 A;  3PAE A;  3Q07 A;  2X01 A;  1W79 A;  3NOP C;  2W1R A;  1YLP A;  1XXM A;  3VV4 A;  3N8R A;  5AQA A;  3CHW P;  2ZC6 B;  2DCF A;  1K6R A;  1K4E A;  1NWZ A;  2P08 A;  1XJ6 A;  2M1C A;  5I5L A;  1SDN A;  2Y2J A;  3LID A;  2ZLY A;  1YMX A;  1MBL A;  2WAD A;  2H0Y A;  3IH9 A;  3OPP A;  5JYP A;  1ZC2 A;  1TDG A;  2YKH A;  5DKK A;  5KSC A;  1MXO A;  4E3L A;  1LL9 A;  4PPR A;  3CAX A;  3QP5 A;  4C3Q A;  1VET A;  1DP9 A;  4OQI A;  4UQI S;  3UE6 A;  1PZO A;  2XRN A;  4N92 A;  1OTI A;  2J80 A;  1JVJ A;  2V8C A;  5E2E A;  3MFX A;  4OQG A;  4E3M A;  4GHI B;  5CGX A;  3MXQ A;  2X02 A;  2V1B A;  4UHU A;  2B18 A;  1CJF A;  2PHY A;  3HJK A;  1KDS A;  1ACF A;  3UMD A;  3SW1 A;  4HEF A;  1DJB A;  4S2P A;  1L2S A;  4CLC D;  5EOE A;  4RX3 A;  3T12 B;  3MQO A;  1D7E A;  4LRZ E;  1H8M A;  1K0K A;  2GDN A;  2HF6 A;  2E8I A;  4CLC C;  2Y2G A;  3HLF A;  4Y5F A;  4C6Y A;  2L4R A;  2Y2O A;  5HFO A;  1NLY A;  1FCO A;  3BW6 A;  4JGQ A;  2O9B A;  1S1Y A;  5CTM A;  4JXW A;  1OTE A;  5F68 A;  1N9L A;  4KZB A;  4U3T A;  2W3G A;  2W3F A;  3G6O A;  1HVB A;  1JWP A;  2O0Y A;  4HIA A;  5G18 A;  2Y2N A;  2WK0 A;  5AQ9 A;  4GNU A;  4H6J A;  2PT7 A;  5DVA A;  4ZDX A;  4D60 A;  3EGD C;  2IWC A;  3EQV A;  3M6H A;  4PM9 A;  3TRC A;  2P9V B;  1MZU A;  2OAQ 1;  3G4P A;  4OH0 A;  4NET A;  5AVF A;  3BY8 A;  5CXW A;  5DJU A;  5A90 A;  1OT9 A;  2WKR A;  3FWL A;  4D2O A;  3HVF A;  4JPM A;  3NDG A;  3TW8 A;  3FKW A;  4WLA A;  1DJA A;  4FTX A;  2WZZ A;  3ZFZ A;  4JF6 A;  2V1A A;  3UN7 A;  3LIF A;  4F3L B;  1X0O A;  3ICY A;  5CGW A;  3T50 A;  1TS6 A;  2ZQ8 A;  3LFV A;  2A49 A;  2EA9 A;  4B4X A;  4KG5 A;  5GLC A;  1PFL A;  3SS4 A;  3ZNT A;  1IYO A;  5FQJ A;  4L9G A;  1I2S A;  5E2G A;  5TJJ A;  5HPI A;  2WUQ A;  1S6R A;  3FV7 A;  3IHA A;  1SCW A;  1Y28 A;  3UDF A;  4F3L A;  4EUV A;  1ZHH B;  3PHY A;  1N9O A;  5U47 A;  5CHJ A;  2V0W A;  5L10 A;  2QZ6 A;  3ZVW A;  4GN2 A;  3GR2 A;  2ZJ9 A;  2DNS A;  3OC2 A;  5L07 A;  2I9V A;  4QU3 A;  4QHC A;  2ZQC A;  1YM1 A;  1SHV A;  2W3E A;  4EQI A;  3IXH A;  1ES3 A;  1XPB A;  3F1O A;  5FI7 A;  4LRX C;  1GA0 A;  2XK1 A;  4B9O A;  4ZRR A;  3HUO A;  4HP9 A;  3VOL A;  2XH9 A;  1H0M A;  3IWQ A;  4XUZ A;  4PM6 A;  3WS2 A;  1IKI A;  3P09 A;  2XRO A;  1GHM A;  4M3K A;  2OSU A;  3LUQ A;  4WBG A;  5CEC A;  4MDZ A;  2Y59 A;  1SZV A;  3S4X A;  3HRE A;  2WGW B;  3SH9 A;  2IWD A;  3LI9 A;  1MKI A;  1LT0 A;  3VP0 A;  4HP4 A;  1PIO A;  3QP4 A;  3P01 A;  2Q0O A;  2XD1 A;  4EXO A;  2Y2I A;  1HTZ A;  1WA9 A;  4IJG A;  5J4E A;  3HBR A;  3W4Q A;  4L9F A;  5AQ7 A;  4QD4 A;  3TE8 A;  3HLW A;  2ZM2 A;  3ITB A;  2EFX A;  3DWZ A;  5AQB A;  4S2L A;  2NUP C;  1S67 L;  3HLG A;  4OON A;  4DJ3 A;  4EEU A;  2P74 A;  4LFU A;  4OPQ A;  5HAR A;  4GJ4 A;  1K38 A;  3PR6 A;  2RL3 A;  2UWX A;  4OPR A;  3CIT A;  4BMW A;  4P6B A;  4OLG A;  4WMC A;  4S2M A;  2JKG A;  3RJU A;  4E3J A;  1GSX A;  2XA7 M;  1F2K A;  2X71 A;  4P6Z S;  1H8Z A;  4IHQ A;  4HJ3 A;  3ZCZ A;  4KUK A;  4GD6 A;  4HHD A;  4Y2F A;  1QMF A;  2ZQD A;  2I72 A;  3IH8 A;  3D72 A;  4YOF A;  3M2J A;  4N1H A;  5KZH A;  4QJG A;  2ZMF A;  2ZM0 A;  3C2W A;  3CPT B;  3CUE C;  1G68 A;  3QHY A;  4II7 A;  4KQO A;  1EW0 A;  3OLO A;  2BLS A;  2H10 A;  4BD1 A;  2W27 A;  1ZTU A;  4LV0 A;  1JWZ A;  2XR0 A;  1O07 A;  3G2Y A;  1CK3 A;  1XJ3 A;  1XFQ A;  2VA0 A;  5AJG A;  5IT5 A;  2HP5 A;  2L1M A;  1NZO A;  3BLS A;  4HY8 A;  2V2F F;  1XKZ A;  1P97 A;  1FR1 A;  1IKG A;  3WS1 A;  2QJ5 A;  4BBU A;  1MC0 A;  2VGL M;  1RGZ A;  2Y79 A;  3NCK A;  4MN6 A;  4R38 A;  1XGJ A;  3CZD A;  1KVL A;  1O7E A;  1MWT A;  4LCM A;  3AGE A;  2PD7 A;  3UME A;  3GV9 A;  2EX8 A;  3W4P A;  4DE2 A;  3QP1 A;  3E98 A;  4EER A;  1BUL A;  4X25 A;  2ZC3 B;  1YLY A;  4DE0 A;  3I7J A;  1P9R A;  1OJG A;  3IX8 A;  2Y91 A;  1L3L A;  3Q82 A;  4DMZ A;  4XUX A;  3ISG A;  4G3K A;  5F69 A;  3M6B A;  5EFW A;  1C3B A;  3FPV A;  1ERM A;  3EEA A;  5A8B A;  5HDS A;  2XFS A;  2UV0 E;  2O9C A;  4B88 A;  3NOT C;  3UE0 A;  3A3F A;  3D4F A;  1W5D A;  3LCE A;  4ARZ B;  4DJ2 A;  3A0R A;  1K4F A;  3E4P A;  3JVU A;  3UB9 A;  4K0W A;  5KIZ A;  3T1S A;  1K54 C;  1FR6 A;  1KE4 A;  3OBF A;  3CJM A;  2M7V A;  1OME A;  5FQM A;  4OQH A;  2JC7 A;  3LEQ A;  5FDH A;  5EVI C;  4Y0U A;  1BYW A;  4F94 A;  3FG8 A;  3D3O A;  2H5S A;  4MBF A;  5FI2 A;  3ZG7 B;  4P85 A;  4EBP A;  3VFH A;  4I3J A;  4NXF A;  2A24 B;  3S7P A;  1JTG A;  4CPK A;  2HZ5 A;  3G2Z A;  4OP8 A;  4R23 A;  1ERQ A;  4HH2 A;  5L8M A;  1D1J A;  1T1A A;  1FOF A;  3DW0 A;  3IT9 A;  1PZP A;  3NDE A;  5HAI A;  3ZG0 A;  2GZA A;  3ZDJ A;  5HX9 A;  3ZNY A;  4XXR A;  1BLS A;  1GA9 A;  4N9L A;  5F83 A;  4BWI A;  3WRZ A;  1Q2P A;  3NUL A;  3DBA A;  3G34 A;  1BLP A;  3U4L P;  5HDD A;  3IWO A;  3WRT A;  1ESI A;  1TDL A;  1IYP A;  3Q1F A;  2EFU A;  1DJC A;  1P9W A;  3Q7V B;  3IX4 A;  3FKV A;  4JGO A;  1CI8 A;  4MMN A;  1XA1 A;  3LR5 A;  2H28 A;  5L2F A;  2P7J A;  4K08 A;  3T4O A;  2PR5 A;  1MKM A;  1XP4 A;  3GMW A;  1ZG4 A;  2WKI A;  5M18 A;  1PNE A;  3W4O A;  5J3W A;  4IVI A;  4KZ4 A;  3GRJ A;  2XDM A;  3IF5 A;  4E3K A;  3E2K A;  1GHP A;  3MQ0 A;  4ESP A;  3O86 A;  1Y54 A;  1EI5 A;  4CLC E;  4ZJ3 A;  3IX3 A;  4DKI A;  2HDU A;  2G7U A;  1AWI A;  1N9B A;  3ZYT A;  4S2J A;  1XJ2 A;  1VET B;  3BYD A;  5J7E A;  1T18 A;  2GX5 A;  1OJ5 A;  4KZ6 A;  2Q9M A;  4LCL A;  2KLI A;  1FQG A;  1OTA A;  3H82 B;  4NXB A;  3MXS A;  3VFF A;  4R70 A;  2MJ6 A;  3C5A A;  1CEF A;  1PWG A;  4WMC D; 
#chains in the Genus database with same CATH homology
 3JPU A;  3QP4 A;  5L07 A;  3QP1 A;  2Q0O A;  3QP6 A;  3QP8 A;  3IX4 A;  1H0M A;  4NG2 A;  3SZT A;  3IX8 A;  3QP5 A;  3QP2 A;  5L09 A;  5L10 A;  4LFU A;  1L3L A;  2AVX A;  4Y15 A;  2UV0 E;  3IX3 A;  4Y13 A;  4LGW A;  4Y17 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...