3QP8A

Crystal structure of cvir (chromobacterium violaceum 12472) ligand-binding domain bound to c10-hsl
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
179
structure length
179
Chain Sequence
ARPLPAGLTASQQWTLLEWIHMAGHIETEGELKAFLDNILSQAPSDRIILVLGRLNNQNQIQRMEKVLNVSYPSDWLNQYSQENFAQHDPIMRIHLGQGPVIWEERFSRAKGSEEKRFIAEASSNGMGSGITFSAASDRNNVGSILSIGGKEPGRNAALVAMLNCLTPHLHQAAVRIAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CviR transcriptional regulator
publication title A strategy for antagonizing quorum sensing.
pubmed doi rcsb
source organism Chromobacterium violaceum
molecule tags Transcription
total genus 54
structure length 179
sequence length 179
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03472 Autoind_bind Autoinducer binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.80 Alpha Beta 2-Layer Sandwich Beta-Lactamase Transcription factor LuxR-like, autoinducer-binding domain 3qp8A00
1L3LA 3QP8A 3QP1A 2Q0OA 3QP4A 3JPUA 3IX3A 3IX4A 5L09A 4NG2A 4LFUA 2UV0E 4Y17A 3SZTA 1H0MA 4LGWA 5L07A 4Y15A 3QP5A 5L10A 3IX8A 3QP2A 4Y13A 2AVXA 3QP6A
chains in the Genus database with same CATH superfamily
3C4OA 4EV4A 2Y2PA 4S2OA 2A49A 1VEUB 1K55C 1ZKJA 1CJFA 5HAPA 4HBUA 4YINA 3WWXA 1YMSA 4E3MA 2DMWA 1S1ZA 4KZBA 1GHMA 3MZEA 4O0PA 1M6KA 1U60A 3S7NA 5L2FA 3SOIA 4S2PA 1K57A 3T4QA 3LY4A 3O86A 2CC1A 3IF5A 1XA7A 5TR7A 5HWWA 3F1OA 1Y28A 1P9RA 5EV0A 4R23A 3CPTA 3F1OB 3TG9A 2Y2QA 3VE4A 2K2NA 2HGVA 3F1NA 2PHYA 4WBGA 1BLCA 2A24B 2O99A 2K7SA 1W7FA 3MR0A 1IYQA 1DJCA 2LB9A 3VOYA 4HP9A 2Y2JA 2HF6A 4O01A 5FDSA 1TF1A 3E2LA 5J7EA 3LR3A 4G3VA 2QJ7A 1DJBA 5CHJA 1K54A 3QP4A 5MC7A 5IT5A 5FASA 1I5QA 4KZAA 2JKTI 4IVIA 4MEZA 4KZ5A 2WK0A 4P85A 3V5MA 1KDSA 4X68A 4QD4A 1T1BA 3LIAA 2XK1A 3LCEA 5AVFA 3PBRA 4KQQA 2W3FA 2VGKA 2HDSA 2XA7S 1LLBA 2WZXA 3ZG0A 1BULA 3G31A 4KZ3A 4JXSA 3SZTA 3EGDC 1F5MA 3LR4A 3V50A 5DJUA 4OONA 5HPFA 2QJ5A 3TRCA 1W63Q 3LGOA 4H6JB 3N8RA 1M40A 2H5SA 3BQAA 3LIBA 2BG1A 2EXAA 3IXDA 5AVEA 3LUQA 4IJGA 3MS6A 3VP2A 2V9AA 2ZL1A 4NG2A 1G28A 1HVBA 1CK3A 1IYPA 4BJPA 1GSXA 3UN7A 5FI7A 3T4SA 4PKYA 3F1PA 4ARZA 1YLTA 3WS0A 2Q0OA 4R3JA 3LIDA 2EX6A 4HJ3A 4MBHA 2GDNA 3KYQA 3F1PB 2HDRA 4RVAA 1WYCA 5FAPA 1H8MA 2Y59A 3UE1A 2WKPA 3MQ0A 4B4XA 2VK3A 3IWOA 4JKTA 2A2LA 3OPRA 3UE3A 2ZOHA 1PWGA 1TS7A 3S4XA 5A8BA 3NOTC 1GSVA 4EU0A 1UGUA 3CAXA 4JXWA 4R70A 4QY5A 1BYWA 1ACFA 2XSSA 5HAQA 3NECA 2QPNA 2V1AA 4ZAMA 2X71A 3D4FA 4GN2A 1DP6A 2B18A 3T12B 2W3EA 1DRMA 5DFYA 4P6BA 5FQIA 1GHIA 3ZG9B 4KQOA 3P98A 5HSQA 3HREA 4X69A 1OTIA 3VE3A 4Y0OA 5G4ZA 2Y2NA 4K08A 3BFFA 3LEZA 2J7VA 3UE0A 5DVAA 3B3XA 3SS3A 1EW0A 2I72A 2INWA 1SZVA 1BSGA 3IF6C 4XT2B 1S66L 4NXEA 1GSWA 4ME4A 4PM8A 5L07A 3VP4A 5EPHA 4EXOA 4ETXA 4S2LA 2JE5A 4EBLA 4BBVA 2V8CA 3RTYA 3PAGA 1L2SA 5HPIA 3QP1A 3W8KA 3KSGA 1FQGA 1YMXA 3N6IA 1WYBA 4I3AA 2HDUA 5F83A 3WS4A 1LI0A 5HW3A 3N7WA 3B33A 2WGWA 3DWZA 4PKYG 3JYIA 4HOIA 2V1BA 1S6RA 1J3WA 2VKSA 4HJ4A 2QWSA 1LL9A 3NJAA 5A92A 3FZCA 5HZHA 2M7VA 2DCFA 2OAQ1 3WRTA 1G68A 1KOUA 3UDFA 4WZ5A 4Y15A 1D7EA 3L9KA 3ZFZA 2XDMA 2M7UA 3E0YA 4X25A 3MFXA 1NXYA 3OPPA 1FSWA 4KZ6A 2UV0E 3W2ZA 1TD5A 5AJGA 5FEGA 1K4FA 2Y79A 2VA0A 2Y2KA 4PHTA 4OOLA 2K31A 3MXQA 3PTEA 3T4JA 2W1TA 4E3NA 3NHQA 1STZA 1ERQA 2W1TB 4JXGA 3CZDA 1XJ6A 2JKRI 3KX0X 3ZG8B 5G4YA 1EWZA 3GRJA 4R3AA 3HLBA 4EUZA 4WELA 1MKIA 1UWNX 1JWVA 2GZAA 1N9NA 2E8IA 3QP6A 5AQBA 2XQZA 1CEFA 4LV0A 1Q2PA 1NZOA 3ZNYA 3H82A 3VFFA 1S1YA 2R78A 3ZG7B 5EVEA 2DRWA 1JNUA 4WZ4A 1EROA 1K57C 4E6WA 4OP8A 1P97A 4OQIA 5I5LA 2ZC3B 4GW9A 1LT0A 4Z1WA 5GLCA 3K2NA 5K5BA 1IKGA 3Q7ZA 4CLCE 4PM5A 2QZ6A 2L1MA 1H8ZA 1HD8A 4DDSA 1ES3A 3IQAA 1SKFA 1E3UD 4L0LA 4OOMA 1TDLA 3D9YA 5AQ7A 3DW0A 1F2KA 3PHYA 5DKLA 1I2WA 4BQMA 3IXGA 5HARA 1LSWA 4OH0A 4KZ9A 1IYSA 4XUXA 1PW8A 3UB5P 4WL9A 2EFUA 1XX2A 5TFQA 5CX7A 1I2SA 5L10A 3UE6A 5A91A 4CLCC 2XEPA 4X53A 3DWKA 4KQRA 1MWUA 4GJ4A 3LI8A 3NOUC 2PD7A 2Y8HA 3UDIA 2M1CA 1PWDA 2ZC7A 4IBXA 1YM1A 1ALQA 3S1YA 4QB8A 1QMEA 4LFUA 3FPWA 5GLBA 4S2NC 2J8YA 1L0EA 4MNRA 4X55A 2XROA 3CWFA 2EWVA 4UA6A 3IS2A 4ZRRA 5FSRA 3SS4A 2H10A 5CHUA 5DFXA 4NK3A 3IX4A 5FQQA 4GS9B 3Q7VA 4MDZA 4Q0HA 4OVDA 3BFEA 3ULFA 3A3JA 4FCFA 1E3UA 3Q7VB 4R1GA 3O5YA 4MN6A 4Y13A 1BT5A 5FQKA 4Y0TA 1TDGA 3LIFA 3BFGA 2JKFA 5IU1A 3MZDA 4DXCA 3FG8A 5E2FA 5HD3A 2GX5A 2GNXA 5GHXA 3CHWP 4BLMA 2ZMVA 1SHVA 1PYYA 1L0GA 2HDQA 4QU3A 1T18A 3UB8A 2W1RA 5L8MA 1NRJA 1VEUA 2ZM8A 5DF8A 2L4RA 2XF3A 2H0TA 4X1LA 4X56A 3KO6A 2EX2A 5J4EA 1O07A 2OWHA 3IWIA 3IH8A 3UPOA 3CG5A 1KGGA 5HX9A 4WN5A 3W4PA 1CQAA 3OZHA 3MXRA 1OT6A 2Y2HA 4FOFA 2W3GA 1CF0A 1MKMA 4OPZA 1WA9A 3SW1A 3B42A 2XA7M 2P9VB 3E4QA 1ODVA 4DJ2A 1NRFA 3W4QA 1PIOA 4L9EA 4UQIS 1YAXA 4PM6A 5AQ9A 2A24A 4P6ZS 2Y91A 2I9VA 3ITBA 4IHQA 2RCXA 4MBFA 4XUZA 2PD8A 4HP4A 2EA9A 2O9CA 4D60A 2BASA 4O8GA 4IBRA 3BLMA 1XFNA 3RXXA 2Y2GA 2WKQA 1S4SA 5F6AA 3KYEA 1N9BA 3OPLA 3T1QB 5FDHA 3IX8A 1RCJA 3WS5A 3P09A 1E4DA 3V3RA 2C5WB 4KZ8A 3M2JA 3T4OA 4F94A 2QYBA 3NULA 1XFQA 4Y2FA 2JN7A 4RX3A 1PWCA 2JBFA 2WZZA 5F5YA 4OPRA 3U2AA 2WKRA 2WKIA 3AGDA 1MWSA 3NCKA 4YOFA 4LENA 3ZHHA 3LYXA 1JTGA 3BYDA 5M19A 2V0WA 1GHPA 3WS1A 1T1AA 1VETB 1HLUP 4LV3A 4H6JA 1CI8A 3LO7A 4CLCB 2PT7A 4EBNA 3C38A 3CUEC 2QKPA 2D01A 3MXSA 5EVLA 3V39A 1MC0A 4CJNA 4EW7A 5J3WA 3OCLA 5HDCA 3RH8B 1NYMA 4WEJA 5D3OA 5KIZA 3LICA 3ITAA 2IWCA 4PM9A 4ID4A 4GLQA 2PBDP 3PBSA 2YKFA 4H8RA 3AGFA 1EI5A 3VSLA 1XKZA 3T4LA 2B95A 3JPUA 2G7UA 4I3JA 2WAFA 4QY6A 1LSXA 3UMDA 3G35A 1MWRA 4II7A 2OLVA 5HL6A 2Z2LB 3GTCA 1LHYA 3D72A 4DRTA 3IXHA 4BBUA 3UY6A 3PYPA 1BTLA 4CQHA 1ZHHB 4WUJA 2O0YA 3HLCA 1F9IA 1ES2A 3HLDA 3TSGA 5GLAA 1A0KA 2W27A 2ZC4B 2NUTC 4U0XA 4N1HA 1YSQA 3DAVA 4UHUA 2V1ZA 4OQGA 4BBTA 3O3VA 1K55A 2ZQDA 1PW1A 4IEDA 4I3IA 4OOYA 1L3LA 2J3TD 4YWZA 3ZG5A 3G34A 1TS0A 1MWTA 2Y2MA 1K56D 1NJ4A 3C7UA 4E3LA 4LGWA 3K3DA 4KUKA 3GQZA 1L0DA 1YPRA 2O9AA 2E8JA 1IYOA 3NC8A 3NIAA 1NYYA 4R4SA 4JGOA 3LR0A 4XT2A 4JGRA 5KMWA 1YLPA 4KQDA 1RGZA 3R7WA 4D2OA 2P74A 4NETA 1PFLA 4N9KA 1TVFA 4UEYA 2Q9NA 1G6OA 4C6YA 4ZJ2A 2L0WA 3R7WB 4B93A 1Y4OA 1G5UA 4QJGA 1ES5A 3Q81A 4ZJ3A 2PBYA 5E43A 5GLDA 3ZDJA 1FCNA 4OP5A 1BLPA 1NWZA 4OLDA 3WRZA 3H9WA 5CEDA 1ZG6A 2VGJA 1K4EA 4OLGA 4LLOB 2ZM0A 2JC7A 3CITA 1H8YA 3TOIA 2Z6DA 5FQMA 1K6RA 1OMEA 1W8YA 2XGNA 2O9BA 1BLSA 3A0RA 3NI9A 1K38A 3SS5A 4HEFA 1K56A 3SH7A 1FR1A 1XXMA 3LY3A 1HZOA 2IWDA 2W3HA 2OLUA 1LI9A 2VV6A 3EGXC 2Q9MA 2OV5A 1SDNA 2ACGA 5KSHA 1W8QA 1IFQA 2WYXA 5FA7A 4MCWA 2LB5A 1H5XA 1YQSA 3UB6A 1OPXA 3HVFA 2JHEA 2ZM2A 3OCNA 5A93A 1N4OA 5HFOA 4I5SA 1V9YA 1XP4A 5DTKA 1J9MA 2ZC6B 2XLNA 1OJGA 2RL3A 4G3KA 4QWOA 2ZD8A 4EEPA 2VX8A 3BQ8A 3M6BA 1GCEA 3VOLA 1ZG4A 2KDKA 1KE3A 3O88A 5EECA 5CECA 1ESUA 4O7DA 4HJ6A 3W4OA 2FH5A 3EQUA 4P87A 3QP8A 1W79A 2A3UA 2R9XA 4GD8A 4GDNA 1TS6A 3E4OA 5L09A 5EVIC 2Y4AA 1OTBA 4E3KA 4HI4A 4LRXC 2C6WB 4N92A 3C5AA 5KSCA 4U3TA 1NZUA 4LCLA 4I39A 1Y54A 3BEBA 4JF4A 2WGVA 4JLFA 1PZPA 2ZBBA 4BD0A 5HD5A 4IUKA 5A90A 3MQOA 1FILA 1KGEA 4LRZE 2JKGA 3B47A 4DE2A 1N9LA 5E2GA 4FSFA 4K91A 1RGYA 3BJNA 4GDBA 5HDDA 4PMAA 4HNBA 5HWTA 3BY8A 4DE1A 3S7QA 3SH9A 1KGFA 1XJ3A 4OQ0A 4PPRA 2XFSA 2IA2A 2HPBA 4KZ4A 5FQJA 3IF6A 3N4IA 2VJWA 3GSGA 4M3KA 1VQQA 2ZQCA 3BFDA 3PR6A 3IF6B 1IOUA 5BOHA 1KVMA 2EX8A 2EWWA 3VOZA 1K54C 5F1FA 2OOLA 4KUOA 3BLSA 3HLGA 2ZQ8A 1K6SA 3S22A 5JYOA 3NDGA 3VMAA 3CMZA 4ESPA 3IBJA 5DKKA 4EQIA 1D1JA 2V2FF 4UA7A 4Y17A 4RYEA 2X02A 2VLGA 4FTXA 2NUPC 3QP2A 1PI5A 3UDXA 4C75A 3GECA 2GJ3A 2WUQA 5FEFA 3ZQ5A 4GS9A 2PYRA 1YLWA 3HJIA 3MQQA 3JVVA 3BFCA 4HESA 3FV7A 4Y5FA 2ZMAA 4S2IA 3Q07A 1OJ5A 1KE0A 4UQIM 3DTMA 3BECA 4UAAA 3N8LA 1FIKA 1YLZA 2HV1A 5FQ9A 4BD1A 2P04A 2BLSA 2OAP1 4R38A 4F3LA 3G6OA 4S2KA 3MZFA 1KE4A 1ERMA 2J9PA 3VP3A 3MKFA 1ES4A 4F3LB 4DXBA 1MXOA 1Z6FA 3EWKA 1JVJA 1MPLA 4JGPA 3D3OA 5CGSA 3A3EA 5G18A 5EM1A 3IXBA 3T1RA 2Z6CA 3A3DA 4BL3A 2G2WA 4LCMA 3M6HA 4XXRA 3UPNA 4DE3A 1MBLA 1D06A 3K3CA 4DJ3A 2P9VA 4NKPA 3MJQA 4BL2A 2PR6A 4JBFA 1XA1A 1CEGA 2HZ5A 4LV1A 3MSHA 5EFWA 5EVIB 3T1XA 1T19A 3PXPA 4CLCD 4GHIA 5U47A 1K25A 4RQ9A 4U0TA 1SCWA 4GHIB 5J8XA 3PAEA 2H28A 5E2HA 1OTEA 3G32A 5CHMA 1XJ4A 3UMEA 2J9OA 2VGLS 3G30A 3VP0A 5F69A 4MN5A 5DF7A 3S7OA 4DN0A 2WGIA 3BM6A 5EE8A 1FCMA 3MBZA 4WMCA 1XGJA 2XFTA 4KENB 4RA7A 3MMHA 4KG2A 3CPTB 1MY8A 3DTEA 2J80A 2V20A 4L9FA 1W5DA 2XD1A 3F1NB 4QHCA 3UNWA 1H0MA 4RX2A 1YSPA 3LFVA 2KX6A 5EOEA 2DNSA 4ZJ1A 3ZVWA 1PI4A 2ZQAA 3M2KA 3FKWA 1IKIA 5CTNA 1VETA 3L7HA 3CLOA 3U4LP 3FYZA 2R9WA 3IHAA 4DMZA 2XR0A 4CLCA 3GVBA 3RFBA 4MLLA 2J3TC 1YLJA 5DJTA 2XRNA 1P9WA 2ZQ7A 3FPVA 4WZ5C 5FAOA 1OTAA 2IWBA 4S2NA 3GV9A 3S7PA 4N1XA 3QNCA 3Q1FA 3OPHA 4S2MA 5GL9A 4PM7A 1GA9A 1C3BA 2VEAA 4NXFA 3N8SA 3T4KA 3KSFA 3HJKA 1E25A 4KZ7A 3BW6A 1YKDA 4FUWA 5GHYA 1LL8A 2Z2MB 3HLEA 1NY0A 4Y0UA 3TJZC 2Y2IA 2PRFA 3KSHA 1BLHA 3OC2A 2ZL1B 2XD5A 1XJ2A 1DJAA 3QNBA 4ETZA 3HUOA 3EEAA 3ISGA 3MFDA 4LV2A 4GKUA 3VSKA 4K0WA 5HWVA 4L9GA 1LSVA 3Q82A 4HY8A 4NEED 4ARZB 4NXGA 4Y7PA 3VP1A 2FFYA 2V0UA 1S4RA 4OKPA 3HUNA 4E3OA 3ZNTA 1ZC2A 3LIEA 5E2EA 4N9LA 5LBRA 4R6LA 2OWJA 5TBMA 2QHKA 5FATA 4X1MA 5EUAA 4ZBEA 5TBMB 1L0FA 3FWLA 4HH2A 2EFXA 4WM9A 4EERA 3HBRA 3MKEA 1K0KA 3IWQA 1SKOA 1G6AA 3UO9A 2OSUA 5I94A 2KLIA 1N9OA 1OT9A 4C3QA 1SKOB 4R0QA 3HL9A 4GCZA 3VV4A 1DP9A 5F1GA 2HP5A 4DKIA 1F98A 1X0OA 2MJ6A 4MBKA 3GMWA 2FFFB 5FL3A 3E98A 1DY6A 2JKRM 3ZGAB 1TS8A 4HHDA 3DTKA 2AVXA 2ZQ9A 2WAEA 1SDEA 2CMNA 3VFHA 3PBOA 5IHVA 3MF0A 1OTDA 3WS2A 1XGIA 1VM1A 4FH4A 3T4TA 3KYZA 1Q2QA 1W63M 4HQAA 1PZOA 4EESA 3NY4A 3IBRA 4JF5A 3I7JA 4GOGA 1KDWA 1KVLA 3ZVTA 1DP8A 4FD8A 1JWZA 2V8FA 4PAUA 3BRMA 1FSYA 3EOIA 2G2UA 3SH8A 3IT9A 2XH9A 1PRQA 4ZDXA 4BMWA 2WGWB 4P0MA 4WEKA 5TGFA 4BENA 3CJMA 3A3FA 3EEHA 4Q0IA 3PBQA 5CGWA 2QMIA 4EUVA 3V67A 3CUEA 1PNEA 3H7WA 1FR6A 3TW8A 3H7WB 3T1SA 1Z09A 4E3JA 4KG5A 3HLWA 4EQ1A 4HIAA 1LL5A 3AGEA 4QPRA 1VB6A 3E4PA 2X01A 2ZMFA 4DF6A 3A3IA 4OPQA 4EETB 3QP5A 2YKHA 3QHYA 2KOIA 2PU4A 3HCYA 2EX9A 4ZTKA 3RJUA 2WKEA 4GNUA 4Q8IA 4R4RA 2PR5A 4UA9A 1NLYA 1UWPX 3RXWA 5HAIA 3EQVA 4WYYA 4FH2A 3ZCZA 2P08A 3BWLA 4MMNA 1BZAA 5CTMA 4S2JA 3FKVA 5FAQA 2EXBA 1VHMA 4GZBA 3C2WA 3E2KA 4E6XA 2JCHA 4GD6A 1V9ZA 4E04A 1HTZA 4LPZA 3OLOA 2BTFP 4R3BA 1ESIA 2WKHA 3UB9A 5HDSA 1T1CA 4B4ZA 5GHZA 3GDIA 3LI9A 4Z9QA 4DDYA 5CXWA 3UB7A 5CGXA 1ONHA 3TE8A 3NOPC 4GB7A 4E3IA 3NBLA 1ONGA 3C8CA 3H82B 2VZWA 2P7JA 3IX3A 3G2ZA 3ICYA 3HUMA 4OPYA 2D02A 2HJEA 1H3QA 4KG6A 4NXBA 2B5RA 3A0SA 3OBFA 3HLFA 3GR2A 3T50A 1NLZA 4JGQA 5FI6A 2H0YA 3PBTA 4M4XA 1JTDA 2PAVP 5M1AA 4JXVA 3LR5A 1JWPA 2ZC5B 5AQAA 2VV8A 5TJJA 3C30A 5DTTA 3OOVA 1TEMA 1IEMA 3G2YA 1GA0A 3NDEA 4EBPA 2Y55A 5DTSA 4EWFA 3FC7A 1BUEA 4YFMA 4MN7A 4DE0A 5CEBA 3CI6A 5F82A 4HBTA 4K0XA 3A0VA 2PYPA 4Q0JA 1AXBA 2HJ9C 5C5KA 5EVID 5M18A 1IELA 1YT4A 5EM0A 2W0NA 4LRYC 4JF6A 4JPMA 3C7VA 3IH9A 5FI2A 5CERA 1P0ZA 2Y2LA 5CRFA 2ZOIA 2J3WA 3DBAA 2HP6A 2ZLYA 3PBNA 1MZUA 3IHBA 2ZJ9A 1O7EA 2FZ0A 4P6ZM 3V3SA 4I38A 1S0WA 2VGLM 1YLYA 3IS2B 4OQHA 4IUHA 3DTIA 2W3DA 3R4KA 4B9OA 4HH3A 3UPPA 4AFIA 2WADA 3KSIA 4WLAA 1S67L 3P7NA 3ZYTA 4Y3IA 1CI9A 5EOOA 4CPKA 3P01A 4WMCD 2JKTM 5KZHA 4IVKA 1ZTUA 5DF9A 4A5RA 5IS1A 2B02A 1AWIA 1WE4A 2PDRA 1FOFA 5F68A 2PU2A 2Y2OA 4X6TA 4YNRA 4BWIA 2UWXA 3BY9A 3JVUA 1FCOA 5HL1A 4WF0A 1XPBA 4B88A 2VV7A 5JYPA 4EEUA 1RP5A 1QMFA 3C4PA 4G3WA 3O87A 5EVIA 2HP9A 3G4PA 3LEQA
chains in the Genus database with same CATH topology
1L3LA 3QP8A 3QP1A 2Q0OA 3QP4A 3JPUA 3IX3A 3IX4A 5L09A 4NG2A 4LFUA 2UV0E 4Y17A 3SZTA 1H0MA 4LGWA 5L07A 4Y15A 3QP5A 5L10A 3IX8A 3QP2A 4Y13A 2AVXA 3QP6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L3L A;  3QP8 A;  3QP1 A;  2Q0O A;  3QP4 A;  3JPU A;  3IX3 A;  3IX4 A;  5L09 A;  4NG2 A;  4LFU A;  2UV0 E;  4Y17 A;  3SZT A;  1H0M A;  4LGW A;  5L07 A;  4Y15 A;  3QP5 A;  5L10 A;  3IX8 A;  3QP2 A;  4Y13 A;  2AVX A;  3QP6 A; 
#chains in the Genus database with same CATH topology
 3C4O A;  4EV4 A;  2Y2P A;  4S2O A;  2A49 A;  1VEU B;  1K55 C;  1ZKJ A;  1CJF A;  5HAP A;  4HBU A;  4YIN A;  3WWX A;  1YMS A;  4E3M A;  2DMW A;  1S1Z A;  4KZB A;  1GHM A;  3MZE A;  4O0P A;  1M6K A;  1U60 A;  3S7N A;  5L2F A;  3SOI A;  4S2P A;  1K57 A;  3T4Q A;  3LY4 A;  3O86 A;  2CC1 A;  3IF5 A;  1XA7 A;  5TR7 A;  5HWW A;  3F1O A;  1Y28 A;  1P9R A;  5EV0 A;  4R23 A;  3CPT A;  3F1O B;  3TG9 A;  2Y2Q A;  3VE4 A;  2K2N A;  2HGV A;  3F1N A;  2PHY A;  4WBG A;  1BLC A;  2A24 B;  2O99 A;  2K7S A;  1W7F A;  3MR0 A;  1IYQ A;  1DJC A;  2LB9 A;  3VOY A;  4HP9 A;  2Y2J A;  2HF6 A;  4O01 A;  5FDS A;  1TF1 A;  3E2L A;  5J7E A;  3LR3 A;  4G3V A;  2QJ7 A;  1DJB A;  5CHJ A;  1K54 A;  3QP4 A;  5MC7 A;  5IT5 A;  5FAS A;  1I5Q A;  4KZA A;  2JKT I;  4IVI A;  4MEZ A;  4KZ5 A;  2WK0 A;  4P85 A;  3V5M A;  1KDS A;  4X68 A;  4QD4 A;  1T1B A;  3LIA A;  2XK1 A;  3LCE A;  5AVF A;  3PBR A;  4KQQ A;  2W3F A;  2VGK A;  2HDS A;  2XA7 S;  1LLB A;  2WZX A;  3ZG0 A;  1BUL A;  3G31 A;  4KZ3 A;  4JXS A;  3SZT A;  3EGD C;  1F5M A;  3LR4 A;  3V50 A;  5DJU A;  4OON A;  5HPF A;  2QJ5 A;  3TRC A;  1W63 Q;  3LGO A;  4H6J B;  3N8R A;  1M40 A;  2H5S A;  3BQA A;  3LIB A;  2BG1 A;  2EXA A;  3IXD A;  5AVE A;  3LUQ A;  4IJG A;  3MS6 A;  3VP2 A;  2V9A A;  2ZL1 A;  4NG2 A;  1G28 A;  1HVB A;  1CK3 A;  1IYP A;  4BJP A;  1GSX A;  3UN7 A;  5FI7 A;  3T4S A;  4PKY A;  3F1P A;  4ARZ A;  1YLT A;  3WS0 A;  2Q0O A;  4R3J A;  3LID A;  2EX6 A;  4HJ3 A;  4MBH A;  2GDN A;  3KYQ A;  3F1P B;  2HDR A;  4RVA A;  1WYC A;  5FAP A;  1H8M A;  2Y59 A;  3UE1 A;  2WKP A;  3MQ0 A;  4B4X A;  2VK3 A;  3IWO A;  4JKT A;  2A2L A;  3OPR A;  3UE3 A;  2ZOH A;  1PWG A;  1TS7 A;  3S4X A;  5A8B A;  3NOT C;  1GSV A;  4EU0 A;  1UGU A;  3CAX A;  4JXW A;  4R70 A;  4QY5 A;  1BYW A;  1ACF A;  2XSS A;  5HAQ A;  3NEC A;  2QPN A;  2V1A A;  4ZAM A;  2X71 A;  3D4F A;  4GN2 A;  1DP6 A;  2B18 A;  3T12 B;  2W3E A;  1DRM A;  5DFY A;  4P6B A;  5FQI A;  1GHI A;  3ZG9 B;  4KQO A;  3P98 A;  5HSQ A;  3HRE A;  4X69 A;  1OTI A;  3VE3 A;  4Y0O A;  5G4Z A;  2Y2N A;  4K08 A;  3BFF A;  3LEZ A;  2J7V A;  3UE0 A;  5DVA A;  3B3X A;  3SS3 A;  1EW0 A;  2I72 A;  2INW A;  1SZV A;  1BSG A;  3IF6 C;  4XT2 B;  1S66 L;  4NXE A;  1GSW A;  4ME4 A;  4PM8 A;  5L07 A;  3VP4 A;  5EPH A;  4EXO A;  4ETX A;  4S2L A;  2JE5 A;  4EBL A;  4BBV A;  2V8C A;  3RTY A;  3PAG A;  1L2S A;  5HPI A;  3QP1 A;  3W8K A;  3KSG A;  1FQG A;  1YMX A;  3N6I A;  1WYB A;  4I3A A;  2HDU A;  5F83 A;  3WS4 A;  1LI0 A;  5HW3 A;  3N7W A;  3B33 A;  2WGW A;  3DWZ A;  4PKY G;  3JYI A;  4HOI A;  2V1B A;  1S6R A;  1J3W A;  2VKS A;  4HJ4 A;  2QWS A;  1LL9 A;  3NJA A;  5A92 A;  3FZC A;  5HZH A;  2M7V A;  2DCF A;  2OAQ 1;  3WRT A;  1G68 A;  1KOU A;  3UDF A;  4WZ5 A;  4Y15 A;  1D7E A;  3L9K A;  3ZFZ A;  2XDM A;  2M7U A;  3E0Y A;  4X25 A;  3MFX A;  1NXY A;  3OPP A;  1FSW A;  4KZ6 A;  2UV0 E;  3W2Z A;  1TD5 A;  5AJG A;  5FEG A;  1K4F A;  2Y79 A;  2VA0 A;  2Y2K A;  4PHT A;  4OOL A;  2K31 A;  3MXQ A;  3PTE A;  3T4J A;  2W1T A;  4E3N A;  3NHQ A;  1STZ A;  1ERQ A;  2W1T B;  4JXG A;  3CZD A;  1XJ6 A;  2JKR I;  3KX0 X;  3ZG8 B;  5G4Y A;  1EWZ A;  3GRJ A;  4R3A A;  3HLB A;  4EUZ A;  4WEL A;  1MKI A;  1UWN X;  1JWV A;  2GZA A;  1N9N A;  2E8I A;  3QP6 A;  5AQB A;  2XQZ A;  1CEF A;  4LV0 A;  1Q2P A;  1NZO A;  3ZNY A;  3H82 A;  3VFF A;  1S1Y A;  2R78 A;  3ZG7 B;  5EVE A;  2DRW A;  1JNU A;  4WZ4 A;  1ERO A;  1K57 C;  4E6W A;  4OP8 A;  1P97 A;  4OQI A;  5I5L A;  2ZC3 B;  4GW9 A;  1LT0 A;  4Z1W A;  5GLC A;  3K2N A;  5K5B A;  1IKG A;  3Q7Z A;  4CLC E;  4PM5 A;  2QZ6 A;  2L1M A;  1H8Z A;  1HD8 A;  4DDS A;  1ES3 A;  3IQA A;  1SKF A;  1E3U D;  4L0L A;  4OOM A;  1TDL A;  3D9Y A;  5AQ7 A;  3DW0 A;  1F2K A;  3PHY A;  5DKL A;  1I2W A;  4BQM A;  3IXG A;  5HAR A;  1LSW A;  4OH0 A;  4KZ9 A;  1IYS A;  4XUX A;  1PW8 A;  3UB5 P;  4WL9 A;  2EFU A;  1XX2 A;  5TFQ A;  5CX7 A;  1I2S A;  5L10 A;  3UE6 A;  5A91 A;  4CLC C;  2XEP A;  4X53 A;  3DWK A;  4KQR A;  1MWU A;  4GJ4 A;  3LI8 A;  3NOU C;  2PD7 A;  2Y8H A;  3UDI A;  2M1C A;  1PWD A;  2ZC7 A;  4IBX A;  1YM1 A;  1ALQ A;  3S1Y A;  4QB8 A;  1QME A;  4LFU A;  3FPW A;  5GLB A;  4S2N C;  2J8Y A;  1L0E A;  4MNR A;  4X55 A;  2XRO A;  3CWF A;  2EWV A;  4UA6 A;  3IS2 A;  4ZRR A;  5FSR A;  3SS4 A;  2H10 A;  5CHU A;  5DFX A;  4NK3 A;  3IX4 A;  5FQQ A;  4GS9 B;  3Q7V A;  4MDZ A;  4Q0H A;  4OVD A;  3BFE A;  3ULF A;  3A3J A;  4FCF A;  1E3U A;  3Q7V B;  4R1G A;  3O5Y A;  4MN6 A;  4Y13 A;  1BT5 A;  5FQK A;  4Y0T A;  1TDG A;  3LIF A;  3BFG A;  2JKF A;  5IU1 A;  3MZD A;  4DXC A;  3FG8 A;  5E2F A;  5HD3 A;  2GX5 A;  2GNX A;  5GHX A;  3CHW P;  4BLM A;  2ZMV A;  1SHV A;  1PYY A;  1L0G A;  2HDQ A;  4QU3 A;  1T18 A;  3UB8 A;  2W1R A;  5L8M A;  1NRJ A;  1VEU A;  2ZM8 A;  5DF8 A;  2L4R A;  2XF3 A;  2H0T A;  4X1L A;  4X56 A;  3KO6 A;  2EX2 A;  5J4E A;  1O07 A;  2OWH A;  3IWI A;  3IH8 A;  3UPO A;  3CG5 A;  1KGG A;  5HX9 A;  4WN5 A;  3W4P A;  1CQA A;  3OZH A;  3MXR A;  1OT6 A;  2Y2H A;  4FOF A;  2W3G A;  1CF0 A;  1MKM A;  4OPZ A;  1WA9 A;  3SW1 A;  3B42 A;  2XA7 M;  2P9V B;  3E4Q A;  1ODV A;  4DJ2 A;  1NRF A;  3W4Q A;  1PIO A;  4L9E A;  4UQI S;  1YAX A;  4PM6 A;  5AQ9 A;  2A24 A;  4P6Z S;  2Y91 A;  2I9V A;  3ITB A;  4IHQ A;  2RCX A;  4MBF A;  4XUZ A;  2PD8 A;  4HP4 A;  2EA9 A;  2O9C A;  4D60 A;  2BAS A;  4O8G A;  4IBR A;  3BLM A;  1XFN A;  3RXX A;  2Y2G A;  2WKQ A;  1S4S A;  5F6A A;  3KYE A;  1N9B A;  3OPL A;  3T1Q B;  5FDH A;  3IX8 A;  1RCJ A;  3WS5 A;  3P09 A;  1E4D A;  3V3R A;  2C5W B;  4KZ8 A;  3M2J A;  3T4O A;  4F94 A;  2QYB A;  3NUL A;  1XFQ A;  4Y2F A;  2JN7 A;  4RX3 A;  1PWC A;  2JBF A;  2WZZ A;  5F5Y A;  4OPR A;  3U2A A;  2WKR A;  2WKI A;  3AGD A;  1MWS A;  3NCK A;  4YOF A;  4LEN A;  3ZHH A;  3LYX A;  1JTG A;  3BYD A;  5M19 A;  2V0W A;  1GHP A;  3WS1 A;  1T1A A;  1VET B;  1HLU P;  4LV3 A;  4H6J A;  1CI8 A;  3LO7 A;  4CLC B;  2PT7 A;  4EBN A;  3C38 A;  3CUE C;  2QKP A;  2D01 A;  3MXS A;  5EVL A;  3V39 A;  1MC0 A;  4CJN A;  4EW7 A;  5J3W A;  3OCL A;  5HDC A;  3RH8 B;  1NYM A;  4WEJ A;  5D3O A;  5KIZ A;  3LIC A;  3ITA A;  2IWC A;  4PM9 A;  4ID4 A;  4GLQ A;  2PBD P;  3PBS A;  2YKF A;  4H8R A;  3AGF A;  1EI5 A;  3VSL A;  1XKZ A;  3T4L A;  2B95 A;  3JPU A;  2G7U A;  4I3J A;  2WAF A;  4QY6 A;  1LSX A;  3UMD A;  3G35 A;  1MWR A;  4II7 A;  2OLV A;  5HL6 A;  2Z2L B;  3GTC A;  1LHY A;  3D72 A;  4DRT A;  3IXH A;  4BBU A;  3UY6 A;  3PYP A;  1BTL A;  4CQH A;  1ZHH B;  4WUJ A;  2O0Y A;  3HLC A;  1F9I A;  1ES2 A;  3HLD A;  3TSG A;  5GLA A;  1A0K A;  2W27 A;  2ZC4 B;  2NUT C;  4U0X A;  4N1H A;  1YSQ A;  3DAV A;  4UHU A;  2V1Z A;  4OQG A;  4BBT A;  3O3V A;  1K55 A;  2ZQD A;  1PW1 A;  4IED A;  4I3I A;  4OOY A;  1L3L A;  2J3T D;  4YWZ A;  3ZG5 A;  3G34 A;  1TS0 A;  1MWT A;  2Y2M A;  1K56 D;  1NJ4 A;  3C7U A;  4E3L A;  4LGW A;  3K3D A;  4KUK A;  3GQZ A;  1L0D A;  1YPR A;  2O9A A;  2E8J A;  1IYO A;  3NC8 A;  3NIA A;  1NYY A;  4R4S A;  4JGO A;  3LR0 A;  4XT2 A;  4JGR A;  5KMW A;  1YLP A;  4KQD A;  1RGZ A;  3R7W A;  4D2O A;  2P74 A;  4NET A;  1PFL A;  4N9K A;  1TVF A;  4UEY A;  2Q9N A;  1G6O A;  4C6Y A;  4ZJ2 A;  2L0W A;  3R7W B;  4B93 A;  1Y4O A;  1G5U A;  4QJG A;  1ES5 A;  3Q81 A;  4ZJ3 A;  2PBY A;  5E43 A;  5GLD A;  3ZDJ A;  1FCN A;  4OP5 A;  1BLP A;  1NWZ A;  4OLD A;  3WRZ A;  3H9W A;  5CED A;  1ZG6 A;  2VGJ A;  1K4E A;  4OLG A;  4LLO B;  2ZM0 A;  2JC7 A;  3CIT A;  1H8Y A;  3TOI A;  2Z6D A;  5FQM A;  1K6R A;  1OME A;  1W8Y A;  2XGN A;  2O9B A;  1BLS A;  3A0R A;  3NI9 A;  1K38 A;  3SS5 A;  4HEF A;  1K56 A;  3SH7 A;  1FR1 A;  1XXM A;  3LY3 A;  1HZO A;  2IWD A;  2W3H A;  2OLU A;  1LI9 A;  2VV6 A;  3EGX C;  2Q9M A;  2OV5 A;  1SDN A;  2ACG A;  5KSH A;  1W8Q A;  1IFQ A;  2WYX A;  5FA7 A;  4MCW A;  2LB5 A;  1H5X A;  1YQS A;  3UB6 A;  1OPX A;  3HVF A;  2JHE A;  2ZM2 A;  3OCN A;  5A93 A;  1N4O A;  5HFO A;  4I5S A;  1V9Y A;  1XP4 A;  5DTK A;  1J9M A;  2ZC6 B;  2XLN A;  1OJG A;  2RL3 A;  4G3K A;  4QWO A;  2ZD8 A;  4EEP A;  2VX8 A;  3BQ8 A;  3M6B A;  1GCE A;  3VOL A;  1ZG4 A;  2KDK A;  1KE3 A;  3O88 A;  5EEC A;  5CEC A;  1ESU A;  4O7D A;  4HJ6 A;  3W4O A;  2FH5 A;  3EQU A;  4P87 A;  3QP8 A;  1W79 A;  2A3U A;  2R9X A;  4GD8 A;  4GDN A;  1TS6 A;  3E4O A;  5L09 A;  5EVI C;  2Y4A A;  1OTB A;  4E3K A;  4HI4 A;  4LRX C;  2C6W B;  4N92 A;  3C5A A;  5KSC A;  4U3T A;  1NZU A;  4LCL A;  4I39 A;  1Y54 A;  3BEB A;  4JF4 A;  2WGV A;  4JLF A;  1PZP A;  2ZBB A;  4BD0 A;  5HD5 A;  4IUK A;  5A90 A;  3MQO A;  1FIL A;  1KGE A;  4LRZ E;  2JKG A;  3B47 A;  4DE2 A;  1N9L A;  5E2G A;  4FSF A;  4K91 A;  1RGY A;  3BJN A;  4GDB A;  5HDD A;  4PMA A;  4HNB A;  5HWT A;  3BY8 A;  4DE1 A;  3S7Q A;  3SH9 A;  1KGF A;  1XJ3 A;  4OQ0 A;  4PPR A;  2XFS A;  2IA2 A;  2HPB A;  4KZ4 A;  5FQJ A;  3IF6 A;  3N4I A;  2VJW A;  3GSG A;  4M3K A;  1VQQ A;  2ZQC A;  3BFD A;  3PR6 A;  3IF6 B;  1IOU A;  5BOH A;  1KVM A;  2EX8 A;  2EWW A;  3VOZ A;  1K54 C;  5F1F A;  2OOL A;  4KUO A;  3BLS A;  3HLG A;  2ZQ8 A;  1K6S A;  3S22 A;  5JYO A;  3NDG A;  3VMA A;  3CMZ A;  4ESP A;  3IBJ A;  5DKK A;  4EQI A;  1D1J A;  2V2F F;  4UA7 A;  4Y17 A;  4RYE A;  2X02 A;  2VLG A;  4FTX A;  2NUP C;  3QP2 A;  1PI5 A;  3UDX A;  4C75 A;  3GEC A;  2GJ3 A;  2WUQ A;  5FEF A;  3ZQ5 A;  4GS9 A;  2PYR A;  1YLW A;  3HJI A;  3MQQ A;  3JVV A;  3BFC A;  4HES A;  3FV7 A;  4Y5F A;  2ZMA A;  4S2I A;  3Q07 A;  1OJ5 A;  1KE0 A;  4UQI M;  3DTM A;  3BEC A;  4UAA A;  3N8L A;  1FIK A;  1YLZ A;  2HV1 A;  5FQ9 A;  4BD1 A;  2P04 A;  2BLS A;  2OAP 1;  4R38 A;  4F3L A;  3G6O A;  4S2K A;  3MZF A;  1KE4 A;  1ERM A;  2J9P A;  3VP3 A;  3MKF A;  1ES4 A;  4F3L B;  4DXB A;  1MXO A;  1Z6F A;  3EWK A;  1JVJ A;  1MPL A;  4JGP A;  3D3O A;  5CGS A;  3A3E A;  5G18 A;  5EM1 A;  3IXB A;  3T1R A;  2Z6C A;  3A3D A;  4BL3 A;  2G2W A;  4LCM A;  3M6H A;  4XXR A;  3UPN A;  4DE3 A;  1MBL A;  1D06 A;  3K3C A;  4DJ3 A;  2P9V A;  4NKP A;  3MJQ A;  4BL2 A;  2PR6 A;  4JBF A;  1XA1 A;  1CEG A;  2HZ5 A;  4LV1 A;  3MSH A;  5EFW A;  5EVI B;  3T1X A;  1T19 A;  3PXP A;  4CLC D;  4GHI A;  5U47 A;  1K25 A;  4RQ9 A;  4U0T A;  1SCW A;  4GHI B;  5J8X A;  3PAE A;  2H28 A;  5E2H A;  1OTE A;  3G32 A;  5CHM A;  1XJ4 A;  3UME A;  2J9O A;  2VGL S;  3G30 A;  3VP0 A;  5F69 A;  4MN5 A;  5DF7 A;  3S7O A;  4DN0 A;  2WGI A;  3BM6 A;  5EE8 A;  1FCM A;  3MBZ A;  4WMC A;  1XGJ A;  2XFT A;  4KEN B;  4RA7 A;  3MMH A;  4KG2 A;  3CPT B;  1MY8 A;  3DTE A;  2J80 A;  2V20 A;  4L9F A;  1W5D A;  2XD1 A;  3F1N B;  4QHC A;  3UNW A;  1H0M A;  4RX2 A;  1YSP A;  3LFV A;  2KX6 A;  5EOE A;  2DNS A;  4ZJ1 A;  3ZVW A;  1PI4 A;  2ZQA A;  3M2K A;  3FKW A;  1IKI A;  5CTN A;  1VET A;  3L7H A;  3CLO A;  3U4L P;  3FYZ A;  2R9W A;  3IHA A;  4DMZ A;  2XR0 A;  4CLC A;  3GVB A;  3RFB A;  4MLL A;  2J3T C;  1YLJ A;  5DJT A;  2XRN A;  1P9W A;  2ZQ7 A;  3FPV A;  4WZ5 C;  5FAO A;  1OTA A;  2IWB A;  4S2N A;  3GV9 A;  3S7P A;  4N1X A;  3QNC A;  3Q1F A;  3OPH A;  4S2M A;  5GL9 A;  4PM7 A;  1GA9 A;  1C3B A;  2VEA A;  4NXF A;  3N8S A;  3T4K A;  3KSF A;  3HJK A;  1E25 A;  4KZ7 A;  3BW6 A;  1YKD A;  4FUW A;  5GHY A;  1LL8 A;  2Z2M B;  3HLE A;  1NY0 A;  4Y0U A;  3TJZ C;  2Y2I A;  2PRF A;  3KSH A;  1BLH A;  3OC2 A;  2ZL1 B;  2XD5 A;  1XJ2 A;  1DJA A;  3QNB A;  4ETZ A;  3HUO A;  3EEA A;  3ISG A;  3MFD A;  4LV2 A;  4GKU A;  3VSK A;  4K0W A;  5HWV A;  4L9G A;  1LSV A;  3Q82 A;  4HY8 A;  4NEE D;  4ARZ B;  4NXG A;  4Y7P A;  3VP1 A;  2FFY A;  2V0U A;  1S4R A;  4OKP A;  3HUN A;  4E3O A;  3ZNT A;  1ZC2 A;  3LIE A;  5E2E A;  4N9L A;  5LBR A;  4R6L A;  2OWJ A;  5TBM A;  2QHK A;  5FAT A;  4X1M A;  5EUA A;  4ZBE A;  5TBM B;  1L0F A;  3FWL A;  4HH2 A;  2EFX A;  4WM9 A;  4EER A;  3HBR A;  3MKE A;  1K0K A;  3IWQ A;  1SKO A;  1G6A A;  3UO9 A;  2OSU A;  5I94 A;  2KLI A;  1N9O A;  1OT9 A;  4C3Q A;  1SKO B;  4R0Q A;  3HL9 A;  4GCZ A;  3VV4 A;  1DP9 A;  5F1G A;  2HP5 A;  4DKI A;  1F98 A;  1X0O A;  2MJ6 A;  4MBK A;  3GMW A;  2FFF B;  5FL3 A;  3E98 A;  1DY6 A;  2JKR M;  3ZGA B;  1TS8 A;  4HHD A;  3DTK A;  2AVX A;  2ZQ9 A;  2WAE A;  1SDE A;  2CMN A;  3VFH A;  3PBO A;  5IHV A;  3MF0 A;  1OTD A;  3WS2 A;  1XGI A;  1VM1 A;  4FH4 A;  3T4T A;  3KYZ A;  1Q2Q A;  1W63 M;  4HQA A;  1PZO A;  4EES A;  3NY4 A;  3IBR A;  4JF5 A;  3I7J A;  4GOG A;  1KDW A;  1KVL A;  3ZVT A;  1DP8 A;  4FD8 A;  1JWZ A;  2V8F A;  4PAU A;  3BRM A;  1FSY A;  3EOI A;  2G2U A;  3SH8 A;  3IT9 A;  2XH9 A;  1PRQ A;  4ZDX A;  4BMW A;  2WGW B;  4P0M A;  4WEK A;  5TGF A;  4BEN A;  3CJM A;  3A3F A;  3EEH A;  4Q0I A;  3PBQ A;  5CGW A;  2QMI A;  4EUV A;  3V67 A;  3CUE A;  1PNE A;  3H7W A;  1FR6 A;  3TW8 A;  3H7W B;  3T1S A;  1Z09 A;  4E3J A;  4KG5 A;  3HLW A;  4EQ1 A;  4HIA A;  1LL5 A;  3AGE A;  4QPR A;  1VB6 A;  3E4P A;  2X01 A;  2ZMF A;  4DF6 A;  3A3I A;  4OPQ A;  4EET B;  3QP5 A;  2YKH A;  3QHY A;  2KOI A;  2PU4 A;  3HCY A;  2EX9 A;  4ZTK A;  3RJU A;  2WKE A;  4GNU A;  4Q8I A;  4R4R A;  2PR5 A;  4UA9 A;  1NLY A;  1UWP X;  3RXW A;  5HAI A;  3EQV A;  4WYY A;  4FH2 A;  3ZCZ A;  2P08 A;  3BWL A;  4MMN A;  1BZA A;  5CTM A;  4S2J A;  3FKV A;  5FAQ A;  2EXB A;  1VHM A;  4GZB A;  3C2W A;  3E2K A;  4E6X A;  2JCH A;  4GD6 A;  1V9Z A;  4E04 A;  1HTZ A;  4LPZ A;  3OLO A;  2BTF P;  4R3B A;  1ESI A;  2WKH A;  3UB9 A;  5HDS A;  1T1C A;  4B4Z A;  5GHZ A;  3GDI A;  3LI9 A;  4Z9Q A;  4DDY A;  5CXW A;  3UB7 A;  5CGX A;  1ONH A;  3TE8 A;  3NOP C;  4GB7 A;  4E3I A;  3NBL A;  1ONG A;  3C8C A;  3H82 B;  2VZW A;  2P7J A;  3IX3 A;  3G2Z A;  3ICY A;  3HUM A;  4OPY A;  2D02 A;  2HJE A;  1H3Q A;  4KG6 A;  4NXB A;  2B5R A;  3A0S A;  3OBF A;  3HLF A;  3GR2 A;  3T50 A;  1NLZ A;  4JGQ A;  5FI6 A;  2H0Y A;  3PBT A;  4M4X A;  1JTD A;  2PAV P;  5M1A A;  4JXV A;  3LR5 A;  1JWP A;  2ZC5 B;  5AQA A;  2VV8 A;  5TJJ A;  3C30 A;  5DTT A;  3OOV A;  1TEM A;  1IEM A;  3G2Y A;  1GA0 A;  3NDE A;  4EBP A;  2Y55 A;  5DTS A;  4EWF A;  3FC7 A;  1BUE A;  4YFM A;  4MN7 A;  4DE0 A;  5CEB A;  3CI6 A;  5F82 A;  4HBT A;  4K0X A;  3A0V A;  2PYP A;  4Q0J A;  1AXB A;  2HJ9 C;  5C5K A;  5EVI D;  5M18 A;  1IEL A;  1YT4 A;  5EM0 A;  2W0N A;  4LRY C;  4JF6 A;  4JPM A;  3C7V A;  3IH9 A;  5FI2 A;  5CER A;  1P0Z A;  2Y2L A;  5CRF A;  2ZOI A;  2J3W A;  3DBA A;  2HP6 A;  2ZLY A;  3PBN A;  1MZU A;  3IHB A;  2ZJ9 A;  1O7E A;  2FZ0 A;  4P6Z M;  3V3S A;  4I38 A;  1S0W A;  2VGL M;  1YLY A;  3IS2 B;  4OQH A;  4IUH A;  3DTI A;  2W3D A;  3R4K A;  4B9O A;  4HH3 A;  3UPP A;  4AFI A;  2WAD A;  3KSI A;  4WLA A;  1S67 L;  3P7N A;  3ZYT A;  4Y3I A;  1CI9 A;  5EOO A;  4CPK A;  3P01 A;  4WMC D;  2JKT M;  5KZH A;  4IVK A;  1ZTU A;  5DF9 A;  4A5R A;  5IS1 A;  2B02 A;  1AWI A;  1WE4 A;  2PDR A;  1FOF A;  5F68 A;  2PU2 A;  2Y2O A;  4X6T A;  4YNR A;  4BWI A;  2UWX A;  3BY9 A;  3JVU A;  1FCO A;  5HL1 A;  4WF0 A;  1XPB A;  4B88 A;  2VV7 A;  5JYP A;  4EEU A;  1RP5 A;  1QMF A;  3C4P A;  4G3W A;  3O87 A;  5EVI A;  2HP9 A;  3G4P A;  3LEQ A; 
#chains in the Genus database with same CATH homology
 1L3L A;  3QP8 A;  3QP1 A;  2Q0O A;  3QP4 A;  3JPU A;  3IX3 A;  3IX4 A;  5L09 A;  4NG2 A;  4LFU A;  2UV0 E;  4Y17 A;  3SZT A;  1H0M A;  4LGW A;  5L07 A;  4Y15 A;  3QP5 A;  5L10 A;  3IX8 A;  3QP2 A;  4Y13 A;  2AVX A;  3QP6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...