3QPGA

Crystal structures of escherichia coli aspartate aminotransferase reconstituted with 1-deaza-pyridoxal 5'-phosphate: internal aldimine and stable l-aspartate external aldimine
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
396
structure length
396
Chain Sequence
MFENITAAPADPILGLADLFRADERPGKINLGIGVYKDETGKTPVLTSVKKAEQYLLENETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKAAIRANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLRLREEFGVYAVASGRVNVAGMTPDNMAPLCEAIVAVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspartate transaminase
publication title Crystal Structures of Aspartate Aminotransferase Reconstituted with 1-Deazapyridoxal 5'-Phosphate: Internal Aldimine and Stable l-Aspartate External Aldimine.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 146
structure length 396
sequence length 396
ec nomenclature ec 2.6.1.1: Aspartate transaminase.
pdb deposition date 2011-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 3qpgA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 3qpgA01
4RLGA 2YCPA 4JE5D 3A9YA 1I41A 4HVKA 1ELUA 2AY6A 2V1PA 1BKGA 2VMTA 4AZKA 3WLXA 2BWOA 3PDBB 3R9AA 3PD6A 1DGDA 1G7WA 1N2TA 3BCXA 3II0A 4NOGA 1G4XA 2C44A 2BWPA 2VGTA 4CVQA 1ZC9A 2QLRA 3N75A 2QB2A 3BWNA 3QHXA 4FFCA 1ARTA 1KMKA 4ADDA 3FQ8A 5DB5A 4WYFA 3ZRPA 4B98A 1LS3A 5EIGA 2DKBA 3FVXA 1KKJA 5K8BA 1Z3ZA 3I16A 3NDNA 4ITGA 1M7YA 1AHEA 3CQ5A 1XI9A 2CTZA 1ZOBA 3GZDC 4WYDA 1GC0A 2CSTA 2DGKA 3EUCA 3FZ7A 5M4BA 1BJNA 1WYUB 4F5HA 1UU1A 1W7LA 1GCKA 1AJSB 1T3IA 4MY5A 4TMRA 2DGLA 4WP0A 1B8GA 4W1VA 5LHAA 3QI6A 1FG7A 3GR9A 2HOZA 3CBFA 3BCAA 4RIZA 2VLFA 1ASDA 1ECXA 2VMOA 5F9SA 1YAAA 1BJWA 2BYLA 2F8JA 4BHDA 3PDXA 2HOXA 4KAMA 3LY1A 4R8DA 7AATA 1C7NA 2YCTA 3DC1A 4KXKA 4RITA 1AMRA 2D7ZA 2OQXA 5IWQA 1YNUA 3G7QA 1V2FA 1V2EA 3F0HA 2WK9A 5FT5A 5AX8A 4AO4A 3HLMA 3A2BA 1WYVA 4ZSYA 1SZUA 3LV2A 4Y0IA 3KKIA 2CH1A 1TASA 4L0OA 3AENA 1TOGA 1BS0A 3ACZA 3FQAA 3E2ZB 4QGRA 4XJPA 5M4DA 1GD9A 2V0YA 2WK7A 3A9XA 2X3LA 3BS8A 2YKVA 2CJHA 2QB3A 5EAAA 4F5KA 4JEWA 2PO3A 1C9CA 3E2YA 4PVFA 3FDDA 2VMNA 2EZ1A 5D95A 4OC9A 1D7RA 3JW9A 2ZY3A 3GZCA 2YRRA 1TOJA 3WCNA 3RBFA 3P1TA 3H14A 2BYJA 4JE5A 3FRKA 3NYUA 3DYDA 1AHGA 1CQ8A 2R5CA 1UU0A 3NUIA 2E7UA 5D5SA 1B5PA 5F8VA 1QGNA 1Y4IA 4ZASA 4W1WA 1BJ4A 4RM1A 1TOIA 2FM1A 2NMPA 3G8MA 8AATA 3FFRA 4MKJA 1OHWA 5HDMA 2D64A 3F6TA 3H7FA 3IHJA 4F5MA 2BIEA 1IJIA 1S09A 2VGZA 1W7MA 1S0AA 4F5IA 4ZAHA 5EUDA 2ZC0A 3AATA 4BMKA 1VP4A 3T32A 1ASCA 1N31A 3FSLA 5G4JA 1H0CA 2YOBA 3B1EA 3FKDA 3TFTA 3AOVA 3MC6A 1SF2A 1AKAA 3WCOA 4EMYA 1AJRA 3CQ4A 3ECDA 3NRAA 3GETA 5HHYA 1FG3A 2AY7A 1RVUA 4WYAA 4E3RA 2CJGA 3CQ6A 4EFFA 4PFFA 9AATA 4W91A 2WK8A 1LK9A 4MSOA 3DRDA 1GC3A 4ADEA 1SVVA 1SZKA 4A6TA 4AO9A 5E3KA 4GDYA 5E5IA 1AMAA 3DODA 3L8AA 2C81A 3QM2A 4F5JA 3HVYA 2HUIA 1ASBA 1ASEA 3LVLB 4ZSWA 1RV4A 3KGXA 4IW7A 2Z9WA 4ISYA 1CL1A 1VEFA 5FT6A 2YCNA 2X8UA 4A0FA 2HP1A 4WB0A 1AY4A 4E3QA 2VMYA 4CBRA 1KL2A 2BWNA 3AEPA 5DJ9A 2ZY4A 4GEBA 3EI8A 4Y0DA 5J8QA 2ZY5A 2DR1A 1CL2A 1BT4A 2D66A 3VK4A 4PFNA 1GEWA 2FNIA 3ZZJA 3EI9A 1BJOA 2Z20A 3K28A 3VAXA 2VGVA 1I29A 5FT8A 2YHKA 2BI1A 4XK1A 1AHFA 3NYSA 1C4KA 3RCHA 2W7FA 3WGBA 1LC5A 1DFOA 3EI7A 2WKAA 1TARA 4MQPA 4LNJA 3ZRRA 5G2PA 1ARSA 4XAUA 4ITXA 3A9ZA 1IX8A 3AOWA 1XEYA 2TPLA 1D7VA 1I48A 1MDOA 4IXOA 2C0RA 1OHVA 2QBTA 2VGWA 3PDBA 3K7YA 4KYOA 3DR7A 3K40A 3QGUA 3RI6A 1CQ6A 2W7IA 1AIAA 1DJ9A 1IBJA 1TOEA 2ZSMA 2JG2A 4J8LA 3AEJA 4F5LA 1PFFA 1TOKA 1C7GA 3PAAA 3JWBA 4K2IA 4CBSA 4MQQA 1YIYA 3AV7A 3TQXA 4WXFA 1MDZA 4ATQA 2X5DA 3UAKA 2Z61A 3FTBA 1ASLA 3FCRA 2ORDA 4GSAA 1RVYA 4IYOB 2E54A 4WBTA 1UU2A 2JJGA 1WYUA 1WSTA 1AJSA 2FQ6A 1EJIA 1PMMA 5JAYA 1BQDA 2JJEA 4GE9A 3G0TA 1E5EA 3LVKA 1YJYA 3FFHA 4UHNA 5FT4A 1GDEA 4PIWA 4UQVA 3OP7A 2Z1ZA 4OBVA 1DGEA 2O0RA 2YRIA 1S07A 2VIAA 1BW0A 5TF5A 2OKKA 5BJ4A 3PGYA 1FC4A 3E6GA 3L44A 3MKJA 1WYTB 1SZSA 1M0NA 1TATA 5DJ1A 3PIUA 1EQBA 1KKPA 1W3UA 3GJUA 3W1HA 5HXXA 4F4EA 5G4IA 2VMZA 1LC8A 4WXBA 2HP2A 4K2MA 1U08A 2GB3A 2BIGA 2VI9A 4WYEA 3VK2A 2GSAA 1W23A 4F5GA 2E7IA 2W7KA 3LWSA 4A0HA 1Z7DA 2W7LA 3E2ZA 3NNKA 4ZWMA 4P7YA 2W8JA 2C7TA 3I5TA 4ZM4A 1ASGA 3LVJA 1MDXA 2Z67A 3MAFB 4JEYA 4TN4A 2HORA 4OMAA 4ADCA 4DGTA 4EB7A 4RAEA 1JS6A 2ZP7A 2DKJA 1S08A 3NYTA 5G2QA 3EI5A 5C6UA 1ARHA 1AY8A 4B9BA 2YKXA 2CANA 5EUEA 4BQ0A 1G7XA 2HZPA 1CZEA 1E5FA 1AKBA 4IXSA 3AEMA 3GBXA 4HF8A 3GWPA 1V72A 3KE3A 4R2NA 4ZM3A 1M6SA 4IY7A 1CS1A 1LKCA 1GC4A 2EGYA 3E2FA 3BN1A 4Y0HA 1O4SA 3BC8A 1QJ3A 2BI9A 3B8XA 3FVUA 3WX9A 1SPAA 1QZ9A 1B5OA 3EI6A 1I43A 3FVSA 2BI5A 4GE7A 4TV7A 1LW4A 4JF0A 4DBCA 2FYFA 1X28A 2HUUA 2ZJGA 3HDOA 4GRXA 1TPLA 1X29A 4WLJA 3HMUA 2W7DA 3ELPA 1PMOA 2AEVA 4H51A 3PPLA 3E9KA 3FZ8A 1H1CA 3NU7A 4MQRA 4UHMA 1S06A 2OGAA 4RJYA 4A00A 1M0QA 1QIRA 1DJUA 4K2BA 5M49A 3B1DA 3UWCA 1GBNA 2W7EA 3BWNC 1C7OA 1N8PA 1YJSA 3N0LA 4M2MA 2W8WA 3I4JA 1DJEA 2BI2A 4Q31A 2ZUKA 4ZWVA 3GSBA 1ORDA 4MGRA 1YOOA 2D5YA 2W7MA 4A72A 1LC7A 2OKJA 4M2KA 4O6ZA 2VMSA 4M2JA 1IAYA 2D61A 2W7GA 2DOUA 3PA9A 3RQ1A 2BKWA 1IX6A 2QA3A 2VMXA 5EQCA 4UOYA 1CQ7A 1IUGA 2VGSA 2Q7WA 4OBUA 3PD6B 2VMWA 3JTXA 4Q76A 4CXQA 4OT8A 4IXZA 4XEWA 3DXWA 3WKSA 3B1CA 3HQTA 4ZDOA 3RUYA 2HOYA 3NU8A 2VMVA 3AEJC 2JGTA 2FN6A 2Z9UA 3LG0A 3BV0A 5EIGB 4IX8A 2EZ2A 1J04A 3E77A 3ZZKA 3B46A 3FZ6A 1QISA 1ASMA 4LNMA 3TCMA 3USFA 2FNUA 3MEBA 4OYTA 2VMQA 2RFVA 3WKRA 3NTJA 4AZJA 2VIBA 3LVMA 3HBXA 2X5FA 4XJMA 4JEVA 3DXVA 4JF1A 2W7HA 2AY2A 3R4TA 1B4XA 1AAMA 3NX3A 4EB5A 5BJ3A 1GEYA 3WZFA 2QMAA 1IAXA 4AH3A 3KGWA 4LW4A 3UE8A 1BQAA 2BHXA 1O61A 2AY5A 2AY1A 3ZRQA 3JWAA 1AMQA 1GC2A 1X0MA 4DQ6A 5E4ZA 2EH6A 1P3WA 2AATA 2CFBA 3COGA 3ASAA 1YIZA 1D7UA 1AY5A 3QPGA 3AELA 1M0OA 3WGCA 3Q8NA 1MAQA 4E77A 4EU1A 3DR4A 1AX4A 4FL0A 4WYCA 3D6KA 2ZSLA 1UKJA 1MLYA 3ATHA 1WYVB 2HUFA 3GZDA 1ASFA 2GQNA 4UHOA 1OHYA 2VMPA 1LW5A 2ZYJA 3OKSA 1AAWA 3AENB 4RKDA 4IYOA 4XQ2A 1WKGA 4GE4A 4AOAA 3FQ7A 2O1BA 1AICA 4OTLA 1ASNA 1AMSA 2D7YA 3EZSA 3EIBA 1QITA 3FDBA 1OXPA 2PB0A 1O62A 2D65A 4RJ0A 1JG8A 3N5MA 3MBBA 2R5CB 1JF9A 3IF2A 2AY3A 2E7JA 1IX7A 4JEZA 4WLHA 1WYTA 3W1IA 2BI3A 1PG8A 1M0PA 1ELQA 3QBOA 5LH9A 4R5ZA 3BWOA 4W8IA 1KL1A 2YKUA 1M4NA 3MC6C 4J5UA 1AHXA 4W5KA 3HT4A 1D7SA 1DTYA 3AEMC 1MLZA 4ZDPA 2AY8A 3A8UX 2VMUA 5I92A 5M46A 4Q75A 4XJOA 5DX5A 4R5FA 3TATA 4W1XA 1OATA 3DZZA 4BA4A 2JJHA 3NUBA 1DKAA 2AEUA 1B9IA 2XH1A 4P3MA 1ZODA 2PB2A 1EG5A 4A0RA 4XJLA 4A0GA 2W8VA 3RBLA 3QN6A 1KMJA 1AKCA 4LNLA 1AIBA 2XBNA 2Z9VA 4ZDLA 4U1TA 1GEXA 4LC3A 1G4VA 3MAFA 2CB1A 4LW2A 4ADBA 2Z9XA 3BCBA 2JISA 2VGUA 1MGVA 3VOMA 4N0WA 2OATA 2AY4A 5EUNA 3JZLA 1W7NA 2OGEA 1ASAA 2D63A 3FD0A 2VI8A 4MKKA 4N0BA 1J32A 3DU4A 1OXOA 3WY7A 1D2FA 1ARGA 2W8UA 2ZY2A 4WD2A 1B9HA 1C0NA 4JEXA 5EAVA 2YKYA 4A6UA 4F5FA 3MADA 1RV3A 1JS3A 2CINA 5EFSA 1ARIA 1VJOA 2EO5A 2O7CA 2CY8A 2R5EA 3ISLA 3HL2A 3TFUA 1AHYA 5G09A 3ASBA 4A6RA 3PJ0A 4WB0B 2VLHA 3P6KA 2CJDA 4WYGA 1SFFA 2R2NA 3CAIA 3VK3A 3AEOA 2W7JA 4U2HA 1IVRA 3EIAA 2GMSA 2VYCA 3JU7A 3W1JA 4I8AA 1X2AA 1QJ5A 4BA5A 2R0TA 4ZLVA 2CH2A 2DGMA 4WXGA 3EZ1A 5G0AA 2W8TA 3M5UA 2Z1YA 3MAUA 2BIAA 1BJOB 2JJFA 1MAPA 2EPJA 2VMRA 1CZCA 3BB8A 1CJ0A 1V2DA 4OCAA 4RKCA 2GMUA 4ATPA 4CXRA 1WKHA 2G6WA 1M32A 3RCHB 4Q6RA 4E1OA 3F9TA 3ELEA 2AY9A 1YJZA 1O69A 3VP6A
chains in the Genus database with same CATH superfamily
4RLGA 2YCPA 4JE5D 3A9YA 1I41A 4HVKA 1ELUA 2AY6A 2V1PA 1BKGA 2VMTA 4AZKA 3WLXA 2BWOA 3PDBB 3R9AA 3PD6A 1DGDA 1G7WA 1N2TA 3BCXA 3II0A 4NOGA 1G4XA 2C44A 2BWPA 2VGTA 4CVQA 1ZC9A 2QLRA 3N75A 2QB2A 3BWNA 3QHXA 4FFCA 3H9XA 1ARTA 1KMKA 4ADDA 3FQ8A 5DB5A 4WYFA 3ZRPA 4B98A 1LS3A 5EIGA 2DKBA 3FVXA 1KKJA 5K8BA 1Z3ZA 3I16A 3NDNA 4ITGA 1M7YA 1AHEA 3CQ5A 1XI9A 2CTZA 1ZOBA 3GZDC 4WYDA 1GC0A 2WB6A 2CSTA 2DGKA 3EUCA 3FZ7A 5M4BA 1BJNA 1WYUB 4F5HA 1UU1A 1W7LA 1GCKA 1AJSB 1T3IA 4MY5A 4TMRA 2DGLA 4WP0A 1B8GA 4W1VA 5LHAA 3QI6A 1FG7A 3GR9A 2HOZA 3CBFA 3BCAA 4RIZA 2VLFA 1ASDA 1ECXA 2VMOA 5F9SA 1YAAA 1BJWA 2BYLA 2F8JA 4BHDA 3PDXA 2HOXA 4KAMA 3LY1A 4R8DA 7AATA 1C7NA 2YCTA 3DC1A 4KXKA 4RITA 1AMRA 2D7ZA 2OQXA 5IWQA 1YNUA 3G7QA 1V2FA 1V2EA 3F0HA 2WK9A 5FT5A 5AX8A 4AO4A 3HLMA 3A2BA 1WYVA 4ZSYA 1SZUA 3LV2A 4Y0IA 3KKIA 2CH1A 1TASA 4L0OA 3AENA 1TOGA 3N4XA 1BS0A 3ACZA 3FQAA 3E2ZB 4QGRA 4XJPA 5M4DA 1GD9A 2V0YA 2WK7A 3A9XA 2X3LA 3BS8A 2YKVA 2CJHA 2QB3A 5EAAA 4F5KA 4JEWA 2PO3A 1C9CA 3E2YA 4PVFA 3FDDA 3N7NA 2VMNA 2EZ1A 5D95A 4OC9A 1D7RA 3JW9A 2ZY3A 3GZCA 2YRRA 1TOJA 3WCNA 3RBFA 3P1TA 3H14A 2BYJA 4JE5A 3FRKA 3NYUA 3DYDA 1AHGA 1CQ8A 2R5CA 1UU0A 3NUIA 2E7UA 5D5SA 1B5PA 5F8VA 1QGNA 1Y4IA 4ZASA 4W1WA 1BJ4A 4RM1A 1TOIA 2FM1A 2NMPA 3G8MA 8AATA 3FFRA 4MKJA 1OHWA 5HDMA 2D64A 3F6TA 3H7FA 3IHJA 4F5MA 2BIEA 1IJIA 1S09A 2VGZA 1W7MA 1S0AA 4F5IA 4ZAHA 5EUDA 2ZC0A 3AATA 4BMKA 1VP4A 3T32A 1ASCA 1N31A 3FSLA 5G4JA 1H0CA 2YOBA 3B1EA 3FKDA 3TFTA 3AOVA 3MC6A 1SF2A 1AKAA 3WCOA 4EMYA 1AJRA 3CQ4A 3ECDA 3NRAA 3GETA 5HHYA 1FG3A 2AY7A 1RVUA 4WYAA 4E3RA 2CJGA 3CQ6A 4EFFA 4PFFA 9AATA 4W91A 2WK8A 2G7JA 1LK9A 4MSOA 3DRDA 1GC3A 4ADEA 1SVVA 1SZKA 4A6TA 4AO9A 5E3KA 4GDYA 5E5IA 1AMAA 3DODA 3L8AA 2C81A 3QM2A 4F5JA 3HVYA 2HUIA 1ASBA 1ASEA 3LVLB 4ZSWA 2KFPA 1RV4A 3KGXA 4IW7A 2Z9WA 4ISYA 1CL1A 1VEFA 5FT6A 2YCNA 2X8UA 4A0FA 2HP1A 4WB0A 1AY4A 4E3QA 2VMYA 4CBRA 1KL2A 2BWNA 3AEPA 5DJ9A 2ZY4A 4GEBA 3EI8A 4Y0DA 5J8QA 2ZY5A 2DR1A 1CL2A 1BT4A 2D66A 3VK4A 4PFNA 1GEWA 3N4SA 2FNIA 3ZZJA 3EI9A 1BJOA 2Z20A 3K28A 3VAXA 2VGVA 1I29A 5FT8A 2YHKA 2BI1A 4XK1A 1AHFA 3NYSA 1C4KA 3RCHA 2W7FA 3WGBA 1LC5A 1DFOA 3EI7A 2WKAA 1TARA 4MQPA 4LNJA 3ZRRA 5G2PA 1ARSA 4XAUA 4ITXA 3A9ZA 1IX8A 3AOWA 1XEYA 2TPLA 1D7VA 1I48A 1MDOA 4IXOA 2C0RA 1OHVA 2QBTA 2VGWA 3PDBA 3K7YA 4KYOA 3DR7A 3K40A 3QGUA 3RI6A 1CQ6A 2W7IA 1AIAA 1DJ9A 1IBJA 1TOEA 2ZSMA 2JG2A 4J8LA 3AEJA 4F5LA 5KTBA 1PFFA 1TOKA 1C7GA 3PAAA 3JWBA 4K2IA 4CBSA 4MQQA 1YIYA 3AV7A 3TQXA 4WXFA 1MDZA 4ATQA 2X5DA 3UAKA 2Z61A 3FTBA 1ASLA 3FCRA 2ORDA 4GSAA 1RVYA 4IYOB 2E54A 4WBTA 1UU2A 2JJGA 1WYUA 1WSTA 1AJSA 2FQ6A 1EJIA 1PMMA 5JAYA 1BQDA 2JJEA 4GE9A 3G0TA 1E5EA 3LVKA 1YJYA 3FFHA 4UHNA 5FT4A 1GDEA 4PIWA 4UQVA 3OP7A 2Z1ZA 4OBVA 1DGEA 2O0RA 2YRIA 1S07A 2VIAA 1BW0A 5TF5A 2OKKA 5BJ4A 3PGYA 1FC4A 3E6GA 3L44A 2EYQA 3MKJA 1WYTB 1SZSA 1M0NA 1TATA 5DJ1A 3PIUA 4K05A 1EQBA 1KKPA 1W3UA 3GJUA 3W1HA 5HXXA 4F4EA 5G4IA 2VMZA 1LC8A 4WXBA 2HP2A 4K2MA 1U08A 2GB3A 2BIGA 2VI9A 4WYEA 3VK2A 2GSAA 1W23A 4F5GA 2E7IA 2W7KA 3LWSA 4A0HA 1Z7DA 2W7LA 3E2ZA 3NNKA 2A1VA 4ZWMA 4P7YA 2W8JA 2C7TA 3I5TA 4ZM4A 1ASGA 3LVJA 1MDXA 2Z67A 3MAFB 2QSRA 4JEYA 4TN4A 2HORA 4OMAA 4ADCA 4DGTA 4EB7A 4RAEA 1JS6A 2ZP7A 2DKJA 1S08A 3NYTA 5G2QA 3EI5A 5C6UA 1ARHA 1AY8A 4B9BA 2YKXA 2CANA 5EUEA 4BQ0A 1G7XA 2HZPA 1CZEA 1E5FA 1AKBA 4IXSA 3AEMA 3GBXA 4HF8A 3GWPA 1V72A 3KE3A 4R2NA 4ZM3A 1M6SA 4IY7A 1CS1A 1LKCA 1GC4A 2EGYA 3E2FA 3BN1A 4Y0HA 1O4SA 3BC8A 1QJ3A 2BI9A 3B8XA 3FVUA 3WX9A 1SPAA 1QZ9A 1B5OA 3EI6A 1I43A 3FVSA 2BI5A 4GE7A 4TV7A 1LW4A 4JF0A 4DBCA 2FYFA 1X28A 2HUUA 2ZJGA 3HDOA 4GRXA 1TPLA 1X29A 4WLJA 3HMUA 2FKIA 2W7DA 3ELPA 1PMOA 2AEVA 4H51A 3PPLA 3E9KA 3FZ8A 1H1CA 3NU7A 4MQRA 4UHMA 1S06A 2OGAA 4RJYA 4A00A 1M0QA 1QIRA 1DJUA 4K2BA 5M49A 3B1DA 3UWCA 1GBNA 2W7EA 3BWNC 1C7OA 1N8PA 1YJSA 3N0LA 4M2MA 2W8WA 3I4JA 1DJEA 2BI2A 4Q31A 2ZUKA 4ZWVA 3GSBA 1ORDA 4MGRA 1YOOA 2D5YA 2W7MA 4A72A 1LC7A 2OKJA 4M2KA 4O6ZA 2VMSA 4M2JA 1IAYA 2D61A 2W7GA 2DOUA 3PA9A 3RQ1A 2BKWA 1IX6A 2QA3A 2VMXA 5EQCA 4UOYA 1CQ7A 1IUGA 2VGSA 2Q7WA 4OBUA 3PD6B 2VMWA 3JTXA 4Q76A 4CXQA 4OT8A 4IXZA 4XEWA 3DXWA 3WKSA 3B1CA 3HQTA 4ZDOA 3RUYA 2HOYA 3NU8A 2VMVA 4H63Q 3AEJC 2JGTA 2FN6A 2Z9UA 3LG0A 3BV0A 5EIGB 4IX8A 2EZ2A 1J04A 3E77A 3ZZKA 3B46A 3FZ6A 1QISA 1ASMA 4LNMA 3TCMA 3USFA 2FNUA 3MEBA 4OYTA 2VMQA 2RFVA 3WKRA 3NTJA 4AZJA 2VIBA 3LVMA 3HBXA 2X5FA 4XJMA 4JEVA 3DXVA 4JF1A 2W7HA 2AY2A 3R4TA 1B4XA 1AAMA 3NX3A 4EB5A 5BJ3A 1GEYA 3WZFA 2QMAA 1IAXA 4AH3A 3KGWA 4LW4A 3UE8A 1BQAA 2BHXA 1O61A 2AY5A 2AY1A 3ZRQA 3JWAA 1AMQA 1GC2A 1X0MA 4DQ6A 5E4ZA 2EH6A 1P3WA 2AATA 2CFBA 3COGA 3ASAA 1YIZA 1D7UA 1AY5A 3QPGA 3AELA 1M0OA 3WGCA 3Q8NA 1MAQA 4E77A 4EU1A 3DR4A 1AX4A 4FL0A 4WYCA 3D6KA 2ZSLA 1UKJA 1MLYA 3ATHA 1WYVB 2HUFA 3GZDA 1ASFA 2GQNA 4UHOA 1OHYA 2VMPA 1LW5A 2ZYJA 3OKSA 1AAWA 3AENB 4RKDA 4IYOA 4XQ2A 1WKGA 4GE4A 4AOAA 3FQ7A 2O1BA 1KAFA 1AICA 4OTLA 1ASNA 1AMSA 2D7YA 3EZSA 3EIBA 1QITA 3FDBA 1OXPA 2PB0A 1O62A 2D65A 4RJ0A 1JG8A 3N5MA 3MBBA 2R5CB 1JF9A 3IF2A 2AY3A 2E7JA 1IX7A 4JEZA 4WLHA 1WYTA 3W1IA 2BI3A 1PG8A 1M0PA 1ELQA 3QBOA 5LH9A 4R5ZA 3BWOA 4W8IA 1KL1A 2YKUA 1M4NA 3MC6C 4J5UA 1AHXA 4W5KA 3HT4A 1D7SA 1DTYA 3AEMC 1MLZA 4ZDPA 2AY8A 3A8UX 2VMUA 5I92A 5M46A 4Q75A 4XJOA 5DX5A 4R5FA 3TATA 4W1XA 1OATA 3DZZA 4BA4A 2JJHA 3NUBA 1DKAA 2AEUA 1B9IA 2XH1A 4P3MA 1ZODA 2PB2A 1EG5A 4A0RA 4XJLA 4A0GA 2W8VA 3RBLA 3QN6A 1KMJA 1AKCA 4LNLA 1AIBA 2XBNA 2Z9VA 4ZDLA 4U1TA 1GEXA 4LC3A 1G4VA 3MAFA 2CB1A 4LW2A 4ADBA 2Z9XA 3BCBA 2JISA 2VGUA 1MGVA 3VOMA 4N0WA 2OATA 2AY4A 5EUNA 3JZLA 1W7NA 2OGEA 1ASAA 2D63A 3FD0A 2VI8A 4MKKA 4N0BA 1J32A 3DU4A 1OXOA 3WY7A 1D2FA 1ARGA 2W8UA 2ZY2A 4WD2A 1B9HA 1C0NA 4JEXA 5EAVA 2YKYA 4A6UA 4F5FA 3MADA 1RV3A 1JS3A 2CINA 3N4RA 5EFSA 1ARIA 1VJOA 2EO5A 2O7CA 2CY8A 2R5EA 3ISLA 3HL2A 3TFUA 1AHYA 5G09A 3ASBA 4A6RA 3PJ0A 4WB0B 2VLHA 3P6KA 2CJDA 4WYGA 1SFFA 2R2NA 3CAIA 3VK3A 3AEOA 2W7JA 4U2HA 1IVRA 3EIAA 2GMSA 2VYCA 3JU7A 3W1JA 4I8AA 1X2AA 1QJ5A 4BA5A 2R0TA 4ZLVA 2CH2A 2DGMA 4WXGA 3EZ1A 5G0AA 2W8TA 3M5UA 2Z1YA 3MAUA 2BIAA 1BJOB 2JJFA 1MAPA 2EPJA 2VMRA 1CZCA 3BB8A 1CJ0A 1V2DA 4OCAA 4RKCA 2GMUA 4ATPA 4CXRA 1WKHA 2G6WA 1M32A 3RCHB 4Q6RA 4E1OA 3F9TA 3ELEA 2AY9A 1YJZA 1O69A 3VP6A
chains in the Genus database with same CATH topology
4RLGA 2YCPA 4JE5D 3A9YA 1I41A 4HVKA 1ELUA 2AY6A 2V1PA 1BKGA 2VMTA 4AZKA 3WLXA 2BWOA 3PDBB 3R9AA 3PD6A 1DGDA 1G7WA 1N2TA 3BCXA 3II0A 4NOGA 1G4XA 2C44A 2BWPA 2VGTA 4CVQA 1ZC9A 2QLRA 3N75A 2QB2A 3BWNA 3QHXA 4FFCA 3H9XA 1ARTA 1KMKA 4ADDA 3FQ8A 5DB5A 4WYFA 3ZRPA 4B98A 1LS3A 5EIGA 2DKBA 3FVXA 1KKJA 5K8BA 1Z3ZA 3I16A 3NDNA 4ITGA 1M7YA 1AHEA 3CQ5A 1XI9A 2CTZA 1ZOBA 3GZDC 4WYDA 1GC0A 2WB6A 2CSTA 2DGKA 3EUCA 3FZ7A 5M4BA 1BJNA 1WYUB 4F5HA 1UU1A 1W7LA 1GCKA 1AJSB 1T3IA 4MY5A 4TMRA 2DGLA 4WP0A 1B8GA 4W1VA 5LHAA 3QI6A 1FG7A 3GR9A 2HOZA 3CBFA 3BCAA 4RIZA 2VLFA 1ASDA 1ECXA 2VMOA 5F9SA 1YAAA 1BJWA 2BYLA 2F8JA 4BHDA 3PDXA 2HOXA 4KAMA 3LY1A 4R8DA 7AATA 1C7NA 2YCTA 3DC1A 4KXKA 4RITA 1AMRA 2D7ZA 2OQXA 5IWQA 1YNUA 3G7QA 1V2FA 1V2EA 3F0HA 2WK9A 5FT5A 5AX8A 4AO4A 3HLMA 3A2BA 1WYVA 4ZSYA 1SZUA 3LV2A 4Y0IA 3KKIA 2CH1A 1TASA 4L0OA 3AENA 1TOGA 3N4XA 1BS0A 3ACZA 3FQAA 3E2ZB 4QGRA 4XJPA 5M4DA 1GD9A 2V0YA 2WK7A 3A9XA 2X3LA 3BS8A 2YKVA 2CJHA 2QB3A 5EAAA 4F5KA 4JEWA 2PO3A 1C9CA 3E2YA 4PVFA 3FDDA 3N7NA 2VMNA 2EZ1A 5D95A 4OC9A 1D7RA 3JW9A 2ZY3A 3GZCA 2YRRA 1TOJA 3WCNA 3RBFA 3P1TA 3H14A 2BYJA 4JE5A 3FRKA 3NYUA 3DYDA 1AHGA 1CQ8A 2R5CA 1UU0A 3NUIA 2E7UA 5D5SA 1B5PA 5F8VA 1QGNA 1Y4IA 4ZASA 4W1WA 1BJ4A 4RM1A 1TOIA 2FM1A 2NMPA 3G8MA 8AATA 3FFRA 4MKJA 1OHWA 5HDMA 2D64A 3F6TA 3H7FA 3IHJA 4F5MA 2BIEA 1IJIA 1S09A 2VGZA 1W7MA 1S0AA 4F5IA 4ZAHA 5EUDA 2ZC0A 3AATA 4BMKA 1VP4A 3T32A 1ASCA 1N31A 3FSLA 5G4JA 1H0CA 2YOBA 3B1EA 3FKDA 3TFTA 3AOVA 3MC6A 1SF2A 1AKAA 3WCOA 4EMYA 1AJRA 3CQ4A 3ECDA 3NRAA 3GETA 5HHYA 1FG3A 2AY7A 1RVUA 4WYAA 4E3RA 2CJGA 3CQ6A 4EFFA 4PFFA 9AATA 4W91A 2WK8A 2G7JA 1LK9A 4MSOA 3DRDA 1GC3A 4ADEA 1SVVA 1SZKA 4A6TA 4AO9A 5E3KA 4GDYA 5E5IA 1AMAA 3DODA 3L8AA 2C81A 3QM2A 4F5JA 3HVYA 2HUIA 1ASBA 1ASEA 3LVLB 4ZSWA 2KFPA 1RV4A 3KGXA 4IW7A 2Z9WA 4ISYA 1CL1A 1VEFA 5FT6A 2YCNA 2X8UA 4A0FA 2HP1A 4WB0A 1AY4A 4E3QA 2VMYA 4CBRA 1KL2A 2BWNA 3AEPA 5DJ9A 2ZY4A 4GEBA 3EI8A 4Y0DA 5J8QA 2ZY5A 2DR1A 1CL2A 1BT4A 2D66A 3VK4A 4PFNA 1GEWA 3N4SA 2FNIA 3ZZJA 3EI9A 1BJOA 2Z20A 3K28A 3VAXA 2VGVA 1I29A 5FT8A 2YHKA 2BI1A 4XK1A 1AHFA 3NYSA 1C4KA 3RCHA 2W7FA 3WGBA 1LC5A 1DFOA 3EI7A 2WKAA 1TARA 4MQPA 4LNJA 3ZRRA 5G2PA 1ARSA 4XAUA 4ITXA 3A9ZA 1IX8A 3AOWA 1XEYA 2TPLA 1D7VA 1I48A 1MDOA 4IXOA 2C0RA 1OHVA 2QBTA 2VGWA 3PDBA 3K7YA 4KYOA 3DR7A 3K40A 3QGUA 3RI6A 1CQ6A 2W7IA 1AIAA 1DJ9A 1IBJA 1TOEA 2ZSMA 2JG2A 4J8LA 3AEJA 4F5LA 5KTBA 1PFFA 1TOKA 1C7GA 3PAAA 3JWBA 4K2IA 4CBSA 4MQQA 1YIYA 3AV7A 3TQXA 4WXFA 1MDZA 4ATQA 2X5DA 3UAKA 2Z61A 3FTBA 1ASLA 3FCRA 2ORDA 4GSAA 1RVYA 4IYOB 2E54A 4WBTA 1UU2A 2JJGA 1WYUA 1WSTA 1AJSA 2FQ6A 1EJIA 1PMMA 5JAYA 1BQDA 2JJEA 4GE9A 3G0TA 1E5EA 3LVKA 1YJYA 3FFHA 4UHNA 5FT4A 1GDEA 4PIWA 4UQVA 3OP7A 2Z1ZA 4OBVA 1DGEA 2O0RA 2YRIA 1S07A 2VIAA 1BW0A 5TF5A 2OKKA 5BJ4A 3PGYA 1FC4A 3E6GA 3L44A 2EYQA 3MKJA 1WYTB 1SZSA 1M0NA 1TATA 5DJ1A 3PIUA 4K05A 1EQBA 1KKPA 1W3UA 3GJUA 3W1HA 5HXXA 4F4EA 5G4IA 2VMZA 1LC8A 4WXBA 2HP2A 4K2MA 1U08A 2GB3A 2BIGA 2VI9A 4WYEA 3VK2A 2GSAA 1W23A 4F5GA 2E7IA 2W7KA 3LWSA 4A0HA 1Z7DA 2W7LA 3E2ZA 3NNKA 2A1VA 4ZWMA 4P7YA 2W8JA 2C7TA 3I5TA 4ZM4A 1ASGA 3LVJA 1MDXA 2Z67A 3MAFB 2QSRA 4JEYA 4TN4A 2HORA 4OMAA 4ADCA 4DGTA 4EB7A 4RAEA 1JS6A 2ZP7A 2DKJA 1S08A 3NYTA 5G2QA 3EI5A 5C6UA 1ARHA 1AY8A 4B9BA 2YKXA 2CANA 5EUEA 4BQ0A 1G7XA 2HZPA 1CZEA 1E5FA 1AKBA 4IXSA 3AEMA 3GBXA 4HF8A 3GWPA 1V72A 3KE3A 4R2NA 4ZM3A 1M6SA 4IY7A 1CS1A 1LKCA 1GC4A 2EGYA 3E2FA 3BN1A 4Y0HA 1O4SA 3BC8A 1QJ3A 2BI9A 3B8XA 3FVUA 3WX9A 1SPAA 1QZ9A 1B5OA 3EI6A 1I43A 3FVSA 2BI5A 4GE7A 4TV7A 1LW4A 4JF0A 4DBCA 2FYFA 1X28A 2HUUA 2ZJGA 3HDOA 4GRXA 1TPLA 1X29A 4WLJA 3HMUA 2FKIA 2W7DA 3ELPA 1PMOA 2AEVA 4H51A 3PPLA 3E9KA 3FZ8A 1H1CA 3NU7A 4MQRA 4UHMA 1S06A 2OGAA 4RJYA 4A00A 1M0QA 1QIRA 1DJUA 4K2BA 5M49A 3B1DA 3UWCA 1GBNA 2W7EA 3BWNC 1C7OA 1N8PA 1YJSA 3N0LA 4M2MA 2W8WA 3I4JA 1DJEA 2BI2A 4Q31A 2ZUKA 4ZWVA 3GSBA 1ORDA 4MGRA 1YOOA 2D5YA 2W7MA 4A72A 1LC7A 2OKJA 4M2KA 4O6ZA 2VMSA 4M2JA 1IAYA 2D61A 2W7GA 2DOUA 3PA9A 3RQ1A 2BKWA 1IX6A 2QA3A 2VMXA 5EQCA 4UOYA 1CQ7A 1IUGA 2VGSA 2Q7WA 4OBUA 3PD6B 2VMWA 3JTXA 4Q76A 4CXQA 4OT8A 4IXZA 4XEWA 3DXWA 3WKSA 3B1CA 3HQTA 4ZDOA 3RUYA 2HOYA 3NU8A 2VMVA 4H63Q 3AEJC 2JGTA 2FN6A 2Z9UA 3LG0A 3BV0A 5EIGB 4IX8A 2EZ2A 1J04A 3E77A 3ZZKA 3B46A 3FZ6A 1QISA 1ASMA 4LNMA 3TCMA 3USFA 2FNUA 3MEBA 4OYTA 2VMQA 2RFVA 3WKRA 3NTJA 4AZJA 2VIBA 3LVMA 3HBXA 2X5FA 4XJMA 4JEVA 3DXVA 4JF1A 2W7HA 2AY2A 3R4TA 1B4XA 1AAMA 3NX3A 4EB5A 5BJ3A 1GEYA 3WZFA 2QMAA 1IAXA 4AH3A 3KGWA 4LW4A 3UE8A 1BQAA 2BHXA 1O61A 2AY5A 2AY1A 3ZRQA 3JWAA 1AMQA 1GC2A 1X0MA 4DQ6A 5E4ZA 2EH6A 1P3WA 2AATA 2CFBA 3COGA 3ASAA 1YIZA 1D7UA 1AY5A 3QPGA 3AELA 1M0OA 3WGCA 3Q8NA 1MAQA 4E77A 4EU1A 3DR4A 1AX4A 4FL0A 4WYCA 3D6KA 2ZSLA 1UKJA 1MLYA 3ATHA 1WYVB 2HUFA 3GZDA 1ASFA 2GQNA 4UHOA 1OHYA 2VMPA 1LW5A 2ZYJA 3OKSA 1AAWA 3AENB 4RKDA 4IYOA 4XQ2A 1WKGA 4GE4A 4AOAA 3FQ7A 2O1BA 1AICA 4OTLA 1ASNA 1AMSA 2D7YA 3EZSA 3EIBA 1QITA 3FDBA 1OXPA 2PB0A 1O62A 2D65A 4RJ0A 1JG8A 3N5MA 3MBBA 2R5CB 1JF9A 3IF2A 2AY3A 2E7JA 1IX7A 4JEZA 4WLHA 1WYTA 3W1IA 2BI3A 1PG8A 1M0PA 1ELQA 3QBOA 5LH9A 4R5ZA 3BWOA 4W8IA 1KL1A 2YKUA 1M4NA 3MC6C 4J5UA 1AHXA 4W5KA 3HT4A 1D7SA 1DTYA 3AEMC 1MLZA 4ZDPA 2AY8A 3A8UX 2VMUA 5I92A 5M46A 4Q75A 4XJOA 5DX5A 4R5FA 3TATA 4W1XA 1OATA 3DZZA 4BA4A 2JJHA 3NUBA 1DKAA 2AEUA 1B9IA 2XH1A 4P3MA 1ZODA 2PB2A 1EG5A 4A0RA 4XJLA 4A0GA 2W8VA 3RBLA 3QN6A 1KMJA 1AKCA 4LNLA 1AIBA 2XBNA 2Z9VA 4ZDLA 4U1TA 1GEXA 4LC3A 1G4VA 3MAFA 2CB1A 4LW2A 4ADBA 2Z9XA 3BCBA 2JISA 2VGUA 1MGVA 3VOMA 4N0WA 2OATA 2AY4A 5EUNA 3JZLA 1W7NA 2OGEA 1ASAA 2D63A 3FD0A 2VI8A 4MKKA 4N0BA 1J32A 3DU4A 1OXOA 3WY7A 1D2FA 1ARGA 2W8UA 2ZY2A 4WD2A 1B9HA 1C0NA 4JEXA 5EAVA 2YKYA 4A6UA 4F5FA 3MADA 1RV3A 1JS3A 2CINA 3N4RA 5EFSA 1ARIA 1VJOA 2EO5A 2O7CA 2CY8A 2R5EA 3ISLA 3HL2A 3TFUA 1AHYA 5G09A 3ASBA 4A6RA 3PJ0A 4WB0B 2VLHA 3P6KA 2CJDA 4WYGA 1SFFA 2R2NA 3CAIA 3VK3A 3AEOA 2W7JA 4U2HA 1IVRA 3EIAA 2GMSA 2VYCA 3JU7A 3W1JA 4I8AA 1X2AA 1QJ5A 4BA5A 2R0TA 4ZLVA 2CH2A 2DGMA 4WXGA 3EZ1A 5G0AA 2W8TA 3M5UA 2Z1YA 3MAUA 2BIAA 1BJOB 2JJFA 1MAPA 2EPJA 2VMRA 1CZCA 3BB8A 1CJ0A 1V2DA 4OCAA 4RKCA 2GMUA 4ATPA 4CXRA 1WKHA 2G6WA 1M32A 3RCHB 4Q6RA 4E1OA 3F9TA 3ELEA 2AY9A 1YJZA 1O69A 3VP6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RLG A;  2YCP A;  4JE5 D;  3A9Y A;  1I41 A;  4HVK A;  1ELU A;  2AY6 A;  2V1P A;  1BKG A;  2VMT A;  4AZK A;  3WLX A;  2BWO A;  3PDB B;  3R9A A;  3PD6 A;  1DGD A;  1G7W A;  1N2T A;  3BCX A;  3II0 A;  4NOG A;  1G4X A;  2C44 A;  2BWP A;  2VGT A;  4CVQ A;  1ZC9 A;  2QLR A;  3N75 A;  2QB2 A;  3BWN A;  3QHX A;  4FFC A;  1ART A;  1KMK A;  4ADD A;  3FQ8 A;  5DB5 A;  4WYF A;  3ZRP A;  4B98 A;  1LS3 A;  5EIG A;  2DKB A;  3FVX A;  1KKJ A;  5K8B A;  1Z3Z A;  3I16 A;  3NDN A;  4ITG A;  1M7Y A;  1AHE A;  3CQ5 A;  1XI9 A;  2CTZ A;  1ZOB A;  3GZD C;  4WYD A;  1GC0 A;  2CST A;  2DGK A;  3EUC A;  3FZ7 A;  5M4B A;  1BJN A;  1WYU B;  4F5H A;  1UU1 A;  1W7L A;  1GCK A;  1AJS B;  1T3I A;  4MY5 A;  4TMR A;  2DGL A;  4WP0 A;  1B8G A;  4W1V A;  5LHA A;  3QI6 A;  1FG7 A;  3GR9 A;  2HOZ A;  3CBF A;  3BCA A;  4RIZ A;  2VLF A;  1ASD A;  1ECX A;  2VMO A;  5F9S A;  1YAA A;  1BJW A;  2BYL A;  2F8J A;  4BHD A;  3PDX A;  2HOX A;  4KAM A;  3LY1 A;  4R8D A;  7AAT A;  1C7N A;  2YCT A;  3DC1 A;  4KXK A;  4RIT A;  1AMR A;  2D7Z A;  2OQX A;  5IWQ A;  1YNU A;  3G7Q A;  1V2F A;  1V2E A;  3F0H A;  2WK9 A;  5FT5 A;  5AX8 A;  4AO4 A;  3HLM A;  3A2B A;  1WYV A;  4ZSY A;  1SZU A;  3LV2 A;  4Y0I A;  3KKI A;  2CH1 A;  1TAS A;  4L0O A;  3AEN A;  1TOG A;  1BS0 A;  3ACZ A;  3FQA A;  3E2Z B;  4QGR A;  4XJP A;  5M4D A;  1GD9 A;  2V0Y A;  2WK7 A;  3A9X A;  2X3L A;  3BS8 A;  2YKV A;  2CJH A;  2QB3 A;  5EAA A;  4F5K A;  4JEW A;  2PO3 A;  1C9C A;  3E2Y A;  4PVF A;  3FDD A;  2VMN A;  2EZ1 A;  5D95 A;  4OC9 A;  1D7R A;  3JW9 A;  2ZY3 A;  3GZC A;  2YRR A;  1TOJ A;  3WCN A;  3RBF A;  3P1T A;  3H14 A;  2BYJ A;  4JE5 A;  3FRK A;  3NYU A;  3DYD A;  1AHG A;  1CQ8 A;  2R5C A;  1UU0 A;  3NUI A;  2E7U A;  5D5S A;  1B5P A;  5F8V A;  1QGN A;  1Y4I A;  4ZAS A;  4W1W A;  1BJ4 A;  4RM1 A;  1TOI A;  2FM1 A;  2NMP A;  3G8M A;  8AAT A;  3FFR A;  4MKJ A;  1OHW A;  5HDM A;  2D64 A;  3F6T A;  3H7F A;  3IHJ A;  4F5M A;  2BIE A;  1IJI A;  1S09 A;  2VGZ A;  1W7M A;  1S0A A;  4F5I A;  4ZAH A;  5EUD A;  2ZC0 A;  3AAT A;  4BMK A;  1VP4 A;  3T32 A;  1ASC A;  1N31 A;  3FSL A;  5G4J A;  1H0C A;  2YOB A;  3B1E A;  3FKD A;  3TFT A;  3AOV A;  3MC6 A;  1SF2 A;  1AKA A;  3WCO A;  4EMY A;  1AJR A;  3CQ4 A;  3ECD A;  3NRA A;  3GET A;  5HHY A;  1FG3 A;  2AY7 A;  1RVU A;  4WYA A;  4E3R A;  2CJG A;  3CQ6 A;  4EFF A;  4PFF A;  9AAT A;  4W91 A;  2WK8 A;  1LK9 A;  4MSO A;  3DRD A;  1GC3 A;  4ADE A;  1SVV A;  1SZK A;  4A6T A;  4AO9 A;  5E3K A;  4GDY A;  5E5I A;  1AMA A;  3DOD A;  3L8A A;  2C81 A;  3QM2 A;  4F5J A;  3HVY A;  2HUI A;  1ASB A;  1ASE A;  3LVL B;  4ZSW A;  1RV4 A;  3KGX A;  4IW7 A;  2Z9W A;  4ISY A;  1CL1 A;  1VEF A;  5FT6 A;  2YCN A;  2X8U A;  4A0F A;  2HP1 A;  4WB0 A;  1AY4 A;  4E3Q A;  2VMY A;  4CBR A;  1KL2 A;  2BWN A;  3AEP A;  5DJ9 A;  2ZY4 A;  4GEB A;  3EI8 A;  4Y0D A;  5J8Q A;  2ZY5 A;  2DR1 A;  1CL2 A;  1BT4 A;  2D66 A;  3VK4 A;  4PFN A;  1GEW A;  2FNI A;  3ZZJ A;  3EI9 A;  1BJO A;  2Z20 A;  3K28 A;  3VAX A;  2VGV A;  1I29 A;  5FT8 A;  2YHK A;  2BI1 A;  4XK1 A;  1AHF A;  3NYS A;  1C4K A;  3RCH A;  2W7F A;  3WGB A;  1LC5 A;  1DFO A;  3EI7 A;  2WKA A;  1TAR A;  4MQP A;  4LNJ A;  3ZRR A;  5G2P A;  1ARS A;  4XAU A;  4ITX A;  3A9Z A;  1IX8 A;  3AOW A;  1XEY A;  2TPL A;  1D7V A;  1I48 A;  1MDO A;  4IXO A;  2C0R A;  1OHV A;  2QBT A;  2VGW A;  3PDB A;  3K7Y A;  4KYO A;  3DR7 A;  3K40 A;  3QGU A;  3RI6 A;  1CQ6 A;  2W7I A;  1AIA A;  1DJ9 A;  1IBJ A;  1TOE A;  2ZSM A;  2JG2 A;  4J8L A;  3AEJ A;  4F5L A;  1PFF A;  1TOK A;  1C7G A;  3PAA A;  3JWB A;  4K2I A;  4CBS A;  4MQQ A;  1YIY A;  3AV7 A;  3TQX A;  4WXF A;  1MDZ A;  4ATQ A;  2X5D A;  3UAK A;  2Z61 A;  3FTB A;  1ASL A;  3FCR A;  2ORD A;  4GSA A;  1RVY A;  4IYO B;  2E54 A;  4WBT A;  1UU2 A;  2JJG A;  1WYU A;  1WST A;  1AJS A;  2FQ6 A;  1EJI A;  1PMM A;  5JAY A;  1BQD A;  2JJE A;  4GE9 A;  3G0T A;  1E5E A;  3LVK A;  1YJY A;  3FFH A;  4UHN A;  5FT4 A;  1GDE A;  4PIW A;  4UQV A;  3OP7 A;  2Z1Z A;  4OBV A;  1DGE A;  2O0R A;  2YRI A;  1S07 A;  2VIA A;  1BW0 A;  5TF5 A;  2OKK A;  5BJ4 A;  3PGY A;  1FC4 A;  3E6G A;  3L44 A;  3MKJ A;  1WYT B;  1SZS A;  1M0N A;  1TAT A;  5DJ1 A;  3PIU A;  1EQB A;  1KKP A;  1W3U A;  3GJU A;  3W1H A;  5HXX A;  4F4E A;  5G4I A;  2VMZ A;  1LC8 A;  4WXB A;  2HP2 A;  4K2M A;  1U08 A;  2GB3 A;  2BIG A;  2VI9 A;  4WYE A;  3VK2 A;  2GSA A;  1W23 A;  4F5G A;  2E7I A;  2W7K A;  3LWS A;  4A0H A;  1Z7D A;  2W7L A;  3E2Z A;  3NNK A;  4ZWM A;  4P7Y A;  2W8J A;  2C7T A;  3I5T A;  4ZM4 A;  1ASG A;  3LVJ A;  1MDX A;  2Z67 A;  3MAF B;  4JEY A;  4TN4 A;  2HOR A;  4OMA A;  4ADC A;  4DGT A;  4EB7 A;  4RAE A;  1JS6 A;  2ZP7 A;  2DKJ A;  1S08 A;  3NYT A;  5G2Q A;  3EI5 A;  5C6U A;  1ARH A;  1AY8 A;  4B9B A;  2YKX A;  2CAN A;  5EUE A;  4BQ0 A;  1G7X A;  2HZP A;  1CZE A;  1E5F A;  1AKB A;  4IXS A;  3AEM A;  3GBX A;  4HF8 A;  3GWP A;  1V72 A;  3KE3 A;  4R2N A;  4ZM3 A;  1M6S A;  4IY7 A;  1CS1 A;  1LKC A;  1GC4 A;  2EGY A;  3E2F A;  3BN1 A;  4Y0H A;  1O4S A;  3BC8 A;  1QJ3 A;  2BI9 A;  3B8X A;  3FVU A;  3WX9 A;  1SPA A;  1QZ9 A;  1B5O A;  3EI6 A;  1I43 A;  3FVS A;  2BI5 A;  4GE7 A;  4TV7 A;  1LW4 A;  4JF0 A;  4DBC A;  2FYF A;  1X28 A;  2HUU A;  2ZJG A;  3HDO A;  4GRX A;  1TPL A;  1X29 A;  4WLJ A;  3HMU A;  2W7D A;  3ELP A;  1PMO A;  2AEV A;  4H51 A;  3PPL A;  3E9K A;  3FZ8 A;  1H1C A;  3NU7 A;  4MQR A;  4UHM A;  1S06 A;  2OGA A;  4RJY A;  4A00 A;  1M0Q A;  1QIR A;  1DJU A;  4K2B A;  5M49 A;  3B1D A;  3UWC A;  1GBN A;  2W7E A;  3BWN C;  1C7O A;  1N8P A;  1YJS A;  3N0L A;  4M2M A;  2W8W A;  3I4J A;  1DJE A;  2BI2 A;  4Q31 A;  2ZUK A;  4ZWV A;  3GSB A;  1ORD A;  4MGR A;  1YOO A;  2D5Y A;  2W7M A;  4A72 A;  1LC7 A;  2OKJ A;  4M2K A;  4O6Z A;  2VMS A;  4M2J A;  1IAY A;  2D61 A;  2W7G A;  2DOU A;  3PA9 A;  3RQ1 A;  2BKW A;  1IX6 A;  2QA3 A;  2VMX A;  5EQC A;  4UOY A;  1CQ7 A;  1IUG A;  2VGS A;  2Q7W A;  4OBU A;  3PD6 B;  2VMW A;  3JTX A;  4Q76 A;  4CXQ A;  4OT8 A;  4IXZ A;  4XEW A;  3DXW A;  3WKS A;  3B1C A;  3HQT A;  4ZDO A;  3RUY A;  2HOY A;  3NU8 A;  2VMV A;  3AEJ C;  2JGT A;  2FN6 A;  2Z9U A;  3LG0 A;  3BV0 A;  5EIG B;  4IX8 A;  2EZ2 A;  1J04 A;  3E77 A;  3ZZK A;  3B46 A;  3FZ6 A;  1QIS A;  1ASM A;  4LNM A;  3TCM A;  3USF A;  2FNU A;  3MEB A;  4OYT A;  2VMQ A;  2RFV A;  3WKR A;  3NTJ A;  4AZJ A;  2VIB A;  3LVM A;  3HBX A;  2X5F A;  4XJM A;  4JEV A;  3DXV A;  4JF1 A;  2W7H A;  2AY2 A;  3R4T A;  1B4X A;  1AAM A;  3NX3 A;  4EB5 A;  5BJ3 A;  1GEY A;  3WZF A;  2QMA A;  1IAX A;  4AH3 A;  3KGW A;  4LW4 A;  3UE8 A;  1BQA A;  2BHX A;  1O61 A;  2AY5 A;  2AY1 A;  3ZRQ A;  3JWA A;  1AMQ A;  1GC2 A;  1X0M A;  4DQ6 A;  5E4Z A;  2EH6 A;  1P3W A;  2AAT A;  2CFB A;  3COG A;  3ASA A;  1YIZ A;  1D7U A;  1AY5 A;  3QPG A;  3AEL A;  1M0O A;  3WGC A;  3Q8N A;  1MAQ A;  4E77 A;  4EU1 A;  3DR4 A;  1AX4 A;  4FL0 A;  4WYC A;  3D6K A;  2ZSL A;  1UKJ A;  1MLY A;  3ATH A;  1WYV B;  2HUF A;  3GZD A;  1ASF A;  2GQN A;  4UHO A;  1OHY A;  2VMP A;  1LW5 A;  2ZYJ A;  3OKS A;  1AAW A;  3AEN B;  4RKD A;  4IYO A;  4XQ2 A;  1WKG A;  4GE4 A;  4AOA A;  3FQ7 A;  2O1B A;  1AIC A;  4OTL A;  1ASN A;  1AMS A;  2D7Y A;  3EZS A;  3EIB A;  1QIT A;  3FDB A;  1OXP A;  2PB0 A;  1O62 A;  2D65 A;  4RJ0 A;  1JG8 A;  3N5M A;  3MBB A;  2R5C B;  1JF9 A;  3IF2 A;  2AY3 A;  2E7J A;  1IX7 A;  4JEZ A;  4WLH A;  1WYT A;  3W1I A;  2BI3 A;  1PG8 A;  1M0P A;  1ELQ A;  3QBO A;  5LH9 A;  4R5Z A;  3BWO A;  4W8I A;  1KL1 A;  2YKU A;  1M4N A;  3MC6 C;  4J5U A;  1AHX A;  4W5K A;  3HT4 A;  1D7S A;  1DTY A;  3AEM C;  1MLZ A;  4ZDP A;  2AY8 A;  3A8U X;  2VMU A;  5I92 A;  5M46 A;  4Q75 A;  4XJO A;  5DX5 A;  4R5F A;  3TAT A;  4W1X A;  1OAT A;  3DZZ A;  4BA4 A;  2JJH A;  3NUB A;  1DKA A;  2AEU A;  1B9I A;  2XH1 A;  4P3M A;  1ZOD A;  2PB2 A;  1EG5 A;  4A0R A;  4XJL A;  4A0G A;  2W8V A;  3RBL A;  3QN6 A;  1KMJ A;  1AKC A;  4LNL A;  1AIB A;  2XBN A;  2Z9V A;  4ZDL A;  4U1T A;  1GEX A;  4LC3 A;  1G4V A;  3MAF A;  2CB1 A;  4LW2 A;  4ADB A;  2Z9X A;  3BCB A;  2JIS A;  2VGU A;  1MGV A;  3VOM A;  4N0W A;  2OAT A;  2AY4 A;  5EUN A;  3JZL A;  1W7N A;  2OGE A;  1ASA A;  2D63 A;  3FD0 A;  2VI8 A;  4MKK A;  4N0B A;  1J32 A;  3DU4 A;  1OXO A;  3WY7 A;  1D2F A;  1ARG A;  2W8U A;  2ZY2 A;  4WD2 A;  1B9H A;  1C0N A;  4JEX A;  5EAV A;  2YKY A;  4A6U A;  4F5F A;  3MAD A;  1RV3 A;  1JS3 A;  2CIN A;  5EFS A;  1ARI A;  1VJO A;  2EO5 A;  2O7C A;  2CY8 A;  2R5E A;  3ISL A;  3HL2 A;  3TFU A;  1AHY A;  5G09 A;  3ASB A;  4A6R A;  3PJ0 A;  4WB0 B;  2VLH A;  3P6K A;  2CJD A;  4WYG A;  1SFF A;  2R2N A;  3CAI A;  3VK3 A;  3AEO A;  2W7J A;  4U2H A;  1IVR A;  3EIA A;  2GMS A;  2VYC A;  3JU7 A;  3W1J A;  4I8A A;  1X2A A;  1QJ5 A;  4BA5 A;  2R0T A;  4ZLV A;  2CH2 A;  2DGM A;  4WXG A;  3EZ1 A;  5G0A A;  2W8T A;  3M5U A;  2Z1Y A;  3MAU A;  2BIA A;  1BJO B;  2JJF A;  1MAP A;  2EPJ A;  2VMR A;  1CZC A;  3BB8 A;  1CJ0 A;  1V2D A;  4OCA A;  4RKC A;  2GMU A;  4ATP A;  4CXR A;  1WKH A;  2G6W A;  1M32 A;  3RCH B;  4Q6R A;  4E1O A;  3F9T A;  3ELE A;  2AY9 A;  1YJZ A;  1O69 A;  3VP6 A; 
#chains in the Genus database with same CATH topology
 4RLG A;  2YCP A;  4JE5 D;  3A9Y A;  1I41 A;  4HVK A;  1ELU A;  2AY6 A;  2V1P A;  1BKG A;  2VMT A;  4AZK A;  3WLX A;  2BWO A;  3PDB B;  3R9A A;  3PD6 A;  1DGD A;  1G7W A;  1N2T A;  3BCX A;  3II0 A;  4NOG A;  1G4X A;  2C44 A;  2BWP A;  2VGT A;  4CVQ A;  1ZC9 A;  2QLR A;  3N75 A;  2QB2 A;  3BWN A;  3QHX A;  4FFC A;  3H9X A;  1ART A;  1KMK A;  4ADD A;  3FQ8 A;  5DB5 A;  4WYF A;  3ZRP A;  4B98 A;  1LS3 A;  5EIG A;  2DKB A;  3FVX A;  1KKJ A;  5K8B A;  1Z3Z A;  3I16 A;  3NDN A;  4ITG A;  1M7Y A;  1AHE A;  3CQ5 A;  1XI9 A;  2CTZ A;  1ZOB A;  3GZD C;  4WYD A;  1GC0 A;  2WB6 A;  2CST A;  2DGK A;  3EUC A;  3FZ7 A;  5M4B A;  1BJN A;  1WYU B;  4F5H A;  1UU1 A;  1W7L A;  1GCK A;  1AJS B;  1T3I A;  4MY5 A;  4TMR A;  2DGL A;  4WP0 A;  1B8G A;  4W1V A;  5LHA A;  3QI6 A;  1FG7 A;  3GR9 A;  2HOZ A;  3CBF A;  3BCA A;  4RIZ A;  2VLF A;  1ASD A;  1ECX A;  2VMO A;  5F9S A;  1YAA A;  1BJW A;  2BYL A;  2F8J A;  4BHD A;  3PDX A;  2HOX A;  4KAM A;  3LY1 A;  4R8D A;  7AAT A;  1C7N A;  2YCT A;  3DC1 A;  4KXK A;  4RIT A;  1AMR A;  2D7Z A;  2OQX A;  5IWQ A;  1YNU A;  3G7Q A;  1V2F A;  1V2E A;  3F0H A;  2WK9 A;  5FT5 A;  5AX8 A;  4AO4 A;  3HLM A;  3A2B A;  1WYV A;  4ZSY A;  1SZU A;  3LV2 A;  4Y0I A;  3KKI A;  2CH1 A;  1TAS A;  4L0O A;  3AEN A;  1TOG A;  3N4X A;  1BS0 A;  3ACZ A;  3FQA A;  3E2Z B;  4QGR A;  4XJP A;  5M4D A;  1GD9 A;  2V0Y A;  2WK7 A;  3A9X A;  2X3L A;  3BS8 A;  2YKV A;  2CJH A;  2QB3 A;  5EAA A;  4F5K A;  4JEW A;  2PO3 A;  1C9C A;  3E2Y A;  4PVF A;  3FDD A;  3N7N A;  2VMN A;  2EZ1 A;  5D95 A;  4OC9 A;  1D7R A;  3JW9 A;  2ZY3 A;  3GZC A;  2YRR A;  1TOJ A;  3WCN A;  3RBF A;  3P1T A;  3H14 A;  2BYJ A;  4JE5 A;  3FRK A;  3NYU A;  3DYD A;  1AHG A;  1CQ8 A;  2R5C A;  1UU0 A;  3NUI A;  2E7U A;  5D5S A;  1B5P A;  5F8V A;  1QGN A;  1Y4I A;  4ZAS A;  4W1W A;  1BJ4 A;  4RM1 A;  1TOI A;  2FM1 A;  2NMP A;  3G8M A;  8AAT A;  3FFR A;  4MKJ A;  1OHW A;  5HDM A;  2D64 A;  3F6T A;  3H7F A;  3IHJ A;  4F5M A;  2BIE A;  1IJI A;  1S09 A;  2VGZ A;  1W7M A;  1S0A A;  4F5I A;  4ZAH A;  5EUD A;  2ZC0 A;  3AAT A;  4BMK A;  1VP4 A;  3T32 A;  1ASC A;  1N31 A;  3FSL A;  5G4J A;  1H0C A;  2YOB A;  3B1E A;  3FKD A;  3TFT A;  3AOV A;  3MC6 A;  1SF2 A;  1AKA A;  3WCO A;  4EMY A;  1AJR A;  3CQ4 A;  3ECD A;  3NRA A;  3GET A;  5HHY A;  1FG3 A;  2AY7 A;  1RVU A;  4WYA A;  4E3R A;  2CJG A;  3CQ6 A;  4EFF A;  4PFF A;  9AAT A;  4W91 A;  2WK8 A;  2G7J A;  1LK9 A;  4MSO A;  3DRD A;  1GC3 A;  4ADE A;  1SVV A;  1SZK A;  4A6T A;  4AO9 A;  5E3K A;  4GDY A;  5E5I A;  1AMA A;  3DOD A;  3L8A A;  2C81 A;  3QM2 A;  4F5J A;  3HVY A;  2HUI A;  1ASB A;  1ASE A;  3LVL B;  4ZSW A;  2KFP A;  1RV4 A;  3KGX A;  4IW7 A;  2Z9W A;  4ISY A;  1CL1 A;  1VEF A;  5FT6 A;  2YCN A;  2X8U A;  4A0F A;  2HP1 A;  4WB0 A;  1AY4 A;  4E3Q A;  2VMY A;  4CBR A;  1KL2 A;  2BWN A;  3AEP A;  5DJ9 A;  2ZY4 A;  4GEB A;  3EI8 A;  4Y0D A;  5J8Q A;  2ZY5 A;  2DR1 A;  1CL2 A;  1BT4 A;  2D66 A;  3VK4 A;  4PFN A;  1GEW A;  3N4S A;  2FNI A;  3ZZJ A;  3EI9 A;  1BJO A;  2Z20 A;  3K28 A;  3VAX A;  2VGV A;  1I29 A;  5FT8 A;  2YHK A;  2BI1 A;  4XK1 A;  1AHF A;  3NYS A;  1C4K A;  3RCH A;  2W7F A;  3WGB A;  1LC5 A;  1DFO A;  3EI7 A;  2WKA A;  1TAR A;  4MQP A;  4LNJ A;  3ZRR A;  5G2P A;  1ARS A;  4XAU A;  4ITX A;  3A9Z A;  1IX8 A;  3AOW A;  1XEY A;  2TPL A;  1D7V A;  1I48 A;  1MDO A;  4IXO A;  2C0R A;  1OHV A;  2QBT A;  2VGW A;  3PDB A;  3K7Y A;  4KYO A;  3DR7 A;  3K40 A;  3QGU A;  3RI6 A;  1CQ6 A;  2W7I A;  1AIA A;  1DJ9 A;  1IBJ A;  1TOE A;  2ZSM A;  2JG2 A;  4J8L A;  3AEJ A;  4F5L A;  5KTB A;  1PFF A;  1TOK A;  1C7G A;  3PAA A;  3JWB A;  4K2I A;  4CBS A;  4MQQ A;  1YIY A;  3AV7 A;  3TQX A;  4WXF A;  1MDZ A;  4ATQ A;  2X5D A;  3UAK A;  2Z61 A;  3FTB A;  1ASL A;  3FCR A;  2ORD A;  4GSA A;  1RVY A;  4IYO B;  2E54 A;  4WBT A;  1UU2 A;  2JJG A;  1WYU A;  1WST A;  1AJS A;  2FQ6 A;  1EJI A;  1PMM A;  5JAY A;  1BQD A;  2JJE A;  4GE9 A;  3G0T A;  1E5E A;  3LVK A;  1YJY A;  3FFH A;  4UHN A;  5FT4 A;  1GDE A;  4PIW A;  4UQV A;  3OP7 A;  2Z1Z A;  4OBV A;  1DGE A;  2O0R A;  2YRI A;  1S07 A;  2VIA A;  1BW0 A;  5TF5 A;  2OKK A;  5BJ4 A;  3PGY A;  1FC4 A;  3E6G A;  3L44 A;  2EYQ A;  3MKJ A;  1WYT B;  1SZS A;  1M0N A;  1TAT A;  5DJ1 A;  3PIU A;  4K05 A;  1EQB A;  1KKP A;  1W3U A;  3GJU A;  3W1H A;  5HXX A;  4F4E A;  5G4I A;  2VMZ A;  1LC8 A;  4WXB A;  2HP2 A;  4K2M A;  1U08 A;  2GB3 A;  2BIG A;  2VI9 A;  4WYE A;  3VK2 A;  2GSA A;  1W23 A;  4F5G A;  2E7I A;  2W7K A;  3LWS A;  4A0H A;  1Z7D A;  2W7L A;  3E2Z A;  3NNK A;  2A1V A;  4ZWM A;  4P7Y A;  2W8J A;  2C7T A;  3I5T A;  4ZM4 A;  1ASG A;  3LVJ A;  1MDX A;  2Z67 A;  3MAF B;  2QSR A;  4JEY A;  4TN4 A;  2HOR A;  4OMA A;  4ADC A;  4DGT A;  4EB7 A;  4RAE A;  1JS6 A;  2ZP7 A;  2DKJ A;  1S08 A;  3NYT A;  5G2Q A;  3EI5 A;  5C6U A;  1ARH A;  1AY8 A;  4B9B A;  2YKX A;  2CAN A;  5EUE A;  4BQ0 A;  1G7X A;  2HZP A;  1CZE A;  1E5F A;  1AKB A;  4IXS A;  3AEM A;  3GBX A;  4HF8 A;  3GWP A;  1V72 A;  3KE3 A;  4R2N A;  4ZM3 A;  1M6S A;  4IY7 A;  1CS1 A;  1LKC A;  1GC4 A;  2EGY A;  3E2F A;  3BN1 A;  4Y0H A;  1O4S A;  3BC8 A;  1QJ3 A;  2BI9 A;  3B8X A;  3FVU A;  3WX9 A;  1SPA A;  1QZ9 A;  1B5O A;  3EI6 A;  1I43 A;  3FVS A;  2BI5 A;  4GE7 A;  4TV7 A;  1LW4 A;  4JF0 A;  4DBC A;  2FYF A;  1X28 A;  2HUU A;  2ZJG A;  3HDO A;  4GRX A;  1TPL A;  1X29 A;  4WLJ A;  3HMU A;  2FKI A;  2W7D A;  3ELP A;  1PMO A;  2AEV A;  4H51 A;  3PPL A;  3E9K A;  3FZ8 A;  1H1C A;  3NU7 A;  4MQR A;  4UHM A;  1S06 A;  2OGA A;  4RJY A;  4A00 A;  1M0Q A;  1QIR A;  1DJU A;  4K2B A;  5M49 A;  3B1D A;  3UWC A;  1GBN A;  2W7E A;  3BWN C;  1C7O A;  1N8P A;  1YJS A;  3N0L A;  4M2M A;  2W8W A;  3I4J A;  1DJE A;  2BI2 A;  4Q31 A;  2ZUK A;  4ZWV A;  3GSB A;  1ORD A;  4MGR A;  1YOO A;  2D5Y A;  2W7M A;  4A72 A;  1LC7 A;  2OKJ A;  4M2K A;  4O6Z A;  2VMS A;  4M2J A;  1IAY A;  2D61 A;  2W7G A;  2DOU A;  3PA9 A;  3RQ1 A;  2BKW A;  1IX6 A;  2QA3 A;  2VMX A;  5EQC A;  4UOY A;  1CQ7 A;  1IUG A;  2VGS A;  2Q7W A;  4OBU A;  3PD6 B;  2VMW A;  3JTX A;  4Q76 A;  4CXQ A;  4OT8 A;  4IXZ A;  4XEW A;  3DXW A;  3WKS A;  3B1C A;  3HQT A;  4ZDO A;  3RUY A;  2HOY A;  3NU8 A;  2VMV A;  4H63 Q;  3AEJ C;  2JGT A;  2FN6 A;  2Z9U A;  3LG0 A;  3BV0 A;  5EIG B;  4IX8 A;  2EZ2 A;  1J04 A;  3E77 A;  3ZZK A;  3B46 A;  3FZ6 A;  1QIS A;  1ASM A;  4LNM A;  3TCM A;  3USF A;  2FNU A;  3MEB A;  4OYT A;  2VMQ A;  2RFV A;  3WKR A;  3NTJ A;  4AZJ A;  2VIB A;  3LVM A;  3HBX A;  2X5F A;  4XJM A;  4JEV A;  3DXV A;  4JF1 A;  2W7H A;  2AY2 A;  3R4T A;  1B4X A;  1AAM A;  3NX3 A;  4EB5 A;  5BJ3 A;  1GEY A;  3WZF A;  2QMA A;  1IAX A;  4AH3 A;  3KGW A;  4LW4 A;  3UE8 A;  1BQA A;  2BHX A;  1O61 A;  2AY5 A;  2AY1 A;  3ZRQ A;  3JWA A;  1AMQ A;  1GC2 A;  1X0M A;  4DQ6 A;  5E4Z A;  2EH6 A;  1P3W A;  2AAT A;  2CFB A;  3COG A;  3ASA A;  1YIZ A;  1D7U A;  1AY5 A;  3QPG A;  3AEL A;  1M0O A;  3WGC A;  3Q8N A;  1MAQ A;  4E77 A;  4EU1 A;  3DR4 A;  1AX4 A;  4FL0 A;  4WYC A;  3D6K A;  2ZSL A;  1UKJ A;  1MLY A;  3ATH A;  1WYV B;  2HUF A;  3GZD A;  1ASF A;  2GQN A;  4UHO A;  1OHY A;  2VMP A;  1LW5 A;  2ZYJ A;  3OKS A;  1AAW A;  3AEN B;  4RKD A;  4IYO A;  4XQ2 A;  1WKG A;  4GE4 A;  4AOA A;  3FQ7 A;  2O1B A;  1KAF A;  1AIC A;  4OTL A;  1ASN A;  1AMS A;  2D7Y A;  3EZS A;  3EIB A;  1QIT A;  3FDB A;  1OXP A;  2PB0 A;  1O62 A;  2D65 A;  4RJ0 A;  1JG8 A;  3N5M A;  3MBB A;  2R5C B;  1JF9 A;  3IF2 A;  2AY3 A;  2E7J A;  1IX7 A;  4JEZ A;  4WLH A;  1WYT A;  3W1I A;  2BI3 A;  1PG8 A;  1M0P A;  1ELQ A;  3QBO A;  5LH9 A;  4R5Z A;  3BWO A;  4W8I A;  1KL1 A;  2YKU A;  1M4N A;  3MC6 C;  4J5U A;  1AHX A;  4W5K A;  3HT4 A;  1D7S A;  1DTY A;  3AEM C;  1MLZ A;  4ZDP A;  2AY8 A;  3A8U X;  2VMU A;  5I92 A;  5M46 A;  4Q75 A;  4XJO A;  5DX5 A;  4R5F A;  3TAT A;  4W1X A;  1OAT A;  3DZZ A;  4BA4 A;  2JJH A;  3NUB A;  1DKA A;  2AEU A;  1B9I A;  2XH1 A;  4P3M A;  1ZOD A;  2PB2 A;  1EG5 A;  4A0R A;  4XJL A;  4A0G A;  2W8V A;  3RBL A;  3QN6 A;  1KMJ A;  1AKC A;  4LNL A;  1AIB A;  2XBN A;  2Z9V A;  4ZDL A;  4U1T A;  1GEX A;  4LC3 A;  1G4V A;  3MAF A;  2CB1 A;  4LW2 A;  4ADB A;  2Z9X A;  3BCB A;  2JIS A;  2VGU A;  1MGV A;  3VOM A;  4N0W A;  2OAT A;  2AY4 A;  5EUN A;  3JZL A;  1W7N A;  2OGE A;  1ASA A;  2D63 A;  3FD0 A;  2VI8 A;  4MKK A;  4N0B A;  1J32 A;  3DU4 A;  1OXO A;  3WY7 A;  1D2F A;  1ARG A;  2W8U A;  2ZY2 A;  4WD2 A;  1B9H A;  1C0N A;  4JEX A;  5EAV A;  2YKY A;  4A6U A;  4F5F A;  3MAD A;  1RV3 A;  1JS3 A;  2CIN A;  3N4R A;  5EFS A;  1ARI A;  1VJO A;  2EO5 A;  2O7C A;  2CY8 A;  2R5E A;  3ISL A;  3HL2 A;  3TFU A;  1AHY A;  5G09 A;  3ASB A;  4A6R A;  3PJ0 A;  4WB0 B;  2VLH A;  3P6K A;  2CJD A;  4WYG A;  1SFF A;  2R2N A;  3CAI A;  3VK3 A;  3AEO A;  2W7J A;  4U2H A;  1IVR A;  3EIA A;  2GMS A;  2VYC A;  3JU7 A;  3W1J A;  4I8A A;  1X2A A;  1QJ5 A;  4BA5 A;  2R0T A;  4ZLV A;  2CH2 A;  2DGM A;  4WXG A;  3EZ1 A;  5G0A A;  2W8T A;  3M5U A;  2Z1Y A;  3MAU A;  2BIA A;  1BJO B;  2JJF A;  1MAP A;  2EPJ A;  2VMR A;  1CZC A;  3BB8 A;  1CJ0 A;  1V2D A;  4OCA A;  4RKC A;  2GMU A;  4ATP A;  4CXR A;  1WKH A;  2G6W A;  1M32 A;  3RCH B;  4Q6R A;  4E1O A;  3F9T A;  3ELE A;  2AY9 A;  1YJZ A;  1O69 A;  3VP6 A; 
#chains in the Genus database with same CATH homology
 4RLG A;  2YCP A;  4JE5 D;  3A9Y A;  1I41 A;  4HVK A;  1ELU A;  2AY6 A;  2V1P A;  1BKG A;  2VMT A;  4AZK A;  3WLX A;  2BWO A;  3PDB B;  3R9A A;  3PD6 A;  1DGD A;  1G7W A;  1N2T A;  3BCX A;  3II0 A;  4NOG A;  1G4X A;  2C44 A;  2BWP A;  2VGT A;  4CVQ A;  1ZC9 A;  2QLR A;  3N75 A;  2QB2 A;  3BWN A;  3QHX A;  4FFC A;  3H9X A;  1ART A;  1KMK A;  4ADD A;  3FQ8 A;  5DB5 A;  4WYF A;  3ZRP A;  4B98 A;  1LS3 A;  5EIG A;  2DKB A;  3FVX A;  1KKJ A;  5K8B A;  1Z3Z A;  3I16 A;  3NDN A;  4ITG A;  1M7Y A;  1AHE A;  3CQ5 A;  1XI9 A;  2CTZ A;  1ZOB A;  3GZD C;  4WYD A;  1GC0 A;  2WB6 A;  2CST A;  2DGK A;  3EUC A;  3FZ7 A;  5M4B A;  1BJN A;  1WYU B;  4F5H A;  1UU1 A;  1W7L A;  1GCK A;  1AJS B;  1T3I A;  4MY5 A;  4TMR A;  2DGL A;  4WP0 A;  1B8G A;  4W1V A;  5LHA A;  3QI6 A;  1FG7 A;  3GR9 A;  2HOZ A;  3CBF A;  3BCA A;  4RIZ A;  2VLF A;  1ASD A;  1ECX A;  2VMO A;  5F9S A;  1YAA A;  1BJW A;  2BYL A;  2F8J A;  4BHD A;  3PDX A;  2HOX A;  4KAM A;  3LY1 A;  4R8D A;  7AAT A;  1C7N A;  2YCT A;  3DC1 A;  4KXK A;  4RIT A;  1AMR A;  2D7Z A;  2OQX A;  5IWQ A;  1YNU A;  3G7Q A;  1V2F A;  1V2E A;  3F0H A;  2WK9 A;  5FT5 A;  5AX8 A;  4AO4 A;  3HLM A;  3A2B A;  1WYV A;  4ZSY A;  1SZU A;  3LV2 A;  4Y0I A;  3KKI A;  2CH1 A;  1TAS A;  4L0O A;  3AEN A;  1TOG A;  3N4X A;  1BS0 A;  3ACZ A;  3FQA A;  3E2Z B;  4QGR A;  4XJP A;  5M4D A;  1GD9 A;  2V0Y A;  2WK7 A;  3A9X A;  2X3L A;  3BS8 A;  2YKV A;  2CJH A;  2QB3 A;  5EAA A;  4F5K A;  4JEW A;  2PO3 A;  1C9C A;  3E2Y A;  4PVF A;  3FDD A;  3N7N A;  2VMN A;  2EZ1 A;  5D95 A;  4OC9 A;  1D7R A;  3JW9 A;  2ZY3 A;  3GZC A;  2YRR A;  1TOJ A;  3WCN A;  3RBF A;  3P1T A;  3H14 A;  2BYJ A;  4JE5 A;  3FRK A;  3NYU A;  3DYD A;  1AHG A;  1CQ8 A;  2R5C A;  1UU0 A;  3NUI A;  2E7U A;  5D5S A;  1B5P A;  5F8V A;  1QGN A;  1Y4I A;  4ZAS A;  4W1W A;  1BJ4 A;  4RM1 A;  1TOI A;  2FM1 A;  2NMP A;  3G8M A;  8AAT A;  3FFR A;  4MKJ A;  1OHW A;  5HDM A;  2D64 A;  3F6T A;  3H7F A;  3IHJ A;  4F5M A;  2BIE A;  1IJI A;  1S09 A;  2VGZ A;  1W7M A;  1S0A A;  4F5I A;  4ZAH A;  5EUD A;  2ZC0 A;  3AAT A;  4BMK A;  1VP4 A;  3T32 A;  1ASC A;  1N31 A;  3FSL A;  5G4J A;  1H0C A;  2YOB A;  3B1E A;  3FKD A;  3TFT A;  3AOV A;  3MC6 A;  1SF2 A;  1AKA A;  3WCO A;  4EMY A;  1AJR A;  3CQ4 A;  3ECD A;  3NRA A;  3GET A;  5HHY A;  1FG3 A;  2AY7 A;  1RVU A;  4WYA A;  4E3R A;  2CJG A;  3CQ6 A;  4EFF A;  4PFF A;  9AAT A;  4W91 A;  2WK8 A;  2G7J A;  1LK9 A;  4MSO A;  3DRD A;  1GC3 A;  4ADE A;  1SVV A;  1SZK A;  4A6T A;  4AO9 A;  5E3K A;  4GDY A;  5E5I A;  1AMA A;  3DOD A;  3L8A A;  2C81 A;  3QM2 A;  4F5J A;  3HVY A;  2HUI A;  1ASB A;  1ASE A;  3LVL B;  4ZSW A;  2KFP A;  1RV4 A;  3KGX A;  4IW7 A;  2Z9W A;  4ISY A;  1CL1 A;  1VEF A;  5FT6 A;  2YCN A;  2X8U A;  4A0F A;  2HP1 A;  4WB0 A;  1AY4 A;  4E3Q A;  2VMY A;  4CBR A;  1KL2 A;  2BWN A;  3AEP A;  5DJ9 A;  2ZY4 A;  4GEB A;  3EI8 A;  4Y0D A;  5J8Q A;  2ZY5 A;  2DR1 A;  1CL2 A;  1BT4 A;  2D66 A;  3VK4 A;  4PFN A;  1GEW A;  3N4S A;  2FNI A;  3ZZJ A;  3EI9 A;  1BJO A;  2Z20 A;  3K28 A;  3VAX A;  2VGV A;  1I29 A;  5FT8 A;  2YHK A;  2BI1 A;  4XK1 A;  1AHF A;  3NYS A;  1C4K A;  3RCH A;  2W7F A;  3WGB A;  1LC5 A;  1DFO A;  3EI7 A;  2WKA A;  1TAR A;  4MQP A;  4LNJ A;  3ZRR A;  5G2P A;  1ARS A;  4XAU A;  4ITX A;  3A9Z A;  1IX8 A;  3AOW A;  1XEY A;  2TPL A;  1D7V A;  1I48 A;  1MDO A;  4IXO A;  2C0R A;  1OHV A;  2QBT A;  2VGW A;  3PDB A;  3K7Y A;  4KYO A;  3DR7 A;  3K40 A;  3QGU A;  3RI6 A;  1CQ6 A;  2W7I A;  1AIA A;  1DJ9 A;  1IBJ A;  1TOE A;  2ZSM A;  2JG2 A;  4J8L A;  3AEJ A;  4F5L A;  5KTB A;  1PFF A;  1TOK A;  1C7G A;  3PAA A;  3JWB A;  4K2I A;  4CBS A;  4MQQ A;  1YIY A;  3AV7 A;  3TQX A;  4WXF A;  1MDZ A;  4ATQ A;  2X5D A;  3UAK A;  2Z61 A;  3FTB A;  1ASL A;  3FCR A;  2ORD A;  4GSA A;  1RVY A;  4IYO B;  2E54 A;  4WBT A;  1UU2 A;  2JJG A;  1WYU A;  1WST A;  1AJS A;  2FQ6 A;  1EJI A;  1PMM A;  5JAY A;  1BQD A;  2JJE A;  4GE9 A;  3G0T A;  1E5E A;  3LVK A;  1YJY A;  3FFH A;  4UHN A;  5FT4 A;  1GDE A;  4PIW A;  4UQV A;  3OP7 A;  2Z1Z A;  4OBV A;  1DGE A;  2O0R A;  2YRI A;  1S07 A;  2VIA A;  1BW0 A;  5TF5 A;  2OKK A;  5BJ4 A;  3PGY A;  1FC4 A;  3E6G A;  3L44 A;  2EYQ A;  3MKJ A;  1WYT B;  1SZS A;  1M0N A;  1TAT A;  5DJ1 A;  3PIU A;  4K05 A;  1EQB A;  1KKP A;  1W3U A;  3GJU A;  3W1H A;  5HXX A;  4F4E A;  5G4I A;  2VMZ A;  1LC8 A;  4WXB A;  2HP2 A;  4K2M A;  1U08 A;  2GB3 A;  2BIG A;  2VI9 A;  4WYE A;  3VK2 A;  2GSA A;  1W23 A;  4F5G A;  2E7I A;  2W7K A;  3LWS A;  4A0H A;  1Z7D A;  2W7L A;  3E2Z A;  3NNK A;  2A1V A;  4ZWM A;  4P7Y A;  2W8J A;  2C7T A;  3I5T A;  4ZM4 A;  1ASG A;  3LVJ A;  1MDX A;  2Z67 A;  3MAF B;  2QSR A;  4JEY A;  4TN4 A;  2HOR A;  4OMA A;  4ADC A;  4DGT A;  4EB7 A;  4RAE A;  1JS6 A;  2ZP7 A;  2DKJ A;  1S08 A;  3NYT A;  5G2Q A;  3EI5 A;  5C6U A;  1ARH A;  1AY8 A;  4B9B A;  2YKX A;  2CAN A;  5EUE A;  4BQ0 A;  1G7X A;  2HZP A;  1CZE A;  1E5F A;  1AKB A;  4IXS A;  3AEM A;  3GBX A;  4HF8 A;  3GWP A;  1V72 A;  3KE3 A;  4R2N A;  4ZM3 A;  1M6S A;  4IY7 A;  1CS1 A;  1LKC A;  1GC4 A;  2EGY A;  3E2F A;  3BN1 A;  4Y0H A;  1O4S A;  3BC8 A;  1QJ3 A;  2BI9 A;  3B8X A;  3FVU A;  3WX9 A;  1SPA A;  1QZ9 A;  1B5O A;  3EI6 A;  1I43 A;  3FVS A;  2BI5 A;  4GE7 A;  4TV7 A;  1LW4 A;  4JF0 A;  4DBC A;  2FYF A;  1X28 A;  2HUU A;  2ZJG A;  3HDO A;  4GRX A;  1TPL A;  1X29 A;  4WLJ A;  3HMU A;  2FKI A;  2W7D A;  3ELP A;  1PMO A;  2AEV A;  4H51 A;  3PPL A;  3E9K A;  3FZ8 A;  1H1C A;  3NU7 A;  4MQR A;  4UHM A;  1S06 A;  2OGA A;  4RJY A;  4A00 A;  1M0Q A;  1QIR A;  1DJU A;  4K2B A;  5M49 A;  3B1D A;  3UWC A;  1GBN A;  2W7E A;  3BWN C;  1C7O A;  1N8P A;  1YJS A;  3N0L A;  4M2M A;  2W8W A;  3I4J A;  1DJE A;  2BI2 A;  4Q31 A;  2ZUK A;  4ZWV A;  3GSB A;  1ORD A;  4MGR A;  1YOO A;  2D5Y A;  2W7M A;  4A72 A;  1LC7 A;  2OKJ A;  4M2K A;  4O6Z A;  2VMS A;  4M2J A;  1IAY A;  2D61 A;  2W7G A;  2DOU A;  3PA9 A;  3RQ1 A;  2BKW A;  1IX6 A;  2QA3 A;  2VMX A;  5EQC A;  4UOY A;  1CQ7 A;  1IUG A;  2VGS A;  2Q7W A;  4OBU A;  3PD6 B;  2VMW A;  3JTX A;  4Q76 A;  4CXQ A;  4OT8 A;  4IXZ A;  4XEW A;  3DXW A;  3WKS A;  3B1C A;  3HQT A;  4ZDO A;  3RUY A;  2HOY A;  3NU8 A;  2VMV A;  4H63 Q;  3AEJ C;  2JGT A;  2FN6 A;  2Z9U A;  3LG0 A;  3BV0 A;  5EIG B;  4IX8 A;  2EZ2 A;  1J04 A;  3E77 A;  3ZZK A;  3B46 A;  3FZ6 A;  1QIS A;  1ASM A;  4LNM A;  3TCM A;  3USF A;  2FNU A;  3MEB A;  4OYT A;  2VMQ A;  2RFV A;  3WKR A;  3NTJ A;  4AZJ A;  2VIB A;  3LVM A;  3HBX A;  2X5F A;  4XJM A;  4JEV A;  3DXV A;  4JF1 A;  2W7H A;  2AY2 A;  3R4T A;  1B4X A;  1AAM A;  3NX3 A;  4EB5 A;  5BJ3 A;  1GEY A;  3WZF A;  2QMA A;  1IAX A;  4AH3 A;  3KGW A;  4LW4 A;  3UE8 A;  1BQA A;  2BHX A;  1O61 A;  2AY5 A;  2AY1 A;  3ZRQ A;  3JWA A;  1AMQ A;  1GC2 A;  1X0M A;  4DQ6 A;  5E4Z A;  2EH6 A;  1P3W A;  2AAT A;  2CFB A;  3COG A;  3ASA A;  1YIZ A;  1D7U A;  1AY5 A;  3QPG A;  3AEL A;  1M0O A;  3WGC A;  3Q8N A;  1MAQ A;  4E77 A;  4EU1 A;  3DR4 A;  1AX4 A;  4FL0 A;  4WYC A;  3D6K A;  2ZSL A;  1UKJ A;  1MLY A;  3ATH A;  1WYV B;  2HUF A;  3GZD A;  1ASF A;  2GQN A;  4UHO A;  1OHY A;  2VMP A;  1LW5 A;  2ZYJ A;  3OKS A;  1AAW A;  3AEN B;  4RKD A;  4IYO A;  4XQ2 A;  1WKG A;  4GE4 A;  4AOA A;  3FQ7 A;  2O1B A;  1AIC A;  4OTL A;  1ASN A;  1AMS A;  2D7Y A;  3EZS A;  3EIB A;  1QIT A;  3FDB A;  1OXP A;  2PB0 A;  1O62 A;  2D65 A;  4RJ0 A;  1JG8 A;  3N5M A;  3MBB A;  2R5C B;  1JF9 A;  3IF2 A;  2AY3 A;  2E7J A;  1IX7 A;  4JEZ A;  4WLH A;  1WYT A;  3W1I A;  2BI3 A;  1PG8 A;  1M0P A;  1ELQ A;  3QBO A;  5LH9 A;  4R5Z A;  3BWO A;  4W8I A;  1KL1 A;  2YKU A;  1M4N A;  3MC6 C;  4J5U A;  1AHX A;  4W5K A;  3HT4 A;  1D7S A;  1DTY A;  3AEM C;  1MLZ A;  4ZDP A;  2AY8 A;  3A8U X;  2VMU A;  5I92 A;  5M46 A;  4Q75 A;  4XJO A;  5DX5 A;  4R5F A;  3TAT A;  4W1X A;  1OAT A;  3DZZ A;  4BA4 A;  2JJH A;  3NUB A;  1DKA A;  2AEU A;  1B9I A;  2XH1 A;  4P3M A;  1ZOD A;  2PB2 A;  1EG5 A;  4A0R A;  4XJL A;  4A0G A;  2W8V A;  3RBL A;  3QN6 A;  1KMJ A;  1AKC A;  4LNL A;  1AIB A;  2XBN A;  2Z9V A;  4ZDL A;  4U1T A;  1GEX A;  4LC3 A;  1G4V A;  3MAF A;  2CB1 A;  4LW2 A;  4ADB A;  2Z9X A;  3BCB A;  2JIS A;  2VGU A;  1MGV A;  3VOM A;  4N0W A;  2OAT A;  2AY4 A;  5EUN A;  3JZL A;  1W7N A;  2OGE A;  1ASA A;  2D63 A;  3FD0 A;  2VI8 A;  4MKK A;  4N0B A;  1J32 A;  3DU4 A;  1OXO A;  3WY7 A;  1D2F A;  1ARG A;  2W8U A;  2ZY2 A;  4WD2 A;  1B9H A;  1C0N A;  4JEX A;  5EAV A;  2YKY A;  4A6U A;  4F5F A;  3MAD A;  1RV3 A;  1JS3 A;  2CIN A;  3N4R A;  5EFS A;  1ARI A;  1VJO A;  2EO5 A;  2O7C A;  2CY8 A;  2R5E A;  3ISL A;  3HL2 A;  3TFU A;  1AHY A;  5G09 A;  3ASB A;  4A6R A;  3PJ0 A;  4WB0 B;  2VLH A;  3P6K A;  2CJD A;  4WYG A;  1SFF A;  2R2N A;  3CAI A;  3VK3 A;  3AEO A;  2W7J A;  4U2H A;  1IVR A;  3EIA A;  2GMS A;  2VYC A;  3JU7 A;  3W1J A;  4I8A A;  1X2A A;  1QJ5 A;  4BA5 A;  2R0T A;  4ZLV A;  2CH2 A;  2DGM A;  4WXG A;  3EZ1 A;  5G0A A;  2W8T A;  3M5U A;  2Z1Y A;  3MAU A;  2BIA A;  1BJO B;  2JJF A;  1MAP A;  2EPJ A;  2VMR A;  1CZC A;  3BB8 A;  1CJ0 A;  1V2D A;  4OCA A;  4RKC A;  2GMU A;  4ATP A;  4CXR A;  1WKH A;  2G6W A;  1M32 A;  3RCH B;  4Q6R A;  4E1O A;  3F9T A;  3ELE A;  2AY9 A;  1YJZ A;  1O69 A;  3VP6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...