3QPWA

Pfkfb3 in complex with aluminum tetrafluoride
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
437
structure length
431
Chain Sequence
b'ELTQSRVQKIWVPVDHRPSLPRSNSPTVIVMVGLPARGKTYISKKLTRYLNWIGVPTKVFNVGEYRREAVKQYSSYNFFRPDNEEAMKVRKQCALAALRDVKSYLAKEGGQIAVFDATNTTRERRHMILHFAKENDFKAFFIESVCDDPTVVASNIMEVKISSPDYKDCNSAEAMDDFMKRISCYEASYQPLDPDKCDRDLSLIKVIDVGRRFLVNRVQDHIQSRIVYYLMNIHVQPRTIYLCRHGENEHNLQGRIGGDSGLSSRGKKFASALSKFVEEQNLKDLRVWTSQLKSTIQTAEALRLPYEQWKALNEIDAGVCEELTYEEIRDTYPEEYALREQDKYYYRYPTGESYQDLVQRLEPVIMELERQENVLVICHQAVLRCLLAYFLDKSAEEMPYLKCPLHTVLKLTPVAYGCRVESIYLNVESVC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3
publication title Molecular basis of the fructose-2,6-bisphosphatase reaction of PFKFB3: Transition state and the C-terminal function.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase,hydrolase
total genus 154
structure length 431
sequence length 437
ec nomenclature ec 2.7.1.105: 6-phosphofructo-2-kinase.
pdb deposition date 2011-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1)
A PF01591 6PF2K 6-phosphofructo-2-kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3qpwA01
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 3qpwA02
2ZSAA 2GRJA 1LS6A 1Q12A 2YKGA 4IJ6A 3BH0A 1H8HA 2PT5A 3DOEA 5TARA 4E22A 4V0LA 1ZM9A 4TMZA 4PQYA 3M0EA 5HCIA 2VTKA 3WNCA 1H2FA 3WMFA 2CCGA 3LW7A 1ZUIA 2HIAA 2O0HA 4OI4A 3AQ4A 3Q5EA 3KQKA 3LBNA 2O8CB 3TUIC 4BEJA 3K4PA 1RPZA 5JJLA 3C5HA 3BK7A 3MMPA 2N46A 4GZLA 3OAAD 1XTIA 2R6DA 2H4XA 2W0SA 3GCGA 4D0LB 3IEVA 4LJ5A 2QY9A 1QZXA 2JLZA 3B78A 3R8FA 4EQ6B 2QG6A 4EJSB 4CF7A 2BOVA 3ZIAD 1G7RA 3GLIB 3IBGA 1KJYA 1NN3A 3NIBA 3TBKA 3I4LA 5JHHB 5A5GA 2D3WA 3KZ1E 2BBWA 5LDDC 1P61B 4LGMA 5CIQA 1M1YE 3GLFB 4TTPA 1OIVA 3NC1C 1OT3A 1QHGA 1JAIA 2EWWA 4ARSA 1BMFA 2WOOA 1FW6A 1E2LA 5C4GB 5F9HA 2DYKA 1ZINA 5KDLA 2FFBA 2RGCA 3B1WA 1G7SA 3QKRA 2XOKD 4UNNA 4LPKA 4JSTA 2CCJA 5LB2A 2EFHB 1W4AA 5EP4A 1AK2A 2P9ZA 2FX3A 4LC1A 5FBVB 3FMOB 1KKMA 1WDTA 3U60B 3CNLA 2JDIA 1EESA 1DVRA 4JLVA 4EDHA 4GOXA 3HYTA 2GJSA 3GJ3A 3AVOA 3LVQE 4V0KA 3HPQA 1YJXA 2QMEA 3I3SR 1I4DD 4HAUA 5B30A 5H68A 2DWPA 2QM7A 2VP6A 2WJVA 5CJPA 5G53C 3BIFA 1OIWA 2DWOA 1E2MA 2ZJBA 2AFIE 1RRCA 1DKPA 5HTKA 4B48A 1AQUA 5TV2A 2PL3A 4AYTA 4AKIA 2BC9A 4URUR 1L7VC 1OF1A 4NCKA 1ZCAA 1Z47A 2H92A 1M7BA 4KFTA 4XJXA 3GW8A 1CR0A 4IFEA 5E7IA 2GTPA 2IHYA 1SVKA 3LBIA 4YDSA 1C7ZA 2GFIA 4LJ6A 3WHLA 4BQSA 4LBWA 2NZ8A 1F60A 3TAHA 2ONJA 4IHQA 3L0IB 5HCNA 3KXLA 4B76A 1CJKC 3BD9A 2H8KA 2OWEA 3B60A 3KQUA 1Z6AA 3LXXA 4GOJA 1ZM4A 3ND9A 4AC9A 3VU9B 3RYTC 1IQPA 5D3MB 1CTQA 1Q0UA 5JCPA 1GL7A 2HCBA 3F2IA 5IK2A 4PO8A 1ZMXA 4NONA 3T12A 4HSEA 1XEXB 3U6KA 3VR1A 4GMDA 5L3QA 3DKPA 2HLDD 2V6IA 4BRWA 5DHAA 4Z54A 3KTAA 3AKCA 3DB1A 3UPUA 2QTVB 1X6VA 3PQCA 3TH5A 2BEKA 5FR2A 1VKJA 2QM8A 4ARZA 2QA5A 1XEFA 2PH1A 3A1VA 4OJQA 4Q18A 2IXEA 4BFZA 4PHHA 3SYNA 3FDZB 2YWEA 2JLWA 1UF9A 1R4AA 2XNDA 3CZPA 1G3RA 3X1DA 4AG6A 1HUQA 1LW7A 2IL1A 4IKEA 4P31A 2ZM5A 2GF9A 3ICQB 1OFTA 4MUBA 1QHYA 4OI2A 4U7DA 2B21A 2E1RA 1NN1A 1ZNWA 4E3WA 1UAAA 3OE7D 4BEBA 1MRNA 1W2HA 1XNJA 4TQ9A 1E2NA 2ERXA 4M1TA 5HZKA 2HF9A 4NH0A 1S3SA 4BLRA 2CK3A 1IONA 2HYDA 1II0A 3NVAA 2C9CA 4G0NA 2JDID 2X19A 4Q5IA 4Q02A 1SVMA 2C9YA 4L9SA 4KXFB 2JLRA 3I72A 1MABA 4GT1A 4A0GA 1SKYE 3P20A 3U3KA 2EKZA 1KMHA 2ENUA 4IFBA 1SULA 4TT3A 2H5EA 3EC2A 2WWIA 5EP1A 4Q4HA 4G5QA 4CVNA 3WNBA 4H1UA 2OCPA 3AVUA 1XFAA 5EXSA 5DIFA 1JBKA 3CPEA 1VIYA 3H1TA 1VCNA 3FDIA 2PMKA 2VSOA 4R2IA 3O0TA 5B58C 3IHLA 3WRYC 4G5SA 5A0FA 1NIPA 3IQWA 1E2QA 2R65A 3SJCA 1DELA 3U4QB 1QHFA 2ZSDA 2OLJA 3F8TA 4DC9A 2RHMA 1G18A 2ZTSA 3EZNA 1Z0JA 1J8MF 4JLJA 5HPYB 3EXAA 2WWYA 2VHCA 521PA 5K8LA 1GFIA 1SXJE 1EFTA 3N2EA 5IK2D 1NN0A 2N1BA 1DKOA 2WU0A 3EOZA 1IXSB 1E79D 2VP9A 3T1OA 4O2RA 2HXSA 2O8DA 4DEXA 1T4GA 4KLNA 4PAOA 2XX3A 2FMXA 1P3JA 1VIAA 1GDDA 4ITRC 1I2DA 3LX8A 2XXAA 5J4HA 3LG2A 2V8OA 1B0UA 1KZ7B 3FYHA 2VP0A 1KO7A 5CLQA 2CHQA 1EFRA 3BXZA 4IOJA 4OHVA 1XEWX 1MO3A 1JECA 2CLCX 3UWOA 4DJTA 2YHSA 3P4XA 2OESA 3IILA 3JZMA 4LJAA 1LTQA 1NF3A 4LPSA 4MH0R 3SFZA 4YONB 3ZZTA 4PPQA 3NFYA 4BFYA 2OSBA 2A3RA 3KB1A 1UPTA 1K5GA 3AKEA 5AUNB 2C5LA 2G3YA 2FEOA 4V03A 1XDBA 1CJMA 2WVJA 2CK3D 5DO9A 1IN4A 1LVGA 1TX4B 2IXGA 3T35A 1PV4A 4XVUA 2QQEA 4BLOA 3B1ZA 4TMVA 4LUCA 4A2PA 3QJYA 2AL7A 4HB0A 4RD3A 1LNZA 4FMBB 1G7TA 3BH7A 1ODFA 4JJKA 2CHGA 1EXMA 1KOFA 2OCYC 2GBLA 2ZRPA 4TTRA 4ZCIA 1AA9A 1IY2A 1P9WA 1OPXA 1AKYA 4CYMA 1K8RA 3O8DA 4Z1MD 3H86A 2QE7D 1BYUA 1Q20A 2GETA 3RDPA 1XJCA 1GWNA 2C78A 4DLYA 2E87A 3CRMA 4PQFA 2FSHA 5DLQC 4JL6A 3K0FB 3RNLA 4M9QA 3OFND 1VCIA 2C04A 4B3DA 1H8ED 4C0HA 3H4MA 2NPFA 2NPIA 1BKDR 4ARVA 1Q3TA 1RKBA 2ZI6A 3LVRE 2LCFA 3I73A 1EFHA 4Q4JA 3A37A 2WMNB 1D6JA 4QHSA 1R6BX 3SE0A 3HWSA 4B75A 1N5JA 4OHYA 4JYBA 3BRWD 2G9NA 2ZR0A 2QAJA 1N6LA 1OKKD 4F7WA 2EOAA 2EU8A 2FN4A 4PO9A 3W8RA 3S1AA 2ZANA 1XP8A 2IS4A 3GP8A 1TQ2A 3SYKA 1F2TA 4LBVA 4LHXA 3D8BA 4CT4B 4BRUA 1YRBA 3C41J 3ZGXA 5DI3B 3K70B 4M1MA 3SC3A 3G0HA 1IOZA 1OSNA 5AJXA 1EWRA 2Y8EA 2DBYA 2QT1A 1KSJA 4WAUA 2QRZA 2EFEB 4M9ZA 4MKGA 2MSDB 4AD8A 3LNCA 3TNFA 3M6AA 3QUSA 5FBRB 1N0UA 1E9BA 3CPHA 3NG1A 4BFTA 4EQ6A 3PGMA 1KK1A 5LB4A 1ZNYA 1LY1A 5JFGA 3AF3A 2JLVA 4XH9B 4ACAA 3NBZC 4B3XA 4ZI2A 2J87A 4MYTA 1II9A 3RABA 4B35A 2BV3A 3UMSA 4AKEA 3BC1A 4FDTA 4IVRA 2W00A 2GDJA 1PLLA 2CVFA 2P0EA 1VTKA 2WMOB 3JVUA 1EX7A 1VG9B 1GNRA 1Z2AA 4FWIB 4G5OA 2W6JA 3HYRA 3QNUA 3QXHA 2ZRAA 1US8B 3EPLA 2QL6A 1W0KA 2WWGA 4PPFA 4US2R 2VHQA 3DHWC 4G1UC 3C5CA 3IKJA 1U9IA 4Q9IA 3VR3A 4JYCA 1SKBA 5FTNA 2B8WA 3QXJA 4GOKA 2ZUCA 1ZD8A 2WPDA 5CYOA 5CDFE 2FPLA 4AKGA 3I92A 5G3YA 3QF4A 4O2LA 4ODIA 3RRZA 1O87A 2WJIA 4KAXA 3GP5A 1IHPA 1UKEA 4NZYA 1GIAA 2GNOA 3AVQA 3ZYCA 3ZVMA 1KO1A 3LXRA 5C4MA 1E1RA 2IWRA 5KDDA 2WV9A 4JT2A 1LB1B 1MOZA 1S4QA 2P77A 3LFUA 3U3OA 3ND8A 3OHMA 2I4IA 1T0JB 1E1QD 3GJ6A 1C9KA 1D2NA 3GMTA 3QPWA 2NZJA 4LJ4A 1GAJA 5FTKA 1C1YA 4RCZA 4R7ZA 3D8HA 3MRSA 3TUJC 4POAA 1XCMA 3IO5A 1W46A 2CEAA 2ZI3A 3O47A 4LYFA 3SFVA 5KNDA 1JI0A 2PMDA 4M1KA 3MD0A 3E9CA 2Z5FA 2ZPTX 4ZIRA 2KJQA 4KU4A 3LL4A 1YZKA 2H57A 2ZRCA 5AR1A 3U6BA 2IHBA 2IYVA 4HEJA 3HDTA 2B6HA 1IHUA 4RVCA 3OF5A 1E2PA 1XEXA 3MGCA 1E2EA 1UJBA 5EZ5A 1FX0B 4Y0VA 4C3ZA 1X1RA 3C8UA 3IIMA 4LBZA 4A6PA 1I2MA 4D82A 1P9RA 1ZBDA 3TK1A 1G19A 1L4UA 2OILA 5L3SB 3QI2A 3SS8A 2WZQA 4C30A 1YR8A 1QFXA 4R98A 4RZ3A 4PZZA 1FTNA 3A6PC 2YZ2A 3L82B 1OLOA 4FXPA 3THYB 4A8JA 1G8FA 1YVDA 4MKIA 3FDZA 2ZR7A 1G8GA 4TN1A 1G64A 2XAUA 1XTKA 3TRFA 3REGA 1NSFA 3QBTA 1E0KA 2IYRA 1FP6A 4L9WA 5DYGA 1J99A 4TMTA 1II8B 3K8YA 4XWAA 4Z8YA 2Z6VA 4CIDA 1P2VA 1N6PA 1YRAA 1GRQA 3K0AB 4OHXA 3RLFA 1VYVA 3T15A 1T8TA 4NCIA 1KGDA 3RWOA 1VPLA 1QHHA 3AUYA 4IDNA 2JA1A 1Z07A 3KJGA 1RIFA 3LV8A 4TQUS 2JATA 1Q1ZA 2WWXA 3QKUA 3W3ZB 1HQCA 3QENA 4TL7A 3LX5A 3EC1A 2ZRBA 4U02A 4DIDA 3GJ4A 1PZNA 2A5GA 2ZYVX 3QXXA 5B2ZA 3R7AA 2F55A 3FKSD 3CZQA 2F43A 4UXIA 3RC8A 2GJ9A 1RJ9B 2ANCA 2EFCB 1GUAA 1E1RD 3AVXA 4D80A 2CHVA 3SU8A 2O0KA 3AVPA 4URXR 1DE0A 3BGWA 4QBFA 1TEXA 2Q3FA 3EIEA 1RC8A 2FWRA 2O8BA 1KI6B 3VHLB 1GKUB 2YWGA 5JEDA 4LJ7A 1K5DA 4NBSA 4C0BA 5GJVC 1CXZA 1KDPA 3EPHA 1R5NA 2XJ9A 3HU1A 4I1SA 5E95A 2ODBA 4YXWA 5KSPA 3B7GA 2HV8A 1OJLA 3U4QA 2PZFA 3ADBA 1X8JA 3BE4A 5FPHA 4GZMA 1SXJA 1WA5A 4XSGA 3MJRA 1NMYA 2ZS8A 2ZRGA 1AKEA 4NYJR 2F7SA 3IPXA 2ZSBA 1VG8A 1H65A 2MMGA 1DAKA 2BM0A 3CH5A 3RVBA 4US0R 1W2GA 4CEIB 1WMSA 4BFXA 4A4DA 4RFVA 5JZVA 2WJJA 1IBRA 5AJZA 1ZAKA 3Q7PA 1RRGA 3RWMB 3AKDA 1GITA 3MWJA 2ORIA 3CRRA 1D2MA 3CWZA 3Q5DA 4OQMA 1M34E 1XX6A 1UKYA 3AH8A 4FMDF 4KODA 4LV6A 5SZJA 2J7PA 1Z0KA 1WE2A 3CBQA 3KKKA 2EVWX 1KSGA 2C96A 2QP4A 1KDRA 2R6FA 2P6OA 2YOHA 1CRQA 1J7KA 4B47A 1IXRC 2ZRLA 3DZDA 3M4YA 2PZGA 2G0TA 4CEHB 5L3RA 3CH4B 5AWFC 3VR5A 3ZS8A 2G6BA 4BFSA 4QJ3A 5KO2A 3U44A 1D5CA 3N5CA 3VX4A 3H84A 5JBQA 4KV9A 4ZI3A 2NQ2C 5TXGA 4KHZA 2EFDB 2YNMA 1OHHD 5B64A 3KQNA 1VHLA 3PV0A 3TGPA 1G7CA 3WBKA 1GNPA 5JHGB 5LBIA 4PZLA 2FPKA 2RKOA 2R62A 3UKDA 1AIPA 4MRPA 1HT2E 3T06B 3X1XA 2QGZA 3SZRA 3X1ZA 2IYTA 3KKOA 4YQFA 2J0SA 1ND5A 5F98A 1KO5A 4MGYR 1DO2A 4NU0A 4BFVA 3NTUA 2A7QA 3IBYA 3K0FA 4E03A 4NL4H 3WYGA 5JWHA 4YLGA 2WJGA 4ZKEA 1ZD1A 4P4SB 2FV8A 3DVLA 1ELOA 3QXSA 2ZU0C 1NSTA 2RGDA 2QTHA 4H1VA 1XXHB 2NO6A 3F0TA 4BLSA 1RRPA 4XSHA 4EUNA 3ICEA 3BBPA 2FPMA 1L4YA 1G3MA 2HPAA 2P9FA 1XXHE 3CX6A 3AP1A 2J0UB 1GKIA 4HI0E 4DCUA 2F6RA 4EPYA 1XZPA 3FHCB 2RCNA 1OH7A 1ZIOA 1KDOA 2XZLA 3A58B 3AGQA 1JR3E 4V0OA 1NBME 1OH8A 4OYHA 2CNWA 2GAAA 2IYSA 1XTQA 3LY5A 1RPTA 1E0SA 2ZYUX 4TLEA 4AROA 3TMKA 4A0RA 3FFBA 821PA 2Q21A 1NLYA 3NH9A 1KI1A 2QENA 2WSMA 3O8BA 4WW0A 5CU7A 4YMSA 2F9LA 2J7PD 4PXAA 2QORA 3TAUA 1NKSA 4DLTA 1NY5A 4TSFD 2QPOA 1TU3A 5E7JA 2W6ID 2ODEA 4N1AA 4W5JA 1XPUA 5KHOC 4BFWA 1QG4A 1WBBA 4P4TA 4FD2A 3WXMA 2EFGA 4NYMR 4WA7A 2D2EA 4OBEA 1PJRA 2D7CA 4Q7JB 4HATA 4YDHB 3E9EA 4EO9A 3A8TA 3PXGA 1RYFA 3SNHA 2CJWB 1HE8B 4NMMA 4DLVA 2Z43A 2XB2A 2I3BA 2VP4A 2QMUA 2BMEA 5LD2B 1SVOA 1N3BA 2ZE5A 3GEHA 4A8JC 1CP2A 1KY3A 5J47A 2B92A 1G291 2L0XA 4F93B 3C7TA 4UXJA 3U7GA 1VHTA 4DWJA 3QEJA 5FTMA 4PR0A 4DB2A 2ZAOA 1GP2A 2ZE6A 3UXMA 4B3BA 1US8A 4BGDA 3BS4A 3GLIE 3SBDA 4A6XA 5AJWA 3THWA 1E3MA 5FPTA 1W0JA 1JQLB 4LBYA 3SI7A 3O8CA 1DAFA 4AY2A 4X8HA 3VX3A 4ZKDA 5CDFA 2A30A 3VKGA 1E2FA 1FQKA 4HB2A 4B3CA 2GEDA 1NJFA 2P67A 3KJEA 3PCRB 4HUQA 5AUPB 3GLFE 4Q19A 4AYXA 4ZDIA 1T6NA 3CRQA 4IDQA 2ZEJA 5E3HA 3GPLA 1JXOA 5JJKA 4JLOA 3ZS9A 5KDOA 1J90A 2F3RA 3X1WA 4KCGA 4AG5A 8OHMA 2AHOA 2B7BA 4OQFA 4LYJA 1T91A 5BN3A 3KKQA 1RRFA 2BBSA 1D9XA 1CF4A 3IIJA 4DCSA 4RZ2A 5TY0A 2IUTA 2AKAB 4MRNA 1OFHA 4U00A 1J8YF 5J4YA 3OEHD 3VAAA 2JEOA 2WAXA 3SQXA 3REFA 1KDTA 5DN6D 4LC0A 1XJQA 5SZHB 1YU9A 3WP0A 2J0QA 4QFMA 1UKZA 2VQSA 4G5GA 5H70A 1G9XA 5K8IA 1UDXA 2RH5A 3B1XA 3RRMA 3THXA 1IY0A 3WMEA 3ZZ0A 4OQLA 1P2UA 5HE9A 3R9WA 4P32A 3EZ7A 3GEEA 4TMKA 1P4SA 1G3UA 3UIEA 5BWMA 4Q7MB 1UBFA 2BWJA 3ASZA 4NYJQ 3SHFA 2RAPA 4Q1DA 1SXJC 4FMCB 4D4KA 3MFYA 1W48A 1DAHA 2OFOA 3P27A 2NO9A 1MRSA 3OEEA 4PHFA 1CR1A 4ESHA 1H8HD 2WIBA 3AB3A 2P6UA 4FCVA 1FMLA 3FFAA 2J1LA 1EG7A 1Z6TA 1FUUA 4C7OB 1NVVR 1FX0A 3TKLA 2PA0A 2RGGA 3MBKA 1YFKA 3W5IA 2XEXA 4LJ8A 3VR6A 3K53A 1AS3A 4E5UA 2QAGB 4KVGA 3UG6A 5GJCA 2RFLA 1ZD9A 4N0DA 2ZJ8A 2JJ8A 2JLUA 3KB2A 4E07A 3PUWA 2HDNB 5SZKB 3V4FA 1ANKA 3DCYA 3FJYA 2XITA 4Z51A 3P4YA 3SHWA 2ZRNA 4B3FX 3QSYA 5TDHA 3GJ7A 1YZLA 3OIVA 1W0JD 2DFLA 3A4NA 1VMAA 3PENA 4IDHA 1Q22A 3K0AA 1YZUA 2XSZA 3NDBB 1G6OA 3TSZA 3EZFA 1DKNA 4BLQA 4WOPA 5FPSA 3DO6A 1HQYE 1KHTA 2AXPA 3KUCA 1BMFD 5G3ZA 1OB2A 2CL6X 2V54A 2A78A 1D2EA 1Z08A 2J45A 2X2EA 2QPTA 3QOFA 4HAZA 4WBSA 2P2YA 4D0GA 1N6NA 3OIYA 2PBRA 4Q7LA 3ZQJA 3ONWA 3RANA 2ZE8A 4W7SA 1X8LA 4I1VA 1SKAA 1KNXA 4CDGA 1TADA 5JECA 2AX4A 2IK8A 5KUTA 3KQHA 4II7A 3TUZC 4WZBE 2DB3A 1Q1EA 4LDJA 2HT1A 1RJ9A 4HDQB 1KI4A 2REXB 4HZUB 2A5YB 4JVLA 1OXTA 3JZAA 3QG5A 4PQRA 4XTCS 1S96A 4HAWA 3DMDA 5IT5A 3FVQA 2FJUA 1WBDA 2KI5A 2GXQA 2GZDA 4CEJB 2WKPA 4M22A 3PJRA 2IWHA 1WQ1R 2AR7A 2QNIA 4QXAA 4A1FA 3N2IA 5CK5A 5DHFA 2ZYWX 1F2UA 4DLSA 1MO5A 1KK2A 2JGNA 3J81k 2E9SA 1HY3A 4X8LA 4KSCA 5EJEA 4C0JA 1R5BA 3QE0A 4QNRA 4Q21A 2ZU6A 2P6MA 2BKEA 4JIMA 2XZPA 4OQNA 4MGIR 2JJ1A 4MYCA 4C0LA 1IM2A 2RGXA 3B5JA 3FHOA 3R8CA 4OJKA 5FR1A 5JSZB 5FOWA 5JWOA 4GL2A 3K09A 1Z0DA 4DT1B 2QI9C 1TEVA 4JS0A 4QJ5A 1LFDB 1R2QA 4RKEA 5FUVA 3QPVA 5JI3E 3LD9A 4MGKR 5J4VA 2QPAA 2IKQA 4M9SA 4ASUA 4PC2A 3QKSA 4RJLA 1COWA 3GEIA 4RFSB 1D9ZA 2QBYA 1CS4C 4FIDA 1W36B 3P32A 3GFOA 4B33A 4NCHA 5JRZA 1UJ2A 2XJ4A 2FEMA 5FL3A 4A36A 2R2AA 2V4ZA 2EQBA 3SR0A 4BASA 1CVIA 1X1SA 3K70C 2QTFA 3I8SA 4ERNA 4ZDJA 2XGJA 2JLQA 4PPGA 2ZJZA 4FINA 1CJTC 1QRAA 4NYMQ 2YN0A 5B57C 4DSNA 5AK0A 1FZTA 3LH5A 4QHYA 2G1KA 1ZC3A 2XNDD 4P33A 2FFAA 4MRSA 2P75A 1IN6A 2OEPA 3GLGB 3B85A 4B3GA 4TL6A 5EE1A 3HP1A 4BUJA 1MH1A 2GILA 4QJ4A 3NWJA 3GLGE 3O8RA 3AVTA 2ODNA 1U0HC 2AXNA 1I4LD 1U0JA 4Q1EA 1P7CA 3EPJA 2GJKA 1KI2A 2P79A 1HTWA 4F91B 1GRNA 2QEQA 3MG9A 1E9AA 2RGNA 2WIAA 2OUKA 2MSCB 2REOA 2BHRA 4LSGA 3B6EA 3E70C 4QBIA 4URWR 3W90A 4C0KA 1GM5A 1E58A 2H4ZA 3IT1A 4B73A 5DE3A 3L43A 1TTTA 1T8UA 1Z29A 4QKQA 2FE4A 3RS0A 3D6AA 2ZSEA 3K9GA 5FL7A 2OO7A 1GTVA 4GSYA 4KFSA 4MKFA 1XD8A 3L8ZA 1OIXA 2WWHA 2V7QA 4IJ5A 4JT4A 4TT3D 2CL0X 4P4SA 4NKRA 2FG5A 2DR3A 2NMVA 1GKYA 2B8TA 2VHJA 4QBGB 2UVQA 5C46F 1VG0B 1XXHA 4QC2A 2JJ1D 2PLRA 4Q4AA 1VYUA 1YZTA 3BORA 2QRNA 4TQAA 3ZDQA 2GXAA 1ZJ6A 2J0UA 1JR3A 4B6EA 4K8OA 4DLXA 1NBMA 3FMFA 4XIGS 1XJ0A 1RIIA 3QBVA 1AGRA 1WRBA 4A0HA 3PR1A 2OBNA 1X86B 3B8HA 4CT5A 3K4QA 1QVAA 1G41A 4X8OA 1KK0A 1T9HA 1G6HA 2Z0MA 4RD4A 3U7HB 3Q72A 4EPXA 4JLDA 3A36A 3K0SA 3IGFA 2X77A 2IYQA 1ZM7A 4LHVA 2F1HA 2JIZA 2O0JA 3GLHB 3D31A 4QGFA 3FTQA 4PC3A 4PZYA 2YINC 1EFRD 1NVVQ 2VP2A 4LHWA 3BFXA 4O25A 3R7WB 3MWKA 2CL7X 2OFWA 3GJXC 4IDOA 1Q57A 5EE5B 5CDHA 2AKYA 5DGXA 1U90A 1AZTA 4D25A 5IHPA 1MV5A 2ZJAA 4JVSB 4JLPA 2O8CA 1P73A 3ZHCA 3AF1A 1ZUNB 3LAWA 5HE8A 1QHXA 3LQQA 5CJ2A 3T34A 5FTLA 1ONBA 2ZJ2A 3DM5A 3FMIA 1W4CA 5GVRA 3VQTA 3VKHA 1CKEA 4F4JA 5TMPA 3THOA 1Z5ZA 1W4RA 3GJ8A 1SKQA 3PG5A 1E59A 4EJSA 3LDAA 1QF9A 2P3SA 2Q9BA 2QSYA 3KUDA 5A4JA 3GLIA 2OZEA 3I8XA 4KYUA 1SQ5A 3U5ZB 1DEKA 1Q1BA 4W5WA 3K9NA 4P4UA 3TE6A 2JJ2A 3RC3A 1T5IA 2VPPA 3PIRA 3T61A 4OI0A 2OCBA 5JCZA 5FOTA 5FUXA 1FL9A 3GLFA 1NN5A 4EPTA 4L8GA 2GXSA 2V7QD 3RS2A 2GEUA 1K6MA 1DAEA 5KOYA 4D0NA 1Q1QA 2FF7A 4DLUA 3BFVA 1XTRA 2QGNA 1XPOA 1JXMA 5FH9A 3WYAA 2BKUA 1BQ4A 1QHNA 2FSGA 1CBUA 4DLRA 4V0ME 4JBXA 4ABYA 2OAP1 3KQLA 3ZQ6A 3AVWA 1JR3D 3MAAC 3VNVA 5FFMA 4KFRA 4IDPA 3FE2A 4M21A 3C16C 2Q3HA 4PZAA 2A5FA 5BXQC 2R8RA 2ZUBA 3DOFA 4XVRA 4FCTA 2EKBA 2BJWA 3RS4A 3UMFA 4IOMA 1BOFA 2HXYA 4NYIR 3DDCA 1XMJA 3MCAA 1NVWQ 1SVSA 3SJZA 1VDZA 4RD6A 3EPKA 3NBFA 3BB3A 4JBWA 3R20A 5FUYA 1HV8A 3KKPA 1FQJA 2D2FA 3NBXX 5BW8A 1SK9A 2UZ3A 2GK7A 5TVKA 4AURA 2FH5B 3K09C 1Z06A 2I1VB 2ZRIA 3QKRB 3FPAA 4ZO4A 1TIPA 1ZCBA 2GCOB 1BQ3A 1HURA 1Z28A 5BQ5A 3F3YA 3AP2A 1E9FA 1N6OA 4MUAA 3U3JA 3K0EA 4KBFA 4DEYA 5EE9A 2ZRKA 2I1QA 4O0MA 1P60A 3VTKA 1CU1A 1IAQA 4Q03A 1SVLA 3VU9A 2YN2A 1DARA 5D3MA 1S3GA 2CCKA 3CWQA 2OG2A 5DI9A 4EFMA 2CMKA 3QVUA 3KKMA 4BPBA 4H9GA 4UNRA 1Z0FA 3L0SA 4QGAA 1ZU4A 1NLZA 4M4SA 5EXXA 2P2ZA 4NHOA 1D8TA 2JJ2D 4NPHA 4HLDA 1AQYA 1W7AA 1ZRHA 1N25A 2F1JA 2H7VA 2EYUA 1C81A 4B6FA 4M0LA 1Y3AA 2D06A 1G1MA 3R9IA 3RSLA 5L3VA 4DB4A 4PZ9A 1KMQA 2R44A 4QL3A 2YV5A 2DPXA 2VSFA 1ESNA 2W6JD 3T5GA 3UANA 2NGRA 1ND6A 1W0KD 3MLEA 3I5XA 3ZLJA 2AWOA 3IDQA 3A1WA 2B7CA 3SBEA 3TQFA 2CDNA 2VO1A 2IF0A 2BMDA 5EP3A 4ACBA 4KI0A 5SZIA 3LRPA 1IXZA 2WPDD 1U98A 2RGNC 4K81B 4Q7KA 1G4AE 1P6XA 2F3TA 4NTZA 1G8HA 2BVNA 1YZNA 4TZ6A 5C2JB 5L8VA 1M7GA 3KTAB 3V4RA 3U7FB 2QMOA 3AKYA 4D4MA 4CEJA 2V3CC 5JLJA 1OW3B 5E4FA 2QU8A 1VCMA 4KJZA 2QQ0A 5EE0A 3IT0A 2IXFA 1E99A 1DG3A 4Q47A 2ZJOA 4A82A 4JKIA 3RS5A 1DOAA 3QQ5A 3LLMA 4MRVA 1RW4A 1CULC 1ZUHA 3AF2A 2C98A 5HZHA 2A5JA 1YQTA 2WWFA 1A82A 4XWOA 3DZ8A 4PTLA 4PX9A 2O8FB 4Q9LA 4OQXA 3HR7A 4ILEA 3E1SA 1AN0A 1KK3A 2IYUA 5KNCA 5JSZA 3W6NA 3B1YA 1IN8A 2W2XA 3AF4A 2WNIA 3WYFA 2ZETA 4TYQA 2J59A 4I81A 4AK9A 2WOJA 3ADKA 3B82A 2TMKA 2D74A 3QXCA 3K9HA 1M74A 4Q4LA 1G5PA 3QEOA 4EFNA 1ZNZA 2N42A 5HR5A 1HE1C 1HEIA 1S0UA 3CRVA 3U3RA 2QUZA 3FHTA 1MABB 1CR2A 2EWVA 2VA8A 2G83A 4IOLA 3VMFA 4BLTA 1G8YA 2IUSA 5M04A 4AKHA 3NBYC 1W49A 4GP7A 2R6GA 2CVHA 3EWAA 2O52A 2VYFA 3TSOA 2RMKA 1S1CA 4RY2A 1Z8FA 1OFIA 3LQRA 4Q4HB 4W9MC 1KSFX 2YOGA 4PFSA 2P5TB 3D4IA 4PPNA 4TSRA 3E5HA 3OZXA 4ON9A 1GL6A 1R10A 4JMPA 4MYUA 2FFHA 4RSGA 4BWYA 1OB5A 4G3XA 3BB4A 5UKDA 6Q21A 3GLGA 4V0NA 1TNDA 2ZIAA 4EAQA 3UATA 2C2HA 4LK2A 4Q9JA 4B44A 3ZD6A 4DVGA 4TTQA 1G8PA 3LO5A 4R2HA 3X1YA 2GCNA 1SGWA 4KSBA 1PLJA 3OIUA 4TWZA 1V7QA 2WJYA 3PUVA 2Z4RA 1KSHA 1H2EA 2QT0A 2VIIA 2OCAA 3BFKA 4DIEA 1M6NA 1E4YA 1UM8A 4EJSC 2VBCA 1W5SA 2QROA 4KVAA 3U61B 1DAGA 1N6HA 4OHZA 2ZI9A 2PJRA 1UADA 3GP3A 4MYHA 3AUXA 4EPVA 1J70A 1EBBA 3R9XA 2LWIA 5J4KA 4TYWA 2AFHE 4DSTA 5BYJA 2WNHA 3W6OA 1N6RA 1G17A 2ZRHA 3CF0A 2J5XA 3WRXC 3CF2A 2ZITA 3VR2A 2NTYC 2K5UA 3MXOA 4TL8A 5IF9A 4QGHA 2IC5A 1TF5A 2DFTA 1WP9A 4P0TA 3AV0B 2NO1A 4FMCF 2IS2A 3CKLA 2KBEA 5CM9C 4HUTA 2R9VA 4M53A 4YXWD 2V1XA 2RGEA 1HH4A 3OAAA 3DPUA 5LPNA 1FPMA 4DDVA 4Q1AA 5JJIA 4C9BA 4GNKA 5HKKA 2JCSA 2GZHA 4NYIQ 3ZIAA 1Z0AA 1NLFA 1SXJD 1E2KA 4JOCA 2J9RA 3Q7QA 2IEZA 4HLUC 1MR3F 1YR7A 1XD2B 2ZS9A 4FN5A 4M8NE 2YWHA 2ZREA 2ZE7A 3F5FA 2AK3A 2ZI4A 1NG1A 3UG7A 5CIWA 1HT1E 1U2RA 4WZ6A 3NHAA 1EFCA 4R9UC 2IYYA 3CNNA 3MUFA 4LYHA 3A1UA 1L8QA 4DBLC 1SHKA 5FBLB 3Q3JB 5K8UA 2FZLA 3AEZA 3NHBA 4I4LA 4KO8A 4YMUA 4LY6A 1JJ7A 4D81A 3R7WA 1PVOA 1Q3HA 2XOKA 5DI3A 4B2IA 1ZM3A 2X1VA 1FFHA 1MO4A 2Q6TA 1GL9B 5CB6A 1G16A 5DSZA 5GADl 3HU3A 2J41A 4D4JA 5FBWB 4Q1FA 4Q4JB 4BZQA 4C2UA 4QRHA 1JALA 5KSYA 1IJFA 4IXMA 2QAGC 4LJ9A 4NP6A 4Q48A 2OFXA 1EGAA 4QM7A 3QG1A 4LX0A 4TLDA 1UBCA 4WZAE 1JQJC 5FUWA 3IUYA 4R71A 2ZRDA 2V1UA 1E69A 3NKVA 2C9OA 4HDCA 2BEJA 3Q8XB 3EZ6A 1FTSA 1FNNA 5DISB 3F3KA 5TB5A 1NMXA 1F2TB 1G21E 1J2JA 1RFLA 2F1IA 2IYZA 2W58A 3A1TA 4DDWA 4EMBA 4UXHA 5F9FA 2C95A 3IIKA 5FTJA 4D2IA 2W0MA 1LV7A 1U99A 2GF0A 3DMNA 2OV2A 4WIAA 1IY1A 4D4LA 4V0MA 3WY9A 1CEEA 1UEJA 3CIOA 3H0KA 2BDTA 4US1R 1DG1G 3NTLA 1P2SA 1U94A 3G5UA 3PEUA 4AIIA 1E98A 1N6KA 3IO3A 2W2VA 3BB1A 4LV8B 1Z6XA 5CYPA 4FWTA 2Q0HA 3P26A 4PSAA 4S35A 5BN5A 1EK0A 2DY1A 2GA8A 3KJHA 2CLDX 1NI3A 4M1SA 2HLDA 1R8SA 1V43A 5HKKD 2GJAA 1KZGB 4IOKA 1FP7A 2H17A 3EARA 4IRUB 1HA3A 1DKMA 4TLAA 1E2DA 2AD5A 4DSOA 5GJWC 2BCGY 1FNMA 3PEYA 3TR0A 2BMFA 3BERA 1U8ZA 2ZR9A 3BH6A 4BE7B 1WXQA 4FMDB 3TR5A 1SHZA 4NDZA 3LNTA 3U3MA 4OI1A 1RE0A 5EE3A 2CNWD 4RD0A 5JWRA 2ECKA 2Z4SA 5EZ6B 2LKCA 4LI0A 1GILA 3PEWA 2YJTD 3WBJA 3EIHA 1KAGA 3OE7A 5CB8A 1P9NA 1E94E 2W83A 2NIPA 3SDZA 1DKQA 2GCOA 3K70D 4JLKA 3OESA 3CF6R 3K1JA 3RHFA 2WSSA 1KTVA 3W34A 1UEIA 3IEUA 2V55B 3QF4B 3B9PA 4JL8A 4P3YA 1DBSA 1Z2CA 3NXSA 4OK6A 3IHWA 1W36C 1TF2A 1DAMA 1BS1A 1XMSA 621PA 2IS1A 2ZJ5A 1Z6YA 1TAGA 3LW8A 2OBMA 4IW3B 3I32A 3X2SA 4E09A 1MT0A 2OHFA 3MSXA 1TPZA 1NVXQ 3EA5A 4LHYA 3W9YA 4F4IA 4EIWA 4K46A 1GG2A 3T1TA 3EZ9A 1W1WA 2DCUA 2RB4A 4QGGA 2ZXUA 3Q9LA 2WBLC 2X2FA 1N0WA 4X8MA 1T0HB 1DPFA 1XQ9A 1UKVY 5L3SA 1E2IA 3EZ2A 4BZXA 3PFIA 1V37A 3ETLA 4MKHA 3THYA 4TLBA 3VFDA 3PUZA 1W47A 1OE0A 1OYWA 2XTZA 4DRZA 4TYNA 4I1OA 1XEWY 1II8A 1VG1A 3A1SA 1HYQA 3SN6A 4NE2A 1FZQA 1C4OA 1QWOA 4GRAA 2PEYA 2O8EB 2PX3A 5EP2A 4ZIRB 2OM2A 1A5TA 5FPYA 4D6PA 4Q01A 2G1JA 2GKSA 4GI7A 4MQBA 1GZSA 4GFDA 4HDOB 1TUEA 1E79A 4A0FA 2ZI5A 5KNBA 1BIFA 4A9AA 4JBYA 5ELXA 4HYYA 4XD7A 3CB4A 1PLKA 3RAPR 4LRWA 4UNQA 4BZPA 4G5RA 4QBHA 5C18A 2YVUA 3C14C 3QVVA 2H1LA 4FDUA 4A8JB 3CX8A 4ZDKA 3W8NA 1DS6A 1AZSC 1ZIPA 3IPYA 221PA 1QG2A 3CR8A 1DKLA 4PAMA 1KI6A 4LWZA 5GJBA 2O8FA 5FOVA 5KPDA 1NY6A 3EASA 3UWKA 5CITA 4JOBA 5JEEA 3U2QA 1G4UR 4Z8XA 2GJ8A 1U8YA 2XTNA 4W5HA 5AJVB 4RD2A 2WSSD 1QHHB 1G3IA 1P72A 1VCOA 1KI3A 2XZOA 3OEED 1TQ4A 1RYHA 3LA6A 1SKYB 1WCV1 4MDFA 2IEYA 2YOFA 1IN5A 3W3AA 1R0ZA 2HUPA 4HZIA 4Y0AA 1AGPA 2GESA 1A2BA 4PSKA 3T5DA 5ANRB 1GVNB 3PITA 1B23P 5EQTA 2P6NA 1T5LA 5JMTA 2F43B 3B1VA 4D26A 2P5SA 2Q9AA 3I1FA 2OAQ1 3L2OB 4EPRA 2W2TA 2QNRA 2VLIA 5FOXA 3FGNA 3IQXA 3TVDA 4CEIA 4PGMA 4Z1MA 2ENWA 4LZZA 2QE7A 1NMZA 4UNSA 2YC4C 4B43A 1YJ5A 1YZQA 2O8BB 2BCJQ 1KY2A 5G40A 3QPUA 4DCNA 4GMXA 1S1MA 1GOTA 1S9HA 1Z22A 3OFNA 5IDVA 1H8EA 4AWXA 1OXVA 4A15A 1AM4D 1MO6A 1V5WA 1RZ3A 3KFVA 3GFTA 4M1WA 1XZQA 1ZP6A 2KE5A 5BN4A 1SVIA 3PUYA 2ASEA 3RRYA 4XOIA 4LYAA 1U0LA 2OT3B 3HJNA 121PA 1SXJB 4ZCMA 2AD1A 2XSZD 4CEHA 2P65A 3GJ5A 2CXXA 2OBLA 3QKTA 3AVVA 4IXNA 3BJIC 1OKKA 3A4LA 1O3YA 1R0WA 4JZKA 3HR8A 3CO5A 5BYKA 4ZDWA 4XD7D 4Q00A 1QVRA 2NO0A 4HLQB 1E4VA 1KNQA 1DAIA 1ETUA 1E2GA 2JLSA 3CLVA 5F2EA 5P21A 4CGZA 2PCLA 2VEDA 4JVMA 4QG7A 1FOEB 5FBQB 2QP9X 3HJGA 2NO7A 3NEJA 3FWYA 1TQ6A 3ZJYA 3V9PA 1Q21A 2F90A 5F3WB 3VNUA 5CM8B 1F48A 3OIWA 1JPNA 1P75A 1EX6A 2HF8A 2KBFA 1ZW6A 1TMKA 1ESMA 5EXTA 3EW9A 1KI7A 2IS6A 1CR4A 2CE7A 1E6CA 3AVYA 2ZRFA 3LWNA 5JS8A 3ADCA 2D62A 2HEIA 4UQOA 3U44B 5H8WA 1NP6A 1E2HA 4M1YA 3T1VA 4DHEA 4IEEA 5AUQA 4QM6A 3FKQA 3L0PA 2WJHA 4WXRA 1NNEA 1KO4A 1NRJB 1U8AA 1Z6GA 1KI8A 4PC6A 1JNYA 1UFQA 4RKFA 5J5CA 4HB3A 4URVR 4ZV4A 5KTYA 2ZUDA 4DKXA 4EPWA 4A92A 2FDCA 3FB4A 1XD2A 2MMCA 4BLPA 1E9SA 3I61A 1Z63A 3B2EA 4UJ5A 2ZAMA 3K0CA 4ZCLA 1Y63A 4TYYA 4ASUD 1X8KA 1NT4A 2DFKB 4F38A 1COWD 3PEVA 4GDFA 1YR6A 2ZS7A 2GEVA 2BBOA 3RS7A 3FOZA 1RPAA 2IYXA 1F5NA 1OXUA 2XNSA 2HJGA 2BIFA 4JL5A 1UBGA 2BM1A 5DNYB 4HBZA 2FNAA 1OYYA 1SVWA 2ERYA 4WVFA 5FPKA 1G20E 2R6CA 4J0QA 5FOSA 1JEDA 3CX7A 2ZRJA 2BJVA 1YHNA 4DCTA 3MWYW 1A1VA 3CRW1 1CIPA 2IF2A 4S2EA 3GLHE 3SEAA 4O3MA 4DLWA 5J4LA 5D3QA 4I99A 4Q9HA 3SYLA 3U7EB 4IEIA 2NG1A 3ZZUA 3A4MA 1NL3A 1R0XA 3ZD7A 2VL7A 2JLYA 4YMVA 4JKYA 5KPJA 2CJWA 3M1IA 2GK6A 2IW3A 4Q66C 1LS1A 1ZM2A 1AJEA 4GP6A 2J7KA 3P1JA 3C4JA 3SQWA 4LOAA 4PO1A 3KXIA 1OFUX 1E1QA 4TLCA 2HYIC 1Z0IA 1N2CE 2FGKA 3KDSE 4Q1BA 4C2TA 2GHIA 2J3EA 4GPTA 2HCJB 3HU2A 2XB4A 1F3OA 1X3SA 1GNQA 5EXPA 4JLAA 2QMHA 2VF8A 2HHJA 4OL0A 1FMJA 4JLNA 1JJVA 4MITA 4CZ2A 5FL7D 4V02A 3CPJB 3GQBA 2ODWA 3QY0A 2IA5A 1OV4A 3DEFA 3D3QA 2FZ4A 1U81A 3CR7A 4LV5B 3RS3A 3SJBA 2ANBA 2F9MA 2JLXA 2WKRA 4Q9KA 1F6BA 2A2ZA 4C0AC 4L16A 2DFNA 1MKYA 3RSOA 2VF7A 4AYWA 5CLLA 1E9CA 3UMRA 5J40A 2JASA 1XTSA 3KKNA 2NOAA 2JAQA 5K8TA 3QIAA 1XPRA 1NBMD 4TMWA 2D4HA 3Q85A 3K9LA 4B71A 1E96A 2V9PA 1WF3A 4B34A 1XF9A 3TIFA 4PC7A 4C0SA 5JI2E 5JRJA 1CJVC 1P2TA 1W5TA 2H18A 2ZROA 3ZH9B 2BMJA 4MDEA 2FSIA 1N0VC 4JLBA 4HLUA 1XD9A 1OH6A 2ZI7A 2AWNA 4JVNA 2CLSA 3G82C 2GVZC 5H1YA 3THWB 1BH2A 2Q3MA 2EW1A 1NKTA 2YWFA 3DM9B 3C7KA 1XRJA 2XTMA 3DKVA 5DYIA 2VSXA 1N5LA 1GRRA 3KL4A 2OXRA 4YC7A 4EFLA 4HUQB 2JIZD 2VRWA 3W6PA 3HPRA 4C0QC 2WTUA 2IX3A 2A6PA 1ZC4A 2FU5C 3C15C 4OK5A 4RCYA 2WAYA 5AUOB 2H0QA 1DO0A 3FKSA 1TQDA 1TUIA 3SJAA 4C7OA 3MJHA 1AS2A 4WXPA 2PCJA 4ESVA 4XTRA 2EYQA 4L5BA 4HAVA 2DWQA 1N6IA 1KI9A 4DUGA 3ZVNA 4FI3C 3GD7A 1L2TA 2QAGA 1Q44A 3RRNA 421PA 2C77A 4DCVA 2P9YA 2P2LA 3BAFA 1KJWA 4KYIB 1XU4A 3BOSA 2A9JA 1CRPA 3THXB 3MWLA 1DADA 4JSYA 4KBGA 3AGPA 2H52A 3E9DA 1SK8A 4FW9A 2UKDA 3PVSA 2ZYTX 4KFUA 2IYWA 2Z83A 2GWHA 2RGAA 1EWQA 2FA9A 1E0JA 4PHGA 1I4TD 3TJZA 3L0OA 2PEZA 2C03A 4XWKA 1A2KC 2OE2A 1R0YA 2WICA 4HAXA 2O8EA 1ZNXA 1XBTA 2FOLA 3WHKA 1JPJA 1VYTA 4N0EA 1KO8A 1YR9A 2PJZA 2PX0A 1KIMA 2YYZA 1A4RA 2CBZA 1E2JA 3LBHA 4KITB 2QSZA 1ZVQA 4MA4A 4OHWA 5GVSA 5FOUA 1R8QA 4MRRA 2QZ4A 2VHTA 3EIQA 1UBEA 2UZIR 3CM0A 4PHTA 2ATXA 3V00A 2VHUA 2GVDC 3NEYA 2REBA 5L3QB 1KAOA 2WM9B 4HZUA 5KYKA 4URZR 5CX4A 2ZQ5A 5AJYA 4DDTA 2G77B 5IRCD 1G5RA 4B2LA 1XCPA 4M2LA 3LLUA 1RVDA 2ZRMA 5G41A 3VKWA 1LF0A 4UKDA 3D7MA 4ARZB 2P6RA 1Z83A 3KJIA 4DZZA 2IYLD 1CJUC 2V6JA 4NCNA 3W5JA 4GPZA 2GZAA 1G5TA 4QNMA 3WP1B 1M2OB 1QHIA 4QOSA 1E9DA 2QP3A 1QDEA 1JAHA 2VH5R 3TQCA 2GXUA 4FCWA 3CONA 3EX7C 3EAQA 4B32A 2WWWA 1E9RA 2QN6A 1TF7A 4HLCA 4OK3A 4M9XA 4DT1A 1WB9A 2P30A 3TW8B 4TL9A 1OHHA 5KSOA 3DL0A 3WNDA 3OI7A 1T3HA 1P5ZB 3K0CC 3TLXA 1N5IA 2GBLC 4YMTA 4RFSA 2G0NA 4XVQA 2IT1A 4B2PA 3NC0C 5E7MA 1BYIA 3UK6A 1KYIA 4DUGD 2MSEB 4CW7A 1TU4A 1AS0A 2OXCA 2X8AA 2ZSFA 2CE2X 3H2YA 4CRWB 2HT6A 3E2IA 1F2UB 2OWDA 2PLFA 1KMHB 3VHXA 4I1UA 2A9KA 3KXKA 3NDPA 1EFUA 3T1QA 2PT7A 4U5XA 3TVTA 4C4PA 4KLZA 4LHZA 1OH5A 721PA 4JJZA 3EG5A 3I5YA 2G88A 1M8PA 1T3LA 1BO6A 2FGJA 2ZVPX 2C99A 3SOPA 2SHKA 1E9EA 2Q9CA 4G01B 1M7HA 1PUJA 3QKSB 3B13B 2RHDA 2ZJYA 3I62A 3B9QA 2QBYB 4BFUA 1R5OA 5LD2C 4QIHA 1S8FA 2IUUA 3IT2A 1YE8A 4TYPA 1A7JA 1QHSA 1VECA 2ONKA 5DH9A 1KKLA 4F92B 2R6AA 2ZVQX 2AN9A 3ADDA 2O8DB 1T3SA 4RZXA 1CLUA 2HJVA 1UJCA 4DDUA 2D7DA 4UNPA 3TSWA 1N5KA 3AP3A 3CUEF 4HB4A 4TSFA 2XXAB 1W4BA 4Q1CA 2VP5A 1IJEA 2W6IA 4ARUA 3N70A 1ZYUA 5KU1A 4LCBA 4PSVA 3CW2A 4PANA 4MGZR 4F4CA 2F1RA 1NJGA 1IN7A 4QHTA 1T8PA 1S2MA 3ECCA 2AK2A 2WKQA 4L4UA 2GCPA 4DLZA 4JLMA 3VR4A 1LF5A 4IVQA 4L15A 1XWIA 1PUIA 5PGMA 1QBKC 3NH6A 3FMPB 3GJ0A 4IJMA 5CK4A 3AF0A 4RZUA 4IVPA 1XCGB 2KWIA 3JVVA 5KSZA 1XMVA 4DSUA 2O5VA 1YKSA 1C80A 1JB1A 1W36D 4YMWA 4BECA 1SZPA 3KX2A 1XMIA 4EKDA 1XB2A 2ATVA 1G3QA 4N3NA 4TMXA 4NCJA 4DXAA 3L8YA 4A2WA 1ZU5A 1OXSC 1XTJA 2PZEA 1U9IC 1DTSA 1S9DA 4TZ0A 5EUQB 1TL7C 1NG9A 3CNOA 1JEEA 2GAOA 3GLHA 2P78A 5FI0B 2FFQA 2A5DA 2RGBA 1UDWA 4A2QA 5FI1B 4HAYA 1E32A 2J0VA 1OXXK 4JODA 1FBTA 4Q4AB 2C8VA 3WMGA 2J46A 4B74A 2WHXA 4M1OA 3QF7A 3TW4A 3PUXA 4RD1A 5JS7A 3KFXA 4URYR 1GSIA 1JR6A 4GBMA 3OEHA 4GPIB 3ZVRA 3BWDD 2IBMA 4AI6A 1KJZA 1Z3IX 5DN6A 1YZGA 3EWSA 3IT3A 3ZVLA 2KSQA 2LKDA 1R7RA 1W44A 2YC2C 1P62B 2H16A 1FUKA 1NVUQ 2BBTA 3AM1A 3S1AB 3EA0A 3D6TB 5EUMA 3GFPA 2OLKA 4OKSA 1NIJA 4ZPXA 2ORWA 4LJYA 1E0AA 2ORVA 4PAQA 2KB0A 5C1BA 3ASYA 2FSFA 4UJ3A 2DHRA 4PC1A
chains in the Genus database with same CATH superfamily
1MA0A 4D9BA 2GRJA 3OZDA 2BHTA 5G2OA 1Q12A 1KQFA 4IJ6A 2E4YA 2F4NA 2GPSA 2IQIA 3DOEA 1EP1B 4WY5A 3ZU5A 4D96A 1RJDA 5TEVA 4PQYA 2VHWA 3WNCA 4ZHQF 5LQRA 2NSYA 5BRJA 5CNJA 1TYEB 2CCGA 1ZL0A 1HYHA 2OC9A 4D4HA 3OQNA 2W6CX 3AQ4A 3OJ0A 5KB3A 4IDDA 5AKHA 1QU3A 1ZGZA 3TUIC 1RTTA 1FS4A 2XA2A 3C70A 3HWRA 2EJTA 3C5HA 3HJUA 3CZ9A 3GA7A 2R6DA 3NATA 3ESBA 1X80B 2W0SA 1K3FA 4NFLA 4RESA 3GCGA 3TLBA 4D0LB 4HL6A 4JP8A 5A6SA 1JA0A 3F9IA 3UJ6A 3R8FA 2QG6A 1X1DA 2BOVA 1PJQA 1T24A 2PL9A 2VNHA 3BJRA 3C3AA 6REQA 1E61A 3GLIB 2R8EA 3ZGVA 3I4LA 2L18A 2FW8A 1ULZA 2HQRA 4X65B 4Q4CA 5B7PA 1CVRA 1LPBB 1ZLYA 4PXSA 1T8YA 2II6A 4HQRA 4LGMA 1M1YE 1WHSB 4O4JF 4BMXA 5LU8A 4TTPA 3M89A 1U28C 3BE8A 1OT3A 2PNFA 3NC1C 4X1YB 4E94A 4R8SA 4EGFA 1EJ0A 2YFHA 1XQYA 4E7OA 1T36B 2W2OA 1EXNA 3EFHA 2XVXA 5ADVA 1ORIA 4JB0A 5F9HA 2BPOA 1TC1A 1ZINA 2GD0A 4AUKA 4IHKA 2XOXA 4CIAA 1WLSA 3B1WA 2EATA 4KIUA 5DGCA 5C80A 1V7CA 3OTQA 4TVBA 4J7AA 1T9ZA 4LPKA 4WESB 4CIXA 1CUZA 1YBMA 3TLJA 2RHWA 3F6SA 1KIAA 3Q41A 2WYVA 4O4HB 2FX3A 1YOVB 4LC1A 4P82A 1R9NA 4FX2A 2WZBA 4MO2A 2R4UA 1U2TA 3E1GA 1EESA 3GHHA 1P2FA 1JFVA 5CXUA 1NOJA 1HX7A 4X1IB 5DGIA 3QPBA 2GJSA 3GJ3A 1YJXA 3FPSA 4CKCA 3OU6A 2E4VA 4HAUA 4W63A 4DADA 1JFRA 2WJVA 3PD7A 4XSVA 5JY6A 1OIWA 1JJAA 1E2MA 4Y3UA 1L4EA 3F5MA 3R3SA 4B48A 1KZYC 2XGOA 3TKYA 4UBLA 4AKIA 3Q7EA 3P9SA 1YZHA 4YAOA 4TZTA 4URUR 1ZNQO 2JVJA 4CLRB 4NCKA 1RAGA 1Z47A 1CR0A 2Z8ZA 4IFEA 3CS3A 5EKDA 2GTPA 1SVKA 2V97A 1O5TA 2FWPA 3P0HA 1YVRA 3RH0A 1PUXA 3RM3A 1XLVA 4X62B 4IHQA 1XEAA 1FNCA 3M3PA 4O2AB 1E3LA 4PLGA 1L5QA 3KXLA 1F0YA 1HFEL 2OWEA 1TCAA 3KQUA 1K4MA 4NXMB 1N92A 3ND9A 1O8CA 4AC9A 4B9AA 4LRYA 1A97A 1CTQA 1Q0UA 3PJGA 3OO1A 2GS9A 3DL7A 4AXXA 1XEXB 3OLXA 2BI7A 3CINA 5L3QA 4WCFB 3LBAA 5DN9A 2V6IA 1A72A 5DW3A 4Z0HO 1B3RA 1FDTA 4Z54A 1V35A 2FG6C 2XVMA 3AKCA 4W99A 3D0RA 3UPUA 1X6VA 3OG9A 4B4VA 4BVHA 1GSHA 3NBQA 1DUIA 2JIQA 2QM8A 4WKGA 5FR2A 4QVIA 1NSYA 3VYUB 1J33A 1XEFA 4XFKA 2PH1A 2PRSA 3O83A 1I3MA 3D81A 1W5EA 2Z6QA 4LRUA 1PTJC 3FDZB 4QUDA 3U48A 3OU2A 4G0OA 5H4GA 1R4AA 2XNDA 5C8VA 4I4NA 4Z7QB 5M3BA 1QHYA 4U7DA 3ONDA 1JTFA 1C1XB 1ZH4A 1NN1A 2FAXA 4S1VA 3GX1A 2YXNA 5EUCA 1QCCA 1XNJA 4TQ9A 5TGTA 1J39A 1JFLA 1M0TA 2G07A 2IHZA 5KHAA 1MRZA 1NQAO 2ERXA 3KE9A 4FFNA 4M1TA 3TW8A 5GV8A 3VPFA 3FNFA 5DYNA 1A96A 1I2BA 2PGIA 3PC6A 2BE7A 4FFVA 5JTTA 2NZXA 2HYDA 1II0A 3AXTA 4I50A 1D1TA 2JDID 4B82A 5I7FA 1IQUA 4KXQA 2VCHA 3FSEA 5JATA 1GGVA 4S1PA 1MABA 1W34A 4XGIA 2DHEA 1IVNA 1SKYE 1TM4E 1NBHA 1PSZA 1L7PA 1MDFA 3IUQA 4EJFA 1KMHA 1AQJA 1C3LA 2D1FA 3OURA 4TT3A 3TLYA 1WV0A 2OCIA 3ZY3A 4FQ8A 4LMAA 4CVNA 1J6UA 2PTHA 3DVRX 3I1YA 2OCPA 4BX3A 3AVUA 2IH5A 2HUNA 1VPDA 2P1DA 1AOXA 5DIFA 1VIYA 1VCNA 3ZUGA 4YPFA 4MR9B 4R2IA 3G7SA 3K71B 4L78A 2JIOA 3JATB 3GVHA 3WRYC 1NIPA 1MD9A 2AW5A 4BBZA 2IXAA 3F8TA 3DOOA 1TCBA 3R7DA 5L9AA 1EA7A 2FEAA 3MUOA 5EZSA 1G18A 1Z0JA 3PKZA 4QUKA 2CF6A 4P5EA 3RHTA 3PTAA 4IG4A 521PA 3G5TA 2QRHA 3O92A 4IM7A 1I4OA 2PR2A 1OI3A 1DKOA 1NN0A 3T1NA 3S8YA 1QZUA 1IXSB 1V3UA 3Q3EA 4L08A 3EQ7A 3C3JA 4O2RA 2HXSA 4TWAA 5IAGA 4P22A 4YIKA 5KNBD 1PT6A 4RTKA 2FMXA 4QX6A 2P27A 4YUVA 4ITRC 3GFGA 1I2DA 2I4LA 2VZEA 3KAQA 3FYHA 3G89A 4YX9A 3KC2A 5J4HA 5LQMA 3TPCA 2BSAA 1Z75A 2DCMA 2E4UA 2GFQA 2TMGA 4ESOA 1EFRA 3A9RA 3BXZA 2GPBA 4BXOB 1J0XO 3MT7A 1MO3A 1S02A 2OGWA 2CLCX 4FZJA 3M6MD 3K96A 5DE3A 5C1DA 3IILA 3JZMA 3W5UA 1PR4A 1BX1A 2IEAA 4Z99A 1KVSA 1C9NA 4UEOA 1NOIA 2BGTA 4JJFA 4D9FA 1WPXA 2UUPA 3F3MA 1JEAA 1LWOA 2ZCJA 2O23A 2QVZX 4QOEA 1UPTA 2UYGA 4WACA 5JSYA 3PNBA 3AKEA 3C7CB 1KDZA 4Q1VA 3THRA 2C5LA 4V03A 5KYKA 4WLOA 4UVGA 4IILA 3T9AA 2ETVA 3I09A 2WVJA 2YHBA 3GZTB 1AKUA 1YWGO 3QZUA 1HWYA 5KVAA 5DO9A 5HXAA 4IKOA 3DMGA 1OR8A 3O21A 2UZ0A 3VSCA 1E2BA 4LI3X 4YJ2F 4ZOBA 1VE9A 3RT7A 4BLOA 5HJ7A 3OZBA 5DX1A 1RXYA 3B1ZA 3MUEA 3X3HA 4TMVA 4D44A 3W79A 2P41A 5E2AA 3OKCA 4R3NA 2XECA 4YWJA 3G2KA 1ODFA 4RMHA 4LYDA 4JJKA 1EXMA 1KOFA 2OCYC 2GBLA 2ZRPA 4TTRA 5T6BA 4ZCIA 1AA9A 1L7DA 1AKTA 1P9WA 1UIMA 2V3WA 3FMGA 3VSBA 2H85A 1GARA 4C89A 1K8RA 1JZSA 4OB6A 4Z1MD 3MUNA 5E6SA 1PR2A 3N28A 1BYUA 1Q20A 4EY3A 2X0RA 2KYRA 1JFFA 3F49S 2O2DA 5IM4F 5DLQC 4CM7A 4GLBA 3RNLA 1CNEA 3Q7SA 5EJMA 4EGCB 5GIPE 3H4MA 3IB3A 3VPBA 3IKVA 4Q7QA 4N0QA 2NPIA 2PX8A 3LVRE 2PVSA 2LCFA 6ABPA 3DBLB 3L84A 1EFHA 1SD1A 2V7XA 3HCAA 4ZRDA 2FG7C 2R7LA 4E70A 4QHSA 5IHXA 2J31A 3OHPA 3ZCTA 1Z62A 4B75A 4U3JB 5FNZA 4PYLA 4J7UA 5EJ5A 1ZK2A 2QAJA 2P40A 5ESXA 3PGVA 4TWIA 1IE3A 4J1NA 3A3YA 5DP1A 3W8RA 5TLSA 3GPBA 4U4AA 3UUWA 3TLKA 2BDEA 3FLMA 3X1XA 2BKLA 2WQ7A 3AL3A 2A3NA 4A5OA 2E55A 2HJSA 3T4PA 3CF4G 1I01A 1TQ2A 4AU1A 2LIVA 1ODTC 4LTDA 3SYKA 1F2TA 1L4BA 2CXRA 2FDXA 4L3OA 1U0FA 1Z12A 2JI6A 4J1SA 3CEHA 1EHCA 2WIDA 1OWMA 4H1WA 3C41J 3C6YA 5DI3B 4B7ZA 2PL1A 2X22A 1ZN2A 1LRLA 1XHLA 2R1VB 4LRQA 4HWRA 2QJOA 2YWDA 5COQA 5AJXA 5K1ZA 2Y8EA 4G1CA 3I1JA 4M8KA 4G2TA 5HBGA 3T7EA 5AVSA 1M6VA 3BE5A 4CMAA 3F96A 2FMKA 4PIPA 2HHCA 2QRZA 2VF2A 3BXEA 2Q3DA 4WAUA 5BSTA 4MKGA 5I8ZA 3T41A 5JVDA 1EJBA 3KAPA 2PE5A 4RQTA 3LWBA 5ITZB 4IXDA 2NT4A 1ZX1A 1XN4A 3QUSA 3FTFA 2P9QA 5FBRB 3IFSA 4EQ6A 5ESRA 4JVOA 4LF8B 5HS6A 1LY1A 1P1JA 3AHGA 2VS1A 5AXAA 1S7GA 5K2MA 4A6EA 5CFNA 4ACAA 3NBZC 1GA6A 1Y6JA 4DG5A 1LDNA 3R8XA 1RHRA 4ZI2A 4MYTA 1II9A 4WXEA 3RABA 3V8VA 3AEUA 5G0VA 4B35A 2BV3A 3D6UA 3EGCA 2X3YA 3BC1A 2L2QA 2JA2A 3M49A 2C4TA 1V5IA 4IVRA 4F5WA 2CDCA 1ILWA 1CNFA 1VTKA 2I6TA 3I6BA 3JVUA 1DL5A 1LK0A 4FWIB 4HCJA 4HDNA 4UOQA 1UMBB 4BYMA 1VIDA 4HGZA 3N2GB 3QXHA 1KH3A 1ML4A 1FXUA 1L5RA 1Z68A 3CCCA 1IZ0A 4KE9A 3V5NA 4UTNA 3G59A 4IVNA 4PPFA 4US2R 3VHRA 1FDOA 5F12A 5EMKA 3C5CA 3CUWA 1U9IA 4FHZA 3RG8A 2Y3IA 3IP8A 3MWDA 4Z0NA 5FTNA 3OIDA 5EEHA 3GNSA 5DK6A 3CLUD 4DLBA 1FXWA 4TUYB 1ZD8A 5CYOA 3VDRA 2FPLA 3MQ4A 4RA6A 3W5CA 2X6RA 1ZW1A 4LGVA 3UJDA 1YSCA 4UREA 4CM8A 4GOOD 2GZ3A 3W2HA 2RB5A 2VXCA 4V2UA 4JOSA 1XGKA 2B25A 2D4AA 4M0DA 3EY9A 1UKEA 1QZTA 3BXPA 1WCIA 4KPFC 3CHYA 1A2OA 3ZVMA 4EG7A 1NX6A 3V7FA 4E22A 1SKMA 1GPWB 4PG6A 2XMPA 3LI2A 1E1RA 2Q1UA 4GBJA 4R54A 2YZNA 4CKEB 2WV9A 5KDDA 4JT2A 3ITDA 3PXCX 3K20A 2P77A 4DV1B 4QUHA 2FOIA 2FQWA 5A4KA 4BNKA 3F6EX 4KXNA 4QTYA 5A7FA 4LSWA 4OQFA 1JEOA 1Z5WA 2JAPA 1HLGA 2Q5OA 4KQ1A 1T0JB 3OFKA 3CVOA 1T0BA 1XYGA 1Z73A 1C9KA 2ZBVA 3QPWA 1VHWA 1K7YA 4G0XA 2D1SA 5FTKA 2WQ6A 4TRRA 1T5TA 5BMVA 3I9JA 1ODJA 2CEAA 1XZDA 3O47A 1EZZA 1Y42X 2VTBA 3ZWPA 1E7MA 3ER6A 3R74A 1GPAA 5COBA 4MVJE 3PDUA 2QT9A 3FZQA 3LL4A 2ZPTX 2FPIB 2A84A 4GI5A 3U6BA 4MLCA 3CF4A 4H0NA 3OF5A 4EW3A 1H3FA 3HJRA 1E2EA 1HL3A 4QFBA 4HGRA 3RF7A 4GPBA 1H5UA 3IIMA 4LBZA 5AVVA 4QFDA 4A6PA 1I2MA 4D82A 2PAFA 2I7XA 1ZBDA 4JJAA 3C39A 2QTVA 1Z0UA 2PMEA 5HJEA 4J8PA 4YT5A 4H08A 2B1IA 1GSAA 5L3SB 1MNAA 4C6HA 2PN1A 4X64B 4DDHA 1Q91A 3A6PC 4PZZA 1HO3A 3A2KA 1P4GA 2OM6A 1YVDA 3AUTA 2NSHA 2QB5A 4OO3A 4TN1A 2XAUA 1QK3A 1XTKA 4IF6A 3REGA 3WE7A 1X42A 4GMKA 3C8HA 3N8HA 3G0BA 4TMTA 3X1MA 3ZK7A 4G9EA 3ADPA 4LWOA 4MRMA 2XUKA 2DPYA 3OIGA 4XWAA 5GOZA 5TSDA 4BHTA 4X44A 4DMCA 1UBNA 4CIDA 1N6PA 1YRAA 4AJNA 4U7HA 3ILXA 4IEFB 3T15A 1T8TA 4RKRA 4TRNA 4NCIA 2BI4A 4INAA 1K3TA 2QRGA 1VPLA 2PYZA 1TQ8A 1FDIA 1M83A 1MJHA 1GAEO 1QHHA 4H7FA 4IDNA 5AHWA 4L28A 5C52B 3HK2A 2V9CA 3KJGA 5EA2A 2FUKA 1BXGA 1PF7E 1WOMA 2Q99A 4FW8A 3QKUA 1V39A 4JP2A 5HKAA 1TAQA 3I30X 1JYEA 1U8UA 2B69A 2LDBA 3EC1A 4U02A 2ZYVX 4XYMA 3UBMA 3GNQA 4I4CA 4DIDA 4AROA 1GFZA 2F43A 1NXPA 1KEPA 1VE6A 4UXIA 2GJ9A 5DNDA 5L4NA 2P5YA 2RGRA 1W88A 4ZYTA 3AVXA 3BM5A 1I7LA 5J1SB 4CV2A 4DLAA 5K4AA 4MCAA 1NVFA 1DE0A 1RQNA 1CCWA 3E7FA 2WB4A 2A57A 1BCSB 2O8BA 4EUEA 1YRQA 5LKAA 1W96A 2OMEA 1K5DA 1ECBA 3IODA 5BR7A 1CXZA 1OC4A 1PCXA 4C08A 2EWMA 2ODBA 3E2MA 3AOEA 3C3DA 5ALTA 5F5XA 5AVKA 5CB4B 1RNLA 1KFEB 3BE4A 1QK5A 5ECGC 4M8LA 1SXJA 5DMXA 1ADBA 1XR3A 3Q1LA 4TLMB 2GLUA 2Q8QA 3C6XA 5G1NA 2QDXA 5KOJA 1ENOA 3KVVA 1K63A 3Q0IA 1RJWA 3GRCA 3GFVA 3THSA 3TIGA 1QX4A 4YRFA 4I46A 3Q88A 2I8LA 3CH5A 3UXYA 5K0JA 1L7EA 4US0R 3G8AA 4OJNA 3RIEA 4HPJB 3Q7RA 4BFXA 3JSXA 4KL8S 3VV2A 1IBRA 1M34B 3QMPA 1W87A 1MN6A 2ODQA 1EA5A 4CMJA 2GJ4A 3GB9A 3Q7PA 3RWMB 3UWDA 4BJ5A 4AUMA 3BILA 4P0PB 3CWZA 2GM4A 4R81A 1M34E 3IRVA 1UKYA 2VYVD 3KWFA 1DWQA 3THOA 2QN1A 2JGIA 4GM1A 4LV6A 3SEFA 2CDAA 2X7XA 1V26A 3E48A 3LMKA 3HNOA 4FR0A 1WE2A 3CBQA 5SZJA 2H5JA 3UHOA 2GNPA 3UVEA 1KSGA 2FPPA 2P6OA 1X7YB 2WIJA 5DB4A 1J7KA 4ZEVA 3M4YA 4NZPA 4BQRA 3PX2A 5FX2A 5AVQA 5HUQA 3KZMA 4F3NA 4MTCA 1UPAA 3U44A 5ENZA 4QJ3A 4JXKA 1ZJJA 2JCBA 2J9XB 1D5CA 3M81A 2B4RO 4F4FA 4O4HF 3N5CA 3VX4A 3O2JA 2PVCA 2Q4BA 4KV9A 5J43A 2HLHA 3TCKA 5LWQA 4ZVKA 3ABQB 3HEBA 3Q9SA 4GLJA 1LA2A 2HGZA 2IIVA 3U4IA 1OHHD 1U6KA 4U8GA 2XB6A 3PV0A 5CFPA 3TGPA 3UY4A 1SXIA 2JGKA 3EVCA 2ZT7A 2C61A 1O9BA 3FPLA 3RU9A 1A88A 3FCOA 2OXTA 1CQJB 2Y1EA 3UKDA 5AKZA 4WKCA 3SZRA 4WT7A 2IPXA 3EBLA 2IYTA 3JWHA 3N0RA 2J0SA 1CZOA 1HTTA 4P83A 2AE2A 1KO5A 5KBYA 3EODA 3ENWA 3BREA 4BFVA 4RW0A 4I66A 3K0FA 3NEPX 2PV7A 4NDNE 3DXZA 3MMNA 4CF4A 4NL4H 3OM0A 3WYGA 4MHOA 2JRCA 1C9MA 2CKMA 4FYXA 2NVOA 1L7BA 4RDCA 2FV8A 4YVFA 3PHLA 1M2KA 4MQFB 3ZLJA 2CV0A 1NSTA 2X7HA 2QQ5A 4AUNA 4EGSA 2GF2A 1EUQA 2QTHA 4H1VA 4NU8X 1FE8A 1PT9A 3GWZA 3NS7A 5DCYA 4GGMX 4XSHA 5BO5A 4EUNA 1YS7A 1XCJA 3BBPA 1ESCA 2FPMA 2OBXA 3DEZA 4GKBA 1G3MA 1JXQA 2XUPA 4YP6A 3RTBA 1JKIA 3ZE6A 5BVGB 5KQSA 2B9EA 4HI0E 2JD0A 5HOEA 5CUQA 1XZPA 1JH9A 3KP1A 1OH7A 1FJ2A 3AV3A 2VYQA 3AGQA 1G2QA 3R3VA 4HYTA 2CNWA 1OGYA 3PYMA 1Y3IA 4KHPB 1OLSB 1ULTA 1XTQA 2FX2A 4XA8A 2H54A 4OMCA 4J3NA 2A67A 3A1CA 4E30A 4M8IA 5J2UF 4MV8A 1VP3A 1BFUA 2IHTA 3FFXA 1MB4A 4JZYA 2CXQA 2O2EA 2P9TA 2ZSUA 3FFBA 4TM8A 5AKJA 5B3LA 1G5QA 2C7QA 2VPYA 1KI1A 2QENA 3O8BA 3PXEA 4WW0A 4I5GA 5CU7A 3SQDA 4PXAA 3TAUA 4UARA 1L1QA 2QORA 3WLFA 2OC4A 3KPVA 1I24A 4F6RA 1NY5A 4MAAA 1CQZA 9LDTA 1UM9A 4CQMA 1T9BA 5AOBA 3PX7A 4ZOLA 3GD5A 4ZT7A 5EJAA 1VLZA 1MC1A 1UMCA 1D2CA 3F47A 5KHOC 3LGXA 4P4TA 1TFRA 1GTRA 4JBHA 4W6ZA 4NYMR 1WCYA 1UOOA 4UHEA 5KVVA 1PDOA 4HATA 3UJ8A 2O20A 3E9EA 1SQFA 1OFUA 4RWEA 3PXGA 1EMDA 3AEQA 4L74A 3RVSA 6LDHA 1DRKA 1WTCA 1PU2A 5JD3A 1MIOA 5DK4A 1AQLA 2VRBA 3WSWA 2HPZA 4CJXA 1EFVB 4U0KA 4F4UA 3RK0A 1LW6E 5D87A 3AHHA 4TROA 1ID1A 3DAFA 4FGJA 3SX0A 1KY3A 2QMQA 1WUJS 3E53A 3LXMA 5LFAA 3OQPA 5JAHA 3U7GA 2HV9A 4DWJA 4ND2A 5BSGA 4YCBA 5FTMA 4EW2A 4PR0A 4BP3A 2V7VA 1UH5A 1US8A 4YGYA 1GSOA 2EC5A 3FSGD 2BFCA 1WMEA 1TRHA 4NENA 4PR3A 1EFDN 1QVWA 3KIPA 3HZZA 4LBYA 4MS3B 4RH3A 4AZ0A 4DV0B 1RBQA 1WG8A 3VX3A 1BZYA 1VKRA 5KYTA 2Z1DA 4RFLA 1E2FA 2D5BA 5AI5A 4RWZA 2GEDA 2XRFA 1QHEA 2QRUA 3SSOA 1NQXA 3PCRB 1O57A 5ALUA 4BTVA 3GLFE 4Q19A 2X15A 4LXUA 1T6NA 1BGVA 1JXOA 4JLOA 2BFOA 1XO1A 2O50A 1QGYA 3I6YA 4KCGA 4MWGA 3TR6A 2AJDA 1ZISA 5DOVA 4LYJA 1EG2A 5BN3A 1RRFA 1ZMOA 3AG6A 3ESAA 3DYIA 4ALLA 1W30A 5CDGA 1HFKA 1M8KA 4HDMA 2CFRA 2IUTA 4UTVA 1JMVA 3QWFA 3OEHD 1NJ2A 1Y1SA 2HN9A 2JEOA 2DOKA 2WAXA 3VAAA 4PIMA 1YB7A 2RH4A 3GLRA 9ATCA 1I8TA 1VLHA 1QGZA 1UXHA 5U4QA 3UV7A 4MQ5A 4YUXA 2Z5VA 3NBUA 5DN6D 4Y98A 3SIPA 2AOXA 3IMEA 5SZHB 5JFOA 2J0QA 5H70A 1UKZA 3FBWA 1XMXA 4DOMA 3L3BA 1N3YA 1UDXA 5EHIA 3RRMA 1A4IA 1IY0A 2B8JA 1SCUB 3PFGA 5HA5A 2CT8A 1GXSB 1Q7EA 4I1RA 3ZZ0A 4E5KA 4OQLA 1P2UA 2DAPA 5FI3A 3AOEC 1CY8A 1U8FO 5HE9A 3R9WA 4P32A 2Q2OA 2IP1A 2JIRA 3MJFA 1KBZA 4EBBA 4PBRA 5JLAA 4CTKA 1UBFA 1XP5A 3ASZA 3DULA 3DZKA 4K6CA 4NYJQ 2RAPA 3SHFA 1SXJC 4D4KA 5B7QA 3MFYA 1W48A 4I55B 4RADA 1NYRA 3QYAA 4PHFA 3WKAA 2WIBA 4CM5A 1VI2A 4DQVA 1OC2A 1VB5A 4GUAA 3G2OA 2PUWA 2QJFA 2R79A 5EOVA 3N6VA 1Z6TA 1VP9A 1YC5A 4L76A 1W52X 3IESA 5EWLB 4NMXB 3TTWA 1FX0A 4RV4A 5ITWA 2MU1A 5KTSA 4GMHA 4OD0A 1QP0A 2ACEA 3VH2A 3E27A 3CVUA 2G8NA 2QTRA 2XEXA 3VR6A 3ZTTA 2RHRA 3DFIA 2C7PA 4LDNA 3V8RA 4RANA 2QAGB 1D8AA 4KVGA 1Y4SA 2MINB 4U2DA 1I0IA 3UG6A 4E5YA 1ZD9A 2AJTA 1MJ5A 1RWOA 2QN3A 2ZJ8A 4N0DA 1N36B 3L0DA 4EGQA 4Z4FA 4Y6QA 3S55A 4Y1GA 2KX7A 1MOSA 5K0LA 5K0ZA 3CNBA 1PSDA 1A76A 2VDRB 3KYBA 2VSYA 3DCYA 4QT0A 2GN9A 3HCRA 4Z51A 1A04A 3SHWA 2NU6B 3W2EA 1UXKA 3OQOA 4R3UC 4K9DA 3TIVA 3QX3A 1COZA 3QUQA 1OWOA 2I62A 3IVRA 1GR0A 3GJ7A 1YZLA 3OIVA 2XVZA 4FHDA 5IZCA 3WB0A 1Q22A 1NC3A 1M2OA 3TSZA 3RFXA 4QDUA 2WM8A 4D8VA 1PNQA 1Y37A 2ZIEA 3RUEA 5FPSA 4AFNA 4E2WA 1QU2A 1KHTA 1SEPA 1DEXA 3UB2A 1FMFA 2V5UA 1RBMA 2Z4TA 2V54A 3DW1X 3EAGA 2Q5QA 1C14A 2VH2A 2X2EA 2J45A 4JHXA 2BFMA 2XE7A 3AM3A 4Q0MA 1IUKA 3HCPA 4FFOA 4D0GA 3HWWA 4Q7LA 4CL2A 1PR5A 3GI1A 3H13A 3DWEX 1YIOA 3I6MA 3PPYA 4FFPA 5JECA 3E7WA 3HKBB 2I80A 2WYUA 3A6DA 3KR0A 4II7A 2DY0A 4KR0A 4PYOA 1Q1EA 4LDJA 3BRCA 3NDIA 4QUIA 1SD2A 4MPDA 1U3DA 3RAEC 4GPAA 2A5YB 1NJSA 1OXTA 2PSJA 3QG5A 4JVLA 1PTKA 4NDAA 1DEOA 4XTCS 3QVKA 1WULS 1ZGGA 3RIMA 2X0EA 2FJUA 5CP8A 2X0DA 2KI5A 3PE4A 5IG2A 3C3KA 4C7MA 2GXQA 3H2JA 3JAKA 4IZOA 1VA5A 3PJRA 5LP6B 1QBGA 1WABA 1WQ1R 1BRMA 1OU0A 3KT6A 1VLLA 3OPYA 3WIDA 5KTRA 1LNQA 3VU3A 1CY7A 2V45A 5DHFA 3DPSA 1DQPA 3ZK8A 4K2AA 1LJ8A 1OZ0A 4S1NA 1ZOPA 3GUZA 1JJBA 4PX3A 4ADSG 5FTWA 5B1YA 4MVJD 3C1TA 4G97A 2JW5A 1Q92A 2JJ1A 4MYCA 2VNSA 4HVAA 3FR8A 3R8CA 4DJFC 3HDGA 1TCVA 4KR9A 1XU7A 2HDHA 5FR1A 3MJTA 5FOWA 1OWPA 4GL2A 1Z0DA 3V7WA 3OCUA 1TEVA 2RHTA 4JS0A 3ZWKA 2BFWA 3B8EA 1AHIA 3EIWA 3QPVA 1WZEA 1BU8A 4A0SA 4CIWA 5JI3E 1PHPA 2QPAA 2IKQA 3BD8A 4RS4A 4JROA 1C9DB 1G55A 1COWA 1GYRA 1D9ZA 3CUSA 2M2IA 3ET4A 1CS4C 3PQFA 3W06A 3GHYA 4MYDA 5CB0A 2QBYA 3OFJA 3GFOA 3FD8A 3G2HA 1UJ2A 5FL3A 1YRLA 4PE5B 4C6TB 5ENVA 4X24A 2B3DA 1DEAA 1CVIA 1CRWG 3PEFA 3C8ZA 4WADA 1IRXA 1X7WA 2OA0A 3P9RA 2WI8A 4ZDJA 1L7AA 1KFKB 1Y33E 3M3DA 2V74B 2JLQA 3C3BA 2ZJZA 4FINA 3NGXA 1CJTC 4NBKA 2YN0A 5G4KB 1GL3A 4F06A 4KXMA 2FRDC 1Q0HA 1W581 4FE4A 3LOQA 1FZTA 4QHYA 2OCXA 3MINA 4AX8A 1YA6A 2O4CA 2BTQA 4H3VA 2XNDD 1SB9A 5HYVA 2I03A 1EI9A 2P75A 1IN6A 1Y1LA 2ZYHA 4TV9A 1AC5A 3CH7A 3ELWA 4QEDA 4TUYF 4ZP1A 5CPFA 5EE1A 1O4VA 3A70A 3HP1A 1ZMTA 1QGED 4BUJA 3LQYA 1MH1A 5EL0A 4Z4CA 2IITA 2Q27A 4X93A 4GOLD 1FFXA 4YJHA 4WDQA 3BMNB 4IIEA 5I4CA 1KI2A 4F91B 4CBVA 1GRNA 1MENA 2QEQA 3RUDA 1JIKA 1E9AA 3K1YA 1I2AA 3AW8A 2WIAA 2ZT8A 3MG9A 4D79A 2H06A 2REOA 3EDOA 4JI4B 1NZDA 4URWR 3EF3A 2EW8A 4MUHA 5CFZA 1JA1A 2L69A 2C2BA 3R3YA 4ZOCA 3D6AA 3K9GA 3BTSA 2ZUWA 2CWDA 2GCGA 3T7IA 4JU9A 1VMEA 2XUOA 4K6MA 1XD8A 2JAWA 4MKFA 5CAEA 2D2IA 3I2GA 3MRTA 1JHVA 4JT4A 2J9YB 4P4SA 2OHHA 3D54D 4ND6A 4RORA 4TT3D 3RSZA 4ENTA 1M0WA 1O1YA 2F17A 1NP3A 2UVQA 1GU1A 4HQLA 4MVJF 4P80A 1OUMA 1SCQA 3R41A 5JD6A 5JZ9A 4HNAB 4M36A 1JEQB 1JA9A 5D6NA 3NHFA 4ZT6A 2PJDA 4TX1A 4C1NA 4PRLA 3KVOA 1X2BA 2J0UA 1YZ3A 3PCXA 3PHJA 1JR3A 2M32A 4K8OA 4NBTA 2JFHA 2JGDB 3FMFA 1QM5A 2PBLA 1RIIA 2IW1A 3NO4A 3WB2A 1WQ4A 1YU6A 5EHQA 1PW5A 4CMCA 4X8OA 2WHPB 5B53A 1DJPA 1G6HA 1BDBA 3B6JA 3O5AA 2Z0MA 5HF5A 1FA9A 1YS1X 2VAMA 4BX9A 1ODIA 1J2YA 1HEUA 1NMEA 4EPXA 4QODA 2YHAA 2X77A 3OC6A 4REQA 4UBNA 2A35A 1J0EA 1U02A 3CB2A 2LVBA 4MUJA 5AXDA 1BMTA 3WSTA 3ZNPA 4CM1A 1YCFA 3DLHA 3ZV7A 2AMJA 1LZKA 2YINC 1EFRD 4PIVA 3ZR4B 4DM4A 1O9HA 1EZ1A 2QYSA 1ZCZA 5AI9A 4IXTA 4O25A 1A27A 2YWJA 4OLFA 3R7WB 3ZTWA 1EUDB 1NFRA 1MW8X 1HSZA 3IPRA 1Q57A 2FPUA 5CDHA 4GR4A 2EJCA 1LSSA 3IPLA 3QFHA 3FRHA 3MVEA 4JUCA 3QU5A 2V8BA 4KMRA 4NULA 2W4QA 3E7XA 3JWEA 4JVSB 4JLPA 3DC7A 3HUEA 3ROQA 5AVTA 1J1UA 1ZUNB 3EIFA 2WMDA 1QHXA 2ZJ2A 1BHSA 3DM5A 3VQTA 2RHBA 1X80A 3NAZA 3ON5A 2AH5A 3QE4A 4KE8A 3A7EA 1MXFA 1Z5ZA 2B6NA 5BRNA 2Z9DA 3S29A 5BSRA 4Z4QA 1Y9ZA 1E0DA 5THXA 1F2DA 1Z35A 3I2KA 4IIHA 2XMGA 3X44A 2QSYA 2P3SA 3BWYA 4HWGA 3GLIA 2BHNA 1O77A 5IVHA 1RLJA 1KRWA 4W5WA 4X3PA 2Q8NA 3T61A 3ZUPA 2X9VA 1XNRB 3IAHA 4YV0A 1XC7A 2ZCUA 1FL9A 5FOTA 1SCNE 5IZCC 5FUQA 3VOBA 1B8NA 1NN5A 3C8DA 1LZLA 2GXSA 2V7QD 2QVCA 2GEUA 2FQ1A 3A32A 3QRWA 1O58A 1K6MA 1T36A 2WTNA 4FEEA 4KB5A 4YHBA 5CB4F 3PFHA 4K9OA 3BFVA 1UOEA 2ZSKA 3EISA 4BCCA 1BQ4A 1QHNA 2HA5A 2FSGA 1LLUA 3DHEA 3PC7A 1YTLA 4LYYA 1T6YA 3HR4A 3IOYA 2XZTA 4RK4A 4LFCB 4JJ7A 4OH1A 4WESA 3WNZA 3ZQ6A 4MUKA 3CUVA 3VNVA 1WM1A 1YOVA 3C5VA 4KFRA 2CXTA 3AHIA 4NK5A 5FFMA 1ZMRA 1JMYA 3H3XA 1K5PA 3O03A 1B6SA 2WT4A 4G56A 1U2PA 2ISCA 2NAPA 1KJIA 1JH8A 1VSTA 2EKBA 2FQXA 3CJQA 1LSUA 1KYVA 3PQ8A 3UMFA 4ER6A 4NYIR 1NWHA 4BO9A 3HUDA 1XMJA 1AGYA 4DR7B 3MCAA 1RCUA 1SVSA 1N1MA 4DL9A 2I4RA 2C4KA 5BR8B 1KYTA 4D5EA 4JR1A 3EPKA 3NBFA 3KNZA 4JBWA 2HA2A 1K7FB 3TPFA 3FDFA 1MC5A 4MEJA 4MMYB 3H1PA 1O54A 5ED4A 3MTEA 5TX7A 1UK8A 1WDKA 4ZRNA 4RJJA 2OLEA 1OBVA 4F04A 2JEZA 2AC7A 4C4AA 3JVDA 2PJUA 2B3TA 1RLUA 1Z06A 4J75A 2B8NA 3M6XA 4N54A 3IAAA 1ZCBA 1SD5A 1JNXX 1HURA 3JTMA 3OKFA 5AW6A 1E9FA 3IH5A 4O2AA 4MUAA 3HADA 3K0EA 4X20B 1H9AA 2I1QA 1CUGA 2NSLA 3OP1A 4O0MA 5LA6B 2HMTA 2C00A 2IBSA 3H9EO 1BHO1 4RAOA 3D2AA 3KG2A 1UR5A 2VDJA 2LW7A 3BT7A 2CCKA 4CF3A 2L82A 3SK0A 5LQJA 5EQFA 4PYQA 4LVOA 3J80A 1CUHA 4RXTA 5FUBA 4UCXA 1T26A 4FZRA 4WCFA 1OVGA 4WY2A 5AHRA 2J3IA 4QGAA 2X7JA 3BSFA 5ALPA 4LS3A 2P2ZA 1HQDA 4NHOA 1YCDA 2EQAA 2W93A 3E8XA 2I2AA 3K9WA 4OQYA 1RFGE 5KNDH 4W1PA 1EIWA 4MVJP 2HHLA 2ZIWB 4WZBE 2F1JA 2G5TA 4P34A 5DZSA 3W5VA 4BLUA 5JR3A 1C81A 5HDBB 5K0BA 4O4LB 4B6FA 2WR8A 2D06A 4DB4A