3QPWA

Pfkfb3 in complex with aluminum tetrafluoride
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
437
structure length
431
Chain Sequence
ELTQSRVQKIWVPVDHRPSLPRSNSPTVIVMVGLPARGKTYISKKLTRYLNWIGVPTKVFNVGEYRREAVKQYSSYNFFRPDNEEAMKVRKQCALAALRDVKSYLAKEGGQIAVFDATNTTRERRHMILHFAKENDFKAFFIESVCDDPTVVASNIMEVKISSPDYKDCNSAEAMDDFMKRISCYEASYQPLDPDKCDRDLSLIKVIDVGRRFLVNRVQDHIQSRIVYYLMNIHVQPRTIYLCRHGENEHNLQGRIGGDSGLSSRGKKFASALSKFVEEQNLKDLRVWTSQLKSTIQTAEALRLPYEQWKALNEIDAGVCEELTYEEIRDTYPEEYALREQDKYYYRYPTGESYQDLVQRLEPVIMELERQENVLVICHQAVLRCLLAYFLDKSAEEMPYLKCPLHTVLKLTPVAYGCRVESIYLNVESVC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis of the fructose-2,6-bisphosphatase reaction of PFKFB3: Transition state and the C-terminal function.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase,hydrolase
molecule keywords 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3
total genus 154
structure length 431
sequence length 437
ec nomenclature ec 2.7.1.105: 6-phosphofructo-2-kinase.
pdb deposition date 2011-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1)
A PF01591 6PF2K 6-phosphofructo-2-kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3qpwA01
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 3qpwA02
4JVLA 4R2IA 3WYAA 2QORA 3CIOA 3DCYA 4GT1A 5GJWC 1P5ZB 1SK9A 3TJZA 4KFTA 4TYYA 2AFHE 1W46A 4HDCA 4E09A 3MRSA 3IILA 2AK2A 3A4MA 4MDFA 3FHTA 3RYTC 1XEXA 2VBCA 4M9XA 1GL7A 2FGKA 1N6PA 2ZJAA 5LBIA 4R9UC 2PX0A 2C8VA 2ZE7A 3C5HA 4P33A 4QHTA 4ASUD 4FCVA 3GLHE 4C0JA 4WBSA 4PX9A 1U9IA 2QMUA 2XX3A 3IT3A 4JOCA 4BGDA 1P61B 3B9QA 3BRWD 4OQXA 1HH4A 3Q72A 1A1VA 3RS0A 2JDIA 2Z4RA 2ZAOA 3BD9A 1UDXA 3CX7A 3OHMA 4HYYA 3T5GA 1YR7A 2BCJQ 2NTYC 4JLNA 3AF0A 3LVQE 3VR4A 4JBXA 2BM1A 5EUQB 1SKAA 3IQXA 1S96A 5CYOA 2KJQA 3MJRA 2WTUA 1E2HA 3RS2A 1KI6B 1R0WA 3JZAA 1Z06A 1XEWX 2H17A 2CDNA 1N5JA 2WWXA 3MWKA 1Q1QA 4B3FX 3FE2A 4OI4A 2WV9A 2WU0A 3GP8A 1AZSC 1OXXK 3MGCA 4ZDWA 5KNBA 3SE0A 3OEEA 3QKRA 1Z3IX 4P3YA 1KY3A 4QHSA 5TARA 3ZZTA 1P2SA 1SXJC 4PZAA 1RFLA 1U90A 3MG9A 2PLFA 3U3MA 2CK3D 4IVQA 3FMIA 3ZD7A 2Z0MA 1KI2A 3CX6A 4ON9A 4B32A 3NVAA 2XGJA 5JWRA 4OI2A 2ZE6A 2ZI6A 1RPZA 1S3GA 4YMTA 2QN6A 1G3IA 1Z0DA 1RE0A 3QIAA 4EJSB 2ZRCA 5E7IA 3A6PC 3GP3A 2CJWA 2XTNA 2CL7X 2VEDA 1CJMA 1A2KC 5EXPA 2VL7A 3KKPA 4IJMA 4M1MA 1IXZA 2PZFA 2HIAA 2OSBA 2Q9CA 2FPLA 4G1UC 3I62A 1E2QA 3BGWA 3Q7PA 2Q3FA 3IT0A 2IBMA 2ZRAA 2RGAA 3K0FB 4TL9A 4PXAA 1PZNA 5L3VA 3RRZA 1OE0A 2F1IA 1SKYB 4Q7LA 4Q4JA 1WRBA 1SVMA 1II8A 4KYIB 1G7TA 1FMJA 3RWOA 4BFUA 1C1YA 1GNPA 5HE8A 1GZSA 3MD0A 5BXQC 4YONB 1SKYE 4DLSA 2GILA 1XDBA 2JAQA 1W48A 1ZVQA 3GJ0A 4DDVA 3I8XA 1W36C 2VP5A 5FOXA 4DB4A 1GITA 1U81A 1G20E 2HT6A 3MWLA 4Q47A 3ONWA 1XTJA 2HXYA 3PFIA 4KYUA 1VG0B 3AGPA 1WXQA 5FBRB 1G5RA 2CLDX 2GF0A 3AB3A 3HJNA 3I1FA 4LC1A 1XJQA 4I1VA 1ZJ6A 2ANCA 1E0SA 2AX4A 3KB1A 1G4AE 1DAEA 2AD5A 1P2TA 4QGFA 1U8AA 1VIAA 1VYVA 3WBKA 3U7FB 2NMVA 2OCBA 2QT0A 4TSFA 1VG1A 1MRSA 2ORWA 3GJ6A 4ARUA 3SJCA 2PL3A 4IXNA 4ZO4A 4CEJA 1E59A 1AKEA 1ETUA 4NU0A 4NYMQ 4NYMR 2GJ8A 2ERYA 3LBNA 4JODA 5A4JA 3MBKA 4IKEA 4V0ME 3PITA 4D4KA 4HLUC 4FWTA 1R8QA 5EXSA 2OXCA 3GEIA 1W0JA 3I4LA 4OI0A 3K70D 4JZKA 3I32A 4C7OA 2RGCA 3B5JA 2VHQA 1NSTA 2QQ0A 1AS3A 3FHOA 4JLBA 1G41A 2FWRA 2P2YA 1CVIA 4E03A 3E9EA 4ZDIA 1N6RA 3P26A 1IN4A 4EPWA 1O87A 3QQ5A 3W34A 5BW8A 5B58C 2P6NA 1GRRA 2ZANA 3KZ1E 3A8TA 3JZMA 2JIZD 1QDEA 1V5WA 3RVBA 2Z4SA 3KTAA 5JSZA 4LDJA 1TUIA 3TGPA 5GJVC 2GRJA 3R9IA 1X6VA 3T1QA 2O0HA 4PQFA 1KGDA 2QZ4A 3D3QA 3TE6A 5GJBA 4LJAA 2C78A 1DAHA 1C7ZA 1W36D 3LH5A 1F5NA 4I1UA 2D4HA 1E9SA 2ZE8A 3D31A 3PUYA 5L8VA 1FUKA 2GJKA 1G8PA 2RCNA 3OESA 3SN6A 1BMFA 2CVHA 3NH6A 1TX4B 4LYAA 3O8BA 2OFOA 3BH6A 3AVTA 2YN0A 5F98A 4LHZA 3NDPA 3A1VA 5IRCD 2P67A 1NN3A 3ADCA 1OIXA 3I8SA 1JR3D 2Q6TA 1NY5A 3P32A 1S8FA 2WAYA 3X1DA 4A82A 3CNOA 2ZAMA 3QPVA 3CR7A 1FFHA 5CLLA 4KU4A 1EWQA 2W58A 2LKDA 2X2FA 3KKQA 1BH2A 1L4YA 3GJ4A 1FP7A 4OBEA 2WWGA 1KSGA 4B44A 3SZRA 4LJ7A 2WOJA 5CDFA 2DFNA 3NDBB 2H16A 2O52A 3GLFB 4QBIA 1OB2A 4NCNA 1Q22A 2YWFA 2QTFA 4JLAA 2QRZA 4M1KA 4OHWA 1FTSA 2GCOA 1QF9A 2W00A 3O8DA 4QG7A 4LV6A 2RB4A 2JCSA 4BFXA 2XB2A 4LX0A 3TNFA 3Q8XB 4CDGA 2C98A 2ANBA 2WJIA 3AH8A 3FKSA 3VU9A 2JJ8A 4LY6A 3T5DA 1TPZA 5KYKA 1CJVC 2BKUA 3WMGA 3PXGA 1LB1B 4JS0A 4O25A 1P9NA 1U99A 1NVUQ 2IA5A 1QHHA 2A6PA 2XZPA 1JPNA 1T6NA 3QKSA 3N2IA 2G88A 1ZM2A 3LWNA 2FA9A 3VAAA 3IT2A 4I1OA 4TL6A 4ITRC 4JJZA 1IHPA 2XITA 4PAMA 3HJGA 2PJRA 4ZDKA 1TEVA 3ASZA 2F7SA 3EPJA 1HE8B 2F1RA 4BWYA 3TUJC 1YZLA 3SYLA 4B73A 3Q7QA 5JRJA 5KSOA 1N6OA 4JIMA 3AUYA 1NN1A 1A4RA 2GF9A 4TLCA 2IYXA 2L0XA 5KDDA 1S4QA 1SXJB 3C16C 4GBMA 2ZU6A 4M1OA 4DSTA 1ND5A 1MO5A 2CCGA 1Q1EA 3G0HA 3KUDA 4M53A 3U7EB 2F43A 3WMFA 2ZXUA 2IS1A 2FOLA 1FNMA 3AP1A 1NKSA 4Y0AA 4CW7A 4EJSC 4LYJA 4JMPA 3CONA 5K8UA 4LJ8A 4DLYA 2GXSA 1E9FA 2OWEA 2GESA 5FUVA 4TT3A 4JT2A 3B1VA 1E9DA 1OFTA 4DSNA 2QENA 2XNSA 1JEEA 5JI2E 4US0R 4BEJA 3SC3A 2G6BA 4F92B 4YC7A 3AUXA 5L3RA 1LNZA 3CWZA 4BZPA 2QRNA 1NF3A 5FOSA 3VR6A 4PZ9A 1XXHE 4AI6A 3C5CA 1NMYA 1MO3A 4DT1B 4XH9B 3KTAB 2ZRLA 3O8CA 4G3XA 4IRUB 1WQ1R 1CRPA 1GWNA 1R5OA 4KV9A 4A6PA 4JVMA 4M0LA 4Z51A 1R6BX 2B7CA 1NRJB 1ZUNB 4IXMA 4RZ3A 2JEOA 3TSWA 4QHYA 3Q9LA 2G3YA 3GCGA 3THXB 4LBYA 3FWYA 4MA4A 2VSXA 2O5VA 3K8YA 4OQMA 4OHXA 2DFTA 4EPYA 1A7JA 1Z0FA 5CIQA 1EESA 4XD7D 2F9LA 1G17A 1I4LD 3A1SA 3BC1A 1LVGA 5JWOA 1UDWA 3GJ3A 1G3RA 4DCSA 2VYFA 4C0SA 2IK8A 1KI1A 3K0AA 4OQFA 1VPLA 1CR1A 1DARA 1BS1A 2ZR7A 4TTRA 2JLXA 2P9FA 3TLXA 3TSOA 3KQKA 5JCPA 3UIEA 3GPLA 1JQJC 2GXQA 3CPJB 4V0MA 3CF6R 3B2EA 2VP6A 2YVUA 4W5JA 1ESNA 2ZROA 4V0KA 4HUQA 4GL2A 1G291 3UMSA 3TSZA 1DKPA 3HU1A 2V1XA 1N5KA 3NHAA 1FQJA 1P7CA 2IWHA 1IN7A 1HT2E 3K9LA 1HURA 5FUXA 2YWHA 2P30A 3W5JA 4BEBA 1Q20A 2J0VA 3A36A 1SHZA 3ND9A 4BFZA 4WW0A 3SJBA 3EIHA 2BMJA 2HV8A 4IJ5A 4YMVA 1R7RA 2O8FB 2H52A 2CL6X 5FI1B 3TUZC 4QFMA 3KL4A 1M7BA 3F2IA 2RHMA 4DSUA 1GNQA 4AG5A 4ZPXA 5FBVB 2ENWA 1UPTA 4CT5A 2KWIA 4TMXA 4KLNA 4S2EA 4BECA 1C81A 1H8EA 1R0XA 3Q85A 5KHOC 2YKGA 2KB0A 4UJ5A 1II9A 1JXOA 1MT0A 2FSIA 1FTNA 1T5LA 2CCKA 3IHLA 2ZS8A 4PO9A 1W44A 2DCUA 5UKDA 2D74A 4EJSA 5FPHA 1E6CA 2PJZA 3QXSA 1DO0A 4YMSA 2OLKA 3C41J 1CS4C 1SK8A 1LW7A 3CH5A 2WJJA 2GETA 1OH8A 3MLEA 4P32A 2OT3B 2A5GA 4ZDJA 3QI2A 1ODFA 1AA9A 1F48A 1SVKA 4A0HA 1YZQA 5FH9A 4E3WA 5E95A 3L82B 1OIVA 1I4DD 1DKOA 2ZSFA 4OK6A 4XVUA 3I73A 4OHYA 2SHKA 1XB2A 1CLUA 3LRPA 3LW8A 1CXZA 3LX5A 1H8HA 4V0NA 3ASYA 4D80A 4I81A 3CRQA 5AJWA 2WJVA 3L8ZA 2IS4A 4G5SA 4M9SA 3VMFA 4LOAA 5J4KA 2W2VA 2YOHA 1W5SA 2FEOA 2WAXA 4XVRA 3GLFA 3X1XA 4CGZA 4TTQA 1ZUIA 4EMBA 2GXUA 1NIJA 2VO1A 4KO8A 4B75A 5FTMA 3SFVA 4RZ2A 3VQTA 1HYQA 4MYCA 3FDZB 4JBYA 1TU3A 1S2MA 1R2QA 2HCBA 1KKLA 3RC8A 1HV8A 3C7TA 4TYQA 3BBPA 3V4FA 3VR1A 1JB1A 2IYLD 5J4HA 1PLKA 2IF2A 1FP6A 3H84A 3WP0A 3SBDA 1CP2A 4RD2A 2VP0A 2Q3MA 4C0AC 1CULC 4M1TA 3BB1A 4Q4AA 4OL0A 3DO6A 4PPNA 2KSQA 1YFKA 3LV8A 5C46F 4QXAA 4QOSA 5HCNA 3U7GA 1NBME 1RW4A 2ZYTX 2F3TA 5FR2A 3VKWA 3NFYA 2AR7A 4XTRA 4WZAE 2JJ2A 2I3BA 3TR0A 2IYQA 2XNDA 3V00A 4TZ6A 1SVLA 1DVRA 2FH5B 4CVNA 1JR3E 2J46A 5F3WB 1E2LA 8OHMA 4Z1MD 2D3WA 4IDPA 1YHNA 3JVVA 2P3SA 1CIPA 4OQNA 5TY0A 1Z63A 4PC1A 1T8TA 5TXGA 4EKDA 5IK2D 2NIPA 3FFAA 1BIFA 1J99A 1T3SA 4Q7JB 1HQCA 2FSHA 4RD0A 3ZJYA 3K0AB 3WXMA 4DWJA 5FFMA 4XD7A 2XAUA 1E2GA 3SI7A 2W6JA 1Z6YA 3T1VA 3ADDA 2IHYA 3RS4A 1XJCA 3K53A 4A9AA 5E3HA 2MSCB 3ZVLA 3GQBA 1W4BA 2XSZD 4TQUS 1J8MF 1PLJA 3GW8A 1KI9A 3AVXA 1ZU4A 4K46A 5LD2C 2AL7A 421PA 2OG2A 1AGPA 4Z1MA 2NG1A 1T0JB 3DZDA 4NKRA 3RABA 4I1SA 2CHQA 5JJIA 1NJGA 3K0FA 2TMKA 1KNQA 4CYMA 1Q0UA 2GNOA 5EQTA 5FL3A 4E22A 3QF4B 4TQAA 5SZJA 3HYTA 1KMHB 1GFIA 3CNNA 1EBBA 2P75A 1A5TA 1GL6A 2CJWB 1Z6TA 2GBLA 2REBA 3Q5DA 1F6BA 1P6XA 5CB8A 1G64A 3SU8A 4ZI2A 1W0JD 4QBHA 2J45A 5CIWA 3MSXA 4QKQA 1WCV1 1QFXA 3VX3A 1AQUA 1XWIA 2UZ3A 3DKVA 4JLDA 3ZH9B 1U8YA 2AWNA 2IF0A 4K8OA 1LY1A 1G4UR 2EFGA 4G0NA 2NPFA 2WICA 2V9PA 2OO7A 5FOUA 1G8HA 2R9VA 3OEED 3LX8A 2E9SA 5FUWA 4AYWA 3QXJA 2ZI7A 1XXHA 3AF1A 4UNSA 4IFBA 5KU1A 2V7QD 1YJ5A 2QAGA 4EIWA 3IGFA 1U98A 1XU4A 2ZSDA 621PA 4Q21A 4XTCS 3M4YA 2DHRA 2OV2A 2ZJOA 1Z6XA 4XIGS 4TLAA 1AGRA 4P31A 4JLJA 3LW7A 2IL1A 4MYTA 4UQOA 3ZD6A 2IUSA 1HQYE 3N2EA 3UWOA 3EPKA 2RGBA 1DAIA 1N6NA 2P78A 4MRRA 2QG6A 3U3RA 2FZLA 3B85A 4UXJA 1KDTA 1G1MA 5H68A 3QKUA 2Q21A 2VF7A 4U5XA 4L9SA 2IEZA 3O0TA 1G8GA 2W2XA 2ZRFA 1YZGA 2EYUA 1CU1A 4EPRA 3VHXA 3IIJA 5DN6D 1G6HA 1OHHD 3QUSA 3OIVA 1E0AA 2KI5A 1BYIA 4N0EA 2ZRGA 6Q21A 4Q02A 4Q4LA 1G16A 4CIDA 1UKEA 5AUNB 3K1JA 3GLHB 5H1YA 2HXSA 5KSYA 5EUMA 4B3BA 4AD8A 2P2ZA 3MXOA 3PEVA 3QXHA 4IVPA 1AS0A 1T3LA 3RS7A 4GDFA 1LFDB 1NLYA 2W6JD 2FEMA 3GEHA 3K0CA 4FN5A 3MJHA 2O8EA 2ZITA 4IJ6A 3PG5A 3FHCB 3H1TA 4ARVA 2XXAA 1CJKC 2NGRA 1MOZA 1TIPA 1RJ9A 5CITA 1E99A 1TUEA 1XFAA 3B1YA 5KO2A 5JECA 4G5OA 1K5GA 4R7ZA 4ODIA 2NZJA 3FFBA 5KPJA 2P9ZA 4M1YA 4O2RA 3G5UA 2WJGA 3L0PA 2VF8A 4GSYA 4OJQA 2G83A 1RYHA 1N6LA 5CDFE 1XQ9A 2GZDA 3M6AA 3C14C 4D0GA 4KXFB 2JLRA 2YWEA 1DELA 4RZUA 4DBLC 2J9RA 2CNWA 2YN2A 1N5IA 4D2IA 2N1BA 2YZ2A 1OW3B 1R0ZA 3F3YA 1P73A 1PUJA 2EFCB 2BKEA 2HYDA 3AV0B 2UKDA 1MO4A 3EC2A 3R9WA 1VCIA 2C95A 3QENA 3BK7A 3WHKA 2EVWX 3EIEA 1W4AA 2R6DA 3FKQA 4AC9A 4ARZA 2G9NA 3QVVA 1XTRA 4JVNA 4AKGA 5EE5B 4HAVA 2H4XA 2PCJA 3GD7A 2GA8A 4M2LA 3U4QA 4NCIA 3E5HA 3IBYA 1P3JA 1UBCA 1XCPA 3ETLA 4IOLA 3T35A 2VH5R 5AJYA 1KI7A 4A2WA 1NG1A 1F60A 1W47A 3OAAA 4GPTA 2YC4C 1OFIA 2D06A 2MMCA 4JLVA 4B6FA 1M74A 5DI3B 4DXAA 3AKEA 2YNMA 4PC3A 1DEKA 3U44A 1UJBA 2ZE5A 4Q4AB 1VKJA 3BE4A 2AXNA 4BQSA 2V8OA 1A82A 1OHHA 2VHUA 1W1WA 3A4NA 4OKSA 2PEYA 3EPLA 3UG6A 1HT1E 4D82A 4DLTA 4DIEA 5G3ZA 4TYWA 2FFQA 3TMKA 1RIIA 4AKHA 2P77A 2FNAA 3HYRA 4B71A 1G9XA 3KFVA 1N0WA 4PFSA 4WZBE 3ZS8A 1U94A 4EPXA 4C9BA 2I4IA 3FDZA 4MKFA 1R8SA 3A58B 4IEIA 1S9HA 5D3MA 4D25A 3QOFA 2W6ID 4YXWD 1EFRD 3CW2A 3U3KA 4PZLA 4HZUA 4L8GA 2WIAA 2YWGA 1YR9A 3AVVA 2XZLA 2B21A 3FOZA 1X1RA 3DOEA 2C04A 4ZCMA 1P62B 3HWSA 4WIAA 1KZ7B 2IS2A 2LKCA 1X1SA 3EA5A 3CRMA 3VX4A 3AGQA 4QM7A 1PLLA 4MGZR 2BOVA 1UM8A 3LQRA 4HUTA 1II8B 4POAA 1KI6A 3DHWC 3I5YA 3AVUA 5F9FA 3WMEA 2R6GA 1JR3A 3PVSA 1Q12A 2Z83A 4JL8A 2VHCA 2QP9X 2P65A 2BMFA 4RSGA 1RVDA 4TMTA 3W90A 4FMDF 4ARZB 2GXAA 2ZJ5A 1GDDA 3N5CA 3RANA 4C0QC 3U61B 2GCOB 3GLIE 2N46A 3EZ2A 3SYKA 1TADA 4TTPA 2JLUA 2QUZA 4OI1A 4HZIA 4ACAA 4RZXA 4DJTA 3LY5A 3UATA 4PQYA 1AKYA 1YZTA 2GVZC 2OCAA 3NKVA 3CM0A 2J7PD 5BWMA 2RGEA 2ZVPX 3BB4A 3QKRB 4EQ6B 4PHHA 2CMKA 3VHLB 5HCIA 4PGMA 2JIZA 1S0UA 2P5TB 3O47A 1DAKA 1E79D 5GVSA 1A2BA 1SVWA 1X8LA 2A2ZA 2QMHA 1RJ9B 3A1UA 2ECKA 1YU9A 4OJKA 4KSCA 5JRZA 2XB4A 4Q7KA 2R2AA 4HEJA 2IUUA 4DHEA 1ZRHA 1IXRC 2IW3A 3PUZA 4ABYA 2DFKB 2O8EB 4PC2A 4BRWA 4M21A 1I2DA 4XWOA 2FMXA 2ZSEA 5K8TA 5DIFA 1DOAA 1JR6A 4B6EA 3CKLA 2GAOA 3GFPA 1P9RA 1Z28A 3EAQA 2Z43A 1Z6AA 2F6RA 2ORVA 3F5FA 1K6MA 3A4LA 2O8BA 2P5SA 1KAOA 3RS3A 3L0IB 4D4JA 5AJVB 3LXRA 1E79A 1G6OA 2P0EA 4H1VA 4OHVA 4C0BA 3R7AA 3SFZA 1IONA 2QE7A 4QBFA 3TH5A 3UMFA 5DISB 1XMSA 4CEIA 1WMSA 3QG5A 2ODBA 4QC2A 2E87A 4ESHA 1XD2A 3H4MA 4J0QA 1X8KA 3E1SA 1E9BA 1JALA 1XZPA 5AJZA 5BN5A 4FDUA 3LBIA 2GJSA 5JI3E 4DLRA 2GK6A 1EG7A 2V6JA 3SBEA 2F9MA 3W6NA 1JEDA 3OIWA 1P4SA 1ZP6A 1S1CA 3PQCA 3QY0A 5B57C 1LF5A 2OAP1 1II0A 1R4AA 3E70C 5EXTA 5G3YA 4L4UA 1L2TA 1V7QA 3LBHA 2DY1A 4GP6A 2A5JA 2VRWA 3K9GA 1QWOA 1L7VC 2A9JA 2ZJBA 3KDSE 1IHUA 2WHXA 5EE3A 1OYYA 1DAGA 2ZSAA 3RRNA 2ZETA 4MGKR 1TF2A 2V54A 2F1HA 3LNCA 4BFYA 4C7OB 4BUJA 4F38A 3U44B 5J4YA 5C2JB 2XOKD 2IX3A 1HUQA 4HATA 1T3HA 4HBZA 2GDJA 3X1YA 4B2IA 2AXPA 2DB3A 3EWAA 4US2R 3QXXA 5DO9A 4LHYA 2R8RA 5HKKA 1K8RA 4Q9JA 2QM8A 4LZZA 5DHAA 5IF9A 2OCPA 3NIBA 3D7MA 1XBTA 4PAQA 3NG1A 4XSGA 4URZR 2B8TA 3P4YA 4LWZA 4BLRA 1NY6A 4CEJB 1ZM9A 1TQ2A 2B6HA 4PHTA 5ELXA 3RSLA 2VP2A 4C3ZA 1GM5A 1E9AA 1G5TA 1MABB 2O8DB 3P4XA 5LD2B 3IHWA 4S35A 4MQBA 4TLDA 1PV4A 3WHLA 2H8KA 2GWHA 2ZI9A 4BFTA 5BN3A 2EKBA 1SVOA 1XD2B 1UKZA 4PSVA 4YXWA 1G19A 4RFSB 4Z8XA 1GSIA 1E4YA 1R10A 2G77B 2QTHA 4Q48A 4DLWA 2ZYWX 4JBWA 4KLZA 1ZAKA 1RRCA 2ZRKA 3H86A 1Q3TA 1E0KA 2FV8A 3QKTA 2QP4A 1LS6A 3CF2A 3HPRA 3OI7A 4LGMA 4BRUA 1Z0JA 2UZIR 1N6IA 3AF4A 2C99A 4Z8YA 1SHKA 1QHSA 3DL0A 1OLOA 3UXMA 2QMEA 4QJ3A 3ECCA 2GTPA 2GJAA 2GCNA 4NMMA 1CJTC 1YZNA 4XWAA 1XTSA 2DPXA 3SR0A 1D9ZA 1ZU5A 4DLUA 4JSYA 3VFDA 3X1WA 4FINA 1D6JA 1E0JA 1P9WA 1ZIPA 4DEYA 3K0SA 1UJ2A 1YE8A 2FN4A 3E9CA 4C0KA 4LV8B 2EOAA 1HE1C 1EK0A 1SVIA 4M1WA 1GKIA 4I4LA 3D4IA 4URUR 5G41A 4H1UA 4KSBA 1XEWY 3GP5A 4W7SA 3BB3A 3OE7A 721PA 4M22A 3A1TA 1YQTA 2Y8EA 4C0HA 1D2MA 2K5UA 1T8UA 3X1ZA 4P0TA 5L3SA 1OH6A 4Q1BA 2DBYA 4GNKA 3WYFA 2QAJA 1ZW6A 2CXXA 4N3NA 4BLOA 1W2HA 2D2EA 1KO5A 5IT5A 2OUKA 4RD1A 3ICEA 2J0QA 2O8BB 1TQDA 1W4RA 4IDQA 1CR4A 1VDZA 3WY9A 1ZBDA 5KUTA 1NLZA 2EFHB 2AD1A 2F1JA 2JATA 1NL3A 3KB2A 4YLGA 5J47A 2OWDA 2CEAA 1IAQA 3GMTA 3SEAA 1FNNA 4CZ2A 2A5DA 2BBSA 5JFGA 3F0TA 3L43A 3MWYW 4HB3A 3GLIA 3VR3A 2CE2X 4GZLA 1XCMA 1OKKD 1TAGA 5DGXA 2GBLC 2WJHA 1FW6A 4GPIB 2RFLA 2EFDB 5DSZA 1OB5A 3WNBA 1KDOA 4LJYA 4QJ4A 1NN5A 4NHOA 1Z2CA 4QJ5A 1XXHB 3ZZ0A 5CYPA 1L4UA 3U3JA 4AWXA 3GJ5A 3TQCA 1OXVA 3C15C 5EZ5A 4MGIR 2PCLA 4AY2A 1M7HA 3LLMA 2IXGA 4LBWA 3WNCA 5L3QA 1KK2A 1CBUA 4KODA 2F55A 3DB1A 1Z0KA 3BH0A 3MAAC 1KJZA 2VHTA 4HI0E 1AJEA 2PMKA 4TMVA 3KJEA 1GAJA 3K0CC 4Q9KA 1COWA 4TYPA 3HPQA 4LHXA 2HUPA 3IO3A 2GK7A 2BCGY 5FBWB 4URVR 3K70B 1QRAA 3IEVA 1Z08A 1GIAA 2ERXA 1JJVA 1Z29A 3EXAA 3HR7A 4OK5A 2BMDA 4UNPA 5B30A 1NLFA 2WPDD 2O8DA 4LUCA 1MABA 4LPKA 3A37A 3MUFA 1KO8A 4MRVA 5CM9C 4TSFD 1N0UA 1U0HC 1W2GA 4BLPA 2ZR9A 3RS5A 2JLWA 2ZRNA 5HKKD 2XJ9A 1ZC3A 2ONKA 4AIIA 1VCOA 1ZMXA 3RSOA 1UBEA 5H70A 4PPFA 3THYB 3CNLA 1SGWA 2G1JA 4NL4H 1OJLA 1EX6A 4A92A 5DLQC 4C4PA 1SVSA 1OIWA 3SJZA 2IT1A 2HJVA 3W5IA 5TV2A 1GL9B 1TNDA 4Q00A 2W6IA 4NONA 2CLSA 5SZIA 5KDOA 3BXZA 3AM1A 2YV5A 4UKDA 1XTQA 2BEJA 5IHPA 1Q1BA 3U3OA 5DNYB 1F2TA 5IDVA 2BDTA 2V7QA 3KJGA 1IN8A 4HB4A 2P9YA 4Q19A 3U4QB 2ATVA 1H8HD 2ZPTX 4KCGA 3I72A 1M2OB 4HUQB 5DI9A 5BN4A 4QRHA 2R6CA 4KITB 4HDQB 4PSKA 4JOBA 2NO0A 4GMDA 4TMKA 4W5HA 3WYGA 3I3SR 4WXRA 4A2PA 1N6HA 1W0KA 3Q5EA 3TVDA 3EWSA 2I1QA 3TRFA 4TMZA 4Q5IA 2WMOB 3W3ZB 4BPBA 3TIFA 1E69A 1HTWA 3DPUA 4ZI3A 2J41A 3CWQA 1ZD8A 2J7KA 2IYWA 3MMPA 2OAQ1 1UADA 3K9HA 4R98A 4HLCA 4JLOA 5ANRB 4KBGA 1HEIA 3OEHA 4R71A 4LJ4A 1TTTA 2ZI4A 1Z0AA 4DVGA 4CEIB 3W9YA 4M9ZA 1ESMA 2BEKA 3ZZUA 1LV7A 2ZRIA 2ZYUX 2OBNA 2D7DA 4X8HA 3SOPA 1G7SA 2VHJA 4PHGA 1D9XA 1YJXA 4MUBA 3SS8A 1IN6A 2IYRA 5JCZA 2WZQA 3CLVA 1F3OA 1JNYA 4BE7B 1C80A 3W6OA 2REXB 2XJ4A 3GLIB 5JS8A 2IHBA 1KK3A 2ZRJA 4YMUA 1QZXA 2IS6A 3R20A 3JVUA 2AFIE 4B35A 4EFNA 3GLGA 3X2SA 2EW1A 3AF2A 1J90A 2GFIA 1SZPA 1OXSC 5AUQA 4URWR 1FPMA 1US8B 3TAUA 3SQWA 5JMTA 1Q3HA 3B6EA 3NXSA 1IN5A 4Q9IA 3HU3A 1IOZA 5AUPB 2QPOA 1GKUB 5FTJA 1DTSA 2IYTA 1ZYUA 5J40A 4A36A 1N25A 3W3AA 4NBSA 4PHFA 2DYKA 3EZ7A 5HZHA 3V4RA 2PT5A 3PR1A 1SXJD 2JLVA 2QM7A 3EARA 3HDTA 2B8WA 4TWZA 2J7PA 4ZKEA 4A0FA 3FMPB 4RD3A 1FX0B 3REGA 4M9QA 4AK9A 2RH5A 1FQKA 4A8JA 1D2EA 2FX3A 3BFXA 2XXAB 1H2FA 4RKFA 3TAHA 4KI0A 4QBGB 4F7WA 4G01B 4GI7A 1LS1A 5CM8B 1JI0A 2EU8A 2IYSA 4X8LA 2GKSA 4TL8A 3T1OA 3R9XA 1KMQA 3KKOA 1E58A 1KOFA 1JAHA 2EWVA 5H8WA 5FOWA 1KY2A 3TVTA 4GFDA 3OIUA 4IOJA 4D0LB 1ZIOA 2GZHA 3BJIC 1ZCBA 4ACBA 1KO7A 1UBFA 5EP4A 4AKEA 1Y63A 4B33A 4FD2A 1G3MA 1FBTA 4PO1A 4YDHB 4PZYA 4RD6A 4ZIRB 1E2NA 2Z5FA 1H8ED 3QXCA 4HSEA 4V0LA 4EQ6A 5FPSA 5J5CA 1O3YA 1XNJA 3H2YA 4BASA 1E9EA 2PLRA 1Z6GA 4DUGD 5B64A 1UJCA 1Z0IA 3NWJA 4MH0R 3S1AB 2IYYA 1OYWA 3NBYC 2J5XA 2QGZA 2VPPA 4G5RA 1VYUA 3EIQA 1GUAA 4V03A 3QPUA 5TDHA 2FDCA 1NVVQ 3UWKA 3CF0A 3LVRE 1KNXA 4Q1DA 2QL6A 3SHWA 5J4VA 4O3MA 2XOKA 3AVYA 3WBJA 1CEEA 5D3QA 3OAAD 5D3MB 4B2LA 4A6XA 3W8NA 1XF9A 3IUYA 3PCRB 1AZTA 4MRPA 1T0HB 1GRQA 1SKBA 2ZUDA 2OEPA 2QAGB 4PZZA 2IKQA 3WRXC 4F93B 2WKPA 2BJVA 2NO6A 4OQLA 2R62A 1CTQA 3B1ZA 1R5BA 5JBQA 2O8CA 4HAZA 1DAFA 3K70C 1FZQA 2IXFA 3I92A 1VTKA 1DBSA 2V6IA 4TYNA 2RGNA 5FL7D 1COWD 3T15A 1XPRA 2J0SA 4FMBB 1OKKA 2Z6VA 4EO9A 2PX3A 2IC5A 1FZTA 4WVFA 2P79A 1M6NA 4HZUB 5CU7A 4JT4A 2FU5C 2N42A 3B1XA 3B78A 3BS4A 4ZCIA 3K09C 2QBYB 2JA1A 2HEIA 2WSSD 4LK2A 2FFBA 4X8OA 3B1WA 1E2MA 3P1JA 3K4QA 4AURA 4B76A 3FJYA 3THXA 4MYHA 1IY0A 3NBZC 3KJIA 1Q57A 4JKYA 2PH1A 4EFMA 3QF4A 4URYR 2HDNB 1ELOA 4JLMA 4DKXA 1JPJA 2W83A 1MRNA 3KXIA 3LFUA 1ZD1A 1BMFD 1ZNXA 5EE9A 2DWQA 3VTKA 3BOSA 3R7WB 5FTKA 1FMLA 4Y0VA 4NYJR 4C30A 1YRAA 2H7VA 2O0KA 2X19A 4LC0A 5FPKA 2CBZA 1EXMA 4UNNA 4NCHA 2RGNC 4PPGA 2VSFA 5CK4A 2XNDD 5DI3A 1J70A 1E2PA 1WE2A 2Q9AA 2ZR0A 4I99A 1OT3A 2BC9A 2ZRPA 1KK0A 3HR8A 4X8MA 2ZIAA 2QU8A 4MRSA 4DCVA 1P2VA 3IT1A 5CX4A 4ERNA 2G0TA 1R5NA 1XMIA 2YOGA 2AKAB 3F8TA 2ZJ8A 1GRNA 3KQNA 1T8PA 2NQ2C 4RFVA 2FG5A 4MKGA 3UG7A 4PR0A 1KK1A 2QAGC 5A5GA 4CF7A 5JLJA 5F9HA 2WWWA 4HLUA 5P21A 3OE7D 1OFHA 2QSYA 1GKYA 3IPYA 4FCTA 5BQ5A 5FR1A 4TL7A 1BQ4A 4FXPA 2ATXA 4U7DA 3DMDA 1WBDA 2QP3A 3FPAA 3QNUA 1KSFX 1GILA 1D8TA 2D7CA 4LCBA 3GJXC 1MKYA 3AVQA 4DEXA 4B74A 2VLIA 3ZVNA 1IBRA 1E2KA 2GJ9A 3GJ7A 2AK3A 2WOOA 3DZ8A 2WSSA 5SZHB 4QGGA 2YJTD 2IUTA 5BYJA 4BLTA 5FBQB 1CR0A 4A2QA 1XJ0A 3GLHA 4GPZA 4MDEA 2EWWA 2UVQA 2ZRDA 3SNHA 4LBVA 1DE0A 1XTKA 3LDAA 1QHHB 2FSGA 5C1BA 3AKYA 3PEWA 1S3SA 1H65A 2DWOA 1VCMA 4UNRA 5BYKA 3VNVA 1E1RA 3K9NA 1C9KA 3FGNA 4PPQA 5KOYA 1E9RA 2HT1A 5EE0A 4EPVA 2FF7A 1BOFA 3ZHCA 4MKIA 1RYFA 3ZS9A 3NBXX 3VNUA 2A30A 4GZMA 2HF9A 3AVOA 2VSOA 1ZNWA 1IJFA 5K8IA 1PUIA 2QMOA 1S9DA 1UKVY 3U5ZB 2JGNA 1BKDR 2C77A 2WKRA 1BQ3A 3DM9B 5FL7A 4LHVA 1GP2A 4Q4HA 3EZNA 5JWHA 3S1AA 3QVUA 4B3DA 1G8FA 1U0JA 4B43A 4N1AA 1ZUHA 3BORA 5JHGB 5C4MA 2A7QA 1JBKA 2P6MA 2EQBA 3KJHA 3PV0A 1Z8FA 2KE5A 4DCUA 1IJEA 1ZCAA 2ZJ2A 1I4TD 1E1QA 1FL9A 1R0YA 1SQ5A 2OFWA 3L2OB 3LO5A 4UXIA 5FTLA 2ZRMA 5CLQA 2WPDA 4JVSB 4B48A 1E1RD 4DDTA 1UFQA 2Q3HA 1KI4A 1VIYA 2H4ZA 1XCGB 1QG2A 3QBTA 1G7RA 2RKOA 3B60A 2A78A 2GEVA 3T34A 4GRAA 4ZCLA 4MGYR 1TMKA 3R8FA 4D0NA 1RRPA 4QL3A 1CRQA 1AQYA 1FOEB 2BHRA 4FMCF 1XEFA 5PGMA 2PEZA 3OZXA 3NHBA 2ZI3A 3N70A 4AYXA 4EFLA 2Q0HA 4FMCB 1GTVA 1QHIA 4Q4HB 4EDHA 2GZAA 4WAUA 3GFOA 1QG4A 3RAPR 3AKDA 3NBFA 4NYIR 3IIKA 2B92A 5DYGA 3WRYC 1J2JA 2XTZA 5AK0A 3CRW1 5KDLA 2CCJA 2MMGA 3TR5A 1OV4A 2D62A 4HAXA 3PJRA 4FWIB 1G8YA 4DDWA 2WWHA 5HTKA 3CBQA 1OF1A 1J8YF 1N6KA 2XSZA 4LRWA 1E4VA 1G21E 5A0FA 4DRZA 2FFHA 4B2PA 4NCKA 1MV5A 4A1FA 4TSRA 2QT1A 4P4SB 4B47A 4AYTA 2O8FA 1AK2A 5M04A 2JJ2D 4TMWA 3MFYA 2QPTA 1XPOA 1E98A 4WOPA 1FUUA 4G5QA 4LJ9A 3KUCA 4WXPA 4FW9A 1NMXA 1BYUA 5LB4A 2H57A 5DH9A 1IQPA 3QE0A 4PANA 3R7WA 1QVRA 4PQRA 1P75A 2V3CC 3DVLA 4V02A 1ZNZA 1GVNB 1D5CA 4Q03A 3AP2A 1N3BA 1W0KD 1XRJA 1RPAA 3CX8A 2BM0A 4HAYA 5AWFC 5TVKA 2HHJA 1RRGA 4JKIA 1QHGA 521PA 4A8JC 2JLZA 1EFTA 4LPSA 2JLSA 2NZ8A 3LLUA 2R6AA 2WM9B 3T12A 2ZEJA 1K5DA 1ZD9A 4D81A 5DYIA 2QSZA 3IO5A 3AKCA 4L15A 3E9DA 4RJLA 4HB2A 3B7GA 1KO4A 2OZEA 2GAAA 3UMRA 1B0UA 3NC1C 3M1IA 3P20A 4HAUA 1TQ6A 5FUYA 2BBOA 4UXHA 1Z47A 1KAGA 4URXR 2ZS9A 4FMDB 4OK3A 2IXEA 3U6BA 4W5WA 3KKKA 4PSAA 1DG3A 4IFEA 4Q7MB 3ZYCA 2X77A 4KVAA 1JXMA 4L9WA 3DOFA 2W0MA 3ZIAD 3R8CA 2C03A 2O0JA 4MUAA 1F2TB 3PIRA 2EKZA 2XEXA 1MR3F 5LB2A 1WA5A 3SYNA 4JLKA 1WBBA 1Z83A 3ZLJA 4D4LA 4E5UA 4F4JA 1MO6A 3L0OA 4K81B 2ZVQX 2ZRHA 4AG6A 4C0LA 1DKQA 1EFCA 2VIIA 2ZU0C 3EZ9A 2ZI5A 2W2TA 2F3RA 2OLJA 3HP1A 4G5GA 5DHFA 3TBKA 2RHDA 3TW4A 2NPIA 2J1LA 1S1MA 2H92A 3SDZA 1HY3A 3U6KA 2H0QA 2DR3A 2CHVA 4UNQA 1Z22A 4PAOA 3QF7A 1U0LA 5E7JA 1ZM3A 2OXRA 4IOMA 5J4LA 1C4OA 3CR8A 1VMAA 2OFXA 2OILA 3T61A 3QEOA 4HLDA 2EFEB 1E3MA 2ZTSA 2V4ZA 2JLYA 2ZJZA 1U9IC 4GOJA 2LCFA 2PMDA 3KKMA 4LI0A 5GADl 1XTIA 1B23P 5CDHA 2QROA 2PA0A 3CZPA 4DLVA 5JS7A 2GCPA 1QBKC 1J7KA 3D8BA 3KFXA 2IYZA 1EGAA 2G1KA 4GOKA 2NO1A 3AP3A 3BAFA 3GFTA 1Y3AA 2D2FA 4Q01A 5E4FA 2HF8A 3CH4B 1PJRA 1LF0A 1DKLA 1E9CA 1QHNA 1XZQA 4DLXA 4ASUA 1RZ3A 221PA 4DZZA 4PC7A 5JEDA 2V1UA 2HPAA 5KNDA 2C2HA 1VCNA 2WWFA 4YMWA 3KXKA 2JASA 4PTLA 1E1QD 3LA6A 2WNIA 3IDQA 5B2ZA 5FI0B 4NCJA 2CHGA 5L3SB 2R65A 1VECA 2ZSBA 1IM2A 4TQ9A 1VHLA 1WP9A 1UEIA 4WA7A 4QGAA 4IOKA 1KI3A 1NN0A 1NSFA 4BZXA 3GLGE 3RLFA 3NEJA 3EZ6A 5E7MA 2BV3A 4LYHA 5AUOB 2YOFA 2R44A 2QI9C 4ZV4A 3MCAA 2VA8A 3GLGB 3DEFA 3U2QA 3U60B 2FGJA 2JDID 4JYBA 2WSMA 1NMZA 1XMVA 4B3XA 2ODNA 1QHXA 2AKYA 1D2NA 5EXXA 4IEEA 2CLCX 1KSHA 3FTQA 4EUNA 3QSYA 1KDPA 4JJKA 2ENUA 1QHFA 3ZIAA 2RMKA 1YKSA 1G3UA 1VG8A 2HLDD 2G0NA 4M8NE 4AKIA 1DO2A 1EX7A 3V9PA 1VG9B 3Q3JB 1IY1A 2WJYA 5F2EA 2GVDC 3B8HA 4US1R 1XD8A 4U02A 3KX2A 1E2IA 1X86B 5DE3A 1GNRA 3C4JA 4DLZA 2ZJYA 1NVXQ 3GLFE 3MWJA 1Z2AA 4DDUA 1NKTA 1E2EA 4M4SA 2BMEA 4Q18A 4QGHA 1SULA 5AJXA 1US8A 1NNEA 2PBRA 1OPXA 2FE4A 4A0RA 4NH0A 1N0VC 4DCNA 1KJYA 1SKQA 1DG1G 3IIMA 1WDTA 5KTYA 4W9MC 1EFUA 1F2UA 3PEUA 2QQEA 1TU4A 4LSGA 3A1WA 2QY9A 3KQHA 3O8RA 1DKNA 5HPYB 5FBLB 5AR1A 3TQFA 1NBMD 1WF3A 2YYZA 3C7KA 4ILEA 2YINC 4BFSA 1KI8A 3ZVMA 4M1SA 2FJUA 1OH7A 3ADKA 3L8YA 4GMXA 4BFWA 1TL7C 3EX7C 4QM6A 3EW9A 4IDNA 2NO7A 3GJ8A 2GEUA 3SHFA 5JHHB 1Z07A 1DAMA 1NIPA 2CVFA 1MH1A 1T4GA 5CJPA 3ZQ6A 3DM5A 1G3QA 3OEHD 4LV5B 1BO6A 4L5BA 1DADA 4IW3B 2ODEA 2WIBA 3ZDQA 4B3CA 1XPUA 3C8UA 1M34E 3UPUA 1OH5A 2XZOA 1EFHA 1YZKA 2AN9A 4H9GA 4CEHA 3D8HA 3CRVA 3GEEA 4RFSA 1YRBA 3EC1A 3CB4A 2V55B 2QTVB 1ONBA 3K0EA 2ZUCA 2LWIA 4TLEA 1W49A 2YHSA 4RKEA 3LNTA 2J87A 2P6UA 3VR5A 4NYJQ 1CJUC 4MYUA 1ZINA 4U00A 3LG2A 4OHZA 1AS2A 4D26A 2X2EA 4XSHA 1N2CE 1VYTA 4Q4JB 3NH9A 3AVWA 1RIFA 1T91A 1P2UA 2PZGA 2YC2C 3IEUA 4YDSA 5JEEA 2DFLA 2W0SA 2WWYA 4A0GA 2C9YA 4A15A 2H5EA 1JQLB 2F43B 1YR8A 4BZQA 4JYCA 5SZKB 1RC8A 2OBLA 4JLPA 3ZGXA 4Q66C 3FDIA 1NVWQ 1WB9A 3IKJA 4QNRA 4DT1A 2FSFA 3CO5A 4LJ5A 2P6RA 3E2IA 4P4TA 1ANKA 3U7HB 2C5LA 3CPHA 3LD9A 1CR2A 1P72A 3B9PA 1EWRA 1L8QA 4NPHA 2ZYVX 1Q21A 4LHWA 121PA 1EFRA 5FOVA 4CRWB 5EP2A 1UKYA 1E94E 3EA0A 2H1LA 3AF3A 1E96A 4DUGA 3J81k 4TZ0A 2GHIA 5CB6A 5L3QB 4UJ3A 1ZM7A 1JJ7A 4B3GA 4CEHB 4XWKA 2NOAA 3WP1B 1IY2A 2O8CB 1G18A 5JZVA 4QNMA 3RC3A 1E2FA 3OF5A 3I5XA 2VTKA 2BBTA 3FVQA 1M8PA 4ZIRA 2RGGA 2QEQA 4BLQA 1RPTA 5KSZA 3LAWA 3VU9B 3OIYA 4B34A 3AEZA 4NP6A 821PA 5EP3A 3AQ4A 4FCWA 1NVVR 2HYIC 4KBFA 3QPWA 2IWRA 2JJ1A 1ZNYA 5EE1A 3THWA 5TMPA 3PEYA 4Q1FA 2CL0X 1QHYA 1X3SA 1DS6A 2FFAA 4MITA 1GOTA 2X1VA 4KFUA 1VHTA 3CZQA 1G5PA 4HAWA 5FTNA 3FYHA 2IYVA 2HJGA 5C4GB 3BFVA 3B13B 3ICQB 1LTQA 2IEYA 5CJ2A 2ZS7A 4GOXA 1T5IA 4AROA 1V37A 2OHFA 3BIFA 2I1VB 3KXLA 1KHTA 1JAIA 3FB4A 4IVRA 4XOIA 3FKSD 2CE7A 5K8LA 3EASA 1W7AA 1V43A 2OCYC 4D4MA 3G82C 2XTMA 5LDDC 2EYQA 3VR2A 3EG5A 2BWJA 2AHOA 3NEYA 3RNLA 2WMNB 5LPNA 4DB2A 4RD4A 1NT4A 2GEDA 3W8RA 3TW8B 3FMFA 2ZM5A 4HDOB 1KTVA 3IBGA 2CNWD 3RDPA 2OM2A 3NC0C 5FPTA 4RVCA 1E2JA 4RCYA 3DKPA 2ZUBA 5C18A 4NDZA 4A4DA 1TF7A 5KSPA 3TKLA 3AVPA 2QGNA 3BH7A 3TK1A 1IXSB 2H18A 3UANA 1KKMA 3QEJA 3KQUA 4F91B 1JECA 2WVJA 4Q9HA 1XEXB 2J59A 2VP9A 4EPTA 5JSZB 1RKBA 4F4CA 1UF9A 1KZGB 2C9CA 2HLDA 4TLBA 2R6FA 1M1YE 1TEXA 3PUVA 1NP6A 1U2RA 2MSEB 4FI3C 1PVOA 4EAQA 2NO9A 4IDHA 4IHQA 1NI3A 4KJZA 1P60A 1KIMA 4JL6A 5G53C 2OBMA 1G7CA 3VKHA 1TQ4A 1XMJA 2RGXA 4YQFA 1YR6A 3K4PA 3EZFA 4D6PA 3PGMA 1E32A 2P6OA 2ONJA 4ESVA 2QNRA 2PT7A 1UAAA 4II7A 3THWB 1ZM4A 4RCZA 2BBWA 1OFUX 2DWPA 4KHZA 1AIPA 4Q9LA 2WWIA 3F3KA 3L0SA 1OSNA 4TT3D 2ORIA 3IPXA 3OFND 2J0UA 4PO8A 2WNHA 2ZRBA 3SQXA 2FZ4A 1SXJE 1UBGA 1NJFA 1XD9A 5G40A 5EJEA 3EPHA 2B7BA 3HU2A 4CT4B 1W4CA 2E1RA 3DMNA 1ZC4A 3RRYA 2RGDA 1I2MA 5JJKA 4ARSA 2HCJB 4FDTA 4ZKDA 4HB0A 4PC6A 3CUEF 4XVQA 5HE9A 4C2UA 3KKNA 5EZ6B 2J3EA 4C2TA 4Q1CA 1KSJA 1CKEA 1YZUA 2FPKA 2QBYA 2RAPA 3NTUA 1QVAA 4OYHA 2X8AA 4WZ6A 3NTLA 4JL5A 4KFRA 3QJYA 1RRFA 4KVGA 2JJ1D 1AN0A 5TB5A 5JJLA 1KDRA 3K09A 3KQLA 3P27A 1KYIA 4JSTA 4KAXA 4MKHA 1DPFA 3PENA 5CK5A 5GVRA 1AM4D 4LYFA 3BERA 1X8JA 1TF5A 2PZEA 5GJCA 4Z54A 1KMHA 2A9KA 4O2LA 1KJWA 5DN6A 4E07A 1T9HA 4LBZA 2QNIA 3QBVA 2REOA 3QG1A 4FIDA 3WNDA 3ADBA 4N0DA 4P4UA 2A5YB 1ND6A 2C96A 3RHFA 3RWMB 3IQWA 1Q44A 2Q9BA 3THOA 3CPEA 1SXJA 1Z5ZA 3FMOB 5EP1A 4BLSA 3BFKA 1N5LA 3BWDD 2ODWA 2ZQ5A 2WBLC 4TN1A 2OESA 4O0MA 3OFNA 4RY2A 5FPYA 3REFA 1NBMA 3LL4A 2P2LA 1E2DA 4LJ6A 4NTZA 3I61A 3SJAA 1M7GA 3T1TA 3D6TB 4MRNA 3PUWA 3ZVRA 4IDOA 4NE2A 1KO1A 2VQSA 3M0EA 2QA5A 4GP7A 4DSOA 3QKSB 3THYA 4QIHA 1GG2A 4L16A 2IYUA 4V0OA 1XP8A 2A3RA 3TUIC 3LQQA 1H2EA 2BIFA 4Q1AA 3UKDA 4F4IA 2ASEA 2BJWA 4R2HA 4NYIQ 3RRMA 2A5FA 3LXXA 2AWOA 2FPMA 1Q1ZA 2BVNA 2VP4A 2WKQA 2C9OA 1XX6A 4NZYA 4DIDA 1NG9A 3D6AA 3UK6A 3B82A 4HLQB 5FOTA 2J0UB 1CF4A 1F2UB 3H0KA 1OXUA 4BFVA 4Q1EA 1UEJA 2KBFA 5KPDA 2MSDB 1OXTA 3T06B 2QPAA 1W36B 3PUXA 2CK3A 3EOZA 5HR5A 3ZQJA 1U8ZA 4DC9A 3VKGA 1YVDA 2JLQA 4XJXA 4P4SA 2QE7D 5HZKA 3W6PA 3CRRA 5IK2A 2F90A 4KFSA 4DCTA 1DKMA 2ZREA 3DDCA 4A8JB 1HA3A 3ND8A 1FX0A 2KBEA 2OE2A 1W5TA 5KNCA
chains in the Genus database with same CATH superfamily
1HDCA 1HSOA 4EG6A 4B82A 1SZJG 1P5ZB 5GJWC 4J16C 1FP4B 4XIJA 2B83A 4FJ1A 5SYNA 1Q11A 2AF4C 1H4QA 2P9JA 3FHTA 4J29A 5K2MA 3RYTC 5ELLA 1U1FA 1A72A 1YL6A 1K86A 1GL7A 1K5PA 1UZUA 3R0IA 1K7SN 5AOCA 2JS7A 2ZE7A 2C8VA 3CFYA 4QHTA 4EY4A 4C0JA 5GINE 5IDYA 3R75A 1RXSA 3EQ9A 4BGDA 1ML3A 1KH3A 4OQXA 2G17A 5LZ2A 3Q72A 2PA3A 4N0MA 3HA7A 3IKTA 3ET4A 2FXVA 1AH2A 4BIMA 5EHNA 3WGUA 4DLKA 2IPAB 1K92A 4HYYA 4LN1A 4WY5A 1Z74A 4ENSA 4BZWA 3AF0A 1ZGJA 2O7RA 1J0EA 4IX1A 3L4KA 1IXKA 1JJIA 4ND4A 1G42A 1S96A 3ANNA 2I6UA 4XGQA 5CYOA 1JIVA 2WTUA 1KPGA 5C80A 3IE0A 3LOPA 1R0WA 1HE3A 4C4YA 1T0PA 4E3ZA 3H6HA 5E9AA 3D8UA 4PCAA 2M98A 4F7DA 5JCJA 2VYND 2G82A 2Z2IA 1ENPA 3A04A 3AEYA 4BTVA 1MRZA 2JHGA 4J94A 4J0CA 4OH1A 4CR7A 1DRWA 1P8JA 3U4IA 3AIMA 2KPOA 3PNSA 4J07A 2FXIA 5KNBA 3IBFA 2G5PA 4P3YA 5E3IA 4QHSA 4ZQFA 3UT5A 3ZZTA 1P2SA 1RFLA 1U8TA 1VMKA 3E53A 5CLJA 2PLFA 4X6XA 1P1FA 4MQFB 1KI2A 4E5YA 1N2CA 3FSEA 1C2YA 1XL1A 3PGA1 3HKCA 4OI2A 2V7GA 4BNNA 2ZE6A 3Q1KA 3DBVO 1ICIA 4NNJA 1RPZA 2QN6A 1Z0DA 2AOWA 3IP7A 2ZRCA 3A6PC 4OB8A 3DFUA 2O2YA 3TB4A 4I8IA 1CJMA 5THKA 2HHAA 1M2VB 3JATB 3KKPA 3NETA 4M1MA 2NUTA 1BCSA 4GRIA 1GT6A 3JYQA 4MULA 4RK1A 1LK0A 3VO9A 1HMPA 3BQ9A 4G1UC 2P68A 3I62A 3IT0A 1N2IA 3AUSA 3C6KA 3RKRA 3RAFC 3WDMA 3LYUA 1M34A 1X38A 3UN1A 1H5QA 3U4MA 5DVZA 2R6ZA 2QUJA 1OE0A 3TD6A 3UGKA 4Q4JA 4YI5A 1SVMA 2HCRA 3R3HA 5JC1A 1XLTC 3TB6A 2NSLA 3U09A 3RWOA 2ZUWA 3TGWA 4BFUA 1GNPA 1KKUA 2BFFB 3DXFA 1JEQB 3O3CA 3DG9A 4QGSA 5FOXA 4DB4A 4B71A 1ZK3A 3TWOA 2HT6A 3LF1A 3DFFA 1XTJA 3DZHA 5IAEA 4I5GA 5IP5A 1WXQA 3KPVA 4ND5A 3I53A 5FBRB 2IRWA 3AESA 2C0QA 4LC1A 4URHA 5KTMA 4OP2A 5BWNA 1AUVA 1ZJ6A 2ANCA 2C07A 3KB1A 4KTVE 3UPDA 1EGQA 4ZARA 3WL3A 1MHTA 1P2TA 3WBKA 1OVMA 3E1KA 5A06A 5IM5A 3U7FB 1TVEA 2H7YA 2ZIFA 2PSHA 4MAAA 2C61A 4EL0A 1P0IA 2WJPA 1VBFA 3SJCA 2PL3A 1Z33A 3SEFA 4ZO4A 2ILTA 3N2KB 1USKA 2YW9A 4KQEA 1CERA 1XAGA 2PWZA 1ETUA 3FYUA 4LDRA 3Q7SA 1MC4A 3UTCA 2Q27A 2DFVA 1MOPA 3E58A 3GG2A 5IARA 3WK4A 4BNTA 1RJWA 4V0ME 1XQVA 3CURA 4D4KA 4IV5A 2JL1A 1R8QA 2BH9A 3LPDA 1W0JA 2VUSA 3NTOA 4FOLA 1NDQA 4XPIA 4OI0A 4GKJB 4CPDA 3I32A 4U7JA 3B5JA 1MORA 1V26A 2WIKA 4E1AA 2QQ0A 1AS3A 1S3IA 2XRYA 3FHOA 1J07A 2IIQA 2P2YA 1OLXA 2FWRA 1CVIA 1PGOA 2PV7A 3MT8A 1IPHA 1HKHA 2PT9A 2Z30A 3G13A 2Z6AA 1CRLA 3WLIA 1I8TA 1VLLA 3Q41A 1UM9A 4OGGA 4CIAA 5AQEA 1N6RA 1XTTA 3P26A 4YT5A 1I5EA 3RVOA 2GPWA 2F00A 2DQKA 3E4DA 3PC7A 3QQ5A 1SAYA 1QZZA 3F5MA 2UZ1A 4OM7A 2ZPUA 4OHCA 4OX9B 2X3YA 3G5MA 2QE6A 3N3AC 2XVYA 1OVGA 4HZGA 1R9GA 4KJXA 4RZSA 3RVBA 2Z4SA 3KTAA 5JAOA 5JSZA 3NT5A 1C8BA 1T6ZA 1LBIA 2GCIA 3L4BC 5EEGA 5BMOA 3ENNA 3ABQB 2AZXA 1X19A 3G0IA 1V9LA 2O0HA 2BMVA 1REQA 3BGDA 4PQFA 4PWYA 3VXKA 1FBNA 4RNCA 1ESDA 2UYHA 3O2SB 3WYCA 3PFHA 2A84A 3AIIA 4GXQA 3VZRA 1B00A 5BVHA 5LMNB 1DAHA 1GLNA 3UK7A 3V1KA 1Y5RA 1RU3A 3LH5A 1W36D 4OYLA 1KP9A 4N3BA 3CISA 3PUYA 3W2HA 1T6XA 1VRWA 2OSVA 3O8OB 1FTWA 3MTIA 5CUQA 4LRUA 5ADVA 4LOLA 1X9GA 1H2AS 3N2NA 3O8BA 2OGUA 4RSMA 3BH6A 5CCBA 4X62B 1FP4A 1EFPA 3ZHQA 4C3OB 2BM8A 3A1VA 3NDPA 1VLMA 4RV4A 3URKA 5JJCA 1MTOA 3I8SA 2XMSA 3GIWA 3HUTA 4QOGA 2CMDA 2Q6TA 4IIDA 3R44A 1BFKA 3P32A 1S8FA 2WAYA 2F8LA 1JF8A 5DNEA 2ZAMA 2FZVA 4DSZA 1I3MA 4AJLA 2LKDA 2P4EA 4IINA 4OMFG 4Y9SA 4RMGA 2NVUA 3KRTA 1RQNA 3GJ4A 1FP7A 3Q3IA 3TOXA 3PUJA 3Q2OA 4B44A 2CSUA 1PEDA 1ID8A 2AOTB 4RSHA 4YRAA 2WOJA 4RA6B 2DFNA 4UD2A 4V2UA 3SAJA 5IVIA 4CF5A 3DYIA 2PR7A 3GLFB 2AFIA 1JBEA 2IU4A 4NCNA 4WDRA 3V4VB 2YWFA 2GZ1A 4X7PA 3AY7A 4B09A 5BUSA 3F6BX 4QG7A 2W00A 1O57A 2GN6A 3MCWA 3HHPA 4YO7A 5B12A 2DR0A 1JTFA 3W9UA 2XB2A 4LX0A 3IBCA 4JSRA 1M6YA 3RFFA 3UOGA 1Z7YA 2WJIA 3DDUA 1KR5A 3UB2A 3IVGA 2YTZA 1CJVC 2R8OA 3WSTA 3WMGA 3RV4A 4O25A 2BMWA 2E85A 5K0CA 4UVDA 1P9NA 1EUDB 4P34A 5LC1A 4UBLA 2SECE 1QHHA 3RRBA 2XZPA 1JPNA 3QKSA 5BOVA 1BHO1 1QYDA 5CA0B 1GYPA 2FA9A 4IIFA 4Y1RB 1L5SA 3KCNA 4PLHA 4TL6A 5F35A 4JJZA 1MP0A 3PRKE 1ZMRA 1ECBA 2XITA 2Q1SA 2P35A 3ASZA 3M33A 3FPJA 4U2DA 2VOJA 1KC3A 4RH1A 3N5KA 3HNOA 4K5QA 3SYLA 4QUBA 2RGRA 2XQFA 2G9RA 3UJBA 3BGIA 3QKWA 2NM0A 3GROA 1NN1A 2OCGA 2AXEA 2GF9A 4R0VA 1W6UA 3GYBA 3ADPA 4LFCB 1S4QA 4HVCA 3WFIA 1WEKA 3OA2A 3JQ7B 4GBMA 4RIFA 3CV3A 1M1UA 2DLNA 3ML1A 1O03A 4F3NA 5IT0A 1I80A 2VRCD 4DSTA 1MO5A 3LYHA 4Y9DA 4XLTA 5FNZA 3TDMA 4H7IA 5I9SA 1UBKS 2VHZA 4NLLA 1M10A 5AK3A 1RP7A 3O1IC 3WMFA 4WLOA 2BFOA 1FNMA 3HB5X 4IIBA 2AE1A 5I47A 4CW7A 3OQIA 5BR7A 4U1RA 3V8PA 2FRXA 1E9FA 3AKZA 1SCUB 2C2GA 4C76A 5FUVA 4TT3A 3B1VA 4DSNA 1JEEA 3O3MB 3RROA 3USCS 4US0R 4MPJA 3FPSA 1KRXA 4F92B 4CMJA 4FHZA 2QSJA 1LNZA 4NZOA 3CWZA 5FOSA 4UHCA 3H83A 2BL4A 3C3XA 4CIWA 1KBZA 3CLUD 4DT1B 4QDUA 1X1TA 2OBFA 2JGRA 3A1FA 5KAMA 5EIOA 5EXDA 1YMQA 1WQ1R 5LP6B 4NEGA 2HXGA 1R5OA 2DJIA 4CL3A 1G59A 5IAKA 4L28A 4Z2AA 3ELYA 3IPAA 4M0LA 1NRJB 2AEMA 4IXMA 3CT4A 3TSWA 2I29A 1SIBE 1Y7PA 1SURA 3VR4D 4OMDA 4QHYA 5AVUA 2FZEA 1H42A 2D1FA 5IYZB 3CTPA 1SHLA 3FWYA 2VSXA 3K35A 4I0WB 4OQMA 3GNLA 1T9CA 4GKBA 3SSNA 2Y9MB 1KZYC 2RHWA 3GAZA 1W87A 1ZOOA 3FNFA 4IDFA 4IJQA 5JMWA 4BXOA 1DEAA 3JR3A 3K30A 3ZBTA 4HX5A 4TM8A 3ICVA 1EWYA 4AY5A 4DYVA 3BC1A 1LVUA 3SEQA 1LVGA 5JWOA 1IH8A 3KM0A 4TV9F 1UDWA 1D2HA 3UFBA 3E8SA 1C9JA 2OD7A 1H2YA 5JRDS 1G21A 2FEKA 4EI7A 3K0AA 4KHPB 5AD1A 4OQFA 1VPLA 3DZKA 3NC4A 2ZR7A 2HTEA 1M8JA 2JLXA 3I9V6 5E4TA 3LHFA 4XDHA 5EQJB 3TLXA 1T8RA 3TFOA 1HO3A 2AOUB 2IGTA 1XYVA 2GXQA 3RW9A 3ZXXA 4BYGA 3B2EA 4R2KA 4W5JA 4YCAA 3T3HA 5LU8A 2ZROA 2GI4A 2NP7A 2QNBA 3FGPA 4DEVA 1UBJS 5FUMA 1D4ZA 3PKZA 2DY0A 2VRCA 1DKPA 3HU1A 1HFWA 1NMQA 2V1XA 3ZVKA 3NHAA 3B53X 2IWHA 3N6VA 2WSYB 2Z8YM 3AY6A 4CCSA 3JAWB 1J25A 2MINB 1VJCA 3ZK7A 4RHFA 3HL0A 4GE0A 5ENDA 4PG7A 5TGZA 2ACVA 3PGKA 4BEBA 3OBIA 4L73A 5IWAB 1YR2A 5LL6P 1SHZA 1I1OA 4RTRA 3SJBA 3HBLA 3FTFA 4K03A 1S2DA 2HV8A 4OBBA 2H52A 2O8FB 2Y6UA 1TAQA 2RJNA 2UYOA 4RPCA 4R0MA 1M6VB 2AJLI 3KL4A 3OJEA 4P93A 1XPJA 4FR5A 5JDCA 3KNZA 4YR9A 3UGQA 4DSUA 5A4IS 1GNQA 3GX1A 3W77A 2LDXA 4AG5A 4D9JA 2VDPB 4ZPXA 3OLQA 3K8OE 4KLNA 4FGUA 4Y6RA 2XKAA 5G1NA 1SOVA 1C81A 4S2EA 1I30A 4Z3OA 4L4XA 2KB0A 1LZLA 4O4JA 5LZ4A 1KEVA 1T5LA 2HD4A 2WFLA 5K6TA 3CNEA 3GT0A 3U7QA 3IURA 2DCUA 5UKDA 1NR7A 1FSFA 3DOUA 3QXSA 5B1SA 2HBZA 4YMSA 3A6EA 4DA6A 5DWDA 3R9XB 3HXPA 4FDVA 4RVSA 2GBCA 5JCXA 2BTQB 3DKRA 4CMKA 2W22A 4WI1A 1OH8A 3KOOA 3QI2A 4MW5A 2AMJA 3EY9A 5A02A 1F48A 3CUSA 4Z4HA 1EAMA 1H5NA 3L02A 2GUGA 4PLZA 4JB0A 1YKGA 5L6LB 1O95D 4C07A 1LDYA 1QYCA 1CUBA 5E95A 2Q5OA 1NBWB 4P3XA 2B1IA 2H1HA 2ZSFA 1G8JA 1Q0ZA 2FWNA 4G1CA 5CB0A 5MN4A 3I73A 4OHYA 4ZV9A 1MDFA 3CEPB 4RKWA 4G09A 4V0NA 3DL4A 2ZBRA 4WVLA 5I7EA 4TKVB 3CRQA 4PIMA 4KIFA 2I6QA 2OBYA 2WJVA 3WLFA 1DZ3A 4G5SA 4M9SA 1RWMA 2YHIA 5J4KA 1K6IA 4AZVA 1UPUA 2GYVA 2W2VA 3A27A 4HOYA 1PG5A 1QVWA 1DQZA 2FEOA 4YJ2F 3ZWWA 3WGTA 4EB6B 3EXIB 1TECE 2RC5A 3M3PA 3ROFA 2RKBA 3WGMA 5LZ9A 5ARBA 1NMSA 3AUUA 1IMJA 1C30B 2IOFK 3WTCA 4GGPA 3X1XA 3PK0A 3FI9A 2GXUA 2VO1A 3MM4A 2PL5A 4KWCA 3DE0X 4AJNA 3SFVA 3RRJA 4MVWA 1SQ6A 2H1OA 2EF1A 1JRLA 5J2TF 5I7HA 1GCOA 5JD3A 2O57A 2VDNB 1S2MA 4N48A 2XI4A 1QZ3A 4W5RA 4ZCQA 2HRRA 3IV9A 4X71A 2NT4A 3T4PA 3RC8A 4E6PA 3V4FA 3NAMA 1Q19A 4GBED 4ZO6A 1N7GA 5THXA 4ZQIA 4PBTA 1C7RA 5TQ2A 1KEWA 1CRWG 4Z4CA 1CP2A 4RD2A 1R0LA 1U0TA 4UZSA 1MAHA 3L1JA 2Z5VA 5CD1A 4RE6A 4M1TA 4YV1A 1D03A 2VDJA 4YJ3B 1GO2A 1U8EA 1YFKA 5ERXA 5E8RA 5C46F 1C0IA 1H2BA 4G9GA 4KMMA 3GFBA 5HCNA 3G6WA 4KO3S 2F4NA 5GM1A 1DFIA 4EW1A 1FNDA 4TTJA 2F1OA 2F3TA 3VKWA 2DKFA 3TIGA 4M7RA 2AR7A 2VF4X 4XTRA 1L5KA 2I3BA 2X7JA 4O2BB 1E5LA 4AKTA 3MPUA 4RUKA 3EXFA 3V00A 1OWNA 1M6EX 3EY4A 3KVRA 2PBFA 4FQ7A 5IS2A 4N6GA 3GGOA 4HT3B 5F3WB 4WXMA 1F7VA 3LKZA 2D3WA 1UIMA 2AFVA 1EEXB 1QONA 2P3SA 3TZLA 1CIPA 4IH9A 3AR7A 3OU7A 4PC1A 5TXGA 4LGCA 5IK2D 3F5DA 1V8DA 5E4JA 2ZGVA 3ZJUA 1QCYA 3QYFA 3S70A 1JEJA 2FSHA 3PDCA 3K0AB 3WXMA 1F38A 1YK1A 3IDFA 4BQRA 5DHRA 4DQVA 1YRLA 3GN1A 3IA2A 3F47A 2VZ0A 3K53A 2C20A 1Q1AA 2HIHA 3BIXA 2MSCB 3GQBA 1RYEA 1TIKA 4OB7A 5GM2A 1M9NA 1B2RA 2BI4A 1YDEA 1PLJA 2JHCA 2ZTLA 3A4VA 1KI9A 5EY5B 1CC1S 1ZU4A 2AL7A 5JSQA 3Q3GE 4RIHA 1CUEA 1AGPA 4FFPA 3OZUA 4YCJA 3DZDA 5A3SA 4ZVNA 2CHQA 1AKQA 1NJGA 3K0FA 3P0RA 4PM4A 1P80A 1KNQA 2O48X 3EHDA 5CURA 1B73A 4CG3A 4EHFA 2GNOA 4FQ5A 5FL3A 2A3NA 4KKXB 4RA9B 3NDRA 3UYLA 1ZPDA 3DMFA 3WLJA 3CNNA 1PZEA 2F59A 1K6JA 2LV8A 4KN8A 2GBLA 2QQGA 3VC3A 1P6XA 3Q98A 4QUEA 1I14A 2VS1A 2HBRA 4G67A 4OFZA 4ZI2A 4QBHA 5CIWA 1V39A 1P5JA 1JHOA 3UV7A 3MSXA 1Y33E 3L0CA 1WCV1 3KOYA 4AUMA 3D4LA 1T36A 3DKVA 5H7XA 4JLDA 4AICA 2ATIA 2EZUA 1U8YA 1EHYA 3C5VA 1LY1A 3HFSA 3W5AA 3HN2A 4G0NA 2K2WA 1Q0SA 2A35A 5KWJA 4MR7A 5AKYA 4Z3KA 2GYWA 4LI3X 5FOUA 3V7YA 5AESA 2R9VA 4BHTA 3W05A 3IP5A 1FFXB 3QXJA 1K89A 2ZI7A 3G7SA 3TTWA 1SBTA 4UNSA 2PT6A 3AY0A 1Y98A 3GYGA 2V7QD 4ZCTA 3L7CA 3T9EA 5JNVA 4QVIA 4EIWA 1VGRA 4DS3A 3IJPA 5JBNA 4GMGA 1D09A 4XR9A 3A6HA 4Q21A 4JQOA 1IUOA 3M4YA 5JVDB 1AKVA 1A5BB 1IK6A 2OV2A 3HA3A 4XIGS 4JYMA 4B4OA 5JPCA 1AGRA 1TUBA 2I6GA 3KHKA 4JLJA 1WHSB 4AXXA 4U0JA 3H9EO 3DLTA 1V1MB 5TX7A 3ZD6A 1C3EA 1T8YA 3EPKA 4ZYLA 1T5BA 1DAIA 5CT6A 1ODJA 3LIPA 2VPYA 1GA1A 3P9YA 2C3MA 3U3RA 3IPLA 2FZLA 4FU0A 3B85A 2HSWA 1OBVA 4Q4DA 4Y1RA 1KDTA 1G1MA 3NUZA 5H68A 3HEBA 2EEZA 3UBMA 4F11A 4GL4A 1THGA 3LZCA 3D7SA 2VNSA 2EJCA 1Q2XA 5FQOA 5HBRA 1PFQA 3AX6A 3WLEA 4R1QA 1IG3A 3ELWA 2ZWPA 4EGFA 1OX4A 3V2IA 3MGKA 4TV8A 1H5UA 2P5YA 4RPKA 2XCLA 3LUPA 4Q3BA 1I7QB 5IFKA 1A4IA 4N0EA 2YMQA 5CNIA 2FR8C 2CXPA 1OBCA 1T4CB 3SZGA 2DUNA 4XLLA 1AKMA 2CUKA 2E4WA 4MUIA 2HRQA 4DC0A 4ED9A 3JQ8A 1MJHA 5DJ5A 2HXSA 4YRNA 2GM5A 4O08A 3QWFA 4B3BA 2P2ZA 2QLMA 3QXHA 1GU1A 2WYUA 1GDTA 5CXXA 2QGFA 4F5YA 1NLYA 2BGKA 2W6JD 1PZMA 1KORA 4ALMA 5JD6A 1L5OA 2OOSA 3BTSA 3ILYA 4B3IA 4B7UA 3FHCB 4BE4A 3D5EA 4ARVA 3WQQA 3ETHA 5JMPA 1TIPA 2Y1LA 3EXHA 2NVWA 1EM8B 1UK7A 5H3HA 3DBOB 1EH5A 5JH7B 4ODIA 3AUTA 5KPJA 3PR3A 4O2RA 4UC0A 1E1NA 3G5UA 2V7EA 2VF8A 3MD9A 3KSUA 3EGOA 4YGYA 5JZBA 4K6CA 2HZBA 3ZDFA 3QPBA 5CDFE 1M6VA 4RY0A 1XQ9A 4I9NA 5GV8A 2AFRA 2P7IA 5WRFA 4D0GA 4ENPA 5BWOA 2YWEA 3DF7A 1PFKA 1G21B 4RZUA 1Z4LA 3ANMA 5HGJA 2XXBA 1W85B 1TYCA 4D2IA 2YZ2A 1JKMA 1GU7A 3IXMA 5FFFA 1J56A 3F3YA 4FDLA 3RKSA 4ANFA 1EVEA 4D8WA 3QLEA 2HV9A 2HA2A 4DL9A 1T0IA 2MYTA 2P91A 5DK6A 2I4MA 1CNMA 2FOXA 4S0XA 2QR2A 4ZP1A 4W5QA 1QWSA 5D6OA 2EVWX 1WUYA 4C4SA 5BR1A 1W4AA 1G8KA 1TA4A 4FYMA 4ARZA 1NUUA 1WU8A 3LT0A 5C3UA 1AUPA 3ZY4A 1XTRA 5LWHA 3CLUC 3QOWA 2QDXA 3H2GA 5EE5B 3V8BA 3PICA 2PCJA 3GD7A 4KDEA 4LWOA 2H3EA 4ARCA 1I6MA 2CUZA 3I12A 5DNAA 4D42A 5BRNA 4EFKA 3KZNA 3E5HA 1JKIA 1UBCA 4YHBA 1ZEMA 2OZPA 1CQIB 3ETLA 4DA9A 1KI7A 2JCVA 3IKVA 3ZCXA 5KJ6A 1AV7A 1NG1A 3V8MA 2J09A 2CB0A 5LOVB 4L4RA 5FBKA 2B78A 2O2DA 3P2YA 5CB4A 3TG8A 1M1NB 2MMCA 4HDNB 4JLVA 4PLTA 3H19A 4B6FA 3C3CA 2FUKA 3D6FA 3HU5A 1X94A 4IEFB 5EIFA 3ZU6A 4DXAA 1UJBA 1DEKA 3PXEA 1VKJA 3MZ0A 3OJFA 3SC2B 3NBMA 3Q3EA 4JROA 5BWCA 2YQ4A 4WBNA 4KGVA 1H1LB 4F3KA 3LYLA 2D59A 4CKCB 4OKSA 1V3QE 2DWUA 3DDWA 2GF2A 5G3ZA 2RHOA 3LHIA 3WSWA 4TYWA 2FFQA 5IJZA 4LYDA 4FYVA 1WXHA 3S68A 3P2IA 4B0PA 4WZBE 3M6FA 3GRYA 2Q4TA 1U94A 3SSMA 2CWDA 1FFEA 3HO8A 2JZOA 4AX8A 1TKRA 2QRVA 3AR6A 3A2KA 3A58B 4B85A 1CUUA 2QLLA 3R5XA 2ISQA 1JHPA 1GUDA 3D0OA 4CQMB 1H6DA 1CYEA 1R8JA 3HDGA 3CW2A 2GSWA 1SBYA 1PBNA 4UUNA 2C3OA 4HZUA 4L8GA 3V4LA 2YWGA 5BQXA 3ASVA 2I9KA 4TS3A 4ZK2A 2AT1A 5BUQA 3FOZA 4C03A 2O5RA 4LOIA 1E6WA 1CEQA 2HWKA 1QF7A 4BKUA 3HWSA 5SY9A 1O77A 3JWHA 4HXYA 4WIAA 5BSGA 2CLEB 2LKCA 3EA5A 3PX7A 5K0EA 3K5IA 1DXHA 1NVFA 4QUJA 4NFLA 4D98A 4F4HA 2RI0A 5A6VA 4Q9DA 4QM7A 3VNAA 2BOVA 5GZ6A 4X92A 1KI6A 1QC5A 3QVKA 2YQ5A 3O95A 3ZU5A 3QFCA 1JR3A 1FS5A 3A05A 4WOJA 2BFEB 5TS3A 4INPA 2VHCA 3RT1A 2AUTA 2I62A 2P65A 1RBZA 2BMFA 3L1UA 3C6XA 3ROQA 3W90A 1XRRA 3OPYA 4ARZB 1HNZB 4C21A 1UC5B 3MYYA 4RK5A 1P74A 4DXHA 1XZMA 2A58A 3U61B 2N46A 1MGPA 3PBKA 2IP1A 4XWWA 1BN6A 1E3TA 5FWXB 2Y1FA 1TU0A 5IC5A 4J0FA 2H2FA 2PL9A 1NOJA 3QNWA 4Y2QA 3FWZA 5AVVA 1XQXA 4HZIA 4ACAA 2AB0A 4RZXA 2NUBA 3IMEA 4PCVA 1RE1A 3EZGA 4C5AA 3L93A 3KVYA 1J8VA 1J9ZA 2X0IA 1XROA 1FYVA 4UW9A 4WSOA 3V1LA 4G6ZA 3D4BA 3OZIA 1FRVA 2OCAA 4FHDA 4ZCSA 1F2VA 1Y7HA 5BWMA 2ZVPX 1X1DA 3OOJA 2VT6A 3C3DA 4QODA 5DHSA 4EG3A 3ASUA 4YYZA 5BSVA 4QXOA 2C97A 3DONA 3KK0A 1MO2A 1DAKA 2QU7A 1YFZA 5GVSA 1X8LA 1KQ3A 2Z2ZA 1RM0A 2WWRA 2YZKA 3WKAA 1RLTA 1JFRA 2XB4A 4IHJB 4OQ4A 1GZHB 1GGEA 2QRKA 5F9FA 4YRKA 2BKAA 1OLSB 1T2VA 2DFKB 1C0PA 3QA9A 4BRWA 1OILA 4EHIA 3HCDA 3TOSA 5P8WA 3H1FA 2R1TA 4N8EA 5CW1A 3CQ9A 2IE8A 2MINA 3P9XA 2VXCA 5DIFA 3I37X 3TW8A 4B6EA 1REQB 4U9IS 3CKLA 1OC2A 1HK7A 1KVUA 2A94A 3F90A 3PUHA 4BNFA 3GFPA 3H2HA 1Z28A 3H2IA 4KGDA 1DXYA 1FDIA 3OM8A 4J2TA 3FPKA 2EZ8A 2VK2A 2Z43A 3FYTA 3F4KA 1TA9A 1MTZA 3LS2A 1KAOA 2LPMA 4HJRA 3L0IB 3LXRA 3AQIA 1VKOA 1Z8DA 1PR5A 1R64A 5ARDA 1D2CA 4WINA 4X9XA 4PYOA 4NC9A 5CBKA 2YN4A 3LQFA 1IONA 1GAEO 2XVAA 3EW7A 3QX9A 1T2UA 4QBFA 4O4JF 1F14A 2EIXA 4NNOA 4WDQA 5IANA 1PR9A 1J06A 2ZSIA 4H1TA 4I3HA 2X22A 5CCEA 4KX3A 5GAJA 2FW0A 1XD2A 4R1TA 4XDGA 2PKQP 4KYTA 5AJZA 3E8XA 4G9BA 2VQEB 3NQ41 4HWSA 1RWOA 2P27A 4UMDA 2PK3A 3LBIA 4KR3A 5ES4B 3CR3C 2GK6A 2Q5HA 2HK9A 2I2WA 4MHTA 3QRWA 2XXAB 4D9CA 1RKVA 1MW9X 2V8BA 1D3AA 5GV7A 4F5DA 2BR3A 1NVKA 4MOWA 3PQCA 1AVTA 1F9EA 5AVTA 1FYEA 1MMFB 5IH7A 5CXSA 1QH1B 4NEQA 4YJDA 1Z13A 6ADHA 5JYDA 1TMYA 3LQYA 3U17A 4L4UA 1L8OA 1V7QA 3LBHA 1UPFA 2PG3A 1KTIA 2DY1A 3T5AA 1VFNA 1KA9H 1P1RA 2A5JA 1O9GA 3FFTA 4KGXA 2ONYA 4R1LA 4RK7A 4UASA 2ZJBA 1YK0A 4AQYB 2ZB3A 1QUEA 2YWDA 4YMGA 3G2KA 2CF6A 3V8RA 3LK6A 2ON6A 2K4MA 1YTUA 1DL5A 2QF7A 4WRRA 3LUAA 4YFYA 4BUJA 4TXHA 5J4YA 3UQZA 3HMQA 4FONA 4D1YA 4OIFA 3T7SA 1RWWA 2JBAB 2O2IA 4CNQA 1Q7BA 1VM6A 2VPXA 3JD2A 4RQBA 2AXPA 3MHTA 4K6HA 4HFRA 2PSFA 1SD1A 4LVCA 5D00A 5A9SA 1AV6A 2QM8A 4LZZA 4PSDA 5IF9A 2OZLA 3FJ1A 3QVOA 1NP7A 2H1WA 4I9FA 4XSGA 2MSWA 1Y82A 4IIGA 4MO9A 4CMGA 1QQ5A 2IVZA 3OZTA 3V8EA 3IYLW 4MUFA 4FS3A 4EABA 3OT4A 4FZ5A 5KYUB 2YVLA 4HPJB 1A8IA 2GBGA 3L49A 5I9TA 3RSLA 2VP2A 3OX4A 4JGIA 4C3ZA 4GECA 5E2BA 1LA2A 5C1DA 3QU5A 2J31A 2XCQA 3U56A 1GYRA 4XX0A 3P4XA 5LYJF 1IQRA 2CHUA 2BFCA 1RI4A 1CUVA 2VJKA 1M2VA 3IHWA 2Q2VA 4JB3A 4MQBA 1LNQA 4TLDA 5ABPA 4YCCA 2ZI9A 4BFTA 3LUCA 3ZDDA 4RABA 1LDBA 1Q50A 2F67A 4MVJP 3B48A 1SVOA 4L78A 3LWDA 4DPMA 1YVPA 1G19A 3HACA 3GLQA 1R10A 1NBEA 3VVMA 2D1TA 2D5CA 4YRQA 1RRCA 3R5FA 3KAJA 5JDCC 4YPVA 1A9PA 2XMPA 3IA7A 1L4EA 4DV5B 2Z8ZA 3H86A 5I7WA 3V1UA 5G4KB 1L8AA 2FV8A 2Q4RA 3HPRA 1CJSA 3DKKA 1KBQA 3MRVA 5AVZA 3FUUA 3DTVB 1N6IA 3R1IA 2DBVO 1NM5A 1SHKA 1QHSA 3RS8A 1L7OA 4BUZA 3BXEA 1OLOA 1S4MA 4XFJA 3WKCA 3NWOA 3ECCA 3MS2A 2GTPA 4NF2A 1WXIA 5ESXA 2Q7OE 2RHGB 3YASA 2Q1TA 3TRHA 1VYHA 1DPGA 1NI5A 1YZNA 3I05A 3IUEA 4M8KA 3GGCA 4UAVA 2I8LA 4DLUA 4JP2A 4ZEOA 4HN9A 4F5WA 1D6JA 3ZHTA 4DEYA 1GEEA 4N7MA 5ALSA 3K0SA 1UJ2A 2V96A 2FN4A 3OFVA 1N0HA 4MJ3A 1SJ9A 4LV8B 1DRJA 1HE1C 1GKIA 2E4ZA 4FFDA 1XYYA 2PZMA 3HXMA 2AGVA 4KSBA 4G8DA 2Q4EA 2HQOA 4RXTA 5K4GA 1XEWY 4INOA 2BHSA 4HUJA 4GIBA 4NZ9A 4Q16A 3E9QA 3OE7A 4M8IA 4M22A 4JCCA 2HU2A 721PA 4RW0A 3CN9A 4Q6WA 1T8UA 3X1ZA 1NOIA 3BMXA 4E11A 3H97A 4P0TA 3LOUA 3VBCA 1OH6A 4Z53A 3A26A 1MZPA 1ZEJA 3WYFA 1VMDA 2CXXA 5B36A 1KQOA 3PF9A 1W2HA 2Q45A 1J33A 4R16A 2ZSUA 4PX5A 5IJ0A 2O8BB 4CQJA 1W4RA 1DTWB 1UXIA 1CR4A 5COAA 5COQA 3BQMB 3WY9A 1QJCA 3NONA 2IY8A 4MV1A 2X5JO 5JNWA 2EHDA 1XU9A 3LQ1A 2W2LD 3IOMA 3BXPA 3KB2A 3JASA 3ZDRA 3L01A 3JQ8B 5AQ1A 3SE7A 4HVAA 2PUDA 1FNNA 1N2SA 3ABSB 5DWVA 1SUWA 4M38A 3ZC3A 3L43A 3JVIA 4HB3A 4H27A 4M60A 3GLIA 2CE2X 5K6AA 1DXOA 4GZLA 2G1UA 1XCMA 4RHXA 5DGXA 4C4AA 2GBLC 3PNKA 2AS0A 3ODGA 4EQZA 4WGGA 4K28A 5B6PA 1VB5A 1E64A 2HU8A 3OFSA 4U3JB 4BMXA 2DZDA 4UEJA 4LJYA 2IZ0A 1U7OA 2V7TA 4BMCA 4NHOA 2QUHA 1SXHA 5F3RA 3DLBA 3GJ5A 3L18A 4FC7A 3DZBA 1TYDE 5B1IA 4MGIR 1VIDA 3OFKA 1WQ3A 2Q1UA 3NRCA 4EA7A 3LLMA 4KEAA 3EF3A 5MF6A 4LBWA 1S8OA 1YZHA 1ZI9A 5CVJA 5ALRA 2F55A 4YIHA 2YRFA 3SS9X 1PDVA 1V1MA 2PAAA 3CC8A 1GAJA 3R6LA 1F4VA 2HOQA 3BCUA 2H2HA 1L7DA 3M82A 1IJBA 1F1BA 1I7NA 4MVJA 3UK0A 1X1QA 4DREA 1V47A 3WKDA 1VHDA 4O0LA 1EGHA 2C8KA 1Z08A 2ERXA 3WK7A 4OQZA 1Z29A 3EXAA 3ZE2B 2NTNA 3COVA 2BMDA 2CMHA 3LPNA 2IHKA 3B9BA 1JMVA 3N58A 1TC2A 2IZ6A 3SIWA 3T7CA 3VZQA 2O8DA 3G2OA 4EA9A 4LNUA 2FDXA 4U2GA 4RQTA 1KO8A 1WB5A 2B30A 4BX2A 1Q7GA 2IY7A 1UKAA 1JIIA 3EIWA 4G2NA 3UWPA 4AQ7A 2XZTA 4BLPA 5JMOA 1JZQA 4B6SA 2ZR9A 5K4AA 1QFYA 2XJ9A 2Q62A 3QHAA 3UK2A 2ONKA 5BMVB 3TMAA 3TLMA 1VXOA 3VH2A 5LNK6 3G8YA 4A92A 1SU6A 4KWEA 5DLQC 1UXHA 1LPMA 4UBMA 1OIWA 1OZAA 2EJTA 4QOHA 5EAIA 4G63A 1TNDA 4JEIA 1V8BA 4PZCA 4NONA 2BGTA 1Y0BA 2Q1YA 4IWYA 4RHEA 3NJ8A 4DG5A 2YV5A 1IG0A 1XTQA 3EE6A 4YGXB 3QHQA 5KJ1A 1Q1BA 2YZNA 3U3OA 2VH1A 1T1SA 2W2OA 3WB2A 3HXQA 1FUEA 2XVZA 2EZ4A 2BD0A 2HJSA 1EYZA 1IN8A 2P9YA 3L7BA 4Q19A 3T0GA 2ZPTX 1H8HD 4RKYA 1PR1A 4QRHA 2O1SA 4KQIA 5MHTA 4GMDA 1PYGA 4XB6B 4BMVA 3VU1A 1HT3A 3TD2A 4EI2A 2BKLA 1W0KA 3BZUA 4S3MA 5HYVA 5HW0A 3EWSA 2R47A 4H7JA 3GRCA 2H9IA 3HDQA 4Z5XA 1Y5LA 4FFSA 1YCHA 4A23A 3TIFA