3QPWA

Pfkfb3 in complex with aluminum tetrafluoride
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
437
structure length
431
Chain Sequence
ELTQSRVQKIWVPVDHRPSLPRSNSPTVIVMVGLPARGKTYISKKLTRYLNWIGVPTKVFNVGEYRREAVKQYSSYNFFRPDNEEAMKVRKQCALAALRDVKSYLAKEGGQIAVFDATNTTRERRHMILHFAKENDFKAFFIESVCDDPTVVASNIMEVKISSPDYKDCNSAEAMDDFMKRISCYEASYQPLDPDKCDRDLSLIKVIDVGRRFLVNRVQDHIQSRIVYYLMNIHVQPRTIYLCRHGENEHNLQGRIGGDSGLSSRGKKFASALSKFVEEQNLKDLRVWTSQLKSTIQTAEALRLPYEQWKALNEIDAGVCEELTYEEIRDTYPEEYALREQDKYYYRYPTGESYQDLVQRLEPVIMELERQENVLVICHQAVLRCLLAYFLDKSAEEMPYLKCPLHTVLKLTPVAYGCRVESIYLNVESVC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis of the fructose-2,6-bisphosphatase reaction of PFKFB3: Transition state and the C-terminal function.
pubmed doi rcsb
molecule keywords 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3
molecule tags Transferase,hydrolase
source organism Homo sapiens
total genus 154
structure length 431
sequence length 437
ec nomenclature ec 2.7.1.105: 6-phosphofructo-2-kinase.
pdb deposition date 2011-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1)
A PF01591 6PF2K 6-phosphofructo-2-kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3qpwA01
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 3qpwA02
4MITA 2ZSAA 2CXXA 1E2PA 2ZE7A 1J8YF 2DPXA 4PQRA 3EC1A 4C0SA 2JLUA 2GNOA 4PZYA 3GLHE 2ZANA 1E59A 1EG7A 4PXAA 3K70B 3B9PA 1KMHB 4QJ4A 2NO9A 3OZXA 1SVSA 4O2RA 4R2HA 1YR6A 1W36C 4BFYA 1ZU4A 2YWFA 3PCRB 2EYUA 2DWOA 2F3TA 4I1OA 4NE2A 4QHSA 4C9BA 2QPAA 4HEJA 2J46A 1MO6A 3QKRA 4C2UA 1OHHD 3K0SA 2H4XA 4Q5IA 2KE5A 1XEXA 4RCZA 5EUQB 2G9NA 2AL7A 4TQ9A 4OQXA 5AK0A 5E7JA 3JVVA 4E22A 2QTHA 3BE4A 4URVR 4GSYA 5DI3B 2O52A 4P4UA 4ARVA 1RIIA 2H0QA 1F3OA 1ESMA 3EAQA 4TLEA 3KKKA 2F6RA 4XIGS 2XZOA 2IS6A 3TLXA 1JXMA 3U61B 3VR3A 4L15A 5FBRB 2CCGA 2V6JA 2GJ9A 3GJ0A 1UFQA 4DEXA 1ZBDA 3NDBB 3CRVA 2REOA 1IBRA 4M21A 4RD2A 3IT1A 6Q21A 4YQFA 1FX0A 2CLDX 5HCIA 4CW7A 1E0AA 4HZIA 4X8OA 2VP6A 1G4UR 1T9HA 3LNCA 2XGJA 2JAQA 3THXB 4IW3B 4M22A 1VCIA 5KOYA 3HYTA 3B1VA 3R9IA 2CHQA 4IRUB 4PQFA 4TL6A 2C2HA 2W2TA 5TXGA 2GEUA 1S96A 1R5NA 1N6NA 2O0KA 2DBYA 3LX5A 4QGGA 4I99A 5HPYB 3B6EA 5LB4A 5AR1A 4C0JA 3SJBA 3U3JA 1E3MA 5IF9A 2WPDA 5AUNB 4PPNA 4JLAA 4KAXA 2ZSDA 1FZTA 2O0JA 4F91B 2ZI5A 2IEYA 4OQMA 5CJ2A 2WWGA 1C4OA 5FPKA 3SJCA 4NYJR 3K4QA 4A6XA 1N3BA 2YVUA 1DS6A 1U9IA 4B48A 3LW7A 1VYTA 1TIPA 5UKDA 1ZU5A 2IYRA 1SXJB 2VHJA 2MSEB 4IVQA 4DDTA 3W34A 5FL3A 4QGHA 3HWSA 1TL7C 3M6AA 2F55A 1CU1A 5KNDA 5KO2A 3IDQA 3PUZA 3LLMA 2OT3B 4Q1FA 3BD9A 4Q1EA 3D3QA 4BFZA 1OPXA 2FV8A 4CT5A 1E1QD 3AB3A 1VG9B 1E2QA 4A0HA 4Z51A 2C98A 1EK0A 2O8DA 4P31A 1MV5A 3CX7A 2VL7A 1CRPA 1TF7A 2YJTD 2WSMA 1WP9A 4P4SA 1J7KA 1Q22A 2GBLA 4FMDB 4M2LA 3CX6A 1C80A 2MMCA 3GLFB 1UF9A 2QTFA 2WWXA 1TTTA 1UBFA 3IIJA 4N0EA 1XD2B 2ZREA 1T5IA 1WE2A 1E9FA 1NVVQ 1NJGA 1GG2A 1E99A 1T0HB 2X8AA 4X8HA 3K0FA 3J81k 2ZM5A 1ZINA 1KNXA 1OXSC 3TE6A 3L2OB 4WA7A 3B13B 3QXXA 4FD2A 4O2LA 3U4QB 2HYIC 2FJUA 1II8B 2WWHA 3V9PA 1U2RA 1KOFA 4R98A 2P6RA 5FBWB 4IOJA 1ZC3A 4CEIB 2EFDB 3CH4B 4Q4AB 2DB3A 2IF0A 5TB5A 4BZPA 4M9XA 4AKEA 1G7CA 3K0AA 2H8KA 1TEXA 4OJKA 3W6OA 4LBZA 1Z2CA 3IT2A 1JQJC 1UEJA 1IHUA 1ZD8A 2QAGC 1QVAA 2D3WA 2VP4A 2ZUDA 3QBTA 3WBKA 4HLDA 3T61A 1BKDR 2EVWX 1AIPA 1DARA 3WY9A 4FINA 3NTUA 3BFKA 1OB2A 4W5WA 2JIZA 2W58A 1ZUIA 1JQLB 3W5IA 1G7RA 1D2MA 3C14C 3KKNA 1SVWA 1YZGA 1T3HA 2ODBA 2I3BA 3SBDA 1S9HA 2REXB 1AKEA 1CJMA 4HUQB 3THOA 4MRSA 3AH8A 1BMFD 2F3RA 1WBDA 1UJCA 3E9EA 4IXNA 4V02A 1SVKA 3V4RA 1XU4A 4BWYA 2G6BA 1OV4A 5FBLB 4LYHA 2A5GA 1HY3A 4BECA 1G8HA 4M1OA 3WXMA 2J7PA 2P67A 5EE0A 1NMXA 4GMXA 2GXUA 4P0TA 4MUBA 2WNIA 3CIOA 4FN5A 4NHOA 4V03A 4LPKA 2FFBA 4QKQA 1JJVA 2J1LA 2FPKA 2QT1A 4LJ5A 4PFSA 4PPFA 1CF4A 3FHOA 4AYTA 3X1YA 1D9XA 1ZIOA 2GKSA 2GK7A 2BJWA 3AKDA 5FFMA 3SZRA 3GJ6A 5JJKA 1DVRA 2IYTA 4RZ3A 4XSGA 4EJSB 1T4GA 2P2LA 5AUQA 5DH9A 1ZM7A 2B7CA 4MYHA 4OK3A 4MRRA 2H4ZA 1UDXA 1DADA 2PT5A 4JVMA 2DWPA 5F9FA 1ZCAA 3KTAB 2YC4C 3UXMA 4NCHA 5D3QA 4KJZA 1R0XA 1XTKA 2PJZA 3K9LA 1SZPA 4PAOA 4EPVA 1D2NA 3EPJA 2XTMA 2R6CA 2GXSA 4CDGA 4TQUS 3BXZA 3AKEA 1U8ZA 1SK8A 1EESA 2ORWA 2WAYA 3BB1A 1J8MF 3D31A 3AP1A 4MQBA 4QGAA 3JZAA 2ZE6A 5FOVA 4B32A 2P78A 1VCOA 1G291 1D5CA 4WAUA 4NYMR 1SHKA 4RD0A 3PXGA 3CPEA 1KO7A 2I1VB 4DUGA 2QP3A 2XEXA 4OHXA 2C04A 1HQCA 3TBKA 3K0EA 2FGKA 1IQPA 4FMCF 2JA1A 1HYQA 4BPBA 2PX0A 3U6KA 2F1HA 1AN0A 2AFHE 3Q5EA 2CNWA 2J0UA 1W2HA 2YINC 2W6JA 2PMDA 1P7CA 1E2MA 1ZW6A 4DB2A 3Q7QA 3AF2A 4Q21A 3EOZA 3SHWA 3QE0A 1JR3A 4TLAA 1E1RA 1OYWA 4UKDA 2WKRA 5KNBA 3MJHA 5AUOB 1E9AA 4M1SA 2ZQ5A 2JLVA 3KKOA 2F7SA 1AM4D 2O8EB 4JYBA 3O8RA 3RWOA 3EZFA 1L2TA 1U0JA 2QMOA 2RGDA 4RVCA 1NVVR 4Q9LA 4PZZA 2WSSA 3HJNA 4EDHA 1G6HA 2Z83A 3T1OA 4B44A 3GJ4A 3DKPA 3M0EA 5G3ZA 5A4JA 1E9SA 1WCV1 3VMFA 4KLZA 1DKOA 3FDIA 3V4FA 5J4YA 5JFGA 1N6LA 1T91A 4C0LA 4D81A 4XSHA 1C81A 2FEOA 3H86A 1MO5A 2D7CA 1JAIA 2BBOA 4EQ6B 4PR0A 3I62A 2F9LA 1W46A 3QXCA 5L3RA 2RGBA 4DRZA 1T0JB 3R8FA 1YJ5A 5K8IA 5EE5B 1LNZA 1Q12A 2ZSBA 4ARSA 2DYKA 4MGIR 1CS4C 1NY6A 1VHLA 2PLRA 4DCSA 4RY2A 3FWYA 3PJRA 3GLGA 2GILA 4YMTA 2GXQA 5E95A 2B92A 1YZLA 5KPDA 1NN0A 3SQWA 3R20A 1DAEA 2ORVA 4JOBA 3F5FA 3CUEF 5LBIA 1W0KD 1US8A 2G77B 2CEAA 1NN3A 1QRAA 1Q20A 3QPUA 4LJ9A 2VEDA 1H8ED 4A2PA 4C0KA 1LW7A 3A4NA 4WXRA 1Z6YA 3F2IA 2NOAA 5KSPA 4NKRA 3GFOA 1E0JA 2WM9B 421PA 5EE9A 4XJXA 4AYXA 3DO6A 1XTIA 4TSFA 1GITA 3LBNA 3QF4A 5DN6D 1II0A 1NF3A 1UBGA 4WZ6A 3UANA 4B43A 3K8YA 3EA5A 4A0GA 2BCGY 1ZD1A 4LI0A 4QM6A 1SKBA 3SI7A 4IVRA 5EP3A 4NYIQ 2R62A 2A9JA 4URZR 1KSGA 5JHGB 1U94A 2WNHA 4TL9A 4XVUA 2FDCA 4L5BA 3LFUA 3WMEA 3QI2A 1M1YE 1F2TA 4PZAA 2VPPA 3DMNA 1N0WA 1M8PA 4NU0A 1N5JA 3K70D 1EX6A 2R2AA 1PUIA 4IFEA 4Q1DA 3FMIA 3LDAA 4PX9A 3FGNA 5FL7A 2D4HA 4LV5B 3ZGXA 4UNRA 1NSTA 2PEYA 1FTSA 2OAP1 3BH0A 3T12A 2VTKA 3FVQA 3KFXA 4BLQA 2V3CC 3UKDA 3IPXA 2IK8A 5AWFC 2O8CB 4UJ5A 2O8BB 4QBHA 3NTLA 2QQ0A 2W2XA 2DFLA 1W4BA 3VR4A 4A6PA 1ESNA 2GCOB 4DT1A 3ZD7A 3QXSA 2JGNA 4AD8A 1DELA 1RPAA 4CEJB 1NP6A 2XNDA 4Q02A 3GLHA 4DSOA 1XX6A 4F7WA 2R8RA 2XX3A 3VQTA 2G88A 2HIAA 3NH6A 1CIPA 3VHLB 2JLWA 3PEWA 3BERA 3EWAA 3A58B 2FN4A 2YOFA 1GTVA 4NCNA 1QF9A 5AJXA 2AD1A 1YZQA 1R0ZA 1NSFA 3PEVA 4CEHA 5JSZA 2YWHA 2ZS8A 2ZU0C 3CRMA 4PSVA 3ZS8A 2GAAA 3FMOB 4LWZA 5CYOA 3QSYA 1QHIA 2PX3A 3U60B 3EPKA 3IBGA 4ZV4A 5CIWA 5KSZA 1EFRA 1KAGA 5FPTA 4TYPA 3W90A 1T8TA 1RKBA 4DLZA 3UMRA 5C46F 2NQ2C 5SZIA 2BKEA 4EAQA 2H18A 1CR0A 2UZ3A 1TQ4A 2OHFA 1Z08A 5GVSA 1NMYA 4CRWB 3ZVRA 4F92B 3MD0A 1DKMA 2OG2A 3C16C 5BN4A 1G3QA 4QGFA 2EWVA 2FF7A 1KSFX 3BFVA 3RVBA 2HYDA 2XTZA 3EZ7A 4UQOA 5EJEA 2X19A 2HT1A 4IDOA 4DVGA 2XXAB 2ENWA 3ASZA 3GMTA 4HAWA 2AD5A 4YXWA 1Y63A 3CX8A 3WHLA 2GWHA 2QAGA 1RRPA 2VF8A 3F3YA 4GT1A 4JT2A 5FI0B 3ADDA 4B76A 4LBVA 4PHGA 2J7PD 3NXSA 1PLLA 3MWLA 3X1XA 1DG1G 4KO8A 1SXJD 5CU7A 3LQRA 1ZCBA 2VHCA 4U00A 4XD7A 2QE7A 2AKYA 2YKGA 2D62A 5CDFE 2X2EA 2FOLA 1KK1A 4AK9A 3VTKA 4QFMA 1G1MA 3CZPA 4A2WA 1XXHB 2HCJB 4MRNA 5AUPB 2GAOA 3IO3A 2JDID 4C30A 3U44B 1P61B 5F9HA 2IHBA 5D3MB 1TADA 3TVDA 2QNRA 3RANA 2YV5A 4OQLA 3VKWA 1AZSC 3AVQA 4C3ZA 1OXTA 1YU9A 1COWD 3MCAA 4HB0A 1KI6B 4URUR 4WW0A 1CLUA 3TUIC 5FR2A 3LL4A 4MKHA 3D6TB 3LLUA 1GKYA 1RIFA 3N2EA 2P75A 3CPHA 1H8HA 1ZYUA 2ZJ8A 2BHRA 3ND8A 4DSUA 3SYNA 4A36A 1A7JA 3U3OA 1U81A 1OW3B 3TMKA 4NYIR 2ZI7A 3LAWA 1KY3A 4JSTA 1NI3A 4D4KA 3A6PC 5C1BA 4WBSA 4S35A 3EZ9A 1J70A 4DIEA 4TMWA 3LA6A 2QGNA 4NH0A 4DUGD 1IM2A 1ELOA 4C7OA 1N6HA 1P60A 3I3SR 1X1SA 1RZ3A 1ZC4A 4D4MA 4CIDA 1YR9A 3PGMA 1M34E 1F5NA 1P6XA 4HLQB 5A0FA 3RSLA 1LB1B 2CNWD 4HDQB 3ND9A 5KNCA 1E9EA 2OLKA 4EIWA 3IT3A 2CCKA 1JR3D 4FI3C 1DE0A 2V8OA 3C5CA 1O87A 4QC2A 2FEMA 2X1VA 3ZZUA 3VR2A 3W3AA 1M7BA 2B8WA 4GOXA 4GOKA 3B82A 4QBIA 3WYAA 1Z22A 3EZ6A 3TIFA 1XQ9A 4DBLC 2YNMA 2WJIA 2XJ4A 1LF5A 2GZAA 4LJYA 5C18A 3DM9B 2XITA 3QKRB 4QRHA 3K1JA 2HCBA 5EXTA 1G5PA 1X8JA 4Q18A 4HZUA 4JLBA 2WMNB 1XEXB 3ZQ6A 2F1IA 3IQWA 3ICEA 1LTQA 1TNDA 2IS4A 4KFUA 5F2EA 1HA3A 3OEEA 2FNAA 5LPNA 2P77A 5EXXA 2DFTA 2ATXA 2I1QA 1EXMA 1QHNA 2ZVQX 1ZIPA 3GJ5A 3CF0A 4UNNA 1TF5A 3IT0A 4F4IA 2OAQ1 1Z47A 3AV0B 2EFGA 3L0PA 4LHYA 3FKSA 2RGAA 4QHTA 2OCYC 1Q3TA 1ZM4A 2QI9C 2VP2A 5FUWA 2OESA 1V37A 3U7FB 1N6PA 1FX0B 1EBBA 4JBXA 5PGMA 2CBZA 1A82A 2YHSA 3AF4A 1G8YA 4V0KA 3PENA 3B7GA 4FWIB 1JEEA 2H1LA 4KXFB 1PV4A 4OI1A 5F98A 1JAHA 2BMEA 2RB4A 5EZ5A 2QZ4A 4GPZA 2AFIE 1AGRA 4BFWA 1ZNXA 2IYYA 2ZRJA 3F3KA 2HUPA 1N6OA 1AZTA 1XZPA 2OXRA 3BAFA 3R7WA 5FI1B 3WNDA 4TSFD 4B35A 4IJMA 2JJ1D 4RD6A 1OH6A 1RYFA 4B6EA 2WICA 2ZYWX 2WKQA 4GMDA 1SKAA 5J47A 1OIVA 2PLFA 3W3ZB 4GOJA 3DOEA 3KKQA 1R8SA 5CIQA 3CR7A 1BH2A 1TQ6A 1MR3F 1WMSA 1NMZA 3ICQB 3BBPA 2ANCA 1U8YA 4BRUA 3PQCA 4Z8XA 4TMVA 2FZLA 4EFMA 4MGYR 1QHYA 4CF7A 2IA5A 1QDEA 4JLOA 5JHHB 3KJIA 5SZKB 1E9CA 3TAHA 1Z83A 3AQ4A 4PTLA 1OKKD 2W6IA 3RRZA 3T1TA 2FWRA 5J4HA 3VX3A 3Q5DA 1IXRC 1T5LA 3A37A 1HE1C 3PEUA 5FOTA 1Q57A 4TSRA 1HH4A 3BC1A 3LX8A 3I5YA 1KJWA 1G8FA 2CL6X 3NH9A 1IOZA 3VR6A 3GEHA 1W0JA 2ENUA 3AVOA 3IEUA 4DCVA 1CR1A 1UDWA 1ZUNB 2OSBA 2QUZA 1RRGA 4GBMA 1E2EA 4LPSA 5M04A 2QBYA 4PC1A 2GETA 3B1WA 1NBME 3SYKA 1YHNA 4DLWA 1KO8A 3N2IA 4JJKA 2XB4A 4ESVA 2CHVA 3KJGA 2P6NA 3ADCA 4MKFA 2O8DB 1RJ9A 1TQDA 4B3CA 2F1JA 4W5HA 4GNKA 4QBFA 2H52A 4LGMA 3L82B 4P4SB 3E9DA 4GP6A 3E1SA 2QMHA 3HP1A 1ETUA 2VO1A 1ND5A 4KBFA 3DDCA 3NBXX 4Q1BA 1Q44A 3I32A 3TSOA 1TU4A 3AKCA 3NEJA 3HU1A 3K0FB 1KI7A 3U7EB 4O25A 2AN9A 4H9GA 4BLPA 3AVWA 4OK6A 1M2OB 5FPSA 2NZJA 4UXIA 2QEQA 2Y8EA 1P5ZB 3KXLA 4I81A 1MO4A 2EOAA 5C4MA 1QHXA 4QJ3A 1XCGB 3OE7A 1JI0A 3MRSA 4K81B 3HDTA 3K0AB 3K9GA 3P4XA 5EP1A 1LS6A 3FPAA 4IKEA 1EFRD 3TAUA 4P33A 4ASUD 5AJZA 1DTSA 3QVVA 5JJLA 5C4GB 4V0OA 1G5RA 2BCJQ 2J87A 721PA 3R9WA 2MSCB 2V7QA 5CB6A 3ZD6A 4HSEA 4RCYA 1VDZA 4B2IA 5EP4A 3G0HA 1QFXA 2K5UA 3I72A 4V0ME 3IPYA 2HXYA 1E2IA 1SQ5A 2QSZA 3QVUA 2G3YA 1WB9A 3AVVA 2R6GA 2YYZA 3T1VA 4EPXA 4YXWD 4LHWA 5IK2A 3OIYA 4KYUA 2XSZA 1HQYE 2P5TB 2QTVB 1G20E 4E07A 4OI0A 1E79D 1S0UA 2WJGA 1T6NA 2DHRA 2QRNA 4JLPA 5DYGA 4A92A 3WRYC 3OEHD 1OFTA 1GILA 1E2LA 1ONBA 1XZQA 3T35A 3BJIC 1J2JA 4QIHA 2RKOA 3AVXA 3KKMA 1RPZA 1E2FA 3CZQA 2Q6TA 4M0LA 3X1WA 1V7QA 4Q4HA 2V54A 1YKSA 1NT4A 2FFHA 2PZEA 2E87A 4BZXA 1WF3A 5FTLA 1MRSA 3LD9A 4C0HA 2A5JA 3FDZA 4LOAA 4M4SA 4IDNA 4IEEA 1N6KA 5K8LA 3HR8A 3QNUA 2QU8A 1UPTA 4TL7A 3B1ZA 3MJRA 3RSOA 3ZH9B 5JCZA 1Z0IA 1H8HD 2NO6A 3H2YA 1P4SA 3SNHA 1VIYA 1VECA 4ARZA 1Z07A 2WHXA 3PUWA 3GEIA 1SKYB 1VYVA 2WV9A 5GJCA 4HDCA 1G7SA 2W0SA 2GF9A 1C9KA 2IF2A 2XAUA 2A3RA 2BDTA 1E6CA 1OIWA 2DWQA 3RS0A 4BE7B 4PZLA 1D6JA 4ZDKA 1KMHA 1KDPA 1XCMA 2LKCA 2HJGA 2OFWA 1NLFA 1ZRHA 4D80A 4JMPA 3GW8A 1GKUB 2NO0A 4M9ZA 4UNSA 2ZRBA 3B1YA 2IKQA 3EWSA 2FG5A 4R7ZA 1S4QA 3CPJB 3RC3A 1Z06A 2IYWA 5L8VA 1KK0A 3Q9LA 1UAAA 2C9YA 5SZJA 4B75A 4M9QA 2J0UB 4FCWA 2GEDA 5KDOA 5CB8A 4RKFA 1KMQA 1KDOA 3MSXA 1EGAA 2ZRDA 3QXJA 1P75A 3L8YA 3THWA 2AK3A 4OL0A 1KZGB 1JPJA 4LYFA 3SN6A 4ZDWA 3FE2A 4W7SA 2BM0A 4B33A 3QEJA 4G5OA 5H68A 1PLJA 3FJYA 4OK5A 4D4LA 5JS8A 3OEED 4TWZA 2UVQA 3R8CA 5K8UA 3MXOA 1XJQA 4TN1A 2G1JA 3ECCA 3WHKA 4TZ6A 2ERXA 1N0UA 4ZIRA 1OH8A 1KTVA 2OLJA 4TTPA 5EZ6B 3ZHCA 2GA8A 1E9BA 3DHWC 2OCPA 2ZE8A 4ITRC 2Z5FA 3P27A 1R10A 1KAOA 5CYPA 1W5TA 1EFHA 1V43A 2VBCA 4Q4LA 3JVUA 3FKSD 4Z1MA 1W36B 1G5TA 3TH5A 3RWMB 4DLXA 1DPFA 4M1TA 4LBWA 3T5DA 2N42A 1KK3A 2QMEA 1DBSA 1XD8A 4AROA 4K8OA 1G19A 5CDHA 4A15A 4KYIB 2JATA 3KDSE 3GLGB 4K46A 4ZDJA 1LF0A 4DHEA 1LY1A 1BQ4A 4TLDA 3OESA 4KCGA 3MFYA 1KJZA 3VR5A 1JNYA 1KKLA 2VHUA 4ARUA 1KSHA 3CWZA 2HLDA 4TL8A 5E4FA 4PSAA 5DYIA 2GFIA 3LNTA 1VHTA 1US8B 1WBBA 2A2ZA 3EIQA 1QWOA 1S1CA 4Q7JB 2EKZA 3ETLA 5J4VA 2I4IA 2OBMA 1G3IA 2WTUA 1RW4A 4LCBA 1FMLA 1FTNA 1EFCA 4HAUA 1ZD9A 1KK2A 1GWNA 5EP2A 4AG5A 2SHKA 1HURA 2GF0A 2OZEA 3GLIE 2FPLA 4BFUA 3C15C 5DSZA 3O0TA 3LXRA 4IDPA 5CDFA 4CVNA 3RC8A 1Q21A 1UJ2A 3WNCA 1R5OA 1YZUA 2ZJ5A 3QF4B 2WWYA 1F2UA 1UADA 1VMAA 2FSGA 4BLOA 3BB4A 2ODWA 2P3SA 3DMDA 1TU3A 1M6NA 2TMKA 3QG5A 1CRQA 4BASA 2W6ID 2XZLA 1NLZA 3H84A 1HT1E 5JEDA 2BVNA 3Q7PA 4XWAA 1G16A 1U98A 2J7KA 4U5XA 4YLGA 3CO5A 1FQKA 3MWKA 4JBYA 1S8FA 4B34A 3RABA 1F2TB 1SVOA 2OILA 4HAVA 1AJEA 3QF7A 1Y3AA 2VIIA 4H1VA 1W0JD 2NPFA 3IO5A 1U90A 2AHOA 2HDNB 2AWNA 2VP5A 3L43A 4NL4H 4PHTA 2ZAMA 3FFBA 4JS0A 3E2IA 3C5HA 2IWRA 4QNRA 3T1QA 4XVRA 4PANA 5E3HA 2ANBA 3PVSA 3CR8A 1PJRA 2JLRA 2AXNA 2R6DA 3LVQE 3N70A 4TMXA 5FUVA 1NKSA 2VHTA 3LH5A 1VTKA 4D2IA 3ADBA 3BK7A 3BH7A 3RRMA 5DGXA 4BEJA 4DT1B 3A36A 3NBFA 4B74A 4BRWA 4G0NA 4KU4A 3LVRE 3FFAA 4Q48A 2GRJA 1KI8A 3GLHB 1SVIA 4B3XA 4BGDA 2ZRIA 4MYUA 1XP8A 3S1AA 5C2JB 2FSHA 3M4YA 4D82A 5TVKA 2CVHA 5F3WB 4FIDA 4HATA 1SVLA 2YWGA 4J0QA 3Q3JB 4JL5A 2OEPA 2XOKA 1ZJ6A 1DAKA 1MH1A 4X8MA 2IT1A 4HLUC 5FOSA 1X8LA 4HLCA 5DI9A 1P3JA 4QJ5A 1N5KA 2AK2A 4JVSB 4Q9KA 1Z2AA 2J5XA 5BYJA 4W9MC 1JBKA 4KODA 4E09A 3OE7D 5JWHA 4B2PA 4CEHB 1V5WA 5JSZB 2ZRKA 1YE8A 3GPLA 1P9WA 2KI5A 2P9ZA 4FMBB 4LC0A 1O3YA 4DSNA 3ZIAA 3SFZA 2Z0MA 1NKTA 4KSCA 1OT3A 4X8LA 5B2ZA 4LDJA 3MBKA 1QHSA 4FXPA 2W83A 4PO8A 3G5UA 2AX4A 3TKLA 5JRZA 3THYA 2ZJOA 1I2MA 5B57C 1KHTA 1GKIA 4KFTA 1DAHA 2H16A 4PQYA 5TY0A 2OWDA 2HEIA 3B5JA 4PHFA 3CNOA 1DAFA 3KFVA 2Z6VA 3A1UA 2IYVA 3DKVA 5CX4A 4JJZA 2ZRMA 1R0WA 4BLTA 4QXAA 2WPDD 3KQUA 1ND6A 2C5LA 4B73A 5IRCD 2R6AA 1C1YA 1GRQA 2DY1A 1W49A 2DCUA 2GJ8A 4RD3A 2QAGB 2CK3A 3GCGA 2H17A 4D0NA 2V1UA 4EPRA 2RGCA 1P73A 2IYZA 3NC1C 3P4YA 5GJVC 4AG6A 1FNMA 4PSKA 1YR7A 4DB4A 2QORA 2IL1A 2H57A 3B60A 1UKEA 4D0LB 2OFXA 4RFSA 1U99A 3X2SA 4B3GA 5HKKA 2CE7A 3MMPA 1GDDA 5HZKA 2J59A 2OBNA 4F38A 4QOSA 1CJTC 2G1KA 1A2KC 1EFUA 4BUJA 4ERNA 4Q1AA 3H0KA 1DKPA 3SQXA 2QPTA 3TUJC 3QKSA 3BRWD 3ZS9A 2OV2A 3PUVA 5JJIA 1F6BA 4KFRA 1Z0FA 5B30A 2VP0A 2CHGA 3TR0A 4PO1A 1Z6XA 3DPUA 4GFDA 5JZVA 1KDTA 4O0MA 2RGXA 1E9DA 2WAXA 1T3SA 3SFVA 1MRNA 4W5JA 5FOWA 1B23P 3TSWA 2ZITA 4ILEA 3C7KA 3MUFA 2VF7A 3KJHA 1UBEA 1NIJA 5GVRA 2IYQA 1TX4B 1GVNB 1NBMA 1G8GA 1Z63A 1NN1A 4C4PA 1T8UA 4LJ6A 4C7OB 4DKXA 1G21E 1FP7A 2VHQA 1KI9A 1WXQA 3KX2A 1NY5A 4EO9A 2GZDA 3CW2A 2JLXA 1S2MA 3AVPA 3IGFA 4XWOA 4OHYA 1CR4A 1X86B 4YMUA 2V1XA 1IJFA 3FKQA 4PC7A 4ZKDA 2CVFA 2A7QA 3RS2A 4N0DA 1VKJA 1E96A 4JBWA 3K9HA 2RGEA 3CWQA 4TMTA 2ASEA 4MDEA 2KJQA 2QAJA 4GP7A 1R7RA 4RZ2A 4RFVA 2GTPA 1P2TA 2MMGA 3DM5A 1ZNWA 4LHXA 4V0NA 1XPRA 1AGPA 5LD2B 2JIZD 2W0MA 4Q7KA 1KGDA 1Z0KA 4A8JC 4IHQA 3EXAA 4HZUB 3ONWA 1U0HC 1LVGA 1II9A 1IY0A 2C96A 2FFQA 2H5EA 3VU9A 3A4MA 1GSIA 2OO7A 2P6MA 5JRJA 4BFSA 5TARA 4G5QA 3NBYC 4XH9B 4Z1MD 3SBEA 4GI7A 3TUZC 1QBKC 3C7TA 3KXIA 1IJEA 2WBLC 3HR7A 2BBSA 4I4LA 4DCTA 1Z3IX 1S3GA 5EE1A 2OFOA 3RNLA 3VFDA 3KB1A 4BZQA 2VLIA 4TTQA 1AS0A 2B21A 3EA0A 5E7MA 1FL9A 5E7IA 4V0MA 5FBVB 1W4RA 2F43A 3A1TA 3LWNA 2VA8A 1LV7A 3AF1A 4URWR 1SXJE 4QHYA 1QHFA 1VCNA 2QA5A 3QY0A 4N1AA 3ZZ0A 3D4IA 1AKYA 3K70C 1TMKA 1IY2A 4MKIA 1EWQA 2JLYA 2P2ZA 2QQEA 1JECA 2BBWA 5TDHA 3SE0A 1IXZA 8OHMA 3QJYA 4DLUA 3TRFA 1XDBA 4B2LA 4JL6A 4EMBA 4LJ8A 1XMSA 2GHIA 2VSOA 3D8HA 5FH9A 1AA9A 4JYCA 3R7WB 1H2FA 2P6OA 2GBLC 3EX7C 1CJVC 4CZ2A 1UKVY 4D6PA 1YJXA 2IXGA 4GRAA 1A4RA 3QEOA 4ON9A 2IW3A 1KNQA 3W9YA 3GLFE 3T15A 2EQBA 4RJLA 2D2EA 4GZLA 4JLDA 5JWRA 3ZVNA 4JOCA 5JS7A 1OXUA 4FMDF 1DEKA 1KI2A 4E5UA 4EFNA 1RE0A 3IQXA 1XMIA 2CLCX 3LO5A 5AJYA 2YWEA 2ZRNA 4A2QA 1K5DA 1HV8A 2NZ8A 4TYYA 2ZUBA 1Q1ZA 3UIEA 1XEWX 1OFUX 1GUAA 3RS4A 3ZDQA 1RYHA 3OHMA 1BYIA 3CBQA 3QENA 3UG6A 2W6JD 3BOSA 1CULC 4IOLA 1KYIA 2WKPA 2OM2A 4JODA 1E1RD 4B3FX 3C41J 3GQBA 3L0OA 2CLSA 2QBYB 1AQUA 1KO4A 2GDJA 2VQSA 3AF3A 4NDZA 3AP3A 1OFHA 5B58C 4TZ0A 2NMVA 4JSYA 4RZUA 3RAPR 1SHZA 4R2IA 4PAMA 4YDHB 1P2SA 2BMJA 4Q19A 1RJ9B 2WSSD 4CGZA 5BW8A 2GVDC 3EZNA 1GP2A 4Q4JA 5FOUA 2ECKA 3I61A 2VP9A 4M1KA 4S2EA 4DJTA 1D9ZA 1G3UA 4PC3A 1P2UA 3QPVA 2QP9X 2IYSA 2IYXA 2XOKD 1W36D 4EPWA 4PAQA 4CYMA 1E2NA 5JI3E 2J45A 1L7VC 3GEEA 4P4TA 4OI2A 2A5FA 2Q3MA 3NHAA 3CRRA 2ONJA 3GD7A 2ATVA 2XB2A 4ZO4A 4C0AC 3CNNA 4YMSA 4AI6A 4E3WA 1OXXK 4RZXA 1GOTA 1SXJC 3EASA 2GCPA 3ZIAD 4YMVA 4OYHA 2IYLD 1DAIA 1JJ7A 2OCAA 2Z43A 1JB1A 4PPQA 3W6NA 2Z4RA 4QNMA 5DE3A 3HPQA 4NMMA 3EPHA 2CL0X 3ASYA 4OHVA 3T5GA 3BFXA 4ABYA 2JLZA 2ZSFA 4V0LA 3QOFA 3PFIA 3ADKA 4I1SA 1IN5A 2PMKA 4Q01A 5L3SA 1YQTA 3FOZA 1K5GA 4HLUA 4ZPXA 1QHGA 1R4AA 3UK6A 2OUKA 4XTCS 2IUSA 1ZMXA 2R65A 4Q66C 5GADl 1VIAA 2QSYA 4XTRA 4B71A 1NIPA 4NYJQ 2O8FA 2FFAA 4JKIA 3T34A 3NFYA 2IXFA 1A1VA 1R6BX 1N2CE 1Q3HA 3A1WA 4MKGA 4RKEA 1KJYA 4MRPA 1NG9A 4DXAA 5CLLA 2PZGA 3QIAA 3TW8B 5IT5A 4L9SA 2AWOA 5KSYA 3K53A 4MYCA 3VKGA 2ZXUA 5L3QA 5FTNA 1MT0A 2RAPA 5FUYA 4D25A 1AK2A 2P0EA 4ZDIA 5HKKD 3VKHA 3GP5A 1NVUQ 3CM0A 3GLIA 2ZRGA 1P2VA 4OKSA 4Q4HB 1CXZA 1B0UA 3DCYA 1FW6A 4QG7A 3WMGA 2BMFA 3U7HB 1ZAKA 1XPOA 5FL7D 3ZZTA 5JECA 1BQ3A 4KLNA 4YDSA 3FDZB 2WU0A 1E58A 1OSNA 3FTQA 2J3EA 2QL6A 3RHFA 3AF0A 2QT0A 5ANRB 5JCPA 5G53C 4HB4A 2ZRFA 3IKJA 4OI4A 4TTRA 2XZPA 4DCNA 2ZR0A 2EWWA 4B47A 4ARZB 3EIEA 2J9RA 1NRJB 2WJYA 4DLRA 1XTRA 1YRBA 2RCNA 2XNDD 3FB4A 3SYLA 2V4ZA 4LJ7A 1F48A 2A5DA 1QHHA 1X6VA 2V6IA 4AC9A 5CITA 4WZBE 2C03A 4YC7A 4BQSA 3P32A 3E5HA 1VCMA 3TR5A 1NBMD 3U7GA 2C99A 1KSJA 4Q9HA 1Z0AA 4OJQA 2HV8A 4LJAA 2LCFA 1FOEB 1FUUA 2NO7A 3QPWA 3TNFA 4IFBA 3VHXA 3B2EA 2GEVA 4B3BA 3OI7A 1G6OA 4HAZA 2FH5B 3DZ8A 3W8NA 2PBRA 2FPMA 5A5GA 4FW9A 2WIBA 2XTNA 1W44A 3AM1A 1T3LA 4DDUA 1FQJA 2RGGA 3P26A 4PO9A 3UWOA 2E9SA 2X2FA 3KKPA 4LHZA 1WRBA 4AY2A 2FZ4A 3THWB 4EJSC 3U3RA 1VG0B 5BN5A 2N1BA 4Q9IA 2BMDA 4L8GA 3SJAA 2YOGA 5DO9A 2WJVA 4MH0R 4RD4A 3KQKA 5HR5A 2Q9BA 1I4LD 3CRQA 2WWWA 1C7ZA 1E2GA 2QP4A 4ZKEA 3P20A 3RS3A 2BM1A 2JJ2A 4ZIRB 2F90A 1RRCA 3VR1A 2J0SA 1P9RA 4KBGA 1GIAA 3K9NA 2QRZA 2IS2A 4US0R 1YZNA 2FA9A 1MABA 5TV2A 1Q0UA 1T8PA 2A5YB 2D06A 5BXQC 2PEZA 1W0KA 2CJWA 5DHFA 1KIMA 3U3MA 1JR6A 4JLNA 1XRJA 1H8EA 2C77A 2QE7D 2KWIA 4XD7D 4OBEA 4HI0E 2GCNA 4A8JA 1I2DA 4M9SA 2AXPA 2PZFA 4KSBA 5H70A 2EFEB 2J0VA 4URXR 1E98A 2P30A 1NG1A 1OFIA 2CMKA 2PT7A 3P1JA 4MGZR 3U6BA 5DN6A 2ZJ2A 3CB4A 1DG3A 3MG9A 4M1MA 1E4VA 3EC2A 3I92A 5HTKA 2X77A 2IX3A 1BOFA 1TPZA 1BS1A 4UXHA 2QN6A 5FR1A 1Z8FA 1K8RA 2H7VA 4US2R 2O0HA 1WQ1R 2RH5A 4AKGA 3C4JA 5EXSA 2QNIA 4N3NA 1U8AA 3L8ZA 3TGPA 1N5IA 3E70C 1XCPA 1FMJA 2GJKA 3KUCA 3E9CA 1F2UB 1NLYA 4NYMQ 1E2DA 4YONB 1HT2E 5IHPA 4UXJA 4BLSA 2GJAA 1CJKC 4EKDA 1E94E 3SJZA 4PC2A 3PV0A 5FUXA 4IVPA 4RD1A 3AVUA 3DB1A 1W7AA 3UG7A 1DKLA 1YFKA 1XEFA 2P79A 2REBA 3B8HA 4ESHA 4MRVA 3H4MA 1AQYA 1FP6A 4G01B 4KITB 2EFHB 2ZI3A 2ZJZA 2B8TA 4GDFA 4UNPA 3REFA 1XNJA 3K4PA 1YRAA 2P9YA 5BYKA 4IJ6A 1CEEA 2IUUA 4LHVA 5DNYB 5DI3A 4LZZA 2PCLA 5FOXA 4PHHA 3BB3A 5CM9C 1I4DD 1IN7A 1EWRA 3NIBA 1UKYA 3H1TA 4DCUA 5BN3A 2BC9A 4QM7A 5EUMA 2PL3A 4DC9A 1XF9A 4JIMA 1X3SA 3AKYA 3BH6A 3OIUA 1JXOA 1GNQA 1CVIA 2D74A 3KQNA 3KJEA 2QGZA 3S1AB 3KB2A 1AS3A 1R2QA 1OIXA 2YZ2A 2GK6A 4DEYA 2ERYA 3JZMA 4TT3A 3KXKA 3KQHA 3PIRA 1GL7A 1E32A 2NGRA 4TMZA 3TQCA 3THXA 4OQNA 3KL4A 3AEZA 5KU1A 4URYR 1L4YA 1VYUA 2ZR7A 3U2QA 3EZ2A 4EPTA 4TYNA 1CJUC 2IUTA 4A0RA 2A30A 1GAJA 1ANKA 1TUEA 4YMWA 2VSFA 2VH5R 3L0IB 3UMFA 4EFLA 4EUNA 5JBQA 4IDHA 5J4KA 1GL9B 2ODNA 2QENA 1D8TA 3OIVA 2B7BA 4IDQA 2IC5A 2ZYVX 2C95A 2XNSA 3N5CA 2KBFA 1ZNYA 1ODFA 3K09C 3OFNA 3AGPA 3SHFA 1XXHE 2R6FA 4LBYA 4LRWA 4WOPA 3THYB 2MSDB 4G5SA 1MO3A 3WP1B 4BFTA 1N6IA 2P65A 1YZKA 4QL3A 4L16A 3FHCB 3DZDA 1XBTA 4JLMA 2NTYC 2ZTSA 1XMVA 5EE3A 1H65A 3LXXA 4HAYA 3W5JA 2IWHA 3REGA 4TYWA 4UJ3A 1SXJA 1XEWY 4MYTA 4DLSA 4II7A 1SGWA 4TYQA 3LY5A 3EIHA 1W48A 4PC6A 1DAMA 2XJ9A 3IIMA 5CJPA 1XTJA 3NHBA 1FUKA 3O8DA 3TW4A 3RRYA 2EW1A 1KI1A 2JDIA 3AUXA 3U5ZB 1G4AE 2BJVA 5G41A 5DIFA 1JALA 5HE8A 1OYYA 2LKDA 5FTJA 1COWA 2RGNC 5L3VA 4R9UC 1PVOA 4RFSB 2NO1A 5EXPA 4M1YA 2ZEJA 3TK1A 4LK2A 2ZU6A 2IXEA 3IEVA 5GJWC 2UZIR 1HUQA 5KSOA 4HB3A 2ZYUX 4UNQA 1A2BA 1J99A 5JLJA 3CRW1 821PA 3GLFA 1IHPA 4WZAE 4Q03A 3GFTA 3QKSB 1ZVQA 3QBVA 1XD2A 2QY9A 3CKLA 1E9RA 1AS2A 2CCJA 2FSFA 3HYRA 4DZZA 3NKVA 3LV8A 4PPGA 4ZI3A 1PZNA 1IY1A 4BLRA 1H2EA 4P3YA 4IJ5A 4M1WA 4Z8YA 3U4QA 5LD2C 1OXVA 4D4JA 1II8A 1YZTA 2KB0A 3W8RA 1W2GA 3I4LA 4LUCA 5CK5A 4AKHA 2GJSA 2ZIAA 2YN0A 3GJ8A 4CEIA 1KDRA 4Q4AA 4AIIA 2CDNA 2FU5C 4NZYA 2ZSEA 5G3YA 1SK9A 4OHWA 2C9OA 2F9MA 3QKUA 1W4AA 1W4CA 3NVAA 2D7DA 4C2TA 4ZCLA 4MGKR 1IONA 5ELXA 4ACAA 1GNRA 1E0KA 4IOKA 3DVLA 2R44A 3DOFA 3IILA 4DLVA 2ZRAA 1Z29A 2EU8A 3FYHA 4M53A 1KI4A 1M7HA 3KZ1E 5LDDC 4IXMA 1I4TD 1YR8A 3TQFA 1GRNA 1W1WA 1JEDA 1QVRA 3IHLA 2VSXA 3IBYA 1J90A 3MWYW 1Z6AA 1GZSA 1BO6A 2KBEA 1Z6GA 4Q47A 3V00A 2ZRLA 4HUQA 4FDUA 1G64A 3MGCA 1BYUA 2W2VA 3BGWA 1Z0JA 2N46A 3X1DA 3F0TA 2V7QD 2WJJA 1OB5A 4P32A 1E2HA 1ZM9A 2P2YA 1GFIA 2E1RA 1M74A 3RRNA 1FZQA 1N0VC 1HE8B 3F8TA 3AVTA 2WWIA 3RS5A 1NL3A 1DKQA 1UKZA 2ZPTX 2R9VA 4I1VA 4F4CA 2JEOA 1GNPA 2JJ2D 2RHMA 3K0CC 1QG4A 3A1SA 3U3KA 1WA5A 3VU9B 3PUXA 5IK2D 1IN6A 1N25A 2ZI6A 4JLVA 4BEBA 2XSZD 4KVGA 1ZM2A 3ZQJA 1U0LA 3NBZC 1PUJA 1Q1BA 4BFXA 3FMFA 2J41A 2A6PA 5H1YA 2ONKA 4Y0AA 4EJSA 2NPIA 3NG1A 2VYFA 3EPLA 2G0NA 2DFKB 4G5RA 2WVJA 3OAAA 2F43B 1TAGA 3LBHA 4ZCMA 2AKAB 3KTAA 5BWMA 1LS1A 3B78A 4HDOB 2FX3A 2ZYTX 1W47A 1G7TA 2JJ1A 1P9NA 5FPYA 4AURA 3FHTA 2PCJA 3LRPA 1UEIA 4Q1CA 2JLSA 4DDWA 5FTKA 1TEVA 1XJ0A 2PH1A 1OLOA 4JZKA 3SS8A 2Q9AA 4DLTA 3D6AA 4LC1A 4JKYA 3L0SA 5EQTA 4EPYA 4ZCIA 4JVNA 1RPTA 3PR1A 1UM8A 1TUIA 2QMUA 1M7GA 4LV8B 5HCNA 1OKKA 2KSQA 3EARA 2ZETA 4A4DA 1QZXA 4ZI2A 121PA 1ZNZA 1F60A 2BEKA 4NONA 1XPUA 1FNNA 1S9DA 4AWXA 1G8PA 2PJRA 3D7MA 3MLEA 1GL6A 2ZS9A 2V55B 2FE4A 3WP0A 4A0FA 3SOPA 5DLQC 1X8KA 2QG6A 5J40A 4TQAA 2HJVA 4ACBA 1G3MA 3NDPA 5FTMA 4XWKA 2DFNA 5HE9A 4Z54A 2BKUA 1HEIA 4NCIA 3W6PA 1OH5A 2LWIA 3RYTC 4MUAA 5KPJA 3SC3A 3C8UA 3B9QA 2O8EA 1E2JA 3AP2A 1RRFA 3QQ5A 1WDTA 3I5XA 5JEEA 4RSGA 3KUDA 4LSGA 4HAXA 2FMXA 1NVWQ 3HPRA 3R9XA 4JLKA 1DAGA 1OHHA 2IYUA 1Z0DA 4FCVA 5KTYA 4PZ9A 4LJ4A 2P6UA 3TJZA 3RDPA 3TSZA 2BEJA 1FFHA 3D8BA 5LB2A 3IUYA 3Q72A 1GM5A 3B85A 2Q9CA 1RVDA 4G3XA 1FPMA 3LW8A 5HZHA 4G1UC 4I1UA 1UBCA 2ZRHA 4GPTA 4EQ6A 5G40A 2RHDA 2WWFA 1P62B 1RFLA 3FMPB 3NEYA 4H1UA 4IOMA 3T06B 1XJCA 3RS7A 1MKYA 5GJBA 1L4UA 2C8VA 4G5GA 5AJWA 1KO1A 4Q4JB 1IAQA 1YVDA 3GP8A 3QUSA 1G3RA 3O47A 2BBTA 3CH5A 1ZP6A 2WOOA 4TT3D 1PLKA 3HU3A 3QXHA 1P72A 2OWEA 2L0XA 3X1ZA 2F1RA 2GXAA 3ZLJA 1XTQA 4D26A 4GL2A 521PA 5TMPA 1IN8A 1NVXQ 4POAA 5FPHA 2O5VA 4Q9JA 3GJ3A 2W00A 3UWKA 4KVAA 3WYFA 4ASUA 1U9IC 2GZHA 3PUYA 2H92A 3IHWA 4F93B 3GP3A 2OXCA 4PGMA 1XFAA 3CF2A 2ZRCA 2JJ8A 1XTSA 5KDDA 3LQQA 3OFND 3EW9A 1VG8A 1VPLA 5CLQA 5FBQB 3VNVA 4OHZA 2WIAA 1FBTA 4ODIA 2HLDD 1VG1A 2A78A 4MDFA 1DKNA 2EKBA 3ZYCA 4Y0VA 3Q85A 1IN4A 4LYAA 2HF8A 2ZVPX 4DDVA 2BV3A 3ZVLA 1HTWA 2ZUCA 1Q1EA 5L3SB 4XVQA 3PG5A 2AR7A 1KO5A 3CLVA 3GJXC 4NCKA 1CR2A 1E79A 4TLBA 4DWJA 4JT4A 4LV6A 2EFCB 1MOZA 4KHZA 1CBUA 3GFPA 3OEHA 1Z6TA 4B6FA 4GZMA 1R0YA 1Z28A 5H8WA 1Z5ZA 5SZHB 3PEYA 3LG2A 3A1VA 1OE0A 3DEFA 1SKYE 4U02A 2O8FB 4WIAA 2IS1A 2OE2A 2RMKA 3K09A 3UMSA 1XMJA 1N6RA 4Q7LA 3UPUA 3AUYA 1TQ2A 1XWIA 1BIFA 2ZROA 2OCBA 4XOIA 5P21A 4DIDA 3B1XA 3HJGA 3RLFA 5KHOC 2HHJA 2WOJA 5L3QB 1E1QA 3Q8XB 1KZ7B 2QROA 2A9KA 3NC0C 4KFSA 2P5SA 3GLIB 2BOVA 4O3MA 2O8CA 1CTQA 3I1FA 3CONA 2JASA 5AJVB 2O8BA 2ZJAA 1SKQA 2GCOA 1ZM3A 3SDZA 4F4JA 1OF1A 1X1RA 3GJ7A 4WVFA 1KI3A 3BWDD 4MA4A 5IDVA 3WRXC 4CEJA 2JLQA 2ZE5A 5J4LA 3MWJA 1LFDB 4LYJA 1KKMA 3ZJYA 2Z4SA 1E69A 2ZI9A 2G83A 3IIKA 1OH7A 2ZAOA 1JR3E 4FMCB 2C78A 2QM8A 4FDTA 2VRWA 2ODEA 3CF6R 4NBSA 2YN2A 4KV9A 4C0BA 3SEAA 1G9XA 2RGNA 2DR3A 1E4YA 3ZVMA 2PA0A 2NG1A 2ZR9A 4NTZA 1SVMA 2UKDA 5DISB 1KY2A 2QPOA 1DOAA 1QHHB 2FSIA 3I8SA 1R8QA 2D2FA 5JI2E 2RFLA 2BWJA 3QG1A 1G17A 1DO2A 4FCTA 4A1FA 2J0QA 2IEZA 1TF2A 5CK4A 2B6HA 4OQFA 2GVZC 2HT6A 1K6MA 2IBMA 2YOHA 3R7AA 3VNUA 2GESA 4JVLA 2ZJBA 4JLJA 2FGJA 2JCSA 4A9AA 1NJFA 3I8XA 4TMKA 3A4LA 3BS4A 1Q1QA 4B3DA 4R71A 3KQLA 4Q7MB 2YC2C 1L8QA 2ORIA 3QKTA 4NP6A 1XB2A 3VX4A 3GLGE 1NNEA 2V9PA 1R5BA 3O8CA 5CM8B 1N5LA 4LY6A 2G0TA 2XXAA 4NCJA 4U7DA 1CP2A 1ZUHA 3I73A 3A8TA 4A82A 4Q00A 3O8BA 1IXSB 4C0QC 1BMFA 5JWOA 2C9CA 1E0SA 4DLYA 4E03A 1EX7A 5KUTA 2NIPA 221PA 3DL0A 3WMFA 1G18A 2IHYA 2Q3FA 1JPNA 5B64A 1QG2A 2CL7X 2Q21A 4JL8A 3NWJA 4TLCA 3TVTA 2BIFA 1A5TA 4NPHA 4US1R 3HU2A 3UATA 3LBIA 5KYKA 2OBLA 4AKIA 4IEIA 2ZRPA 1XXHA 5JMTA 3EG5A 4AYWA 2CK3D 3AGQA 4L9WA 3U44A 2WZQA 4M8NE 5D3MA 2ZS7A 3BIFA 1SULA 1MABB 4FWTA 2HXSA 2WMOB 5KDLA 3MAAC 1W5SA 4HUTA 3G82C 1DO0A 621PA 3AVYA 5BQ5A 1RC8A 1EFTA 2CJWB 1KI6A 2ZJYA 3OAAD 4HYYA 1CKEA 3OIWA 3WYGA 3CNLA 1OJLA 2CE2X 4D0GA 2P9FA 3BORA 4A8JB 1D2EA 1GRRA 2QM7A 4QBGB 3M1IA 4DSTA 3OF5A 5K8TA 3WBJA 4HBZA 4L4UA 3K0CA 2EYQA 3SR0A 4LX0A 4CT4B 1XD9A 2ZI4A 1G41A 5J5CA 1E2KA 4HB2A 1S1MA 3VAAA 2Q0HA 3PITA 3SU8A 1NN5A 1UJBA 4GPIB 2WJHA 3WNBA 2HF9A 4KI0A 2Q3HA 4WXPA 2HPAA 4BFVA 5DHAA 1S3SA
chains in the Genus database with same CATH superfamily
2FVYA 1NJSA 1QAQA 4GG1A 4M6WA 2WKSA 1WHSB 3KQWA 3EC1A 1DIHA 4O4LA 1W5AA 1Z82A 1VL0A 2GNOA 4PZYA 2ZFUA 4WZAA 1PS0A 5JVDF 1E59A 1EUCB 2ZANA 3DC2A 1D7AA 3KTFA 4PXAA 4KQ2A 4ZAWA 4QJ4A 1SB8A 3OQIA 4FE7A 3OZXA 2PMFA 4B09A 4DHWA 1G8AA 2QIOA 1QS0B 3ACCA 3LPCA 2DLNA 5F1KA 1W36C 1Q7EA 5L9AA 2QQFA 1TMYA 4JA0A 1YCHA 3WWDA 1B6RA 3T7KA 3T52A 5KI6A 5CG1A 5IDQA 1V5FA 4G5YA 3RBAA 4C9BA 2J46A 3T4EA 4C2UA 1RU3A 4F8EA 1NONA 3I2IA 5HHTA 2H4XA 4KHPB 1EFAA 1H2ZA 1BROA 1OR8A 4KRGA 4RCZA 5LDGA 5EUQB 4TXHA 2I7DA 3DDUA 5AK0A 1JG4A 2BP7A 3DNFA 4KQWA 4MQ4A 1LCIA 1Y3FE 4URVR 3W6ZA 1NWHA 1Q7RA 1FJXA 3W2GA 3TTVA 3HXLA 1ADFA 4ALLA 5B2EA 4B3SB 2P40A 3EAQA 4WUVA 3TD2A 3U09A 2I4NA 1AN9A 1XSEA 3DT9A 2JAOA 3F98A 2FPPA 3M6FA 4L15A 3EWNA 3ZJ5A 2UVPB 1T0PA 3C6ZA 3GJ0A 1NPYA 1WUKS 2HHLA 2NT4A 2NVUB 3U81A 1LBEA 1XLTA 2DKOA 2REOA 4BVGA 4AY6A 2ZIUB 3TRKA 4EZBA 3FOFC 3HLKA 1FX0A 5HCIA 4F5DA 2JHPA 2F1KA 4HZIA 3GG2A 1N75A 1G4UR 3UH0A 2EHJA 2IYOA 3EGOA 4YUWA 1EE2A 3N6XA 3RRBA 4EEZA 1JQEA 1EUDA 5LQJA 1Z5WA 3JAKA 1RACA 4RO0A 1L5OA 3IRUA 1EDBA 4R9SA 2DJ5A 1H4VB 1HDGO 4G63A 4YHHB 1I51A 1IEXA 3KAJA 2NU6A 2HA0A 3U4CA 2W2TA 4LHEA 4Y9TA 1VKRA 2FZCA 4QPNA 4BFCA 3PUIA 4LF4B 4GX5A 2EJUA 2ZG6A 1AXRA 1P9LA 1XGKA 2OHJA 5EMHA 1DDOA 4TZTA 3ED1A 3GRCA 3J81A 2QTLA 4ML3A 4PPNA 2AOUA 3R2JA 4G36A 4RBNA 4F91B 2F62A 3TW6A 4OQMA 2AE2A 2WWGA 3GXBA 5FPKA 5IXYA 3T95A 4Q3AA 3VU0A 4IKOA 2YVUA 4Z7NB 1FP2A 2BFAA 3QBEA 4M37A 1U7ZA 1U9IA 1TIPA 3GJQA 3LW7A 4IGKA 1ZH0A 4WI1A 4B48A 4DNFA 5LU9A 4DA8A 3FSEA 3BJZA 2FWAA 4XASA 4IVQA 5TS2A 2EC5A 4FKBA 2X0FA 3I0ZA 4TTIA 3W34A 4A27A 3S7ZA 4F2PA 3NV9A 1TL7C 1ZOIA 3M6AA 3PT9A 5A3QA 2OP0A 3EGWA 3B6JA 5KNDA 5KO2A 1MLDA 3PUZA 4OAOA 5A1JA 5K0EA 1MVNA 1FDVA 1XNGA 2NN3C 1P0QA 2KLHA 4OUKX 1L7MA 5BWOA 1OV6A 4Y9RA 5FV7A 2DUUA 2AI3A 1E1QD 2ZTHA 3AB3A 2FUCA 2WWTA 1ENZA 3QVSA 3C5WP 3BRWA 3K31A 4UHHA 3CKKA 4A0HA 4EKNB 3KQQA 2M32A 2C98A 4Z9YA 3RK0A 4L72A 2Q2NA 5BSWA 4CN8A 2PZMA 1TF7A 2IXBA 2GNPA 1HG0A 1IXYA 5IYZA 1SBTA 2OC4A 2QN3A 1QTIA 4P4SA 4M2LA 3HGQA 3CX6A 1T1RA 1NKVA 2PYIA 2HA4A 4MW9A 2VKTA 4W8GA 4DUZB 1C9MA 4QT0A 1NP3A 1WE2A 2HNKA 1NVVQ 3EQZA 1NJGA 3S8YA 2E89A 2FQYA 1GPDG 3K0FA 2CHFA 4M49A 1ZINA 3ILYA 1OXSC 3F1KA 3O4RA 2Q27A 4JKOA 4WA7A 3S29A 1M2OA 3IVMA 3ESZA 5D51S 1EVQA 1LI7A 3OTWA 4JI1B 1I3CA 4L5CA 4RJ2A 1GXSB 1DDGA 4W1QA 5FBWB 1L1FA 4Q4AB 1UZAA 2QOEA 5I7RA 1GHTA 4YAKA 2QWXA 2MINA 3I1YA 3QNMA 5EIXA 1FU7A 3KOOA 4AKEA 2AZTA 3H9CA 4HFJA 2BSAA 4ND6A 5CDUA 1U5BA 4A5SA 1XNRB 4N3BA 1TIKA 2OECA 3GOQA 3OOEA 4MVJG 3W6OA 1HFWA 5DXJA 4KVFA 4Q3OA 5C81A 4AVYA 3ZHTA 5JS6A 2D3WA 2G9ZA 1SUPA 2E48A 4H7JA 1BKDR 4XOUA 2Q5LA 1DARA 3ZXIA 4EEKA 5JQGB 3JRNA 2P4QA 3BFKA 4MVXA 4W5WA 1OB2A 4OIFA 4TXNA 3KKNA 3C14C 1YZGA 3CURA 4N5HX 3SBDA 4F5WA 1GRVA 1R15A 3HVKA 1C1XA 4HUQB 1MT3A 4OBXA 3GRZA 3QELA 1MEOA 3AH8A 1U9JA 3L8GA 2F3RA 3DLCA 5F73A 3H1GA 4AXBA 1DGQA 1ZCZA 3TG8A 3QU9A 3O4FA 1XRLA 3Q3GE 2WSLA 4LYHA 1QPZA 1K0UA 1ZUWA 1X7HA 3KNZA 1M1UA 2DQKA 1Z0SA 1W30A 2BFNA 3H1AA 3T54A 2XMZA 3N2YA 4WH0A 4OCZA 4X63A 1KQOA 5EE0A 2YS7A 4GMXA 3NVDA 2RB5A 2HCRA 1NZJA 3SR4A 2ZVDA 3LT4A 4NHOA 4V03A 5F3DA 3E22A 2I3DA 4YCDA 2J1LA 3UOGA 2QT1A 1M5RA 4PFSA 4PPFA 1JHDA 1Z4PX 3TJMA 4IZIA 3I9JA 3E7WA 1VPVA 5HK8A 3LTNC 1PCXA 3D5QA 4O5AA 2BJWA 3CGGA 3PZRA 4OBBA 4R81A 5CR9A 4KN6A 3ESCA 3BE6A 5JJKA 3M6WA 2V5AA 2IYTA 4RZ3A 1BS2A 2X6TA 3AYXB 1LD3A 4JGBA 3B3AA 1NOKA 4FB5A 2WAAA 1PZEA 3EX7C 4MYHA 2B7CA 4CF5A 1ZDMA 1RXYA 1MAVA 1E1DA 3NP7A 4RDCA 2LCQA 4BQFA 4DS3A 3TECE 1FMFA 3UHFA 4PLHA 3Q5GA 2C4VA 1ZX1A 4TYMA 3ICPA 1ZOPA 1I0IA 4GXNA 4K9LA 4KJZA 1XTKA 1F4PA 4HXYA 4PAOA 1CE8B 3P45A 3EPJA 3OKPA 4C01A 3FRJA 1IUPA 3OCXA 4WN9A 3ENNA 3D31A 2CJXA 4QGAA 3DLIA 5K0NA 2RGUA 1YQ9A 3HBJA 4FYIA 4P58A 3HKEB 1K7XB 1V3TA 1VCOA 1GR0A 3IQGX 3O84A 3D3JA 1D5CA 1G5IA 1PZFA 3AF4A 1SHKA 2B4RO 2GPWA 1DZ3A 1KO7A 2I1VB 3QPCA 4DUGA 1NYRA 4U2CA 3WLAA 5B1YA 1A7UA 1X38A 3UOAB 4BPBA 4JEHA 3U6KA 2F1HA 1KETA 1SN7A 1OBOA 2XPCA 2ZSHA 1RRVA 1DZIA 2DR0A 1G8MA 2W6JA 3C7CB 3OCUA 1FK8A 1ORIA 2Z56A 1I2BA 4DB2A 3Q0TA 3QE0A 4FBGA 5AKXA 4OQDA 2DUJA 5EY5B 5LUBA 4XPIA 3RYHA 1UC4B 3IAM6 3OTGA 4BKMA 4DIOA 4NNPA 2F7SA 3RYFA 5IF3A 4RTJA 1HMPA 3RWOA 1NF2A 3V8RA 3EZFA 3ZY4A 3LJKA 2QMOA 3MMNA 1QUEA 3FW1A 4EO7A 2I66A 4UTVA 2Y0PA 4PZZA 3AW8A 2VPZA 4EDHA 3ZE2B 4RPJA 5EVCA 1L7BA 1Q1NA 1VMIA 1WCV1 1V1RA 5AJTA 3ZQUA 2G1PA 1R0SA 1B1AA 3JTEA 2F3QA 4C0LA 5EUBA 4D81A 4QEDA 3KHUA 4HS4A 4XSHA 2QRVA 4TS3A 4ZOCA 4P36A 3QXCA 5L3RA 1PFQA 1TJYA 2G04A 2RGBA 3CF4G 4HN4B 4KIJA 3R8FA 1YJ5A 3PQ3A 1CVLA 3L6CA 4L2IB 4N12A 4GKJB 2DYKA 4XGRA 2BSQA 3NTRA 4RY2A 4DCSA 4ZQCB 1JR4A 4DPKA 1CY4A 2G72A 2Q28A 1ODTC 1Y98A 2L42A 4J9VA 5E95A 3RIMA 1HF3A 2B92A 5JO9A 1KORA 5KPDA 5IJZA 1ZSYA 4YRZA 3NALA 4KG7A 2J3JA 1H1TA 1QPBA 2R6R1 1VSBA 3R20A 4U7WA 3ETGA 1WUJS 1W0KD 5K4AA 5CCBA 3T3HA 8GPBA 1FVOA 1SC6A 2VEDA 2HBQA 3AETA 3RVNA 1A9XA 1WDMA 1SD1A 4FQ5A 4WXRA 3HKDB 3Q9UA 3F2IA 4CN9A 1N36B 5JPDA 2OCDA 3CUYA 2LXNA 4XYBA 4BN4A 5JNWA 1FDRA 3CUSA 3R23A 2WM9B 3TR6A 3Q41A 3O8OB 5IUJC 4H18A 4DZRA 4GWKA 4NATA 3DO6A 1JW9B 3S99A 3ETDA 4YP1A 4KMOA 5FUQA 1SQ0A 3BWBA 2AVNA 1Z26A 4H6VA 4TSFA 2DBQA 3H5NA 2O1EA 3BFPA 3QF4A 1ZN7A 3OZCA 1C8KA 3QA9A 3PWKA 4S1WA 1CQXA 3KOWA 1TJ3A 2SKEA 2GQ0A 3I76A 4YHBA 3N05A 4QM6A 3VISA 3FJ1A 5EP3A 1LPSA 2FK8A 3GJZA 4AY5A 1Z34A 1BCSA 3HFGA 4O0LA 3KT0A 1U94A 2V7UA 3PYXA 4L5BA 5I9IA 1J4AA 4YR7A 1AKWA 2JBHA 3WDMA 1BDIA 1ESZA 2VBFA 4JOQA 3DMNA 3RK1A 4OEHA 3LKVA 1UKAA 3KWLA 3WGLA 1VXOA 5SYMA 3CZ5A 2X86A 1DRJA 3K70D 2R2AA 2C4WA 4PX9A 3LDAA 2PQ6A 4KWTA 3JASB 4PNHA 1E3JA 1NSTA 4BX8A 2IE0A 4YREA 2PEYA 1FTSA 2OAP1 3H1PA 3N2KA 3GVCA 1JG7A 3L9WA 4J03A 1NRIA 1SOWA 1G6KA 4YRNA 1B00A 3ONFA 4GMKA 2AMJA 4H1TA 4WOKA 3F78A 2O8CB 3FOEC 5JVDA 1WUIS 1OLSA 1W4BA 1YQWA 1SU7A 2E4XA 2YHIA 3A4IA 3BA1A 5LA6A 4S04A 4PYNA 4OLAA 2XH8A 5JDCC 2IZ0A 3K8ZA 5FI5A 4OLBA 1GTG1 1Z5VA 3QU4A 1JA9A 4TMYA 4X7BA 2PD4A 3TI9A 4KTVE 1CD5A 1ECCA 2E4ZA 3KR0A 4PZPA 4Y2HA 2VUTA 3VQTA 1QG6A 2A8YA 2O8NA 2XW6A 1CIPA 4O5OA 4HKTA 3EPRA 1U7WA 3LUDA 4OGKA 2E5LB 3ILXA 4LY3A 4M0MA 2YOFA 3QWAA 3PDUA 3THSA 3QX3A 1SAYA 2Q5HA 3GEBA 2VHWA 2OMKA 4TVBA 2XNHA 1QCDA 1QF9A 3ZPXA 1M1NA 5AJXA 3IJ5A 2AD1A 2FPIA 3T4XA 2VPTA 4CG2A 1G2OA 2PS0A 3G0CA 1A8PA 3PEVA 1D4AA 4CUKA 4UMFA 5JSZA 2ZS8A 5AESA 2VWGA 1V8OA 3F7TA 1DV2A 3FCEA 3ZX5A 3BA6A 4XYLA 5ICCA 2QD1A 3G9TA 3ZS8A 2B34A 3P9NA 4RJIA 4EHJA 3CS3A 3NHZA 4Z49A 5LQMA 5JY6A 2GEJA 4G0YA 4RL6A 3U60B 1DKUA 3G2HA 4N49A 1L5KA 3TINA 3EPKA 4PVDA 1U1EA 5D5QA 5KSZA 1EFRA 5FPTA 4GKKB 2H11A 2V7WA 1RKBA 3W04A 4DLZA 3UMRA 1FDTA 3OPYB 4DBLE 2NQ2C 1GYPA 1Z2PX 3K15A 4FI3F 3CYFA 2ON6A 3OWOA 2QVLA 4EAQA 5BSFA 2UZ3A 3DCJA 1N2EA 3MTDA 3P0EA 4QDJA 3EK2A 4QECA 1VKNA 3S2SA 3U7JA 3ZIUA 3BQMB 4JUDX 4NOKA 4CRWB 4EW1A 1DKMA 2ZB2A 3ZVRA 2CNLA 1J42A 4RHCA 2COKA 3A31A 3C16C 4WLEA 4Y2TA 4LC9A 3RYIB 1V0JA 3D3KA 3KYIB 2JF0A 4EHIA 4I2NA 3DFUA 3QITA 1R6DA 2HYDA 2JIRA 2XTZA 2P5UA 3EIUA 2X19A 3NWPA 3IE2A 5TJHA 4C08A 4DVGA 3HM9A 4MIOA 5K6AC 2C5FA 4JQOA 4I55B 3WHLA 4ZMSA 3RK4A 1JLRA 1DEXA 4UUOA 2R2GA 3ADDA 3RSGA 4Q16A 5AI4A 2QDKA 3LLVA 4YCJA 2J7PD 3NXSA 1CB7A 1PLLA 4HC4A 5MN4A 1QTNA 1SXJD 3ZDZB 3ER8A 5HF9A 1QLWA 2OLEA 1W4ZA 2B1IA 4Z3KA 4JZYA 1NPTO 1XZFA 4R83A 4U00A 2IOFA 2QE7A 2V6MA 4XD7A 3OCJA 1U1DA 5D85A 2AKYA 4CCSA 3K8OE 1N5RA 4X3OA 2MYNA 4IGEA 4QFMA 1G1MA 3DUFA 5DM70 1J1ZA 4ZT6A 1XXHB 4D96A 5IANA 4EG0A 5AUPB 2GYUA 4TT8A 2GAOA 3EEIA 3IO3A 2Y0DA 2JDID 4RACA 4MP3A 5GMOA 3U44B 1FLAA 1M0TA 3HWRA 3AESA 1X7YA 2QNRA 2YV5A 3C8MA 3JQ9A 4HDRB 1BAPA 5E8RA 5ARCA 5GOZA 3VKWA 4YAJA 4BNNA 4HPXB 3MN1A 4WW0A 1CLUA 1AHPA 2Q1SA 1REQA 1ORRA 1GKYA 3LLUA 2P75A 3JW8A 4JA2A 1NHGA 4MQUA 3UM9A 4CTNA 2ZUEA 4JBIA 2ZJ8A 4UAUA 4DSUA 3JD0A 3GROA 3SYNA 3FOWA 4G1CA 1OD6A 1SCUA 5DM60 2QU7A 3H2IA 4J76A 1OW3B 1CIJA 1R3DA 2H1RA 4NMHA 3VGJA 4C6TB 5GIPE 2BZSA 3PA6A 3DHEA 3H9JA 3W5BA 3HI4A 4R4JA 4D4KA 1QRRA 4R9RA 1GPMA 1I24A 5EMLA 3GZTB 5C1BA 1WMDA 1RPNA 1C3XA 1VCHA 2GMWA 4S35A 5E6SA 5IJ9A 1RDFA 5AXDA 4C7OA 1N6HA 5ECWA 1P60A 2Q07A 5SY9A 6PFKA 1KEEA 4CIDA 3LM8A 4E94A 5A9SA 2XCQA 1YR9A 4D92A 3PGMA 1P6XA 4HLQB 3WLMA 4JX8A 2WAOA 4M6WB 4YRLA 1YXMA 2Q6KA 4HDQB 4O4LB 1CP3A 1ECPA 3ND9A 4WZAB 5H3CA 2PLAA 3LC0A 1S2IA 3NHWA 4A3SA 4NZPA 4PRKA 4TKVA 1EP3B 1HFKA 3A3KA 2TMDA 1ZJ4A 3OQIB 4UMDA 5E1OA 4Q24A 3GELA 1M7BA 3AJEA 3TMAA 4GOXA 3WYAA 3B82A 1T1EA 3EZ6A 3TIFA 4N8EA 3BL6A 2XGGA 3UK0A 2DE0X 2GZAA 3EJ6A 1BX1A 3H2KA 5EFOA 2I29A 1U3DA 4TMFA 2Q1WA 2RJNA 2HCBA 2YWDA 2HV9A 4IQFA 1JS1X 2F4NA 3IR5A 3VPCA 1YGPA 4JLBA 5FDFA 3ZQ6A 2GN1A 2PGNA 1BVRA 4MQEA 4RNCA 2IS4A 1YZYA 2BP7B 4S12A 3EIOA 4KE9A 3OEEA 2FNAA 4HYEA 4FLEA 4WGGA 3AUFA 3U9TA 3P9QA 5B3JA 4CG3A 4DCOA 2ATXA 3JQFC 4LSWA 1F9AA 2VHVA 3GJ5A 5DNDA 3DYVA 3CF0A 3T5AA 4X9XA 2OAQ1 4UVGA 1Z47A 4ANFA 2RGAA 4EMSA 4FP9A 4QHTA 1H2BA 1GTSA 1KQ3A 1N8NA 2FPPB 2YL2A 3EAFA 1VGVA 3AFHA 3HCRA 4LXGA 4MR8A 4QPJC 2IHZA 3EGCA 4D6YA 1PU2A 5JLAA 1QDLB 1Q3TA 3NDJA 4FX5A 2QI9C 5FUWA 3L49A 1FJ2A 3HQ4O 4QUGA 3DOCA 2X6QA 3LDGA 4CV1A 4EL0A 3B8EA 1MN6A 4CCYA 5DLEA 1FX0B 3GJSA 3M6UA 2C2YA 4OOEA 4E4TA 1XYGA 2QTTA 3HUTA 4HQ0A 5BQXA 2IEBA 3PENA 4LZWA 1EA7A 1XZCA 3B7GA 1SOAA 2HOQA 4INPA 4ALKA 1UR5A 1EUDB 1KS9A 4OAPA 4OI1A 3A3NA 3JAKB 3ABQB 3UXEA 3PFFA 3DF9A 2C4TA 3DAGA 5EWMA 1ZNXA 3DKKA 5B55A 2YHBA 2GRUA 4PIVA 1U4SA 2NU6B 3L8DA 1D6MA 1H0RA 4X62B 3BRQA 3WNDA 1LBTA 2WTEA 3UVEA 3PQ4A 4IJMA 1OX4A 3MJ4A 2JJ1D 1ULTA 1YH3A 2D0PB 4RD6A 3TZKA 1X7ZA 2WICA 2ZYWX 5J47A 1VBNA 3W3ZB 4J90A 2VR1A 2PMBA 4RK6A 3EGXA 4WUTA 2AOUB 1L5MA 4D5EA 5JNUA 1TQ6A 3ZBPA 1I33A 4JNKA 1TEZA 3AY7A 2YX1A 4IDCA 4H3SA 4MGYR 4CF7A 1QDEA 4UFNA 2I99A 1E9CA 1F0YA 2O4UX 4FJ1A 3ZLBA 3VRHA 1OKKD 4BVJA 5ERGB 2FWRA 4GGMX 2OCGA 1FMCA 1KDVA 2N9UA 1NUHA 3VX3A 3Q5DA 1IXRC 2OGUA 3R6GA 3PEUA 2H07A 4C43A 3OTHA 4M86A 2CL6X 2HIGA 3NH9A 3LYLA 1XV5A 3AHHA 3R0VA 1FFDA 1QZUA 3IEUA 5CNMA 4BBJA 5ECYA 1ENYA 4RHTA 2QN1A 2Y1DA 2X8JA 4MAMA 3CCCA 3MMXA 3ZBUA 1T35A 1KYTA 2R87A 3B1WA 1E63A 4M7OA 4TX1A 4ESVA 2IY7A 3VR4D 5FX2A 3ADCA 2P6NA 3M6LA 2F3SA 1FRQA 1O9GA 1HTTA 4FYYA 4M89A 2F1JA 4GNKA 4Z2YA 2E6KA 5IYZB 1Y7PA 4P4SB 3V1TC 2QMHA 5DRTA 1I7NA 3KWJA 2YJGA 2VAPA 1W8IA 4K40A 4NOMA 4RDHA 3FCAA 3NEJA 4RKRA 1AK1A 1A8UA 1E8NA 3K0FB 4J75A 1KI7A 4NRDA 4H08A 3A9TA 3FB1A 3MFQA 3L7NA 3GUVA 4GIBA 4E70A 5JIBA 4D74A 2I55A 1M2OB 2MR6A 3NBAA 3WGJA 3LPLA 1U1IA 4UXIA 2RBKA 3GAFA 1IEVA 4MUKA 4MLDA 1P5ZB 3M6XA 4I81A 1LPOA 5CEFA 4OMUA 4TKUA 4HDSA 4TS1A 2IBTA 4CT0A 2MINB 2D54A 2A1UA 2OO3A 4KSYA 4C0WA 2NVBA 3P5BA 1ODLA 1JI0A 3HDQA 2PUCA 5BVGB 3NM5A 3CLHA 1K8QA 1U5BB 5TF4A 3K9GA 4JI6B 1EZ4A 2O7SA 1Q0HA 4GZ6A 4EY4A 2VK2A 4IH4A 3MWEA 4ZEOA 2WMDA 3EMKA 1LRLA 1X70A 3S70A 4J2HA 5DKFA 3I5AA 3WLJA 5AJZA 1DTSA 3RARA 3JAWA 3EVAA 4Y9UA 5C4GB 3X1JA 2OQRA 1AUOA 2J87A 4P2GA 4WESA 3R3VA 721PA 5CB6A 3ZD6A 3HYCA 3DMGA 4FFWA 4PWZA 3ICOA 3TL2A 3OLZA 1NOIA 3GVXA 2K5UA 3WL4A 1O58A 2HXYA 1RJEA 3LF1A 1OMOA 3D4PA 4OB8A 3S55A 4N3CA 2PUGA 3AVVA 5C7OO 4KLAA 1RQXA 5T4BA 3OFKA 4EPXA 4AN4A 2QXUA 1C1XB 3VZRA 4N8DA 5IK2A 1I0ZA 3QELB 4YP5A 4ZI7F 3REOA 2P5TB 3PXCX 4E07A 5F1OA 4OI0A 2VXOA 2UDPA 2J32A 3O31A 3OWXA 1OWLA 1P7PA 5KYNA 3UHJA 2GM9A 1OFTA 3DXXA 3OEHD 1ONBA 1XZQA 3DFFA 3GNLA 3BJIC 4QATA 3SHTA 4CL8A 2Z2YA 2O3TA 1E2FA 3HA2A 2JEZA 3O7MA 1P1HA 3HU5A 4M0LA 1GG8A 5I9TA 2JCGA 2VLBA 3DBRA 1DTWA 3BWVA 1FBNA 3V2UA 2I2WA 3E22B 4KLRA 3UAOA 4EVIA 3C3EA 5FTLA 1TFUA 1W1IA 2HU5A 3ABIA 2BKVA 1MRSA 2D1SA 5ESXA 3T3IA 3FDZA 1PWYE 3ECSA 4LOAA 1AGXA 4M4SA 4IDNA 3ZHUA 5B7QA 4IEEA 3KRTA 3HR8A 3QNUA 4IS2A 1TIBA 1UPTA 3DONA 2ZATA 1A96A 1XDGA 3HYNA 3OCYA 3WE7A 2ID8A 3JD4A 1Q2UA 1VIYA 2X58A 3AZOA 3G2MA 2AC7A 3UCFA 2F00A 3UJPA 5KREA 1V9CA 2WHXA 2DHQA 3GEIA 2KPOA 1C8LA 2GZ3A 3QX8A 4HQFA 5KHAA 4B6GA 5GJCA 2W0SA 4DA6A 3KD3A 2VJAA 2WW8A 1I13A 2UV8A 3JRXA 3VC3A 5EKXA 4J0EA 1GEEA 1OIWA 1AHHA 1D6JA 4WN9B 2LKCA 1Z6QA 1EP9A 1M2FA 2OFWA 3NUQA 2H0AA 4IKPA 4D4GA 5CH3A 5JDIC 5CVJA 2ZJ3A 1JQ3A 4UNSA 5KC9A 3RFCA 1NR5A 1A7KA 4B87A 1DQZA 2X8WA 3EWSA 4XIYA 5MDHA 1QGDA 3TLZA 4B6JA 3BJRA 3CPJB 3MW8A 2WIJA 2QR5A 4BC1A 4Y1FA 5L8VA 4D3FA 1TZBA 4CKCA 7AT1A 1UAAA 3IA7A 3PCTA 4MTLA 5SZJA 1EK6A 3WRXA 1I30A 1AO3A 4FCWA 4ZQIA 3WK8A 1GQRA 1NBOA 3IS3A 3E05A 2G70A 3ADOA 1KMQA 3F9CA 1KDOA 2YNMD 2A33A 3ILHA 1FFXA 4MMXB 1DEAA 2PT9A 3HWX1 2ALJA 2AN4A 4XPIB 3RYHB 4DMRA 1U4NA 4JDPA 3V6LA 1EBUA 3MRXA 1D3AA 4KN9S 5DW0A 1JPJA 3RYFB 1YFLA 4LYYA 3FG9A 1EAMA 1V8DA 2FUEA 1Q19A 5AKZA 3DC7A 1PR4A 5DPMA 3EULA 1C3OA 4KJXA 1PBNA 2J3IA 2VJOA 5THXA 3ZY6A 4D4LA 2H2DA 5K8UA 1C7RA 4RSMA 1XJQA 3WHKA 4LN1A 1V1RB 3P9IA 5AOVA 2DT8A 4DV0B 2OLJA 4OH1A 1O6FA 1A9ZA 1S8NA 1E9BA 2K2QB 1A71A 2ZE8A 3BCSA 3WICA 1KAOA 2QRVB 2GN8A 2ZWVA 3KAPA 1JXQA 2XUFA 3AY0A 1G5TA 4Q9DA 4U2FA 3K0HA 4LBWA 5GPBA 3WJ2A 1VM6A 4OSOA 5IMSA 1J09A 5ALZA 1GV0A 4DLBA 2NZXA 4HFRA 4YFVA 2D3TA 2BFWA 1I3OA 1ZN9A 3L4BA 3MS2A 1G19A 2JRLA 5CDHA 1TZ2A 1ZZEA 3KDSE 4UVDA 4EY8A 2FPUA 4XPZA 1FIUA 1SBYA 3ZD9A 3L1KA 3OX4A 4DHEA 3FOAA 4TLDA 4DMGA 5DK6A 1UPUA 1VYHA 2AEEA 3U56A 5GZ6A 1JNYA 1GM5A 2VHUA 1G6Q1 1ZCFA 2FQQA 2JRCA 3PE4A 3GRUA 4ARUA 1Z5OA 2GFIA 4N03A 3SM3A 2AMYA 1VHTA 3GT0A 3LRTA 4IMRA 1JHOA 2A2ZA 2D2VA 3GFFA 3MYRA 5DU2A 1JL3A 3S40A 3HLYA 1XA4A 5J4VA 3AETB 3HCPA 1XWWA 1A9XB 1JDNA 1G3IA 1RW4A 3BWCA 3GAMA 4ILKA 4QU5A 2PMEA 1Z0UA 3RUDA 4EL5A 4RGYA 1ZD9A 1KK2A 3IXMA 3AXTA 1WL8A 3O0TA 1QAMA 4Q3BA 2CMFA 4IDPA 4CVNA 2PVSA 4A5OA 2Y71A 1E3LA 1Q21A 1UJ2A 4EMTA 3Q2IA 3WNCA 1JIKA 5AH0A 3B6IA 1R5OA 2ZJ5A 2B8NA 3QF4B 4JFAA 1UADA 3PK0A 1O89A 4HEHA 5ALWA 3A3YA 3VOTA 3OU7A 4XDZA 5D87A 1JTFA 2ODWA 2FEKA 1ULSA 4BE9A 2TMKA 2JCBA 3NUZA 4CIVA 3O8QA 3U7RA 5J43A 3L4KA 5ALQA 4BASA 4JVOA 3KOUA 5K0LA 3RR2A 4CV3A 2XZLA 2XHZA 3TF5A 1BCSB 3CVXA 2BVNA 3Q7PA 4U5XA 3TTUA 4YLGA 1YB1A 1EGQA 3JXEA 1S8FA 3KAQA 4F1JA 3AL0C 1AJEA 2I65A 1QCCA 2GHTA 4GYWA 3TZHA 3RTBA 1R9NA 2XWJI 1Y3AA 4Z5XA 4GI5A 3E5MA 3QZUA 1QNFA 1U90A 1MG0A 2PRSA 2V7EA 2AG5A 3WB2A 4AZ3A 2NO5A 3HDVA 2VP5A 5TS3A 4NL4H 1MC5A 2IGBA 2PD3A 3L0YA 4FILA 5IDXA 3C5HA 4OHMA 3N2KB 4I1PA 4QOEA 3KPYA 1P6QA 2GFQA 1ATIA 1NUSA 3H0CA 3KALA 5FWXA 3ZY2A 3FJOA 3CQ9A 5E3HA 3O38A 3PVSA 1O4WA 4CMKA 3CR8A 3VVBA 1RR6A 3QFCA 1MOSA 3LVQE 3AEYA 5JVDB 1VTKA 4D2IA 3ADBA 1OLSB 2YHIB 3BH7A 1T1GA 5LA6B 4BEJA 4DAEA 1R3UA 4G0UA 3A36A 3NBFA 3JVEA 1AE1A 3LVRE 4KU4A 4AAYA 4Q48A 3PFHA 3WHIA 5JS1A 4BGDA 2TSYB 4Z0NA 4GPBA 3I2YX 1XP8A 3VYRB 1W5FA 4DC1A 2YW9A 5TVKA 4HYTA 3OLCX 3PFNA 1W87A 3HG7A 4ND2A 4ED9A 2YWGA 1PJ4A 1J25A 4J0QA 4JL5A 2OEPA 1H0SA 3N7TA 4ZZ0A 1DAKA 2RHCA 3PRJA 1PJ3A 4LX8A 2IT1A 2F9FA 2ZCUA 2QR3A 1H22A 3DFIA 1X8LA 3HA3A 3K9BA 4LWQA 1M1NB 1P3JA 3WI7A 5EHZA 4IUBS 5IW8A 2W6NA 5BYJA 1YS4A 1YB5A 2FPIB 4KODA 5KTSA 2ISSD 1Y1KE 5H81A 3FNGA 3OE7D 3V3KA 3ZU2A 3BXPA 2D0OB 1H2XA 3NX4A 5JSZB 2WYIA 4OH7A 3ZDCA 1B0ZA 1IUKA 2G80A 3L1HA 3PQFA 2FZWA 4FMBB 4LC0A 1TO2E 5CFQA 2PZLA 3PQ5A 3MPUA 3SFZA 3ZIAA 1NKTA 4F85A 1OT3A 3HBNA 4XUDA 4DR3B 2J5BA 1K3FA 2V7BA 2AX4A 4GI2A 3TKLA 2AQKA 4F3RA 2CLOB 5JRZA 1GDTA 2V6FA 1FX1A 2ZJOA 3T8YA 3GEPA 3GDFA 5TNXA 3SKVA 2WHYA 3B38A 3UEOA 3A04A 4K9RA 5ESDA 1SZJG 2OWDA 1DAHA 2RJOA 1VHWA 2YXBA 3HFJA 3OD1A 4YCMA 4DR6B 3B5JA 3UOWA 4IMJB 2QUIA 3AILA 1MB2A 3WLHA 4Z4EA 4HRVA 3CNOA 3FWKA 5EESA 3T0GA 4HH4A 3HVJA 2VHYA 3NDRA 3GU3A 3WV5A 1R0WA 4JJEA 2OBYA 1RLMA 3PNYA 4QXAA 5DV9A 2ZT8A 3B48A 4QA9A 1ND6A 1AXGA 2II6A 1K92A 4FN4A 2EKLA 4UC0A 1C9NA 1MDFA 2DY1A 2DCUA 3BMNA 1RTTA 1U3GA 1BEUB 4H3KB 4QRIA 5B36A 1XDUA 1AMUA 2H17A 3MAGA 1IYZA 4I3HA 4DLKA 4AG6A 5JATA 1E6MA 1ODJA 2NQTA 4MWDA 4Q7EA 4RHUA 2VVTA 1Q5PA 1FFAA 3K9QO 3P9PA 5FNVF 3X2SA 3QEBZ 5CVTA 4YRJA 2CE7A 4ZO7A 3PP8A 3DUWA 3MMPA 5BT8A 3GX1A 2H2HA 1CJTC 2IW1A 3DUFB 1EFUA 1DKPA 1Y4ZA 1D7OA 2TRSB 3GCXA 5A6SB 3FR8A 3HB9A 2XMGA 2C9ZA 5E9WA 3DHNA 5IM5A 3TUJC 3AESB 1X7YB 5H83A 3EXG1 4UPVA 3NGXA 4MUIA 5B3AA 4BGEA 4Y6PA 3FTCA 4RWEA 4H15A 5JJIA 1OI3A 4P82A 3UGTA 4UBJA 1F6BA 5EL0A 1Z0FA 3PGJA 1Z2EA 1REQB 2CHGA 3V7FA 3IAEA 5KVQA 2HLPA 4OYYA 3VYVA 4BUCA 2B4KA 1A1SA 3U39A 1E9DA 3C43A 3DDWA 5G0VA 1SCUB 1KAHA 1NXTA 5C51B 2WAXA 3OT1A 4Z7QB 2XXAB 2QL5A 1H2AS 1NM5A 2O2XA 3C3BA 4J1TC 4O4JA 5CX1A 4C87A 4D99A 4ILEA 5ILOA 1MJNA 1NQTA 3ZDDA 4TPKA 1UBEA 4BNZA 1KE2A 1Z63A 5IJ9B 5E6SB 3V8PA 3PNLA 4C4PA 4C4TA 3ZHQA 4U63A 1NXSA 1A72A 4JB2A 4QDZA 2WLSA 3MCUA 4BMNA 4DKXA 4C7OB 2C92A 2VHQA 1KEEB 3PNQA 1NY5A 1YB2A 3KQMA 3NORA 4TVKA 2FY8A 4EO9A 3CW2A 5A9SB 1S2MA 2J8ZA 3AVPA 4XWOA 4QYWA 5JQWA 2HMYB 3LC7O 2JLXA 3GPDG 4C4RA 2V1XA 4TRRA 1TEHA 2CVFA 3DTVD 4KXQA 3ZW7A 4BFLA 1IOLA 4HNAA 4N0DA 4NU8X 3VPDA 1QRUA 3AO0B 4P5DA 3R7NA 2H63A 2RGEA 4HGOA 2ASEA 3EIWA 4DQ0A 5HM6A 2AW5A 3EXIA 2HMSA 2KJQA 4GP7A 1B73A 3SVLA 2GTPA 1UK7A 4RANA 3BTSA 3LYAA 2RKBA 2JVKA 1GQFA 2ZAIA 1UMBA 2ZLBA 4EWLA 2QRJA 3GV0A 4KL8S 2H1IA 2XT9A 4GYYA 4A8JC 5G1NA 3EXAA 3A6HA 4YX9A 1LVGA 3R3YA 4MQEB 3L1JA 3V34A 1II9A 1VJGA 3Q6IA 1QFSA 1JVNA 1BMDA 1IMJA 1C0IA 3S2GA 3NBYC 4XH9B 4DKJA