3QPYA

Crystal structure of a mutant (k57a) of 3-deoxy-d-manno-octulosonate 8-phosphate synthase (kdo8ps) from neisseria meningitidis
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
276
structure length
250
Chain Sequence
MDIKINDITLGNNSPFVLFGGINVLESLDSTLQTCAHYVEVTRKLGIPYIFKASFDAANRSSIHSYRGVGLEEGLKIFEKVKAEFGIPVITDVHEPHQCQPVAEVCDVIQLPAFLARQTDLVVAMAKTGNVVNIKKPQFLSPSQMKNIVEKFHEAGNGKLILCERGSSFGYDNLVVDMLGFGVMKQTCGNLPVIFDVTHSLQGRRAQALDLALAGMATRLAGLFLESLHLLEDFLIRIKALDDLIKSQPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-dehydro-3-deoxyphosphooctonate aldolase
publication title Targeting the role of a key conserved motif for substrate selection and catalysis by 3-deoxy-D-manno-octulosonate 8-phosphate synthase
pubmed doi rcsb
source organism Neisseria meningitidis
molecule tags Transferase
total genus 75
structure length 250
sequence length 276
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.55: 3-deoxy-8-phosphooctulonate synthase.
pdb deposition date 2011-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00793 DAHP_synth_1 DAHP synthetase I family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3qpyA00
2CU0A 2IQTA 4OWGA 3EX6A 4MY1A 5FESA 1VC4A 4POCA 4XKYB 3P67A 5F1UA 4RXGA 3W2NA 1H7OA 4N9CA 5FEXA 4P61A 3EB2A 2DJXA 3KVKA 1U5JA 3B05A 4Z1DA 4OBTA 2W6RA 3UWZA 2ZCGA 4MKNA 4OU1A 3P7YA 3D0CA 3LCXA 1F5ZA 3CQ0A 3LHUA 3SW6A 2H8XA 3BLEA 4GC4A 4JYFA 4A2RA 4AAJA 2DP3A 3TIMA 3GXTA 2ZQ0A 1TV7A 1VGAA 3ZS4A 4C1LA 1SR9A 5AC7A 5AHFA 3L66A 4IMCA 4N2YA 3OVRA 1O5KA 3CTLA 1R30A 4BI7A 4O0KA 1G4TA 1KA9F 5CPNA 2XFWA 4PTNA 3TMQA 3GLCA 5LNUA 3MP4A 1GVFA 1UCWA 4JNMA 1EA0A 2WKJA 5F2IA 4TO8A 5D05A 2TMDA 4Z1CA 3HGSA 2WNNA 4UNKA 1Z42A 4N9BA 3LGEA 1NVMA 3MI3A 1WBHA 4RX0A 3T40A 1VPXA 3A21A 1FX6A 3IV3A 4UNLA 1RVGA 2EF9A 2JBMA 4N6EA 1T99A 3VNDA 3FA5A 2RDTA 4RV8A 1OFEA 2NUXA 1D9EA 3GDKA 4ZL1A 3W86A 4DQWA 4OGZA 2VEPA 1UASA 2X1SA 3EWUA 1SW7A 1XL9A 3UWWA 1VYSX 1OYBA 4UTMA 1LBFA 3MBDA 4NVTA 1CX9A 3IEBA 3H53A 2ZTKA 2C6QA 1A50A 1VHNA 4QQ3A 4OV9A 4WOZA 2X1RA 1MSSA 3VCRA 4O1BA 4IGHA 4N4PA 4MY9A 4JXCA 4MFEA 1OVDA 4LUIA 3B06A 4UUIA 4FB7A 1BEUA 3HGOA 1DJNA 3MW7A 3FIGA 1O95A 5F4SA 1EP3A 1H1YA 4MFDA 4A3UA 1T96A 3DENA 3TAKA 3LTSA 1LDCA 4JX6A 2YDAA 3BPWA 4L4LA 3R12A 1JCLA 3W84A 5FEPA 3TDFA 2ZYFA 5AN7A 2ZZ5A 1Q6OA 3LHVA 4MVAA 3M41A 1LORA 3NAVA 2FDSA 3EXSA 3NA8A 1L2UA 2HTMA 2JGQA 5G4EA 4UFJA 4UFLA 3A23A 1W5QA 5TQLA 3G18A 3LLFA 2CLFA 4LTSA 4I7UA 1YTDA 1CW2A 5KZDA 3B4UA 3S5ZA 4UTUA 3QW3A 1Z48A 3QSRA 3QFEA 1Q3NA 2OMAA 2GJLA 4CCEA 4JY9A 3I7SA 4GUHA 4TIMA 2G97A 2E6AA 4OQVA 2DZWA 5D37A 3C0JA 4GNJA 5I3KA 3TR2A 5HR6A 2GQ9A 3GDTA 5F1VA 3L67A 3ABOA 4MPQA 3BGGA 2YPIA 1OFRA 5K4XA 4K6AA 4BK9A 2QUTA 3HF3A 1SO3A 3C6CA 3IGSA 2I1OA 3BLIA 2X30A 3RK8A 2NLIA 1KFLA 4QITA 2E6FA 1XUZA 3GDMA 3QMTA 2YYTA 1XCFA 3W7PA 4MJMA 2CLKA 2WSQA 1SW0A 3KVMA 4DF1A 4ADSA 4NJGA 1ME8A 2V2DA 4IOTA 1MXSA 1WAUA 1XXXA 2Z0IA 4I7VA 1YXCA 4R34A 2FPTA 4LC8A 1FUYA 1TTQA 4J9JA 5CGQA 2XN0A 3RLUA 1FWWA 2Q3OA 5DBTA 1FWNA 3R8RA 1SSGA 4FNQA 1H62A 1PHWA 1TTPA 1B3OA 4PFMA 3ZFHA 2JGYA 2ZA3A 3F4NA 3S9YA 1VCVA 4O18A 3LCLA 2R94A 3QJAA 3FJLA 1EP1A 2WNQA 4OHQA 2B0MA 3DFOA 1H60A 2CLLA 4N6FA 4UCGA 8TIMA 4NUWA 2B7QA 1XKYA 4KWWA 3QW4B 4LVDA 1X1OA 1PIIA 3EWZA 4LS1A 1A53A 3UZ5A 2GVLA 3BW3A 4JTKA 4JY8A 3IVUA 4S2CA 1VYRA 2GOUA 3HGRA 3LHYA 1RR2A 3G0XA 4E38A 2Y61A 5LNRA 1SZNA 3H54A 3IGUA 3G1FA 2A85A 1W5NA 1HO1A 3DFPA 1JCJA 2QJIA 5DBUA 4FHAA 3NPVA 3PS7A 2VFFA 4Z0SA 4GXMA 2WNZA 2VFDA 2X1TA 3MP3A 3IVSA 4UTTC 3S42A 3JRKA 5G2HA 2E77A 2BXVA 5FF7A 1FDYA 1L6SA 3LI0A 5FEWA 2A7NA 3O07A 4K38A 5HULA 4ZQOA 3RU6A 3LDVA 5U7SA 5EPDA 1TRDA 4LV9A 4MY8A 4O19A 4UFKA 1WBJA 2E5DA 4IJBA 3RMJA 1NEYA 3WK1A 1YPFA 2J9ZA 3R89A 2DZUA 5C54A 4NJIA 4WY0B 1EUAA 2JKPA 3W07A 1DQWA 5KITA 3I6RA 3C8FA 3W73A 5DN1A 5HUPA 4ADUA 3B0VC 3O1NA 2W0UA 3CPRA 2V0TA 4YMZA 1LTDA 5LNSA 4LUJA 3FKKA 5AYZA 4RR4A 1VLIA 5CPOA 3B8DA 3TW6A 4GUIA 1JUEA 4UTWA 4EOUA 3L5LA 2Z6IA 1BKSA 1VYPX 3C2EA 1FWSA 3W2LA 1K03A 1VQTA 1I2QA 2WO5A 2VENA 4JIPA 4FX7A 4NX5A 4ZMGA 3B0UX 1KTNA 3ANYA 4MZ8A 3NVTA 1HFBA 3DBPA 4FX6M 1KLYA 1OFPA 1KM0A 3HO8A 1F05A 4DELA 1L6YA 3DFTA 2A7PA 3AO0A 2NUWA 2BZNA 3A9IA 3W1TA 4JTUA 4X2RA 2Q8ZA 2QCEA 1RQBA 3LV6A 3UPBA 3TW7A 1W3TA 3U6WA 2ZZ4A 4CCCA 4NQ1A 2ZRYA 3PG9A 3M47A 1KM5A 1M7OA 3SI9A 3WJZA 3G0SA 1DORA 5LGZA 3P82A 1KM4A 3EWWA 3CB8A 1TO3A 5IBXA 3ZWTA 3NM1A 4I9AA 5F2LA 2YYUA 3NQEA 4JTSA 3TUUA 5FEZA 2C18A 3LXAA 3PG8A 3HPZA 1OFOA 3JS3A 5D2WA 3GR8A 4Y6GA 4XZ9A 3QQ0A 4JTIA 3MI6A 1OFQA 1PV8A 3PY2A 1OF8A 4FIQA 3DKJA 3KVLA 2V2HA 2YCEA 3CC1A 3UYCA 3GKAA 3HMJG 1TV8A 3GVGA 1W54A 4UTHA 4ORIA 2CW6A 1W5PA 3W2KA 5A5WA 4ONVA 4NZFA 4D2JA 3EEGA 2LLEA 2WJZA 2TPSA 1O4UA 2NX1A 4ICNA 5K7JA 1CI1A 3WK2A 4L4MA 3MP5A 3SIZA 4LW7A 3SZ8A 1OX4A 1MEIA 1XBVA 2V81A 4Y96A 3ZWSA 1KFCA 3FJ6A 1XUUA 1C8VA 1UB3A 3L21A 3BGJA 1LRNA 1M6JA 1YTKA 1PCKA 1W3IA 1IXQA 4Q4KA 2G95A 1TJRA 4JD4A 5F4WA 3BW4A 5AOUA 4AWTA 1XM3A 3NL3A 1F74A 1LM1A 2Z1BA 1SUXA 2BX7A 2D73A 1ZY9A 1H7WA 1TTIA 5EY5A 1LOSA 1FXPA 4MZYA 2CLMA 3K30A 1TPWA 3THAA 1V5XA 3CT7A 3W7CA 5D32A 4O53A 5AFDA 4HNTA 4WOQA 5C5YA 3CWNA 1DVJA 3LCFA 3EKZA 1YDVA 3MHGA 1I2OA 2VFEA 4TX9A 3HIJA 3W1UA 5C2XA 2ZBTA 2XN1A 4GFSA 1TTJA 3M16A 1K3UA 1S3HA 4NX0A 3RFAA 3E12A 1OHLA 3LB0A 5L9FA 1X6UA 1AL8A 3HGJA 1KM3A 1OYCA 2WPBA 5CSSA 3N2MA 7TIMA 3UY8A 4FXRA 3ABRA 3KFTA 3O15A 2W79A 5KZMA 1I4NA 3W7KA 3A5VA 3NPWA 4AWSA 2ALDA 3TX9A 2BWGA 4LT9A 4O10A 2NWRA 3C2VA 4JYDA 5HJLA 2VFGA 2OT1A 4BWLA 3M7WA 1TPVA 5LHFA 2OCZA 1Y0EA 3G1HA 2TRSA 4CNNA 4A2SA 2GVJA 2PC4A 4WUIA 3EXRA 3EX2A 4A22A 2QCHA 1YDNA 3GAKA 2ATMA 3NQ2A 1R46A 1ONRA 1MEHA 3B03A 3GXPA 3NQDA 4JGDA 1WA3A 5EYWA 1J4EA 1LRTA 2QDHA 3LOTA 3C61A 1RV8A 1QOQA 1H7XA 5F2GA 3PB2A 3TSDA 1EX5A 4UTJA 3C4UA 4N02A 4X9SA 2ABAA 1FWRA 3N19B 4JDBA 1FCVA 1I2NA 3W7MA 1LYXA 3FOKA 2E68A 3L65A 3EKLA 2X16A 4WY0F 2NX9A 3T55A 2E09A 3UNDA 2P1FA 4HNUA 3W9ZA 5E93A 4O11A 4YCOA 4Y90A 1OK6A 5HMSA 3LTPA 2GQ8A 1X1ZA 2Y88A 3GK0A 1IXOA 3HPXA 1L9WA 1BWLA 1B4KA 5DCEA 4FO4A 3LCHA 4KKXA 1VH7A 1TPC1 4IUOA 3SSJA 1OX4B 2YSWA 1GT8A 3SGZA 2QR6A 2CLEA 1DQXA 4O0ZA 2V2CA 3T78A 3VI2A 5AYXA 5KSWA 3FLUA 5D04C 1TPH1 1TMHA 3QH2A 1OX5A 4K36A 4QM1A 1R47A 1QWGA 1X8FA 4M19A 4A29A 1H63A 5F4XA 4RK8A 2YFNA 4BFAA 4Z08A 1YLVA 4GUFA 2HMCA 4PL1A 3G1YA 4HKPA 2ZZ2A 3DAQA 1QAPA 4GWEA 3THQA 1KFJA 4HIBA 5AHIA 4HSOA 3P5YA 4K8HA 2QKFA 1T8XA 5D02A 3KX6A 1Z44A 3MYOA 3O63A 4H6KA 1C29A 5CG7A 1ML1A 3T44A 3C2OA 3QMRA 1AW5A 2G5WA 3GX9A 1HL2A 3I7RA 1EWDA 4O1DA 2EHHA 1NF0A 5HNRA 4FXSA 3S5OA 1WQ5A 3O6CA 3TNOA 3BO9A 2VEMA 4XTIA 1LLZA 5D2YA 3G3DA 3WJYA 2QCCA 4HNNA 3W7HA 5EL1A 2NX3A 3TFXA 4QAIA 3W74A 1IIHA 1P0NA 3DKLA 2ZFAA 2FJKA 4ZQNA 5D30A 1VR6A 4R7JA 3NL2A 5HWMA 1VS1A 3KAOA 1P5BA 1FCUA 1TSIA 3UWUA 3MHFA 4WQ6A 4NXKA 2C14A 2QJGA 1EIXA 3GKFA 3M0ZA 4WJEA 3DU0A 5EA9A 3P81A 5KINA 5CPLA 3BARA 1EPXA 1GYNA 3NNTA 3CWOX 1HTIA 1P1XA 2I14A 4QSHA 1GPWA 1LOLA 3OG3A 3WK0A 4JTTA 3TC6A 4FNTA 1DV7A 1ALDA 1ME9A 1JR1A 3LM7A 3TSMA 4QJ1A 4M6QA 5I3IA 3LX9A 1JQVA 3Q2DA 3LERA 4OV4A 5FF0A 3F4WA 1N8FA 5G2IA 1WOBA 4ALDA 2J6XA 2VEIA 1VCFA 3TSBA 2NXIA 3BG3A 2NV1A 2DJLA 3S1UA 5DCBA 4JS3A 2O7SA 5FF2A 3FYPA 1TJPA 3KRUA 3YPIA 2TSYA 2ZRXA 3SECA 1BTMA 1O94A 1JRCA 2OJPA 5LGXA 4S2BA 3S1WA 3W85A 3TQVA 1HUVA 5D33A 4IWWA 5DCDA 4EVZA 3O16A 3P60A 2C0AA 5T26A 2VFIA 3N34A 3NQGA 1GJPA 1KBIA 2RDWA 5AHLA 1LLWA 3N9RA 5K4ZA 3PUEA 4MUZA 1FBAA 3UD6A 3PF3A 1I2RA 1ZALA 1HO4A 1SO5A 4LS0A 3W7NA 3HB9A 1RZMA 3LRLA 5H2ZA 1YPIA 2F84A 3E0IA 4CLMA 5IBXC 4P2VA 5C6MA 3IGXA 3M9YA 2GPTA 2A2IA 3VE7A 1TQXA 3QZEA 4LC6A 1TPDA 3BV4A 3ABSA 3G22A 3NG3A 2E1DA 3NOEA 4O50A 3MHUA 4WD0A 3PUDA 1NSJA 5FF3A 2BLEA 1ZJIA 3CEUA 1WXJA 2PCQA 1LZOA 4BI6A 1N55A 1VLWA 1UUOA 4UMCA 1OYAA 2JKEA 3P5ZA 3W1QA 4K7VA 4UIOA 4RZ6A 4RXFA 1F76A 3GXNA 1F2JA 1ZFJA 5SWUA 5K3VA 3TAOA 4QNEA 2H90A 2J27A 2RH9A 3PAJA 3G24A 2ZZ3A 1R2RA 3W2JA 3FYOA 1W37A 2R91A 1JJKA 3NPXA 3DI0A 1X7FA 1JUBA 4H4IA 5BRBA 3QRHA 3SR7A 2AAMA 2AQWA 3IVTA 4XWUA 2QEZA 1FY6A 4O14A 5IM51 4Y9AA 1PL9A 2ZZ6A 1WYIA 5AC6A 2UV8G 1DBTA 5K9XA 1M7PA 1ADOA 3S6DA 2A21A 3O05A 2P0OA 3S1VA 3MWAA 1GVQA 2FFCA 4DPPA 3USBA 1XBZA 1W1ZA 1PHQA 1TPUA 3OHIA 4NNBA 2P10A 1GZGA 2J88A 3WFAA 4IQLA 4MJZA 1FCQA 3G0UA 1QOPA 4MYAA 3L0GA 2XN2A 1RQHA 1D3HA 1K8ZA 4Y8FA 3UWQA 4UMBA 4HPXA 2FB2A 1JCXA 3G8RA 3C56A 4O13A 1GG0A 1QDSA 3OVQA 2HS8A 3KHJA 1R2TA 4JTLA 4JX4A 1KFBA 1LBMA 4ZQRA 2PRMA 2DZVA 2QAPA 1FDZA 1SO4A 3F1QA 5G4WA 2RHGA 1OX6A 2JK2A 3N3MA 4JEQA 5AHNA 2I9EA 4C1KA 2FIQA 5K9CA 5L6UA 2C19A 5AHMA 4WX2A 4PODA 2DU2A 3O8AA 2Y62A 2WSRA 3I68A 5CZTA 3T7VA 4HNVA 4GRSA 1U83A 1ICQA 2FLIA 2PE4A 3GYEA 1YXDA 4CNOA 1FXQA 2Y89A 3N2XA 5BOOA 3TJLA 2FQIA 2YW3A 3EX3A 4HPJA 2E6YA 4IX0A 5LZLA 4YLWA 3IIZA 2OZ0A 1VRDA 1MO0A 3TKFA 4AF0A 1OFAA 2QJHA 3S8HA 3PC0A 4JTFA 4ZQPA 2RDUA 3S0CA 2V82A 1ZCOA 5KZEA 4O52A 3GDLA 4UMAA 4MLJA 3DXIA 1IXPA 3MBFA 3S5NA 3HG3A 4OT7A 1F6KA 4IPIA 4NT0A 1GTHA 3OIXA 2CWNA 2ISSA 2NV2A 5HINA 1KW1A 4LOCA 3W7JA 6TIMA 2QCMA 1H7RA 1OK4A 3G1AA 4HHPA 2RKXA 2Y6ZA 3W7EA 4LVAA 3NO5A 1GTEA 3P80A 3TQKA 4XTDA 2VKZG 4GJ1A 4DBDA 2YFOA 5DY3A 2Q8LA 3ZR4A 1W5OA 3VFLA 4Z1BA 2DORA 3WK3A 3W2MA 1LBLA 3PM6A 3NQ8A 3BG5A 1GVOA 3PULA 2TYSA 4PH6A 4B5NA 2YR1A 3I7QA 3P8JA 4MOZA 1QPNA 1RD5A 3Q37A 4UXDA 3TJXA 4XKYA 4IX2A 4R53A 3KXQA 4X3ZA 3NM3A 3TC7A 1I2PA 1L6WA 1PS9A 3L0NA 1TCDA 5AC8A 2FTPA 4EWND 3TXVA 3W6YA 2QF7A 1XC4A 4YXGA 2CLHA 2V9DA 3E02A 3NQ7A 1S5TA 1OABA 2Z2UA 3QYQA 3KRZA 1THFD 4N4QA 4IMGA 4JTHA 2Y7GA 4E0CA 5LSMA 2ZRWA 4XBSA 2C15A 4ZVJA 4K7YA 3VE9A 3A24A 3G1VA 3STCA 2A1YA 5BNKA 2C13A 2EGZA 4ML9A 1K7FA 3M6YA 3TA6A 3V75A 4U28A 1KFKA 3TMLA 2A5HA 3NDOA 1YTEA 3C3NA 3NQMA 4ORMA 1MZHA 2C1HA 2FPYA 4M6PA 2A7RA 5K2ZA 2FPVA 2GUUA 5DLCA 3NL5A 1LROA 3PUOA 5AHEA 1VZWA 5HR7A 4KFOA 2OX1A 4W9TA 3PWAA 1DJQA 2J9XA 1XDLA 4O57A 4DO5A 5J5DA 3DFSA 3DZ1A 4TMBA 3BLFA 1EB3A 4PCFA 4KFPA 1K7EA 3W7OA 3NYZA 3R13A 4FNRA 3G1SA 3NPUA 1K7XA 5G5IA 3HOJA 2VXNA 4NNAA 2QUUA 4NJJA 3SJ3A 4EF9A 5H91A 3W2UA 4NZJA 3WJXA 3CEPA 3U2OA 2EPHA 1H7PA 2YX0A 3W87A 4QIUA 3HBLA 1I8JA 3R5EA 4H3DA 4DEFA 3FKRA 5LKYA 5E0KA 3NL6A 3ELFA 4BI5A 4CCDA 4HSNA 3BG9A 4G1KA 6ALDA 1AW2A 3P84A 4A21A 4NNCA 1SQ7A 3NGJA 4GUJA 2WSYA 4K37A 2H3BA 1ICPA 4FNSA 1H50A 3EX1A 3GR7A 2YGYA 3TROA 3MYPA 4O15A 4ZQCA 1AK5A 2QUVA 1XBXA 2NUYA 3IIVA 1EWEA 3DHDA 3H55A 2AGKA 3DI1A 4O12A 1TIMA 1W5MA 1OG0A 1WOAA 3PSVA 2VOMA 4DF0A 1TQJA 2HSAA 4M6VA 4UR8A 5BMWA 3NQ6A 3M1ZA 1W0MA 2ATSA 3UXDA 5EKYA 3W1NA 3NQAA 3IIXA 4MZ1A 4MYXA 3STGA 5I3GA 2EKCA 3QF0A 2Y7DA 4LRSA 4AWUA 2ZA2A 5E1QA 2NZLA 4O8RA 5TBOA 3G1XA 1A5BA 4AHQA 1TPEA 1P4CA 1NF7A 1SPQA 1YXYA 1M5WA 3G8EA 4K39A 3UY7A 3CLMA 1K8XA 4NJHA 3W7GA 3LCIA 1GYLA 3Q94A 4PEKA 3PBVA 1TPFA 4LVFA 1JCMP 1YYAA 4BR1A 2VFHA 3QQ1A 3OEXA 5D38A 3RLVA 3GNDA 1G7UA 4GUGA 3M5VA 4XUGA 3BW2A 2E6DA 4NJKA 2GQAA 2OT0A 4LS2A 1XFBA 3GIYA 2A6LA 5HWJA 1GVSA 4O4VA 1P0KA 3F03K 2Z6JA 2X2GA 4O17A 1G67A 3MUXA 1ZAHA 3SFKA 1KFEA 1TYGA 2E5BA 4UR7A 1UBSA 4UTKA 1KTBA 4TMCA 2FB3A 4YCPA 1ZNNA 1JUKA 4M7SA 1J2WA 5GVJA 1IF2A 4LNYA 1TRIA 3CHVA 1Q6LA 1JRBA 1RPXA 3M44A 1QO5A 2ZRZA 1XBYA 2PRLA 4DBEA 3LHZA 3FFSA 4UFIA 1G4PA 2ZA1A 1WV2A 2B7PA 3TE9A 1TPB1 3RNDA 5G2WA 3T4CA 2WOQA 2ZRVA 3NXFA 3CU2A 2Y63A 4PC8A 2QCGA 5D03A 4O54A 4UC5A 1ICSA 1SU5A 1KLZA 1Q6QA 5DXYA 5D09A 4EIVA 1KV8A 2R14A 3GZ3A 1SZEA 4N9EA 4JYEA 3W1RA 1YADA 1B4EA 3LBMA 1UJPA 3M5ZA 1D3GA 1A5CA 3CM4A 4UTWC 1BWKA 3L5AA 4WY0A 1H7NA 1JULA 3WJSA 3EXTA 4DXVA 4EF8A 2C16A 1N7KA 4QISA 3DFQA 1Q45A 4OE7A 1KTCA 3EX4A 4Q32A 4DO6A 3KVJA 3QEZA 4ZZ9A 1GWJA 1EEPA 5MHBA 5EBUA 2ZDRA 1TB3A 1SW3A 4CQ9A 3LLDA 3DHFA 1XDMA 4LVGA 3S5YA 3W1MA 4O1CA 5FF4A 3P62A 1VHCA 4MIMA 1A5SA 1I45A 3HG4A 2V5BA 4FF7A 2QCDA 3QPZA 2B4GA 2R8WA 4FNPA 1E51A 1QO2A 4HT3A 3L2IA 1K02A 3KRSA 2E5CA 1G4EA 3LRKA 2KZHA 1SZFA 4YL2A 2Q3RA 5LNVA 1NAL1 2ZZ7A 5A8GA 2A6NA 5AB3A 2H3DA 3MJYA 3MO7A 4UFMA 4CNPA 2QCFA 4LVBA 4PL2A 4TR9A 1A5AA 1FDJA 1R2SA 3O06A 3W7IA 1SFLA 4N9DA 5LNWA 2ISWA 2DZXA 1O5XA 2NXHA 3DH7A 1KV5A 4FEZA 1JCNA 4FX8A 3HG5A 3NZRA 4JR5A 2VELA 4WXYA 4FNUA 1B57A 2V8ZA 2YW4A 1V7YA 2ZZ1A 3PBUA 3N14A 3U8GA 3QM3A 1H51A 2Y7EA 4Z0JA 1GVRA 3IRDA 1QMLA 2CFFA 3TXZA 4DF2A 1ZENA 1C9DA 5CZJA 2B7NA 2PURA 2HS6A 4DO4A 5C55A 3EWXA 2CZ5A 1UUMA 2CLOA 5BMXA 1LCOA 1O60A 2CZEA 1W31A 2V30A 4R33A 4FIRA 1EUNA 3GAYA 3PSWA 4KFNA 1F7BA 4LRTA 3BVJA 4AB4A 1IGSA 4MLRA 5DY2A 2J9YA 3W7RA 3ATZA 4PA8A 1DOSA 5BW6A 4YWIA 3G1DA 5EMUA 1KBJA 5HQEA 3OBKA 3STEA 2QCNA 4XBKA 3L68A 3R2GA 5I3FA 3TK7A 3O6YX 1H61A 2PRHA 3NQCA 1WDWA 2WV8A 5I3HA 1WX0A 3IIOA 3QPYA 1QFEA 1NFBA 1F6PA 1FWTA 3O6DA 3N9SA 3DFNA 1FCBA 3TU9A 3W72A 4ZQMA 3HQ1A 3LXBA 4RJEA 2JKAA 1QPQA 4I7WA 4UFHA 3UZJA 2A0NA 4AMAA 3W71A 5TIMA 5HUOA 4AVFA 3TCEA 3NEVA 2Y70A 3FS2A 2GVGA 3OVPA 5G1YA 3INPA 3M5YA 3B04A 2CZDA 1J5TA 5CZSA 4E2BA 4AHOA 4JDYA 1TREA 4DPQA 1KM1A 4JICA 4TU1A 5HWNA 3W1AA 3TH6A 5U4NA 5ABTA 4BWLC 2QDGA 3A22A 3W7QA 3M5XA 2NWSA 3UWYA 2QCDB 1XI3A 2DZSA 1G7VA 4QNWA 4HN4A 1G69A 3UPWA 3C2RA 3LXCA 4AEOA 4O4WA 2C3ZA 2QAFA 2VEKA 2ZTJA 1Z41A 3GDRA 1DKWA 2O7QA 1KM6A 1VCGA 4M5PA 3CIWA 1PE1A 4JTEA 1QNVA 3M43A 1W3NA 3E49A 1SO6A 1IXNA 5D2VA 3W88A 3STFA 5K9DA 1AL7A 3LV5A 3LI1A 4ADTA 1OFDA 3W1PA 3HPSA 3UWVA 3GB6A 2DZPA 1W8SA 3NZ1A 3W1LA 4IPJA 3V1PA 3LTYA 3QC3A 3Q58A 3LCWA 4Z1AA 5CPMA 3W83A 1DL3A 3P61A 1Q6RA 1B9BA 3E96A 3HG2A 2H6RA 1JQXA 2H8ZA 3NR0A 1LP6A 1SFJA 5DELA 3UQNA 3LHTA 4JX5A 4O28A 4IMFA 4GE8A 4RZ4A 3P74A 2V5LA 4RLIA 5CSRA 1QR7A 1G6CA 1SSDA 1G4SA 4IXXA 3QMSA 4AHPA 3RF9A 1GQNA 3NQFA 1JVNA 5F2MA 1VJIA 2RFGA 3CIXA 4K8EA 3PVFA 3BK0A 3L9CA 3W75A 1S5VA 4JIQA 3HJZA 3W23A 2NXGA 1EP2A 1ZHAA 4IMEA 4NXSA 5KMYA 3C2FA 3W70A 2Y7FA 4IMDA 3ATYA 3OA3A 2QCLA 3JR2A 4UTTA 2BTMA 2F7FA 3EWYA 3SY5A 4CQ8A 4LV4A 2DZTA 1LOQA 3GNNA 4XQ6A 3VKJA 2G96A 4LY8A 3DGRA 3MMTA 1YDOA 1GEQA 5DXXA 5I3JA 1ZAIA 2WQPA 4AXKA 4IXHA 3L0KA 3MI2A 1AG1O 4Q33A 4WXZA 2CLIA 1QPOA 3LBCA 1GG1A 1FQ0A 1H1ZA 3PR2A 3W76A 2CZFA 4BF9A 3TFCA 4JTGA 4UTIA 1DHPA 1PVNA 3EWBX 5J5RA 3TV8A 1H5YA 5LHEA 3LRMA 3PBWA 4JN6A 5AYYA 1MEWA 3I65A 4O1AA 4RKAA 3FEMA 1TV5A 4LU0A 3IIPA 1KM2A 3N73A 1GOXA 2VC6A 4U4MA 2J24A 1RQEA 4AF0B 4NU7A 3W22A 3KOFA 1PCWA 2X1UA 2ABBA 3E9AA 3QSTA 4X22A 4RCXA 1HG3A 1QPRA 5G1TA 3L5MA 1OJXA 5CZ0A 2YXGA 3SGUA 2GJNA 3W1XA 4O16A 4UTLA 1OFBA 4JTJA 3W3OA 2ZRUA 3PB0A 4M7TA 2BSLA 5FI8A 1S5WA 4KWVA 1W56A 3A5FA 4S1FA 5CKSA 3ABQA 2B7OA 3NQVA 1OF6A 1AMKA 3S1XA 3LHWA 5D2XA 3G3MA 4WZHA 3TQ0A 1AW1A 2A4AA 5D2TA 1ME7A 1ZAJA 4RZ5A 3C52A 1QCWA 4AH7A 1JCYA 2ISVA 1IIGA 1SZGA 2Y85A 5KTLA 4GBUA 2EAWA 3W7DA 3PBYA 3WJWA 4CQAA 3AJXA 1LRQA 1F73A 3UXAA 4E2DA 4LWWA 3W7LA 1K8YA 2YZRA 3B0PA 1T0OA 3P8IA 3LCGA
chains in the Genus database with same CATH superfamily
3WUFA 1XIEA 4MY1A 3T0TA 5FESA 1U5VA 1Z9AA 1Z69A 1EEXA 4RDZA 3OZOA 5EB8A 1PKYA 4Z1DA 2V5JA 5MKGB 4MKNA 3WF0A 4OU1A 3D0CA 1DEDA 1YIXA 3LHUA 4AG0A 3TYCA 4AZCA 4ROPA 3AZSA 4AD4A 2DP3A 2OKOA 3TIMA 5CAHA 5JIWA 1VGAA 3A47A 3CPUA 1SR9A 4A6GA 1BSLA 5AHFA 1OM0A 3OQ8A 4Z2LA 4N2YA 3NSNA 3OVRA 2Y8KA 5CGTA 3KCOA 3GTHA 4PTNA 3GLCA 4Y9NA 4JNMA 4TO8A 5D05A 1RJRA 3HGSA 2WHMA 4QP0A 1PEZA 4AFYA 3MI3A 4RX0A 4YNGA 2DIEA 1ZTVA 4UNLA 1RVGA 2EF9A 1XW8A 2IQDA 3GFZA 3CWHA 2PDHA 4RV8A 1TZZA 4GXWA 4IPPA 4H00A 3W86A 1VBJA 4EXQA 1SW7A 4DZ5A 1T6MA 1XL9A 4FAMA 3EMCA 3W27A 1LBFA 4NVTA 1B1YA 1VFFA 4P7LA 1CX9A 3IEBA 3BDKA 2ZTKA 1CWYA 2ZXQA 1UR9A 4O1BA 1HQTA 4MY9A 1R85A 1VFMA 1BD0A 4UUIA 1OQFA 3T8LA 1O95A 1ONXA 1H1YA 4A3UA 3VD9A 1FH8A 4KCWA 1EYEA 3H8AA 1ZZMA 4L4LA 1JCLA 4Q8OA 1KNWA 1RSCA 2ZYFA 2ZZ5A 4MVAA 5CC3A 1DE6A 2JGQA 4I6VA 4UFLA 4Q4OA 3WQEA 1ELSA 3BJSA 1UKPA 2PGEA 1UPMB 3S5ZA 3B4UA 4UTUA 3QW3A 3SUSA 4PE8A 4OIFA 2OMAA 3GU9A 4TIMA 4KH2A 5I7GA 1YMYA 3QZAA 4GNJA 5I3KA 5HR6A 4U5KA 3FSTA 1RVKA 2YPIA 1OFRA 2Z1VA 3JW7A 1SO3A 3EMZA 2ACUA 1WO2A 1EJUC 1WDQA 3IUIA 2CBJA 1XUZA 3S2NA 2W5FA 1PTAA 1CZ1A 2AL2A 4J27A 2WVSA 4IGMA 2CLKA 1AQFA 3KVMA 2GJXA 4ADSA 1ME8A 2V2DA 4IOTA 1MXSA 3MUAA 2Z0IA 3TEVA 1YXCA 8A3HA 2QPXA 4IFKB 3C8NA 4TTGA 3REQB 1FWWA 1BTCA 2DH2A 5C7HA 3BXWA 2ZX6A 1P6BA 1SSGA 5B7YA 1C92A 1H62A 4DB7A 4PFMA 1YNPA 2F9RA 4AZ5A 2JGYA 3N25A 2ZA3A 3S83A 1VCVA 3B8UA 3QJAA 1Q13A 1H60A 2CLLA 4UCGA 3KHDA 2B7QA 4KWWA 3VIHA 1X1OA 3W28A 3EWZA 1K8CA 2XH4A 1E43A 4JY8A 1EDGA 3UJSA 4LUYA 3HGRA 1RR2A 3B9DA 4X0VA 3OGSA 2Y61A 5LNRA 1SZNA 4CD6A 3H54A 1OC6A 3U2CA 1TJ2A 1FP8A 1W5NA 2WMKA 4JOMA 3DFPA 2L5HA 2WHLA 5EMLA 4GXMA 2WNZA 3HM7A 2V69A 3MP3A 3RLGA 3S42A 4RW3A 2E77A 1CT5A 3KEHA 4US6A 1FDYA 5FEWA 4PUNA 4H9YA 3WN6A 4REQB 4DJEA 3E0FA 2A7NA 1VENA 5HULA 2G8ZA 4Q4SA 1ESWA 4LV9A 3H22A 4MY8A 4DWSD 4X60A 4KMQA 3SCNA 3VMOA 1PXGA 1MQRA 2JKPA 1WAWA 1EHAA 4GBDA 1F3WA 1AFSA 2PUZA 3VPLA 4R85A 4YPJA 1PZ1A 1XQKA 1LTDA 4LUJA 3FKKA 3BCJA 1XLFA 1JUEA 1JD7A 4EOUA 4BQ3A 1X98A 1NARA 2YL6A 4S3GA 2WB5A 1VYPX 3CQJA 3CH9A 2QJMA 3W2LA 4TVUA 1VQTA 1X96A 3PPCA 1I2QA 1B30A 2WO5A 5CAKA 1P0EA 3B0UX 3ANYA 3NVTA 1HFBA 1XIHA 1EGZA 3WDJA 4W5UA 4DELA 3VOIA 3DFTA 2BZNA 4JAWA 4H9UA 2D24A 4V33A 2GFTA 2Q8ZA 4MB3A 3LV6A 2VEFA 2GDQA 1W3TA 3U6WA 4ERAA 2OGYA 4KWOA 3PPGA 2CHOA 2ZRYA 4Z2KA 1MXDA 2AL2B 2HVMA 3G0SA 1DORA 3VC5A 2HDJA 4IQDA 3CB8A 4GY7A 4I9AA 4D8LA 5I6SA 5FEZA 2PI6A 3HPZA 1OFOA 3A4JA 3JS3A 2VNCA 3GR8A 4Y6GA 3TYBA 4CNTA 4JTIA 3ZT5A 3TQPA 2PDJA 4W7UA 2YCEA 3N29A 3RN6A 3N9KA 1W54A 4UTHA 1GONA 3H2MA 4RPQA 1W5PA 3S2LA 3W2KA 1AMYA 2J8FA 4QG8A 2Z27A 4Q7BA 4ONVA 1EF3A 3V5OA 2VUYA 3WLJA 2LLEA 4LUSA 1FA2A 2TPSA 2NX1A 2W27A 3EOLA 3WZ0E 3UCQA 4MNLA 5E9XA 1IR2A 3SIZA 3Q65A 1OX4A 4W7VA 1GKQA 3SCTA 4Y96A 1KFCA 3F5KA 3VIOA 1UB3A 1W1YA 1LRNA 3C86A 2AKZA 3QV6A 1BKHA 4BCEA 2X09A 3W25A 3H4XA 5AOUA 4BQ5A 1XM3A 1LM1A 4NZ5A 5A3HA 4GIAA 1GK8A 3B9AA 1Q4WA 4F0SA 2W9MA 3STPA 1TTIA 5EY5A 1LOSA 3EZ4A 4MZYA 2VZSA 1R3YA 2Z26A 1TPWA 3UP8A 2W62A 3R4IA 2VVSA 1V5XA 1NIUA 4YTRA 2VX4A 2EO7A 4QHRA 5D32A 1XRVA 3S46A 5JQ9A 3IK4A 4DX3A 4KEZA 4HNTA 5C5YA 3CWNA 4WJXA 3GS6A 1IT0A 1DVJA 1KKRA 3QV7A 4B5UA 2UY2A 1FH7A 1NWSA 4OJYA 4LX4A 5C2XA 1TZ7A 4B5SA 2IKGA 2C79A 4JIIX 1EGVA 3UR2A 3AHTA 3WO8A 1IYXA 4HTYA 4PTVA 1K3UA 1S3HA 4M6UA 3QGAC 1JPIA 1FP9A 1F8IA 3N2MA 4S3DA 4M81A 3H24A 3K1DA 4IPLA 4O0QA 3OIHA 3ABRA 1LG2A 3CHEA 4HU0A 3RR4A 3FGCA 4E4UA 3NPWA 4HP5A 2ALDA 3TX9A 1QNSA 2NWRA 3C2VA 1A47A 4C6FA 3VDHA 2VFGA 4TVDA 3M7WA 3A13A 1TPVA 2XHYA 4GYJA 3RX4A 1Y0EA 4HNOA 4CNNA 1UR3M 4CD5A 1V3IA 2VQUA 1R46A 1ONRA 1MEHA 3GXPA 3NQDA 4JGDA 2YKKA 4GLEA 4QXIA 1H7XA 2ZDSA 4ZCWA 1TWZA 1QW9A 2ZKMX 1XRFA 1XX1A 3FXYA 4WSKA 3PJTA 4ZOBA 3BQ5A 3VIIA 3TN6A 1EZ2A 3HQNA 3L65A 2ZIDA 1PIFA 3DEQA 1EF2A 1Y65A 2NX9A 4HNUA 2NQLA 1SFSA 2F61A 4Y90A 3LTPA 2AMXA 4D6HA 4HU4A 5DCEA 3KDNA 1XIGA 1GW9A 1TPC1 3TYEA 3SSJA 1MNSA 3FXGA 1OX4B 3UCDA 3MO4A 3EOUA 2CKRA 2V2CA 2ZX7A 3VI2A 3VZXA 4GO9A 1PKLA 4JL1A 5I24A 1TPH1 2J7HA 1TMHA 1QWGA 1AJ0A 2Y2WA 4BFAA 3U9IA 3KTCA 2AOSA 3MS8A 3IACA 4HKPA 2JFEX 2YBVA 4E8CA 2IQ0A 4RNIA 3ITLA 3DAQA 3THQA 4C6QA 4HSOA 3P5YA 4K8HA 2QKFA 3O63A 1UOZA 1C29A 4H6KA 5CG7A 4FALA 1XLAA 1SJCA 3C2OA 3QMRA 3SURA 3RHGA 4ZFMA 1CECA 4DRSA 3KZPA 3I7RA 2FVLA 2EHHA 1NF0A 4FXSA 4TX8A 3O6CA 3K46A 3BO9A 5D2YA 4E3VA 1MMFA 2H9AB 4JHMA 2Y5JA 1VJSA 4RPPA 1YPXA 2VX6A 2WANA 3C5QA 2NX3A 3TFXA 4QAIA 3W74A 3LNPA 2Y8VA 2ZFAA 1E0UA 3NL2A 1MRAA 4RW5A 3KAOA 3GBEA 1TA3A 4HB7A 2C14A 4H01A 4DI9A 2ZE0A 4HHLA 1EIXA 1NU5A 5CH9A 2J7BA 2FZ8A 3DU0A 4WJEA 1G1YA 4M3PA 5CPLA 3BARA 1EPXA 4GC3A 2R1PA 4QSHA 4FI4A 3T08A 2X42A 1EC8A 4JTTA 3TC6A 1DV7A 4XUYA 1ME9A 5AC5A 1JR1A 4Q4RA 3GW3A 1W2VA 4S3KA 3Q2DA 4OV4A 3VOCA 2XVGA 3WLHA 1N8FA 1WOBA 4ALDA 3SN4A 1DIEA 2VEIA 3TSBA 1R0MA 3QY8A 5DCBA 4RNFA 3R43A 2O7SA 1FH9A 1JYWA 3SECA 1BTMA 2OJPA 1SJBA 3I4KA 3AIEA 3S1WA 1HUVA 4EVZA 1JD9A 5EFFA 3P60A 1ZB5A 3N34A 3DYPA 2RDWA 2HXUA 1LLWA 3CIVA 4TV6A 3PUEA 4MUZA 3T8QA 1PTDA 1ZALA 4LS0A 2PTXA 1RZMA 3K5XA 2BXYA 2EG7A 1YPIA 2F84A 3M0XA 4CD8A 1O68A 4CLMA 2REQA 3WQCA 2MANA 3V5CA 3KM8A 2GPTA 1TQXA 3ABSA 2Y5EA 4J1OA 1OCBA 4O50A 4WD0A 1A5MC 5IXEA 4AVOA 1EOMA 1U1JA 3QC0A 1WXJA 2PCQA 1LZOA 4UMCA 1OYAA 2GLKA 4NZ4A 4QBXA 1PTGA 1RALA 3CV6A 4RXFA 1F76A 1ZFJA 1W3LA 1K4GA 4H2HA 1HKMA 2H90A 3PAJA 4YU1A 1XGEA 5A95A 1R2RA 4M51A 1RCQA 1MNZA 1OGBA 2V6AA 4V15A 3UU0A 2FFIA 4XWUA 2PLMA 1FY6A 4O14A 4KEUA 3I3EA 1PL9A 4JIRA 2ZZ6A 2R1MA 5AC6A 2ODOA 5K9XA 4OOUA 3SQMA 2A21A 1XIIA 4DPPA 5AYIA 1DJXA 3E2VA 1E6PA 5A6JA 1PHQA 4DJED 3OHIA 2BVDA 1XRTA 4ZO8A 1TA3B 1WXYA 3G0UA 2DSUA 1QOPA 2ZXDA 2HXTA 5JU6A 3PN8A 3ZOAA 3AISA 1ECEA 3OVQA 2FJUB 3KHJA 3LS9A 1KFBA 4QEEA 2DZVA 5T8GA 3BJTA 2JK2A 3B0XA 2FIQA 5K9CA 3M0YA 1CEOA 1JPDX 2DU2A 2Y62A 2V38A 3I68A 3ITGA 5CZTA 3BAIA 3SUVA 4PRTA 3T7VA 2OSWA 3GYEA 1YXDA 2HEJA 3DESA 2Y89A 1MFUA 5BOOA 4JQ4A 2FQIA 2YW3A 5LZLA 3KTXA 3IIZA 1XIBA 1VRDA 4Z2HA 1MO0A 5CJNA 3PP7A 2O55A 1K9DA 3WDQA 4PBGA 3ARTA 4JTFA 4ZQPA 3OJGA 3P0WA 4KERA 3GDLA 4GG9A 2WZHA 3MBFA 4ZO9A 3S5NA 1L8PA 1AVAA 4OT7A 3U57A 1F6KA 3AIQA 3GXFA 5GNYA 1GTHA 1FWCC 3F7JA 1KXTA 2ISSA 2PDGA 4GISA 2B81A 2REQB 5DT5A 3VX1A 1H7RA 2YCJA 1OEPA 1Q8AA 1S5NA 3IANA 5JXQA 3IJIA 2JALA 4JFWA 4XTDA 1GVIA 2YFOA 3ZT7A 2Q8LA 4ZOAA 3VFLA 2DORA 1HX0A 3WK3A 4A8LA 3ITCA 3PM6A 1GVOA 2TYSA 2ZXAA 2WSPA 4I90A 4XO7A 5CBBA 2WKGA 4Q22A 5I09A 4UXDA 3IAPA 3TJXA 4XKYA 4R53A 3CUJA 4JQ1A 2DSWA 1FHLA 4JFUA 1UWTA 4HOZA 3E02A 2YA0A 4EPDC 1OABA 3HA1A 1NWRA 1TE6A 3EB4A 2FMOA 2V5KA 4HBKA 4E0CA 5LSMA 4K8GA 1YHTA 4ZVJA 4AC7C 2KAUC 3A24A 4KGJA 4OFCA 2O9OA 2IS7A 5BNKA 2VQTA 1CLVA 2ZC8A 3VILA 4F0RA 3IS4A 4W8AA 4CU6A 2A7RA 5HQMA 4U33A 1S2UA 3KP1A 3NL5A 3CK5A 1F9CA 1VZWA 2HBVA 4PSPA 2OX1A 3OODA 4UQAA 3AWOA 3OYZA 1XDLA 3QR0A 4H7CA 4TMBA 1AUSL 1UD4A 1YRRA 5DMYA 1K7EA 3EDFA 2BVTA 4FOJA 4FNRA 4IF2A 5CBIA 4PMJA 1UA3A 3G1SA 3T2QA 3NPUA 2WM1A 3HOJA 3BL3A 2QUUA 3FW6A 3T4WA 3IGHX 1W3JA 4EF9A 3W2UA 3WJXA 5C2CA 3CEPA 1AA1B 1U33A 3PBMA 1UKQA 3GTFA 3WF4A 4H3DA 3T42A 4DEFA 3FKRA 5LKYA 5E0KA 6ALDA 1SQ7A 1VPYA 4K37A 4TVCA 2FDMA 1H50A 2XH0A 3TROA 1J0HA 5FJRA 2QUVA 3VVGA 4HMEA 1XBXA 3U2EA 2R1LA 4LANA 4E3TA 3KBMA 4D72A 5IFTA 4L7ZA 1DWJM 1EH9A 1VIWA 4H04A 1GCYA 1WOAA 2G4FA 3H21A 5A2BA 4DF0A 1TQJA 4K1GA 1LWHA 3L4ZA 3CQKA 2ATSA 2C7FA 3QLLA 2C1IA 3E3HA 3NQAA 4MYXA 2EKCA 3QF0A 1KCZA 1V3MA 1OGGA 1ADDA 5TBOA 3UYIA 3BANA 1XLJA 1P4CA 4K39A 4U3CA 4C1NB 2NQHA 3KS5A 1RK6A 1K8XA 3ZQ9A 3LCIA 3J7HA 5AZ0A 3OZPA 2D0HA 1TPFA 4LVFA 1F3XA 1JCMP 1XYZA 3DYMA 4L5ZA 1NDYA 2CHNA 1NOWA 4UQBA 2J4GA 1G7UA 3PZ9A 2Y24A 1T7LA 5FA5A 1PYMA 3WEZA 1ADSA 4GI4A 4L56A 3WLOA 2VDHA 4LS2A 1WKDA 1XFBA 3MMUA 5HWJA 3HJEA 1UROA 3F03K 3PBGA 3KDOA 3SFKA 3RPDA 4NIRA 1TYGA 4PCNA 4UTKA 1JPMA 1ZNNA 3N13A 2J7GA 5M5DA 2VP8A 3K2GA 3CHVA 4JQ3A 5FCZA 1DJYA 1CLKA 1UZHA 2PRLA 1E40A 5I07A 2X0SA 4UFIA 4UB9A 1WV2A 3EDEA 4KWSA 2XWEA 3EMQA 3T4CA 3PNZA 1D2KA 1FWGC 2WOQA 2ZRVA 3NXFA 1ZRQA 4PC8A 3CBWA 2NV9A 4O54A 3RG6A 3BOFA 1XD1A 4JKMA 3AC0A 3F5LA 4L6HA 1KLZA 1Q6QA 4LCRA 4WGHA 2R24A 2VURA 3GZ3A 4HOWA 1NWTA 3E1F1 2ACRA 3EKGA 4WY0A 3VNZA 3K8LA 3WJSA 4M82A 4DXVA 3S2CA 4EF8A 2C16A 5A6LA 4QISA 1OWQA 1Q45A 3V0SA 5AECA 1A4LA 3QEZA 1GWJA 3WLQA 4MKSA 2XINA 2ZVIA 5MHBA 1ZP4A 1O12A 2F6KA 5EBUA 4MWAC 1V6YA 4CU8A 3W53A 4Y8EA 3DHFA 1XDMA 3S5YA 3W1MA 4NZ1A 1KB3A 2RUSA 4O1CA 5FF4A 1JAEA 3HG4A 2V5BA 3CHFA 2R8WA 4FNPA 3VFCA 1QO2A 1FKWA 2X8RA 3WBXA 1DWIM 1K02A 1G4EA 2FTYA 4YL2A 3ZLGA 5LNVA 2A3EA 3RDKA 1G01A 1XYMA 2YLAA 5H1WA 1XLIA 2YCLB 1FDJA 2G37A 4HJFA 2JF6A 4KQNA 3E0LA 3T9PA 1A5LC 2DZXA 1O5XA 2NXHA 4Q4PA 4FEZA 1B0IA 4EXAA 3TW9A 1IWBA 4IT1A 3POHA 3FJNA 2OB3A 4GNKB 2YW4A 4IG2A 1V7YA 4HYWA 3PBUA 3ARRA 4PMXA 3QM3A 4ENLA 1XC6A 2PTWA 4Z0JA 1XYFA 4LUTB 3TXZA 1FKXA 1ZENA 3NQBA 1C9DA 4S3JA 2B7NA 2DEPA 4DO4A 3KLKA 1FFQA 3B4YA 4GJIA 4XVEA 1EUNA 3QR1A 3PSWA 3QTGA 2G3NA 3U48A 4H9VA 4ZOEA 3H4GA 1ZS2A 2J9YA 3VCNA 5A8QA 1KBJA 3OBKA 3WLLA 1MDLA 3STEA 3GU2A 2BHYA 1QNRA 1IEIA 5I3FA 3O6YX 2PRHA 1B3YA 2XU2A 1WDWA 1SGJA 1QRQA 3B40A 5HDRA 3W26A 3M0VA 5HQLA 3N15A 3QPYA 4JQ2A 4MADA 1QFEA 1R9XA 3N9SA 1FCBA 3W72A 4GVIA 3FAWA 2WWDA 5A69A 4PRRA 3HQ1A 4AU0A 2DW6A 3LXBA 4UFHA 1PIGA 1NWUA 1EJTC 3KP0A 3W71A 1TVLA 2O9RA 1UWSA 1B3ZA 4AVFA 3NEVA 3WG6A 3UETA 3WLMA 3MCMA 2A3AA 4E2BA 3UZZA 4RNJA 3RUBL 1TREA 3BLPX 3PZTA 4ZB0A 4M80A 5ABTA 2QDGA 3A22A 3W7QA 3LZ5A 3UWYA 3BQ6A 1H41A 2Q6ZA 2HPMA 1G7VA 4QNWA 4HN4A 3V0UA 3UR5A 1JXJA 5BYWA 2VGBA 3LXCA 3A12A 3TYDA 4JFVA 4WR3A 4MF4A 1Z41A 3GDRA 2O7QA 1KM6A 1LLOA 5D4YA 1AH0A 3M43A 5I03A 4C6MA 1HGYA 1RCOB 1XSJA 1QBBA 1IXNA 1SO6A 2ZADA 1OFDA 3UWVA 4QTGA 4DI8A 1TKKA 3FA4A 4PSRA 4S3EA 4IPJA 3V1PA 1WKEA 5ABEA 2WMIA 1QU4A 4DLMA 2ZICA 4KESA 5GJNA 4QG9A 2QMJA 4OVXA 1A3WA 3V18A 3NR0A 3GZAA 1SFJA 2PTDA 5DELA 3UQNA 1Q85A 3LHTA 2XG9A 1MW3A 1PX8A 4GE8A 4Z1YA 3APGA 3P74A 3ITOA 4RLIA 5CSRA 1TWWA 6A3HA 2WXDM 1R6WA 4IXXA 3A4XA 2GYIA 4S3FA 4AHPA 2BFGA 5BXPA 4PUJA 3WD4A 1C7TA 2X0HA 4AMCA 3ARQA 3HJZA 5KMYA 4IMEA 4K2SA 4R7OA 3C2FA 2WVVA 4D6CA 2PP1A 2A3HA 4IQEA 1BVZA 4J3VA 2QCLA 3U7BA 1J0YA 1OBAA 3EWYA 3SY5A 4CQ8A 4F2UA 4W88A 2DZTA 4TQTA 4NP7A 3FX4A 4QS5A 1BF6A 3VKJA 4Q4MA 3CXOA 4C90A 5I3DA 3HTWA 3DGRA 1NH6A 4FPSA 2OWXA 1OD0A 3WMLA 5DXXA 1AZ2A 1ZAIA 2YCIX 1W8GA 2PGFA 2ZX5A 4NYUA 3MI2A 1AG1O 2EXOA 4IP5A 4Q33A 4WXZA 3ZR5A 1S5MA 4AIUA 3LBCA 1E3XA 3QGKC 2RGLA 3W76A 4NKCA 1XYAA 3VMPA 1F3TA 3TFCA 3UZYA 2I7GA 4JTGA 4CNSA 1K70A 4A3HA 1VBGA 1H49A 4UTIA 3U4AA 1S2VA 1XQLA 5AYYA 1JDDA 1GJUA 4RKAA 1VIZA 5E0FA 1XLGA 2F38A 4LU0A 3GNRA 3ARVA 3MUY1 1KM2A 3N73A 4HA3A 3O0FA 5BU6A 2X05A 2J24A 1HJVA 2G50A 2PDNA 1PCWA 3B97A 4AISA 3E9AA 4RCXA 1QPRA 2VWTA 3W1XA 3ARUA 4O16A 4UTLA 5BWFA 3VOHA 1EO5A 4DM1A 1S5WA 3ARPA 5REQA 4S1FA 1Y8BA 3NQVA 3S1XA 3SRFA 2XTKA 1UZ1A 5D2XA 3Q45A 5D8WA 4JHOA 6XIMA 7REQA 4X2PA 4ML4A 3S2MA 4UZUA 1HGWA 3VDGA 3AHVA 1MVYA 3CMJA 2GVYA 3W7DA 3WJWA 3DHUA 6ENLA 1F73A 4E2DA 3SRHA 3V3WA 5EMYA 1M1BA 3LCGA 4OWGA 2OYLA 3EX6A 4AUBA 3Q67A 1TFVA 4POCA 3P67A 3R8HA 5F1UA 4PBFA 4RXGA 3W2NA 4GKLA 1O1HA 5FEXA 4P61A 1Q7QA 3CL6A 2W6RA 3ID7A 4FR6A 3UWZA 3E2SA 3RITA 2OEKA 1F5ZA 3CQ0A 2BDQA 1PX3A 3WDIA 3W0KA 4H8HA 4GC4A 1UWIA 4O1FA 4JYFA 3L4YA 4A2RA 1CXEA 3NXLA 1DJWA 3GXTA 1BQGA 2QV5A 3ZS4A 5MF5A 2XIIA 2FZBA 3CTLA 1R30A 2PA6A 4O0KA 1G4TA 4CVUA 3M0MA 5A6SA 2XFWA 3QVQA 3VOFA 4B3ZA 5LNUA 1OD8A 1UCWA 1XD0A 2WKJA 2TMDA 2WNNA 4UNKA 3KCLA 3M0LA 2PDLA 3L7RA 4IMAA 1NVMA 3T40A 3A21A 4EX4A 3VM7A 3NCOA 3GVQA 4GIEA 1SZRA 1T99A 3VNDA 3FA5A 5CZKA 2NUXA 2NQ9A 1P0DA 4ZE4A 1L8NA 4IICA 4IM4A 2VEPA 3EWUA 5M2FX 3HU7A 3ZJ8A 4C6PA 1KWKA 5CBJA 1OYBA 3MBDA 1ITXA 4XD5A 3QOKA 2X1RA 4N4PA 2D2HA 2OGJA 5HNUA 3ZLHA 1QT1A 1DJNA 3FIGA 3GVRA 2Z1XA 3TAKA 3OLGA 2YDAA 1Z89A 4H19A 5FEPA 1HKWA 3TWBA 1UD6A 5JIPA 1A49A 3TOPA 3LHVA 3M41A 4V1YA 4MTVA 5G4EA 4UQDA 1BRLA 3A23A 1P43A 2E4TA 4I7UA 5G4HC 1YTDA 4Q8TA 4GX8A 5KZDA 7REQB 4H8VA 3QSRA 3VX0A 3QFEA 2D23A 1ZBKA 3AHXA 3AMGA 4OQVA 3S3GA 3GDTA 3G5EA 3P6LA 4MPQA 1UJQA 2XIQA 3C6CA 2GGGA 4QE4A 3BLIA 2X30A 2E6FA 3THDA 2PLCA 2WM0A 2P5NA 2FHFA 3GNXA 3MSRA 2WSQA 4B5TA 2ZWZA 4PTMA 3VIFA 4NJGA 5HMFA 3U5YA 4IGNA 1WAUA 4QS6A 1J8VA 1LQ2A 2BXZA 1G0CA 2CBUA 5CGQA 4W93A 3RLUA 1RA5A 5DBTA 1ZSXA 2PWDA 5CC5A 4FNQA 4JN7A 4KBXA 3BOLA 3UERA 3SUUA 3QR3A 3VKKA 3ZFHA 4KRTA 4O18A 3FJLA 1ZP3A 2QPUA 2Y5SA 5GJPA 2B0MA 4N6FA 9XIMA 1RLDA 1NP0A 4NUWA 1XKYA 2YDQA 3QW4B 4FXJA 4LYKA 4WLCA 4E4PA 4QCEA 1WKFA 3BW3A 4JTKA 1KC7A 3NGFA 4S2CA 4QLKA 3ERPA 3IGUA 2V3DA 3COTA 2WHJA 4V28A 1JCJA 2QJIA 3SEPA 4FHAA 1LUCA 4BQ2A 4WJ8A 3L4XA 2VFFA 1N2VA 3GTXA 2VFDA 5FJUA 1JZ8A 1L0PA 2BXVA 2GSEA 5FF7A 3ZVHB 3LMYA 1Q5MA 2J8TA 3VD4A 1ZBWA 4K38A 3RU6A 3W81A 1V02E 1WBJA 1NEYA 3DHPA 4NJIA 3TN3A 1GORA 4URIA 4ZBCA 3W07A 1XH1A 3C8FA 2QGHA 3W73A 4LEQA 5DN1A 3GE7A 3TZNA 3B0VC 3HV9A 2V63A 4GQQA 4YMZA 5AYZA 2I9UA 3N4EA 1J5SA 4UTWA 2Q71A 3EBVA 5IHRA 3C2EA 2DY3A 1BLIA 3DFYA 3WLPA 1V3HA 1UWAA 2VENA 4JIPA 4FX7A 4NX5A 1CTNA 3TTOA 1KTNA 1XLKA 1QWKA 3DBPA 1KLYA 5A6BA 1OFPA 1MRQA 1RP8A 1KM0A 1F05A 1B2YA 2GJPA 3A9IA 4JTUA 2PDBA 1W9VA 4X2RA 3C0QA 1JDEA 1QUMA 3UPBA 5CJ5A 3NJ3A 4OBSA 2ZZ4A 4QFUA 2ZUUA 1UC5A 3QKEA 4RE4A 3AIBA 3M47A 1KM5A 1M7OA 2JIWA 4F0LA 1C8QA 4AX6A 5LGZA 1V0KA 4A3QA 1KM4A 3GIQA 1TO3A 3H2NA 3NM1A 1D8WA 2YYUA 3TUUA 4ES4A 4DLFA 3KL5A 4XZ9A 2WC3A 3VUPA 3NVDA 1PV8A 1DTNA 3PY2A 2PCEA 1CXLA 3KVLA 3RAOA 2V2HA 3I6TA 1P6WA 1QW8A 1R3QA 1TV8A 1W32A 2QGYA 3G2GA 1S2TA 4GQRA 2CW6A 4W7WA 3I4EA 3UVAA 5GQBA 5A5WA 3LSCA 4ILSA 4NZFA 3QY7A 2GSHA 3AXKA 3NWRA 3OA5A 1O4UA 4ICNA 5K7JA 1CI1A 4JTRA 4RDYA 3WK2A 1KO0A 3SZ8A 2V81A 3PZOA 5LIYX 2DZAA 1BHGA 3UPMA 2OR2A 2PP0A 1PYFA 3BMWA 1YTKA 3N4AA 2BY3A 1LUCB 1IT7A 1LWJA 1TJRA 4JD4A 3BW4A 3NL3A 2OEJA 3AWNA 2BX7A 1ZY9A 5A6TC 4NL1A 1H7WA 1KBLA 3FHAA 5T9CE 3T1GA 3THAA 2HNEA 2UY5A 1E9YB 3W7CA 3CMFA 3EYPA 1YDVA 1PDZA 4TX9A 3W1UA 2ZBTA 2XN1A 4GFSA 3M16A 4C5YA 2PODA 3BC9A 1DXFA 2PDXA 4AYSA 5LXEA 1WZKA 4NX0A 4QAWA 4OUEA 3E12A 4Z2GA 1PPIA 3II1A 2XGBA 1HL8A 1O5RA 1V6UA 2ICSA 4G7EA 2HCVA 2VX7A 4FF5A 3LPGA 1MZRA 1D3CA 1UPPA 1VF8A 2ASHA 4HNLA 4F79A 3P93A 1I4NA 4PUDA 5GNZA 3A5VA 3SUWA 2BWGA 2QHAA 5HJLA 5LHFA 3VGHA 2DGAA 2TRSA 4A2SA 2PC4A 2P76A 3EXRA 3EX2A 5FD0A 1K1DA 1Q6EA 4D9PA 2QCHA 4O1EA 5HMEA 3NQ2A 2Q09A 5AZ1A 2SFPA 5EYWA 2V3FA 1E73M 4M8UA 1GOQA 2PAJA 5TD4A 1DP0A 5F2GA 3TSDA 1ITCA 3TA9A 7CGTA 4UTJA 3C4UA 4X9SA 2ZVRA 1DIKA 4NY2A 1I1XA 4PCSA 1I2NA 4NRSA 4GABA 4R3UA 3T55A 2OZ8A 2P1FA 3W9ZA 5I78A 2J7FA 1DYSA 4O11A 1TV4A 5HMSA 1OK6A 2IMRA 2Y88A 1IXOA 1JAKA 3I3BA 1BWLA 1QI3A 1B4KA 1QK2A 1GOIA 5JBEA 1VD6A 1GT8A 3N11A 4DY1A 2NQZA 4HPGA 3T78A 3E5BA 4WDWA 2Q01A 4U10A 3FLUA 5D04C 5BOEA 1ODUA 1R3VA 4DAIA 3UG8A 3QH2A 4M19A 4A29A 1XJBA 4GCAA 2PDYA 4GUFA 2HMCA 3BLOA 3WD3A 3RM8A 2BY0A 1KFJA 5AHIA 3SCRA 3VMNA 5BOFA 3N6HA 3XIMA 4LPCA 5D02A 5CPQA 1Z44A 3MYOA 3T44A 3BSHA 1XS2A 5LXXA 4KCUA 1FWAC 1UH3A 1EWDA 4O1DA 5HNRA 5B80A 4M1RA 3GBDA 2VEMA 4GK8A 4NAEB 1YEYA 3G3DA 1M7XA 1VEOA 2OVLA 3DKLA 2VMFA 4XIMA 2FJKA 1VR6A 3EDKA 3L2LA 1P5BA 5EBAA 1FCUA 3UWUA 3MHFA 4WQ6A 3DOPA 1UWRA 3F2BA 3FN9A 4PMOA 1FFRA 1WB0A 2BVYA 3P81A 3HURA 3A4AA 4UWMA 3NNTA 1GPWA 1LOLA 3OG3A 3UXKA 4FNTA 1ALDA 3HPFA 4FMVA 5I3IA 3WSUA 4G9PA 2PGRA 3LERA 2QJJA 2WHKA 5FF0A 3F4WA 3KWSA 5G2IA 1UQYA 2J6XA 4F8XA 3BG3A 2NV1A 2DJLA 3TP4A 5H8MA 2VL4A 3FYPA 2C1GA 1TJPA 3PWGA 3YPIA 2TSYA 2ZRXA 4K68A 4MKVA 1O94A 4HJWA 2PDWA 3W85A 3VOJA 4IWWA 1DTUA 5E0CA 1E0VA 4XZLX 1ENUA 2VFIA 3BWWA 3C2YA 1KBIA 2Z7GA 2PDUA 5K4ZA 2WQDA 5CPSA 1BYAA 1FBAA 3MZ2A 1SO5A 3UZXA 4L9XA 3L4UA 3HB9A 4ZENA 3W7NA 5H2ZA 4E8DA 4M0XA 5IBXC 2RJHA 1JEZA 3WYZA 2HE5A 2O9TA 4MNJA 3IGXA 4FS9A 4AWEA 3QZEA 4LC6A 3KTSA 2BNJA 1RJPA 3WEMA 3MHUA 1FTXA 5FF3A 2XH2A 4ZB2A 2QMKA 1ZJIA 4C6IA 3AROA 1US0A 1DWGM 4WEVX 1VLWA 1HP5A 4ATLA 1UUOA 4I3GA 2XH7A 3W1QA 4BHYA 3LMZA 1BXNA 4RZ6A 3KLLA 1JNDA 4QQUA 3WBWA 1F2JA 3GD6A 1MUCA 5K3VA 4CN6A 4C7DA 3HFYA 4DBWA 1TX2A 1I0DA 3CPGA 3AICA 1KCXA 1F4HA 1HW6A 3R0UA 1X7FA 4HA1A 3SB0A 5BRBA 3GH5A 3QRHA 3IVTA 4H7ZA 4ZE5A 3LBOA 2D2OA 3K4WA 2JE8A 1GPFA 4UQ9A 2VZOA 3K13A 2BOEX 3W38A 4GYFA 1IEXA 3USBA 1V6TA 1SFTA 4D6FA 3MT1A 4NNBA 4LQ1A 5FJTA 3ZO9A 4EKJA 4JKLA 1ISXA 2VZUA 4MYAA 3L0GA 2XN2A 4YTTA 3UGRA 2P0IA 1D3HA 1K8ZA 3MKVA 4HPXA 5ABHA 2GWGA 3C56A 4O13A 1GG0A 4PMZA 4IHCA 2HS8A 4NF7A 3F1QA 2RAGA 2WZIA 3OPSA 4AY1A 4ICMA 4WX2A 3FK4A 2OWCA 3O8AA 4V27A 2ONEA 2CXGA 5HBFA 4GRSA 1ICQA 2GVEA 2FLIA 1E9ZB 1BG4A 4EWJA 5A6BD 3DBNA 2W91A 3VIMA 1YX1A 3WH5A 4KCVA 4W87A 5AVHA 5TAOA 4YLWA 3G6MA 1V3LA 4NYYA 1MUMA 4AQLA 3TKFA 4AF0A 1OFAA 5DF0A 3WEOA 1ZCOA 4O52A 2XZ7A 2V3EA 5ENLA 1IXPA 3OVGA 5I5RA 1REQB 7ODCA 1OSEA 1KCLA 2DT2A 1HKJA 4NT0A 2VUNA 4ZOCA 1HXJA 3OIXA 2OSYA 1P6CA 2Z2AA 5EU9A 5HINA 3W7JA 6TIMA 3R25A 2QCMA 4H6EA 3WQGA 3WNMA 1E1CB 4E6MA 4HHPA 2RKXA 2Y6ZA 3W7EA 4LVAA 4LGXA 1UC4A 1GTEA 4QJ3B 1TV2A 2VKZG 4DBDA 3VOGA 2PS2A 5DY3A 1CGXA 2VR2A 4H2CA 5C0QA 2Z24A 3VIPA 4PH6A 3T07A 3VK5A 2YR1A 1V03A 4MOZA 1QPNA 1RD5A 1KQYA 3KXQA 3NM3A 1U30A 3NDZA 3MUCA 1L6WA 2GGEA 2IUZA 5C9XA 3TXVA 3M7SA 4AD5A 3KE0A 3QQWA 5MKGA 2V9DA 4JTDA 4IIHA 1WZAA 2GDVA 3C0LA 4N4QA 3GG1A 3H2AA 5D9PA 3KBSA 4MM1A 1E5JA 4XBSA 4K7YA 4DZIA 3PTQA 3VE9A 1NQKA 3G1VA 4Q7NA 3STCA 1I9CB 1PB0A 1XCXA 4NG3A 3ZM8A 4ML9A 1K7FA 1J12A 3V75A 4L9ZA 5T9BG 4U28A 1L6GA 3SIMA 1KFKA 4AIBA 5BROA 2WCGA 3ALFA 4HNCA 4GQGA 3NQMA 1MZHA 3H7UA 4G8TA 5K2ZA 3RLHA 2TODA 4S3CA 1NTHA 2VWSA 3LM3A 4KFOA 4W9TA 2WVTA 1UD2A 1VEPA 4DO5A 3DZ1A 2D2GA 3W7OA 3NYZA 3R13A 3AHZA 3AS3A 1JI2A 4JTCA 2NQJA 3WL1A 2VDGA 4MWAB 4ZEPA 3D47A 3SJ3A 1WNOA 1HIZA 3QBUA 3U2OA 2YX0A 4QIUA 7PTDA 2GK1B 3CJPA 4F0MA 3GR4A 4HHMA 1PBGA 1MI3A 4BI5A 4CCDA 3KRBA 2CNCA 1XGZA 3SCVA 2ADAA 4UQCA 1OZMA 2VGFA 4FNSA 3GR7A 2FKPA 4KCTA 3T0BA 4ZQCA 4G56A 1AH4A 2MUCA 3IJ7A 7A3HA 4WVXA 5EMMA 1EWEA 2OO0A 3H55A 2AGKA 3ICJA 4LFYA 1AODA 1W5MA 2DZBA 4LAUA 3UCCA 4FK9A 5KETA 1JYNA 4IP7A 2QPSA 4UR8A 1UWQA 2HPIA 4WK9A 3NQ6A 2AQOA 5EMJA 1K9FA 2CYGA 4MZ1A 5I3GA 3CV7A 1K4HA 4D8ZA 3ITXA 3URQA 4WSHA 4AHQA 1WE5A 1YXYA 2HWGA 2WJFA 4NJHA 1GYLA 4B9ZA 1HF6A 4RE2A 3OO2A 1YYAA 1IEWA 3QQ1A 4IFKA 5D38A 1FWIC 4IPNB 3RLVA 3REQA 3P14A 3GNDA 2E6DA 4GQBA 4NJKA 2GQAA 2WPGA 2OT0A 4HK7A 1EOKA 4S3AA 3GIYA 4KEVA 1XP3A 2GOKA 1P0KA 1UR2A 5A8OA 3N2BA 1OC5A 1XLLA 1BGAA 3LGGA 1V0MA 3T05A 3WQWA 1KFEA 3SAZA 2E5BA 4UR7A 3W00A 2GGHA 4TMCA 1I0BA 1QI5A 1GW1A 4YCPA 1DWHM 1C9WA 4HN8A 3ZSSA 1CB2A 4Q8UA 1TRIA 1JRBA 1RPXA 1XBYA 2V3GA 3LHZA 4QDPA 4DJEC 1E55A 1J2BA 2O4MA 4UOJA 1G4PA 4AC1X 1PKMA 3WH9A 5I00A 1PZ2A 2Y63A 1ZUAX 3CU2A 3TVAA 2QCGA 2OSXA 4G6CA 1NDZA 2BV9A 1JCTA 1M7JA 5FAJA 4REQA 4PFHA 1ITQA 5DXYA 3JVAA 4EIVA 3OLDA 3BH4A 3E74A 4JYEA 3W1RA 3WLTA 3F5JA 1UJPA 3PZGA 3M5ZA 1JZ6A 1BWKA 3M64A 3VCCA 3DFQA 1OZQA 4OE7A 1IEVA 1KTCA 2J62A 3A4WA 3CUFA 1E6XM 4LB4A 3D3AA 4YTQA 5A8NA 7XIMA 3CZEA 1QNQA 2RDXA 2ZDRA 1P7TB 3LLDA 4L1WA 4LVGA 1E6NA 1ISWA 1YNYA 4GPNA 1VHCA 3SQSA 3MANA 3KZSA 2I56A 4B91A 1CXFA 2R6OA 1GOMA 1TMLA 2PWFA 3QPZA 4CNUA 4OOZA 3AMKA 2I57A 3PFMA 1PZ0A 1YE6A 3GYCA 1FHVA 3KRSA 3SUTA 4Z42C 1XIMA 3WH6A 4DAFA 4F0KA 3BAYA 1O1ZA 3UEQA 1Q8JA 2Q3RA 3O9NA 4XAPA 3O7UA 1YQ2A 3N2TA 3T0AA 4Q8NA 5I06A 1R3TA 3MJYA 2VJXA 3WH8A 2G0WA 4LALA 3LUTA 1A5AA 4EACA 3O06A 1SFLA 3LN3A 4QGCA 2PDQA 3DH7A 4AY8A 1KV5A 2DFAA 2PDCA 3NZRA 4JFSA 2VELA 4WXYA 3S47A 3P3BA 5E6YA 5BXTA 1U5HA 3V35A 2PBGA 4YTSA 4GI8A 3W6MA 3WNNA 4AZHA 3FVMA 2W61A 1DJZA 1GVRA 3IRDA 1W2PA 4AZ7A 5LIWX 5HNNA 3SN0A 4R88A 2HS6A 1FRBA 2WBGA 2YBUA 4R9OA 3EWXA 4KS0A 1NJJA 2CZ5A 1LQ0A 4LYPA 4S3BA 3UA4A 2VD8A 3VKCA 2CZEA 3PJXA 4FIRA 5I77A 4LRTA 1IGSA 5DY2A 4P7OA 3L4VA 4KIRA 1W3HA 3EB3A 1RK5A 3W7RA 1DOSA 1P1MA 4DXXA 5EMUA 3OYXA 4XBKA 4F48A 5FIPA 2XPKA 3R2GA 3TK7A 1UMLA 1H61A 1GYMA 2WV8A 3A3WA 3QHMA 1FWTA 3CMGA 3SY1A 3K4DA 3AUJA 3HQOA 2WC7A 3TU9A 4X61A 1VBRA 3LD5A 4RJEA 3UZJA 1IEQA 3AIUA 4IIEA 1HVQA 3WNLA 1FWHC 3B9NA 4WKAA 4DNMA 3USZA 4E8GA 4EP8C 3FS2A 3M5YA 2C71A 3B04A 3OBEA 1J5TA 5CZSA 5DX7A 4DPQA 4Q8PA 1KM1A 3CAVA 1XPYA 3H2EA 4JICA 1UA7A 3W1AA 2XVKA 4I8YA 1HJQA 2TAAA 3WF3A 1KWGA 3LZ3A 2NWSA 3M5XA 1PZ3A 2XGZA 2FVKA 3PJUA 4P8XA 4W86A 8XIAA 5DMLA 2DZSA 3W01A 1EZWA 2C3ZA 3MKCA 2QAFA 3UNTA 1E6SM 1BQCA 1WUEA 1DKWA 3UZWA 2E8ZA 1A3HA 4JTEA 2EPNA 1W3NA 3IK2A 3E49A 1E6QM 2J6VA 3NYDA 4LH8A 1POJA 1DQUA 4XIAA 5FAGA 4LNCA 3ANUA 3NZ1A 2OZ3A 3QC3A 2FZDA 4Z1AA 3UG5A 3W83A 5LIUX 4B92A 4ZSUA 1RJQA 3HG2A 4H83A 3SM0A 2WZEA 4PTDA 1JQXA 4HGXA 2H8ZA 3ZR6A 1EXPA 1LP6A 2KX9A 3BAXA 2DUZA 1OCQA 4RZ4A 2V5LA 3CV2A 1QR7A 1RBAA 2E1WA 4U31A 3W37A 1IZKA 2CHRA 3QMSA 3APTA 5DMMA 4GXPA 3RF9A 3AI0A 1GQNA 1M41A 3NQFA 1JVNA 5F2MA 5H8UA 3VABA 3W75A 3RX2A 1EP2A 4LCQA 3W70A 4BA0A 3M07A 4BS0A 3OA3A 2VCBA 4HVXA 1J0ZA 4AIEA 3XISA 4LV4A 1OB0A 3MSGA 3RPMA 3GNNA 1V08A 4XQ6A 1H1NA 2G96A 4MJ4A 3N18A 2NLYA 2BMBA 2F6UA 3CL8A 1UBPC 2OTDA 1GEQA 4J3WA 2IPJA 3W6LA 1E0WA 1F3EA 4DN1A 5CSYA 1EJ7L 3I6EA 5T91A 4A35A 5GJMA 1CBGA 2XWDA 2WMHA 3L0KA 1BFNA 3BE7A 4PMQA 2WW5A 4GIYA 4J2MA 4FLOA 3PR2A 4BF9A 3ABZA 3BCFA 1V0LA 4EPEC 2VRJA 2H9AA 1QBAA 4LAKA 5CXPA 2AL1A 1MEWA 4O1AA 3ZIZA 2VC5A 1UR4A 1DJHA 2VC6A 3CB3A 4AZBA 2ON3A 3OGVA 1UG6A 3W22A 1U1UA 1GOWA 2WCSA 4PBEA 4ZTYA 4C6DA 4X22A 1HG3A 2HVNA 1OJXA 4GZEA 4L6DA 3OQEA 4QLJA 3SADA 2OOGA 2DUXA 3THCA 3CQHA 3BAJA 1OFBA 2O92A 4B4FA 3RRAA 1M65A 3N6JA 4KWVA 1IZCA 1OF6A 1AMKA 3HPAA 3D6NA 1ISYA 1ZGDA 4QCFA 3HV8A 2UZ9A 3WQFA 4P7RA 5C9WA 1ME7A 1ZAJA 4RZ5A 3GH7A 1QATA 3C52A 4FA3A 3ENLA 5A1AA 1QCWA 4AEFA 1JCYA 3PZQA 1A0EA 1NOFA 2OZTA 1S38A 4PTWA 3S2JA 5E9AA 3AJXA 1LRQA 1UD8A 1UR8A 3CZKA 1OY0A 4MUPA 3RGTA 3RPTA 3P8IA 2CU0A 2IQTA 3TONA 2VCAA 1VC4A 2VC9A 2E28A 1H7OA 1JXKA 3EB2A 3KVKA 2D3NA 4IUGA 2ZCGA 3LCXA 4B3LA 7ENLA 3TTYA 1H0IA 4CGTA 4H6QA 4AAJA 4A05A 1NDVA 1ZL1A 2D0GA 4XZHA 3UG3A 2R1KA 4C1LA 5AC7A 2E9BA 5CCZA 1PSCA 3VDAA 1CIUA 4XD3A 3L66A 4MDOA 4IMCA 1E6ZA 2QXWA 1OC7A 1KA9F 5CPNA 3NO3A 3TMQA 3SCPA 2W67A 1TUXA 3MV01 5JBDA 5TNVA 1EFZA 3MP4A 3S9IA 4DYKA 3VIKA 5FJOA 2Z4GA 1EA0A 1E1EA 4Z1CA 1Z42A 4N9BA 2QVHA 4U3AA 2I5QA 1WBHA 4J3SA 3P0XA 4XSMA 1Q6DA 1QNOA 2RDTA 2FVMA 4PUKA 3NZQA 3QPEA 1D9EA 4ZL1A 4J7RA 2X1SA 3UXIA 5FKYA 2F6XA 3VO0A 2WK2A 4UTMA 3H53A 2C6QA 4TTUA 4QQ3A 4WOZA 4L1GA 4V2XA 4IGHA 4W89A 3URNA 4IIDA 1FWJC 4JXCA 1OVDA 3H26A 4LUIA 4FB7A 1O7AA 1BEUA 3MW7A 4HSHA 5F4SA 2HE8A 3NO1A 3UGVA 3DENA 1EXBA 4JX6A 2FGLA 3BPWA 3R12A 1HT6A 2I16A 2WBKA 3CS2A 3S1GA 1D7KA 3TDFA 1Q6OA 1LORA 3NAVA 3NA8A 1L2UA 2HTMA 4UFJA 2FZNA 2BOGX 4CN4A 5TQLA 1S2CA 1GVYA 1WZLA 3G18A 3WD0A 1OCJA 1B31A 1CW2A 1XICA 1Z48A 3VIGA 5DO8A 1Q3NA 4CCEA 2WVUA 3B8SA 4JY9A 5A2AA 4GUHA 3E6EA 5D37A 3C0JA 3TR2A 2GQ9A 5F1VA 4RZBA 4YIWA 5K4XA 3TYAA 4DYEA 1UW9A 3RK8A 3BZJA 2NLIA 5JUVA 3GDMA 3NTYA 2YYTA 1XCFA 3W7PA 1C3FA 2VZTA 5C2GA 4C6OA 4DF1A 1NOUA 4MWAE 5ABFB 1XXXA 4I7VA 4BEUA 4R34A 2FPTA 1TTQA 2XN0A 3LPOA 1M53A 1XIFA 1DJIA 1TTPA 1B3OA 1TWSA 3QYSA 4J3UA 4Q8WA 1QHOA 2FHBA 1LF1A 2R94A 3GVWA 4CQDA 9XIAA 3ABXA 5IRPA 1K6AA 4OHQA 4EK7A 2XVNA 3SN1A 3GXIA 4LVDA 1A53A 2YB1A 4CN1A 3ARZA 3IJ6A 2A3BA 1XWYA 1R9ZA 2DIKA 4TX6A 2DT1A 2R82A 2GOUA 1N8WA 4YJ5A 1K9TA 3LQLA 5BZAA 4GI9A 2IPGA 3G1FA 4D6EA 1S3TC 5DBUA 5C8BB 3ISIX 3NPVA 1TUFA 2X1TA 4UTTC 3WBYA 3AALA 5DQPA 4N0RA 1XLDA 4YYFA 3SCUA 5LIKX 3LDVA 5U7SA 5EPDA 3CUHA 1TRDA 4TXEA 3K1GA 4UFKA 1W9XA 2E5DA 4IJBA 4PMNA 3RMJA 3WK1A 2J9ZA 2WZMA 3WMSA 3ALGA 1EUAA 4GY1A 1DQWA 5HMDA 5KITA 1A5NC 1KKOA 5BCAA 5LA1A 6PTDA 5HUPA 3VZZA 4ADUA 2DVUA 4JBRA 3O1NA 3U7VA 1J11A 5C9UA 2NT1A 1DWAM 3R1ZA 5LNSA 4GUIA 1CGTA 1NQ6A 2Z6IA 2XIMA 2VRKA 4PYSA 3KOZA 3V1HA 2QVNA 1JZ3A 1K03A 2PC8A 3FDGA 5E70A 4RL3A 4KETA 1ZQ5A 4MZ8A 1V4YA 1ONEA 4J3TA 3HO8A 3EA2A 4C65A 1JZ2A 3F4VA 1L6YA 3AO0A 1Z3NA 4PEEA 3KL3A 1UZ4A 4HZ6A 1RQBA 1G5AA 4ICCX 3TW7A 4ZR8A 3PZUA 4FLRA 3F4DA 4B2DA 3ZYZA 4AZGA 4K3ZA 3PG9A 4WDUA 3AUOA 3SI9A 3WJZA 4H9MA 3P82A 5IBXA 5F2LA 1U2YA 3NQEA 4JTSA 3CYVA 3NEHA 1B3VA 3AS2A 3OW1A 3HFTA 3PG8A 5D2WA 1XV8A 3QQ0A 1DJGA 2OFJA 4IQJA 2BGQA 1XLCA 1OFQA 3MI6A 3OHMB 1OF8A 4FIQA 4CUCA 3S4TA 2ZOXA 1J18A 4IJCA 1OINA 3CC1A 3GKAA 3GVGA 1K6WA 4ORIA 4XX6A 2XVPA 2OODA 2PZ0A 3ARSA 3CTTA 3GFYA 6REQB 3CNYA 4DJDC 4D2JA 4F9JA 2WJZA 1W3KA 3KBJA 4B16A 2X0YA 3E0WA 4ZXOA 3MP5A 4LW7A 1PJ9A 3SCWA 4KGLA 5CEWA 1XBVA 3BGAA 3WQVA 4LAMA 4C1NA 1JIBA 1V02A 3FJ6A 1XUUA 3M6DA 4LBRA 3JU2A 3UFYA 1A0CA 3BGJA 1M6JA 5M1TA 1PCKA 1J9YA 4Z2IA 4GVFA 2AGTA 2NW0A 4ACZB 3VXGA 4AWTA 1F74A 2Z1BA 4LAOA 1SUXA 2D73A 4R9XA 3RM4A 3WD2A 1PDYA 2VGIA 3VTRA 4WKHA 1EBHA 2DUAA 4QSFA 4FZIA 4US5A 3WCZA 3D3FA 2PPGA 3FVDA 1Y7VA 5BXRA 1QK0A 1Y5XA 3CT7A 3L23A 5AFDA 4C6CA 3CZLA 1JF6A 3GWQA 4C6EA 3LCFA 3EKZA 1KRMA 4HZMA 3WQOA 2VFEA 2EJAA 2G3FA 3TOYA 1TTJA 3AYVA 2PMQA 3PAOA 3PUGA 1ZJBA 4KWUA 1JG9A 1PKNA 1OHLA 3LB0A 1CENA 1AL8A 1KM3A 2WPBA 4GYKA 5CSSA 1GZJA 3P2VA 3BLKA 2I5IA 1ITUA 3O15A 1ODZA 3PTMA 3V16A 1RAKA 1O5QA 4D1JA 4AWSA 3E38A 4LT9A 4JTAA 4JYDA 4CQCA 3T09A 2OT1A 4BWLA 1Y5WA 3LEPA 2OCZA 4Q8MA 1I60A 3G1HA 1CYGA 4WUIA 4A22A 1YE4A 1UP0A 4ECLA 4INFA 1LQAA 3B03A 1P48A 2QDHA 1W6TA 1RV8A 4ZXLA 1PUDA 5DFAA 3OP2A 5E5CA 1KRCC 1GQIA 5CG0A 4N02A 3WD1A 2ABAA 4NI3A 3N19B 3EGJA 1KRAC 1FCVA 4PUMA 3W7MA 1LYXA 2E68A 3GU1A 4KIEA 3WDPP 4H8UA 3EKLA 3OTRA 4WY0F 3UNDA 1SR0A 5E93A 5FSEC 2OG9A 4YCOA 1V3JA 2YIHA 4UQEA 1X1ZA 4PMUA 4XVDA 2YOCA 3GK0A 4EAMA 3HPXA 1L9WA 3F4CA 4O8AA 1J0KA 1XHGA 3ARYA 4KKXA 2QNEA 3B8IA 4C6BA 1YBQB 4IUOA 1R87A 2VOTA 3SGZA 2CLEA 4O0ZA 4A8IA 2YCLA 1RXOB 1GQLA 2PBOA 4XD4A 3AIWA 1V3KA 5AYXA 5KSWA 4K36A 3R0DA 1A3XA 1R47A 2XGIA 1X8FA 3AXHA 5F4XA 4PUEA 4RK8A 2YFNA 2P50A 4Z08A 4DUVA 1YLVA 1WDSA 1OT1A 3G1YA 2ZZ2A 5C9RA 3FJ4A 4GWEA 3FV9A 3T0DA 2GGIA 1VBHA 2F2HA 4LUTA 2BHUA 2VD9A 1ML1A 2XZ9A 1BPLB 1D8CA 1XLEA 1XFCA 3GX9A 1HL2A 2VC7A 2INEA 3H7VA 2GWNA 1TCMA 4TOQA 4YVVA 2P53A 4Y7EA 5BU9A 3TNOA 4QR6A 1GJWA 4PR4A 4XTIA 1GNXA 1QHPA 3WENA 5LA2A 2XFYA 3WJYA 4HNNA 2CXEA 3W7HA 1MDRA 5IOBA 5EL1A 4XSLA 2QV4A 1IIHA 1P0NA 4GI6A 4ZQNA 4R7JA 5HWMA 1S46A 2QJGA 1OGSA 3W02A 3GKFA 3M0ZA 3BV7A 3FHQA 3RIKA 1UKTA 3DG6A 4I5RA 5KINA 1GYNA 3CWOX 3A6OA 1HTIA 1NFGA 2I14A 4PMRA 2ALRA 4MDPA 4QJ4B 3DCPA 3TSMA 4QJ1A 4M6QA 5F7UA 2NSOA 2ANUA 2F2KA 3NURA 4HZ7A 4DNHA 2RGMA 2WCAA 3KRUA 2BVWA 4UZSA 5LA0A 2XVLA 3S9ZA 2ZX9A 4DBUA 4DO7A 5A6AA 3TQVA 4L65A 5D33A 4AD3A 3EOEA 3VGDA 5TF0A 2C0AA 2VEGA 3CO8A 2C91A 2Y1HA 5I23A 3N9RA 3WUGA 1C93A 3UD6A 1HO4A 2PGWA 3LRLA 3CT2A 4HU8A 1I6NA 3EOOA 4RUBA 2D22A 4P2VA 3RCMA 1V6VA 3R94A 5C6MA 1BVWA 1W9DM 1QASA 1EC7A 4AZCB 3TC3A 1TPDA 2PF0A 1HJWA 3NG3A 2E1DA 3NOEA 1QI2A 2BLEA 2PLKA 3CEUA 1YKWA 1A5KC 6CGTA 1TELA 4OKDA 1UR0A 2JKEA 1ZBVA 3P5ZA 1ECQA 5M17A 2PU0A 1GGOA 4K7VA 1VJZA 4UIOA 3LNMA 5FL1A 2CBVA 3GXNA 5SWUA 3WMBA 3AMLA 4QNEA 2J27A 4NZ3A 4YN5A 2ZZ3A 2DW7A 3W2JA 3FYOA 3RCNA 4BZYA 3GDBA 3KOXA 2R91A 5H6HA 3DI0A 5KZ6A 1J6OA 2FYMA 4H4IA 1VFSA 2AAMA 1PO9A