3QPYA

Crystal structure of a mutant (k57a) of 3-deoxy-d-manno-octulosonate 8-phosphate synthase (kdo8ps) from neisseria meningitidis
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
276
structure length
250
Chain Sequence
MDIKINDITLGNNSPFVLFGGINVLESLDSTLQTCAHYVEVTRKLGIPYIFKASFDAANRSSIHSYRGVGLEEGLKIFEKVKAEFGIPVITDVHEPHQCQPVAEVCDVIQLPAFLARQTDLVVAMAKTGNVVNIKKPQFLSPSQMKNIVEKFHEAGNGKLILCERGSSFGYDNLVVDMLGFGVMKQTCGNLPVIFDVTHSLQGRRAQALDLALAGMATRLAGLFLESLHLLEDFLIRIKALDDLIKSQPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Targeting the role of a key conserved motif for substrate selection and catalysis by 3-deoxy-D-manno-octulosonate 8-phosphate synthase
pubmed doi rcsb
source organism Neisseria meningitidis
molecule tags Transferase
molecule keywords 2-dehydro-3-deoxyphosphooctonate aldolase
total genus 75
structure length 250
sequence length 276
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.55: 3-deoxy-8-phosphooctulonate synthase.
pdb deposition date 2011-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00793 DAHP_synth_1 DAHP synthetase I family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3qpyA00
1SQ7A 2H3DA 3MI6A 1W31A 2QAPA 4IJBA 2BTMA 1I2RA 1H60A 1C29A 3N2MA 2RDWA 4UNLA 2Q3OA 5L6UA 3LGEA 3P8IA 5FESA 2NXIA 5KINA 3EKZA 4ZQCA 3Q2DA 3TJLA 2GVLA 3LHYA 3GVGA 3R13A 3LERA 1OYAA 3W2UA 4UR7A 1GYNA 1K8XA 4ZMGA 3ZFHA 3A5VA 3G0XA 4UNKA 2ZZ7A 2FLIA 3W7HA 3LB0A 3G22A 2R91A 3EX4A 3MP3A 4DEFA 4O4WA 2A7NA 4XBKA 3W71A 2Z6IA 1NEYA 1VYSX 4N4QA 1K03A 1FY6A 4KFPA 1R46A 1ICQA 4ADSA 3PR2A 1WXJA 4WY0B 2OJPA 1DJQA 2J24A 3C56A 2EAWA 1H7WA 1QPNA 4FNUA 4TMBA 3C52A 4MFDA 1MEHA 3M43A 4TR9A 5CPOA 3TU9A 1KTNA 4LVAA 5SWUA 3W3OA 2ZRYA 4BI5A 3UD6A 3ATYA 1D3HA 2CLFA 2JK2A 3S1UA 4DO6A 3W7MA 2ZTJA 3T40A 4K8HA 1PE1A 4UMAA 3I68A 4O0ZA 2E09A 4GNJA 3E02A 1YDOA 5D02A 1SUXA 3TQKA 2Y61A 3SY5A 1RPXA 1RR2A 3P60A 1TPB1 2FPTA 4GJ1A 1VLIA 2YDAA 4IWWA 1XM3A 3W9ZA 5E1QA 3DFNA 5LNWA 4OHQA 7TIMA 3R12A 1VJIA 4A2SA 1XUZA 1FDYA 1KM0A 3W75A 3STFA 1GVRA 3PUDA 3UNDA 1G7VA 1H62A 1FXQA 1Q3NA 2EGZA 1Z42A 3CLMA 1X1ZA 2YYTA 3E49A 4ICNA 3QW4B 3QSTA 2B4GA 4RCXA 3W6YA 2YZRA 3NPVA 3PBWA 1GVQA 1S5WA 2WO5A 3M1ZA 4PC8A 2FDSA 1TPWA 2C6QA 4NXSA 5IM51 5EKYA 4FHAA 4E38A 1Z44A 4MZ1A 1W5MA 5D32A 3FKKA 2V81A 1I45A 1TQXA 3NVTA 1LP6A 1YTKA 4R34A 1OF8A 2FIQA 2ZA3A 4MY8A 2B0MA 1HG3A 3PSWA 4UTJA 5D2XA 4HPXA 5DCBA 1IIGA 3O6YX 1D9EA 1GJPA 1UUOA 1VC4A 4OBTA 4O1DA 3HGSA 4FO4A 1GZGA 2D73A 4CCDA 2YW4A 3KVKA 4GRSA 5HWJA 4O1CA 2JKEA 3F03K 3IIPA 1LZOA 4GUJA 2DORA 3UWVA 3SZ8A 4JX5A 3TSDA 3U2OA 3W83A 1ME8A 3QMRA 2V5BA 3W7DA 3W1AA 2JKPA 3LM7A 4D2JA 2ZRUA 5CZ0A 3O8AA 5TIMA 2C14A 3NG3A 3W7IA 4UTKA 2Y7DA 3NQMA 1M7OA 2RH9A 2ZRXA 4RK8A 5HJLA 2NUXA 3D0CA 1CX9A 3TV8A 4N9DA 2ISWA 4WX2A 1KM5A 1W3TA 4UUIA 2A21A 2YPIA 2TSYA 4JY8A 4O19A 3P67A 4DPQA 2HS8A 3SR7A 2V8ZA 2DJXA 1LM1A 2QDHA 5G2HA 1GWJA 3MYOA 4YLWA 3M5YA 1FWNA 2YSWA 4AWTA 1CI1A 3GXPA 1QFEA 1H1ZA 4BWLC 2X1SA 3S1XA 1I2PA 4GXMA 2E6FA 1XBXA 3KVJA 4K36A 4MY9A 4LC6A 5KTLA 3BG3A 1G67A 3NYZA 1LLWA 4O50A 5DXXA 3W23A 3W7QA 2PRLA 3GZ3A 4LU0A 3DGRA 4RKAA 2YR1A 3B05A 4BR1A 3G1YA 4AB4A 4LVBA 3PUOA 4FX7A 1SW7A 1QCWA 2H90A 3PG9A 4N6EA 4Z1AA 2QJGA 2IQTA 1GVOA 4WZHA 1W1ZA 3M47A 3IIVA 2ATMA 1OX4B 4NNCA 3CM4A 1TPVA 1GG0A 1EIXA 1EP2A 3CEUA 4Z08A 3NPUA 4UMCA 4UFIA 2ZA2A 3HIJA 4IXXA 1TRDA 3EWBX 4HNNA 1WDWA 1VH7A 2WNNA 5F2IA 1YLVA 5CZSA 2HS6A 1F74A 4O15A 3TDFA 1Z48A 2OCZA 2J9YA 2BSLA 1JCXA 1RVGA 1KM2A 5BMWA 3QSRA 1DBTA 2RDUA 4PH6A 5KZDA 1KFJA 1IXQA 3VCRA 1M6JA 4HHPA 1TJRA 4YCPA 1O94A 4FNRA 4XZ9A 4P2VA 1UJPA 4CLMA 5D09A 3TSMA 3W1UA 1YYAA 3HGOA 5AYXA 2JKAA 4KKXA 1W8SA 2ZZ3A 4DPPA 2FPYA 1I2NA 3L21A 4N4PA 4PODA 4HSNA 3GNDA 2ZZ6A 4MYAA 4Y96A 4UTWA 1I4NA 5LZLA 2J9XA 1DQXA 3DFSA 3BLFA 2CLMA 4JN6A 3QPZA 1OFDA 1NF7A 1X1OA 5I3KA 1OJXA 1ONRA 4JR5A 3TC6A 2R14A 4JYFA 2C19A 3NPWA 1JCLA 4IX2A 1W0MA 1BKSA 4FIRA 1TB3A 3SJ3A 4O57A 5AN7A 3A21A 1G4TA 5F2LA 4ZQPA 2V2HA 3QMSA 2V2CA 1UASA 4ZQRA 3STCA 3W7EA 4EF8A 2PCQA 2JBMA 2VENA 1Q45A 3M5ZA 4LRSA 1XCFA 1PHWA 3RMJA 4GFSA 3WK2A 3G1AA 4OQVA 5T26A 1UBSA 5J5DA 3M0ZA 3HOJA 1F7BA 4JYEA 3EXSA 3RFAA 1H7NA 4Y90A 2J9ZA 3DI1A 3GDLA 4MLRA 1AL8A 2NWRA 1QNVA 1BWKA 2WSQA 4MJMA 5BMXA 1VR6A 4AF0B 1FWTA 1L6YA 2RHGA 2WSRA 4DO5A 2VFHA 4FNSA 2JGQA 3PY2A 3W7KA 2Y85A 3BK0A 3S42A 4EOUA 1TPUA 1AW5A 5D2WA 1RV8A 3TH6A 3GDKA 4A3UA 3BGGA 4L4MA 4QISA 3TR2A 3EB2A 3W1RA 1VZWA 1LLZA 6ALDA 4K7YA 3E9AA 3BO9A 3ANYA 3G1XA 3GLCA 4JTHA 2OMAA 4NZFA 1SO4A 3T4CA 4GUFA 3N9RA 1OYCA 3DAQA 4FEZA 4XTDA 5F4XA 2E6DA 3L68A 5H91A 1H61A 4FX6M 4NJGA 3T44A 4DF0A 3P8JA 1E51A 3SIZA 1SW0A 4KFOA 3TJXA 5BRBA 2WSYA 1AW2A 4AWUA 1SZGA 4ORMA 3TSBA 2YGYA 2V82A 4WOZA 3MI3A 3UPWA 4N02A 5KZEA 2ZRWA 1DJNA 2DZUA 1W5QA 2B7QA 1GVFA 3GXNA 4UCGA 4WXYA 1R47A 3Q58A 1ME7A 1GOXA 3P5ZA 1F73A 3GR7A 1R2TA 4QNWA 3L0NA 3O07A 3BVJA 1UB3A 1MZHA 3KHJA 5LSMA 4PFMA 3PG8A 4A29A 4W9TA 1LROA 2UV8G 3IV3A 5G2IA 2A6LA 3M5VA 3C2FA 1TV5A 1VCGA 2ABAA 5TBOA 1VHCA 3S5ZA 3LCGA 1WX0A 4X3ZA 5AHEA 1GQNA 4GBUA 5G4EA 3I6RA 1G4PA 5LGZA 3VFLA 4UFKA 4IMGA 1P0KA 1YXDA 5CKSA 4WXZA 1GEQA 4DF1A 3VI2A 5EBUA 2X1RA 3IRDA 1VYPX 3LRLA 2O7QA 3GXTA 2BX7A 4DBDA 3QFEA 3W1LA 2NUYA 1J4EA 3UXDA 3NPXA 1EA0A 2QUUA 4J9JA 3HG2A 2QKFA 4JX6A 3CQ0A 3MJYA 3W7GA 1ZJIA 4MYXA 2TMDA 2WNZA 1SU5A 4IMFA 4WJEA 4PL1A 4DELA 3LRMA 1S3HA 3W70A 2XN0A 3CWNA 1TTIA 3O06A 4GUGA 5FF4A 1TIMA 1OK6A 3G24A 4JX4A 2A6NA 3WFAA 1DKWA 1WOAA 2Z0IA 1ZHAA 1WV2A 3F1QA 5BNKA 2C3ZA 3HGRA 2ISSA 2DZXA 4O4VA 3G0UA 4E0CA 3LXAA 3O05A 4LS0A 4O1AA 4M6QA 1TSIA 3WJYA 3EWZA 3LCWA 4ZQOA 2DZWA 4N9EA 2QCMA 3MBFA 4K38A 2I14A 3NXFA 2Q8ZA 3NQGA 5FEZA 3WK0A 1SO3A 1FX6A 1YDNA 1O5KA 4AWSA 4L4LA 1LRTA 2HTMA 1KV5A 3KVLA 3DU0A 4UMBA 4XWUA 4ADTA 4UFHA 4TX9A 4R7JA 5CPLA 2H3BA 3L0KA 5FF3A 5HWMA 4IOTA 1H7PA 4EIVA 4GUIA 1IXPA 2A2IA 3QF0A 3DFQA 2RFGA 4P61A 4JDBA 3UWZA 2GOUA 1PCKA 3PBYA 2YXGA 1LOQA 3A9IA 4JS3A 4AHQA 4AHPA 1VPXA 2F7FA 4NZJA 3GKFA 2PURA 4I7VA 1EWEA 5K9XA 1AW1A 5HWNA 1P4CA 3W7LA 4XKYA 4QQ3A 5HINA 3O15A 1LBFA 5F4SA 1XUUA 1HL2A 2NZLA 3LLDA 1V7YA 1PHQA 2RDTA 2QUTA 3N3MA 3S1WA 2TYSA 3W2LA 1N7KA 3OEXA 4IQLA 5CPNA 5KSWA 2ZZ4A 4U28A 3L5LA 3G18A 3IIXA 2WKJA 1J5TA 4JNMA 5FF7A 2A7RA 3B0UX 1XI3A 1NVMA 3QQ0A 3N19B 2WPBA 4LOCA 3LRKA 4N9CA 1HUVA 4PTNA 1XL9A 4RZ4A 1OYBA 1SZEA 1T99A 4RV8A 1SSGA 2W6RA 5FEPA 2E6YA 3RNDA 1K02A 3OVQA 3CWOX 5AYZA 2QCEA 2V30A 1GTEA 4LV4A 2G5WA 3W72A 4E2BA 1H63A 3TQ0A 5C2XA 3EX3A 2NXGA 4O18A 3DBPA 5H2ZA 3NDOA 2F84A 1KLYA 2AGKA 3C3NA 4UFMA 1KBIA 3Q94A 3STEA 1R2RA 5D33A 2Y7FA 5FI8A 3K30A 2E5BA 2H8ZA 3MWAA 1A5BA 2E6AA 4Q33A 5DELA 5C5YA 5HMSA 4XUGA 4CNNA 4JDYA 4E2DA 3PAJA 2CZDA 3C8FA 3P84A 5G1TA 3ZS4A 4HT3A 3QEZA 3T78A 4I7WA 2C13A 1H7RA 4OV4A 2CLOA 4CCEA 4O52A 5BOOA 3S9YA 2QAFA 2YYUA 2NWSA 2OX1A 5FF2A 4MPQA 3BG5A 2E77A 3GDMA 3TMQA 1B3OA 3HG4A 4C1LA 2V0TA 1IIHA 3L5MA 3N34A 4BWLA 3W07A 3BW3A 1U83A 5CSRA 2VXNA 4RX0A 3JRKA 4ZL1A 2ZRVA 5C54A 1JCMP 1TV8A 2Y63A 1V5XA 1A5CA 4Z1BA 4IMDA 1JVNA 3HPXA 4EF9A 3CEPA 5I3FA 4IMCA 3N73A 5AHIA 1F05A 1JULA 4ALDA 1AK5A 1KV8A 1FCBA 3EWYA 3BLIA 3M16A 3R5EA 2DU2A 1BTMA 1OF6A 3P81A 3FFSA 3W88A 4YWIA 5HUPA 5FEWA 2ABBA 3P74A 1A5AA 3QQ1A 3UPBA 1NFBA 1KM3A 4UTIA 2P1FA 5D2TA 2VELA 1RD5A 1ZY9A 3IVUA 3TW6A 4O1BA 2J27A 3C6CA 1YPIA 3O16A 5CZTA 1FDJA 3H55A 4K39A 1P1XA 2CZFA 4Y8FA 3LBMA 1DOSA 1P0NA 5U4NA 4MUZA 3B06A 3CHVA 1LTDA 8TIMA 3F4WA 4HNTA 4HPJA 3ZWTA 1JQXA 1KW1A 2P0OA 1R30A 1XC4A 2DJLA 4NNAA 3TXVA 1PCWA 4MY1A 3QW3A 1IF2A 3LTPA 3RU6A 4CQ8A 2E1DA 1S5VA 5EPDA 3CU2A 4NVTA 1AL7A 2CLEA 3KVMA 1F2JA 3B04A 3W2JA 2ZCGA 1H1YA 3WK3A 1VCFA 5I3GA 3A5FA 2DZTA 2VEMA 4WQ6A 1F5ZA 5DCEA 5DXYA 2CFFA 1UCWA 3HF3A 2A7PA 3W1MA 3S1VA 3E12A 3QMTA 3W1QA 3M41A 1EUNA 4UTLA 1OABA 3ZR4A 3B0PA 4UTWC 5LHEA 3UWWA 3NO5A 1WOBA 1MO0A 3GAYA 2YW3A 5KMYA 3QYQA 3QRHA 4O13A 4JTTA 5F2MA 3HMJG 1K8ZA 1JCYA 3UY7A 1TYGA 3THAA 2B7PA 1MSSA 4XBSA 5K4XA 1TPEA 3BGJA 4A22A 2CLLA 3W1PA 3P61A 3W1XA 3INPA 2VEPA 3THQA 4UTTC 2QR6A 3DZ1A 4UIOA 2VFIA 3UYCA 2WQPA 3ABRA 3W22A 3GKAA 5D38A 2V5LA 1JUBA 4RXFA 2P10A 4RLIA 4ZQNA 2EHHA 4BK9A 2ZDRA 1EPXA 3G0SA 4OE7A 4TMCA 1QPQA 5K4ZA 4R33A 1Q6QA 3NQFA 5FEXA 2GJLA 2CZ5A 4UR8A 2ZA1A 5DCDA 3NL2A 3QC3A 1YPFA 4IPIA 1TJPA 2G97A 4O11A 3TQVA 4GUHA 2J88A 3WK1A 3GR8A 2CLIA 3FYPA 1XFBA 1G6CA 3P7YA 3P5YA 1T0OA 4O16A 4AH7A 4XQ6A 1TV7A 1KBJA 3TXZA 3DH7A 1EWDA 4UFJA 2PC4A 4CCCA 4H6KA 1B4EA 1W3NA 1XKYA 3NGJA 3IEBA 4LS1A 3W7JA 5D05A 4DF2A 3MYPA 5AHNA 3NR0A 1T96A 3UY8A 3HGJA 5DY3A 3EX1A 4NQ1A 1KLZA 4Y6GA 3TK7A 2G96A 1OX6A 2TPSA 3PS7A 2PRHA 3L9CA 3UZ5A 1J2WA 4NX5A 2NX1A 3L65A 4EWND 4POCA 4WOQA 3EEGA 1Q6RA 2ALDA 1SPQA 3CB8A 4OU1A 3S5YA 4R53A 3NL3A 5F4WA 3LHTA 1FCVA 3LXBA 4QAIA 1WQ5A 2GUUA 3O6CA 2OT1A 2Z1BA 4Q32A 2GQAA 1L2UA 4M7SA 5K9DA 1YDVA 5F1VA 3BW2A 4K37A 2H6RA 4IX0A 2VFDA 1M7PA 3W1TA 4UTMA 3LHZA 2FQIA 3T7VA 3CIXA 1K7FA 1WBJA 2ZYFA 3LI0A 4UXDA 3S5NA 1RQHA 3C2VA 4ADUA 4Z1DA 3LCHA 3KX6A 4GE8A 1LBLA 1JR1A 1NF0A 3ABSA 2C18A 3NQ8A 2HMCA 2QJIA 3NA8A 4JICA 3KRUA 5AHFA 4O17A 4MZ8A 1LORA 3W7RA 5CG7A 3N14A 1H50A 3ATZA 4LTSA 5DY2A 1XBVA 1GTHA 5L9FA 1X6UA 4BI7A 1TTJA 3NOEA 3E0IA 4K8EA 2ZQ0A 5D2YA 3SECA 3FOKA 5D30A 3PC0A 3HBLA 4UFLA 4FNTA 1PIIA 3IVTA 4NUWA 5A8GA 1OFOA 1WBHA 5F1UA 4MJZA 1LYXA 4LT9A 3BV4A 2ZFAA 1L6SA 2E5DA 4UC5A 2R8WA 1JUKA 3OBKA 4AHOA 4MLJA 3OG3A 5DLCA 3KRZA 5CZJA 3EXRA 4MVAA 3GB6A 3PULA 3FJLA 3GYEA 4PL2A 1L6WA 3NL5A 1WAUA 4KWWA 3MHUA 4HNUA 3GX9A 3HO8A 2B7OA 1EX5A 3USBA 4YMZA 1IXNA 4AXKA 1DQWA 3VE7A 4Y9AA 1VLWA 3M5XA 3FYOA 3LCLA 4N9BA 1I2OA 5FF0A 5AYYA 1TPH1 2QCFA 4O14A 2G95A 4I9AA 1FCUA 2GQ9A 3NNTA 3UWUA 3UXAA 1LBMA 1TTPA 1VRDA 1EP3A 4WD0A 4GWEA 1VHNA 3NAVA 3TC7A 2QEZA 4FXSA 1SW3A 3G3MA 1Q6LA 4IXHA 1TCDA 2EKCA 2CU0A 1VGAA 3NQDA 3MW7A 4G1KA 1IXOA 4O10A 3B4UA 3FA5A 3IVSA 4JIPA 5I3IA 5AOUA 3P62A 3UQNA 1Z41A 2GVGA 4LW7A 3BG9A 1OFPA 3BPWA 4IUOA 4BF9A 2TRSA 3W2KA 1CW2A 5HNRA 4NT0A 3GIYA 5LKYA 3OA3A 3DFTA 4S1FA 2GQ8A 2ZZ5A 2KZHA 3NZRA 3PF3A 3TFCA 2FPVA 3FKRA 4DO4A 1THFD 4K6AA 5E0KA 1N55A 3CT7A 3LX9A 3SSJA 4JTJA 1GT8A 1ADOA 3LV6A 2WJZA 2AQWA 4JTEA 1SZNA 4CQ9A 1OX5A 3W1NA 4FX8A 1KFEA 1QOQA 1KFLA 3BLEA 1ZAIA 2CW6A 2Y88A 3IGUA 3GK0A 5AC6A 2DZPA 3B03A 1FXPA 4LS2A 4NJKA 3E96A 4JY9A 2VKZG 5J5RA 5EL1A 2QCDB 1KM6A 4MKNA 2VFFA 1K7EA 1YTDA 4LRTA 2DP3A 1YXYA 3G8EA 5LNRA 1A53A 2A4AA 2BLEA 3DFPA 5D04C 3IGSA 1KTCA 3TROA 3S0CA 3W2MA 2JGYA 3V75A 2BXVA 3W2NA 2Y7GA 4FXRA 3WJXA 2CLHA 1U5JA 2YCEA 1GPWA 3MI2A 1MEIA 1SFLA 1XDLA 2WNQA 3V1PA 4M19A 4QITA 3G8RA 1W5OA 3NQ7A 2A5HA 3FS2A 1XBYA 3A22A 3MBDA 3IIOA 4S2CA 4EVZA 1JJKA 1F6PA 2I9EA 4DQWA 3M44A 3I7QA 5GVJA 4NU7A 2EF9A 3Q37A 1DHPA 1TRIA 1ICPA 1QPRA 3BW4A 3SGUA 2C0AA 4XTIA 3H53A 5KITA 4LNYA 1QMLA 3I7RA 4NJIA 4CNPA 1H7OA 2ZZ2A 5HR7A 1TREA 5E93A 3HPSA 4O12A 3HJZA 4U4MA 4WY0A 2Z2UA 3EX2A 2EPHA 1LRQA 3O6DA 3CIWA 1F76A 2B7NA 3KXQA 4TIMA 3M9YA 2ISVA 1O60A 1Q6OA 3OIXA 3CC1A 2XFWA 4WUIA 4PA8A 5HULA 3W73A 3EWXA 5U7SA 5IBXA 3PB0A 4JD4A 1ZCOA 4LC8A 1N8FA 2A85A 4AVFA 2C15A 5HUOA 3N2XA 3U8GA 3AJXA 2VEIA 1LRNA 3TA6A 3LLFA 3QM3A 1QWGA 3NQAA 1H51A 4FB7A 4YCOA 1QAPA 3LCIA 3U6WA 1S5TA 5K2ZA 1OFEA 3NQCA 1KFCA 1O4UA 1A5SA 1FCQA 5AC8A 1RQEA 4MFEA 5AHLA 3EWWA 4JTIA 4JTSA 1OFQA 2XN2A 4O8RA 3CTLA 4YXGA 1ML1A 4AF0A 3NEVA 2FTPA 2QCLA 4LV9A 1LOSA 3QH2A 5G2WA 4X22A 4HNVA 1PL9A 4I7UA 3PUEA 4NXKA 3LBCA 1DORA 3DKLA 4H3DA 2YX0A 2CZEA 4HSOA 4BI6A 1JRBA 1TMHA 1TPC1 2VC6A 3VKJA 3TX9A 5I3JA 1ALDA 5LNUA 1H7XA 1FWRA 5DN1A 1OHLA 2NLIA 3HG5A 3YPIA 1HO4A 5EA9A 4KFNA 3PVFA 1BEUA 1ZENA 1JQVA 2E68A 4GC4A 4MZYA 1K3UA 1LDCA 4QSHA 3DI0A 5EY5A 1VQTA 3F4NA 1EEPA 1O5XA 1AG1O 4QIUA 5DBTA 3MUXA 2DZVA 3TAOA 3S5OA 3P80A 3LHVA 3GAKA 4ZZ9A 4A21A 2GJNA 1ZAHA 1FBAA 3NZ1A 4O28A 1FUYA 3IIZA 3G1FA 1KFBA 2NV1A 4M6VA 2O7SA 4N2YA 3NM3A 3O63A 1L9WA 1OVDA 4JGDA 2C1HA 1UUMA 1EUAA 3I7SA 2QCDA 1AMKA 1R2SA 4ZVJA 5I3HA 3LI1A 4HIBA 5AFDA 1QO5A 3TW7A 5EMUA 3OVPA 4QNEA 1B57A 1ZAJA 2W0UA 2Y70A 4XKYB 1P5BA 4PCFA 2QCCA 4LVGA 2C16A 1HO1A 3EWUA 2BZNA 3TIMA 1OG0A 3LHWA 4BFAA 5ABTA 1VYRA 1SO5A 4MOZA 1SR9A 4RZ5A 2V9DA 5MHBA 3FJ6A 2I1OA 2X2GA 1XXXA 4MIMA 3HPZA 4LUJA 3TCEA 1YTEA 1M5WA 2V2DA 3SFKA 3PWAA 4H4IA 3BARA 4LWWA 3LXCA 5C6MA 3R8RA 2X30A 2Q3RA 3RK8A 3LCFA 5IBXC 4O0KA 4DXVA 1W5NA 3TNOA 3NQVA 3L66A 1G4SA 2QCHA 1SFJA 4FNQA 2Q8LA 3R2GA 4YL2A 3NM1A 1O95A 1JRCA 4LVFA 5EYWA 1DVJA 1QDSA 1YXCA 2FFCA 3UWYA 3L5AA 4TO8A 1X8FA 2R94A 3MP4A 4AMAA 1T8XA 1TO3A 3PBUA 2H8XA 3TE9A 3TAKA 5A5WA 4RR4A 3N9SA 4NX0A 3RF9A 1QO2A 5K7JA 3WJSA 1HFBA 1SZFA 1TPDA 4Q4KA 3FIGA 4FNPA 1QR7A 3DHFA 2LLEA 2VEKA 4Z0JA 1W5PA 3LV5A 4KWVA 3TKFA 2BWGA 3PBVA 5CGQA 4UTUA 4ML9A 1SO6A 4M5PA 1TPFA 4K7VA 1W37A 5F2GA 3H54A 3PSVA 3M7WA 2PRMA 1NSJA 1PS9A 1W54A 5LHFA 3DKJA 3VE9A 4OV9A 2Y62A 1KM4A 1ZNNA 2OZ0A 3DHDA 3W85A 3TFXA 3C0JA 3OVRA 4RJEA 4TU1A 1W56A 3UWQA 3QPYA 5D2VA 1PVNA 2FB2A 4IGHA 3A23A 3S8HA 2NUWA 4Z0SA 3GDTA 4CNOA 2CWNA 2J6XA 2QF7A 4OT7A 2RKXA 3HG3A 1I2QA 1VCVA 6TIMA 1DL3A 2NX3A 3HQ1A 4OGZA 1K7XA 1EP1A 2QDGA 1F6KA 3L2IA 5CPMA 2W79A 3PB2A 1G69A 1X7FA 2NV2A 1ZFJA 1MXSA 1PV8A 4UTHA 3FEMA 1WYIA 3W76A 3DXIA 1TQJA 3L0GA 4A2RA 3C2RA 1JCJA 3G1VA 3PM6A 2Y6ZA 4FF7A 5AHMA 3W87A 3KFTA 4OWGA 5TQLA 1ME9A 4O54A 5C55A 1VS1A 3T55A 1DV7A 3B0VC 1FWWA 4JIQA 1B4KA 1KM1A 1KFKA 4QM1A 1Y0EA 3WJWA 3TUUA 3SGZA 3OHIA 3JS3A 1OFRA 1FWSA 4JTFA 4CQAA 5K9CA 2ZBTA 3AO0A 3W7OA 2GPTA 5BW6A 4ONVA 2HSAA 5D03A 3DENA 5HQEA 3W7PA 3S6DA 3NL6A 1SSDA 1A50A 4NJHA 2Z6JA 3KAOA 3LTYA 1GG1A 3HB9A 1FDZA 2FJKA 2WOQA 4RXGA 3WJZA 5G4WA 1EB3A 4IMEA 1G7UA 3EX6A 3NQ6A 5CSSA 4FIQA 3NQEA 1I8JA 1TTQA 2YFOA 4JTKA 4QJ1A 4AEOA 1GVSA 1OFBA 3SI9A 2YFNA 1JUEA 1RZMA 2E5CA 3LHUA 4N6FA 5G5IA 2VFEA 1MEWA 4JEQA 4ORIA 1XBZA 4RZ6A 5KZMA 5AB3A 3W84A 4NNBA 4X9SA 4WY0F 3O1NA 1B9BA 1OX4A 1OK4A 4JXCA 2OT0A 4X2RA 2VOMA 3M6YA 1NAL1 1C8VA 3UZJA 3W7NA 1LCOA 2QCGA 1IGSA 3STGA 2WV8A 1XDMA 3QJAA 5D37A 2Y89A 3EXTA 3MP5A 3W86A 1QPOA 3RLUA 4JTGA 4NJJA 2QJHA 1G4EA 2ZTKA 3G1HA 4O53A 5LGXA 3B8DA 5DBUA 4JTLA 4DBEA 4HKPA 3GDRA 2XN1A 3QZEA 3W74A 1ICSA 3ZWSA 2NXHA 2FB3A 4HN4A 4C1KA 2DZSA 3TMLA 1QOPA 2ATSA 3W7CA 1FQ0A 3DFOA 4LUIA 5LNVA 2QCNA 2GVJA 2A1YA 2QUVA 3C2OA 3R89A 4AAJA 3MHFA 4JYDA 4M7TA 3SW6A 1C9DA 5G1YA 4LVDA 4LY8A 3EKLA 1W3IA 3ABOA 3I65A 1GYLA 4UTTA 1LOLA 1ZALA 4M6PA 3P82A 4Z1CA 3VNDA 3CPRA 1K8YA 1KA9F 1WA3A 3IGXA 3NQ2A 3C61A 3MHGA 1KTBA 2ZRZA 5LNSA 1JCNA 2X16A 3G1DA 4ZQMA 3C4UA 3RLVA 1BWLA 1OFAA 2CLKA 5K3VA 1YADA 2AAMA 3LDVA 3A24A 3ABQA 2A0NA 3MMTA 3G3DA 4IPJA 2X1UA 3JR2A 3ELFA 3G1SA 5HR6A 1H5YA 2VFGA 3GNNA 2ZZ1A 4PEKA 4JTUA 1RQBA 3LTSA 3L67A 1HTIA 2X1TA 4B5NA 4S2BA 3MO7A 5AC7A 3C2EA 3FLUA 3LCXA 2NX9A 3LOTA 3KRSA 2Y7EA 2PE4A 3KOFA 1D3GA
chains in the Genus database with same CATH superfamily
4P7RA 1W31A 3I3BA 4CGTA 4GK8A 1I2RA 1H60A 4A4AA 1C29A 5I03A 3N2MA 2MUCA 2RDWA 3ARWA 4IPLA 5FESA 3XIMA 4ZQCA 2GVLA 3AYVA 1RBAA 1RAKA 4NF7A 4LCRA 5MKGA 4XV0A 2ZUTA 2V3DA 5FIPA 4PMRA 3FYYA 5E6YA 3LB0A 1K8CA 4BZYA 2R91A 3PPFA 4AIUA 3IS4A 3IANA 3W71A 1PSCA 2E9BA 4AYSA 2Q71A 4N4QA 4L65A 1ICQA 4ADSA 4D9PA 5M3WA 3O7UA 3WDPP 1H7WA 1XFCA 3BMVA 3C52A 1RA0A 4MFDA 3MCMA 3VUPA 3GG7A 5CPOA 4BI5A 3ATYA 3T40A 4K8HA 1J0JA 3MKVA 4OOUA 4UMAA 4O0ZA 3RMEA 1RH9A 3KBNA 1SUXA 1PXGA 2NLYA 2Y61A 3TQKA 1ISYA 3CAQA 3KOWA 3NZPA 1TPB1 2FPTA 1WZKA 1PAMA 2YDAA 4IWWA 4XD4A 4HOXA 5BWAA 2PLMA 1XM3A 3W9ZA 5E1QA 2ZVIA 3N29A 5LNWA 4F66A 1GCYA 4AFYA 1RUSA 2R1LA 5BCAA 3K1GA 1XD0A 2VUYA 1XQLA 3TTQA 1FOBA 3WQWA 4AUBA 3LZ5A 4GYFA 2D2OA 4UQBA 2YZRA 2CKRA 3PBWA 3M1ZA 1ITCA 1WKDA 2QGYA 4AZ5A 2GK1A 4LUYA 1Z44A 4P7LA 4AEFA 1R3YA 1I45A 2BVYA 1BQGA 2ZC1A 4TUFA 2F61A 1YTKA 1E6QM 1T5AA 3MZNA 1E6XM 2FIQA 2X09A 3M0JA 4UTJA 4HPXA 3O6YX 2OLHA 4QDPA 1UUOA 5AVHA 3TTYA 4O1DA 4CVUA 3GVRA 3E0WA 4MSSA 3WQFA 4C7GA 4DZAA 1V02A 3QVQA 2GJXA 3Q65A 4ZSTA 3A3WA 2OEMA 3N6JA 3WNOA 4H9YA 4PYSA 5EB8A 6TAAA 3SZ8A 3GTNA 1OCQA 2V5BA 3U9IA 1FKWA 4AZIA 1ZZMA 2BVTA 3QQWA 2C14A 2G3MA 3W7IA 1HKIA 3BICA 5ECVA 4RK8A 1UR2A 2XU2A 2NUXA 1TVLA 2QJMA 1V6UA 3D0CA 3AS2A 4D71A 3W26A 3N4AA 3N4FA 5B80A 2TSYA 4JY8A 4DNMA 1XCWA 4C6EA 2V8ZA 2Q01A 2XIOA 3REQA 3WG6A 3VZYA 4CQCA 4RV3A 3TYDA 4YHGA 3W81A 1BQCA 2QQ6A 4IIBA 2IKJA 5C2CA 3GXPA 4IP5A 3OPSA 1GW9A 3URBA 2ZC8A 4LB3A 4GXMA 3S1XA 3SCQA 4LYKA 5BXSA 3KVJA 4K36A 4MNMA 4J3ZA 1KR1A 1G67A 1GOOA 4ZODA 4JTDA 5DXXA 3W23A 4DJED 5JIWA 5EMJA 2Q09A 2XWDA 3LLXA 2P88A 1CGTA 4BR1A 1QOXA 4AB4A 4FX7A 1VJZA 1MUCA 2H90A 4IM4A 4N6EA 4Z1AA 3N04A 3UG3A 4W7UA 3IIVA 1VIZA 1TPVA 4BEQA 4HPGA 3IJ9A 3OODA 1XIIA 3NPUA 4GO9A 3EWBX 4HNNA 2WNNA 1BSIA 4HPNA 4O15A 4Q4QA 3T42A 3TDFA 4LBSA 2OCZA 3BMXA 1CLXA 1XYFA 2WMFA 5REQB 4WRHA 1UWUA 1VFFA 2VEGA 4PH6A 3VCRA 2EO7A 1TJRA 4U3AA 4IIEA 4FNRA 3W1UA 1YYAA 2J25A 2FHFA 4JTRA 4GMEA 3UWEA 2ZZ3A 1I2NA 1PX8A 2QDDA 1E9IA 3GE7A 4MYAA 3PZMA 4LAKA 4HK7A 4QJ3B 1I4NA 1S1PA 1E0TA 1ZRQA 2I57A 5LZLA 3BLFA 2EQDA 1TMQA 1X1OA 1V8EA 4AC1X 3UXKA 1BRLA 2HWGA 2WZEA 4URIA 3TN4A 4JYFA 1WUEA 3S4TA 1UKTA 4IX2A 1S2AA 4FIRA 3DX5A 4YN5A 3SJ3A 4O57A 3MQTA 4E3VA 1SJDA 3IJ8A 1JZ6A 2YDQA 2VJXA 5I0DA 1UASA 4ZQRA 2PCQA 3WD0A 2VENA 3VDAA 2OVLA 2G3NA 1HIZA 3TOPA 4ZGYA 2IW0A 1GQKA 3WK2A 2Q02A 5T26A 3W25A 3FVMA 3HOJA 3EXSA 3RFAA 4Y90A 3LBOA 3GDLA 4G56A 2V69A 1A5OC 1BWKA 1QTWA 1XH2A 2WSQA 5BMXA 4QS6A 5BRQA 1OT1A 1UKSA 4AF0B 1UD6A 2E3ZA 2QZRA 2VGGA 1J96A 3L2MA 4FNSA 3PANA 1CEOA 2JGQA 2UZ9A 3BK0A 5ABGA 3QV9A 2Z1VA 1AW5A 3SAZA 3TH6A 3RM4A 3UCDA 2VCCA 1VZWA 4AW7A 1LLZA 4FA3A 1DE6A 2UY3A 2J74A 1HJSA 4K7YA 3O6AA 2QVHA 1JZ7A 2E1WA 4NZFA 4V1XA 3T4CA 4GUFA 4ZENA 3VNKA 3O9NA 4JFVA 4HP5A 4FEZA 2HK0A 3VXGA 1DJXA 1WDRA 2XVNA 3T44A 4DF0A 4JTCA 3AUJA 3BZJA 3SIZA 1RK6A 1BKHA 2ODOA 1UP0A 4JFUA 4KFOA 1N2VA 4XAFA 1SZGA 1Q5MA 3TSBA 1NQ6A 1MQRA 3SRDA 5KZEA 3VGGA 4HCHA 4KCVA 1HKJA 1SJCA 4KWSA 1CGYA 2DZUA 3HQNA 4DO7A 2D2JA 4QE1A 3BAIA 1GVFA 2DSWA 4C7DA 3UZZA 7A3HA 2VRQA 3VDHA 4XIAA 4YHEA 1R2TA 3GHUA 3L0NA 1MZHA 5E5CA 5LSMA 1TWZA 4K1WA 4IIDA 2X7VA 4KWOA 3NIYA 4GZJA 3VIKA 4Z2LA 1UR3M 1LROA 5H6HA 1EBHA 2OSXA 3C2FA 5TBOA 1VHCA 3S5ZA 3LCGA 3OTRA 2BMBA 4M24A 1GQNA 1R85A 5G4EA 3I6RA 3QKEA 4X3ZA 1GKQA 1G4PA 4UFKA 5B7ZA 4IMGA 1A5KC 3GO2A 4XZWA 1P0KA 3WF0A 5CKSA 3K4AA 3LSBA 4WXZA 3F5JA 1C90A 4PGLA 4D6JA 1RBLA 4YVPA 5EBUA 2X1RA 2OWWA 3LRLA 1KNWA 4IIHA 2DIEA 2GGHA 4DBDA 2C1IA 1X38A 3UXDA 2PDBA 1IZKA 2QUUA 3KOXA 2PDJA 3HG2A 2WC7A 3CQ0A 3W7GA 5JXQA 4FR6A 8XIAA 1SU5A 3R58A 4H9TA 4WJEA 2PI6A 3TWBA 3AMDA 1S3HA 4NASA 1OEPA 3O06A 4GUGA 1UC4A 3FY1A 2A6NA 1NIUA 3TC3A 1E3ZA 1DKWA 1ZHAA 1WV2A 5BNKA 1EXBA 3HGRA 2GSEA 1Y65A 2ISSA 2OGYA 3G0UA 3QY6A 4XO7A 4E0CA 3ITTA 4NKCA 3O05A 4LS0A 4O1AA 1IEQA 4Y9NA 3WQ5A 4PB5A 4NL1A 4K38A 4UZUA 3NQGA 1SO3A 1LT8A 1EF3A 1QW8A 1VPYA 2DIKA 1F9CA 1LRTA 2HTMA 3GWQA 3KVLA 2EJ1A 4WGHA 4UMBA 2QIWA 1JF6A 2V67A 3UZYA 5CPLA 2PP0A 3R94A 4F0KA 1LJYA 3PTQA 2EKGA 3SCSA 3LU2A 5FF3A 3GFYA 2CEQA 1OCNA 3VNZA 4ZO6A 3QF0A 4LEQA 2P3ZA 3UWZA 2ZE3A 2YXGA 3VUSA 2GVYA 2G3JA 2E67A 2DEPA 2ANUA 2QULA 4AHPA 5XIAA 4NZJA 4I7VA 1EWEA 4UOJA 5K9XA 3FA4A 3WO8A 4BKNA 4IF2A 1P4CA 2R82A 2FGZA 3GH7A 5D9OA 1ECQA 1Q7MA 3W7LA 5A3HA 5F4SA 1XUUA 1ZBVA 3SCVA 4HPHA 1PHQA 3WQDA 1PDYA 1V0NA 1HL8A 1N7KA 3OEXA 4JNZA 1TZ7A 3G18A 3IIXA 2WKJA 3UERA 4OIFA 1DJWA 4I90A 5BOFA 4R7OA 1A4MA 1US2A 4LOCA 2D23A 3LRKA 1W2VA 1XLFA 1HUVA 3AICA 4AIOA 2VC7A 2EG6A 1SSGA 5FEPA 4HA0A 3OVQA 3RU8X 4LNCA 1GTEA 2GGEA 3SO7A 2HVNA 4JQ3A 4PE8A 4GQQA 5H2ZA 3GS6A 1OCBA 4NSBA 1KLYA 2AGKA 2V5KA 4L56A 2E4TA 5D33A 5FI8A 4G5DA 4QLLA 1JDFA 4E4PA 4J5NA 4QRNA 3VIHA 3IK4A 5ABFA 1S3TC 4XUGA 1FHLA 5HMFA 4U3CA 2XJ7A 1IHIA 1W1VA 4MJ2A 2CZDA 5G1TA 3P84A 1UP3A 5I77A 1GVIA 2C13A 4KRTA 3S9YA 1WCGA 4M80A 1W9PA 4KGJA 5FF2A 1KGXA 3WQVA 2C71A 4M29A 3VTRA 1US0A 4AD0A 5TD4A 1IWBA 3L5MA 1RLDA 1U83A 4MB1A 2VDHA 2VXNA 3UR8A 4NZCA 4O0QA 4RX0A 1G01A 2WMIA 2DFAA 4ZL1A 2YKKA 3ARRA 4IMCA 2D0GA 5AHIA 3M0VA 4JFTA 4HCDA 3THDA 3M16A 4AISA 3GD6A 2DU2A 1BTMA 4NYUA 3P81A 5AZ0A 3FFSA 4RPQA 3P74A 1IT8A 2VX4A 3CZKA 4HU3A 3QQ1A 4UTIA 4C7FA 3AHYA 3GZAA 2P1FA 1ZY9A 1PPIA 3C6CA 3ZYZA 5CG0A 1YPIA 5CZTA 1FDJA 3H55A 3TR9A 1GKRA 1PYFA 3UGVA 3T6CA 4MUZA 3PZIA 9CGTA 3EZ4A 4S3BA 3ZWTA 1TA3A 1R30A 2DJLA 3TXVA 2OYMA 3RU6A 4IJCA 1UD3A 5DT7A 1D2KA 4CQ8A 1K4GA 2GFTA 1S5VA 2Z27A 4GYPC 2PU0A 4ZB0A 4GQGA 1O12A 3WLTA 3WK3A 1X6NA 2WKGA 4DM2A 2DZTA 3B9DA 1MW1A 3TW9A 1R3VA 5DCEA 4C6IA 1R7AA 1UCWA 2A7PA 3E12A 1JPIA 5HOSA 4W4QA 4ZO7A 2YA1A 4MUPA 2NVAA 1MUMA 3ABXA 1JCYA 2YIHA 3UY7A 4AD1A 3AMKA 5ABEA 4A22A 3R11A 3P61A 3INPA 4C6CA 4UIOA 4LUSA 1G94A 1AH4A 1QXLA 2Y5EA 4MF4A 5D38A 2I5GA 1JUBA 3MMUA 2P10A 4G1NA 3UYIA 4GNKB 4TMCA 1GKPA 1QPQA 4LANA 4MB5A 1Q6QA 3BCDA 3HMCA 2ZA1A 3N6HA 5DCDA 3NL2A 3QC3A 4O11A 3SN1A 2W4XA 4GUHA 4I9MA 2CLIA 1XFBA 4CD7A 4AH7A 4DI8A 4HNLA 1L6GA 1KBJA 3DH7A 1EWDA 3WQCA 2FZNA 5A6AA 3WD4A 3B9EA 3AIWA 5D05A 1PYMA 5AHNA 1X96A 3S2JA 3EX1A 4NQ1A 1ISZA 1KLZA 2TPSA 3L9CA 3SRFA 2PDLA 1KBKA 4D1JA 2O92A 1XYBA 4R53A 3NL3A 4DJFC 3CZGA 1CGXA 4C6JA 2RGLA 3LHTA 2BG5A 5M5DA 2OT1A 1CT5A 1A3WA 2GQAA 4TX6A 4K37A 3OBEA 3AXXA 1HN1A 3AHZA 2VVSA 4ZB5A 1RLCL 3T7VA 3M64A 4PRWA 3CIXA 1V6VA 3AYSA 1UWIA 3FXYA 3KW3A 2NT1A 5EMLA 3UPMA 3KX6A 5C9RA 2J7DA 1JR1A 1VBUA 1NF0A 2C18A 3QGKC 2G3FA 4WEVX 4DIAA 1EJXC 3VKKA 5D9MA 2BOFX 3KWSA 1LORA 3W7RA 1J6PA 2J7BA 1E3XA 2FYMA 1VPQA 5AZ1A 1XIJA 3EB4A 4C1NA 3U2EA 4ZBCA 1AZ2A 3ES8A 4BI7A 4DBUA 1P0BA 1TTJA 2EJAA 4WCJA 3BQ6A 3SECA 3HBLA 4GBDA 2OFJA 4NUWA 1GGOA 1WBHA 1LYXA 3BV4A 4AD5A 3GQYA 3CHEA 3WF3A 4JKMA 4Q7NA 3GH4A 5EMKA 2R8WA 3GW0A 3OBKA 4MWAC 8A3HA 4FSAA 4EKJA 3NZGA 1Z7AA 5A8MA 2RJHA 2XIQA 4CN1A 4K1GA 3FJLA 3GYEA 4PL2A 4AD3A 4YYFA 1L6WA 1IWPA 3NFUA 5C9WA 3VD7A 2E8ZA 4DJDA 3USBA 3AAMA 2JE8A 4AXKA 4GY7A 1DQWA 5H1WA 5JBFA 4XD3A 4FPSA 2B81A 5FF0A 1NDZA 4O14A 1IZCA 1GW1A 1FCUA 4M1BA 5DMYA 4FLRA 1S46A 3UWUA 1TTPA 2GYIA 1RA5A 4AZHA 1JPHA 3H70A 2QEZA 1SW3A 1YQ2A 3EAUA 4R7WA 3GIQA 1TCDA 4M8UA 2CU0A 1VGAA 3SSZA 2YB4A 3MW7A 2BHZA 4G1KA 4W85A 3FA5A 4JIPA 3VKCA 4DUWA 2IPJA 4FXFA 1Z41A 4H2CA 3W2KA 5LKYA 5BYWA 3OA3A 3DFTA 3ZT5A 3V16A 3BSGA 3RJYA 3NZRA 1UPMB 3B40A 4F9JA 2FPVA 3EOUA 1D7FA 3ITVA 4GJJA 3I6TA 4DO4A 5E0KA 3H2NA 1FWFC 4GYKA 3LX9A 4JTJA 2WANA 4UWMA 2WMKA 1W17A 1TVPA 1MDLA 3WEOA 4DUOA 4NI3A 5A6TC 2PFHA 4RW5A 1QOQA 5AC6A 1ZAIA 1EGMA 2Y88A 1A5LC 3ZR5A 2QVNA 5D4YA 3B03A 1FXPA 2HNHA 3VGBA 3RUBL 4JQ1A 4JY9A 3VGHA 5EL1A 2QCDB 4MKNA 4C5YA 1K7EA 1GEHA 4QCEA 4HJFA 3SB0A 1NWUA 1R6WA 1WUFA 3MO4A 4Q8OA 5CAHA 3EA1A 1EZ2A 3MVIA 1BVNP 1M7JA 1U22A 2DSUA 3DFPA 1KTCA 3TROA 3S0CA 2G41A 3W2MA 1B30A 1WPCA 1IE7C 4AYGA 2BXVA 3CYJA 3BV7A 3BJTA 1IV8A 4FXRA 4KT2A 3PZQA 3UNTA 1M01A 3QN3A 1GPWA 1U1JA 2QDEA 3B9OA 1XDLA 4V1YA 3AXIA 4WSHA 3SN4A 3NQ7A 3WYZA 1XKJA 3W82A 3BAWA 2QPUA 1H49A 4GKLA 3NEHA 2I9EA 3BSMA 2DUXA 5GVJA 3WX7A 3V5OA 3ZMRA 1YNQA 3SGUA 1V93A 3GVVA 4LNYA 3RCNA 1QMLA 1XIBA 1OIMA 3U3HA 2Q6ZA 5HR7A 1TREA 2BGQA 3C86A 5E93A 5A6BA 4WY0A 2Z2UA 3EX2A 4DHGA 4AD2A 2QMKA 1OC7A 3N12A 2PZNA 4QXIA 4YS1A 4TIMA 4XVDA 4L9ZA 2PUZA 3LSCA 1Q6OA 3HTWA 2XFWA 4WUIA 3AALA 2QF8A 3PB0A 4LC8A 1ZCOA 4MGGA 1B1YA 4PCPA 3E0LA 3U8GA 2VEIA 5CLTA 3LLFA 2NSXA 4QR6A 3WDJA 3QR3A 5K2ZA 2YCLA 3NQCA 1KFCA 4DZHA 1A5SA 1FCQA 5I06A 4JTSA 6REQA 4WIWA 3PPHA 3EOSA 3S6OA 4YXGA 3ZJ7A 2FTPA 4Q4PA 3GW3A 2QCLA 2QT3A 2YL9A 3B8SA 4X22A 3USZA 4I7UA 4I5UA 4IT1A 3PZ9A 4EPBC 3APYA 4H3DA 2PWFA 4U33A 2G8ZA 1TMHA 2WZHA 1UA7A 4WGXA 5I24A 3SN0A 2Z2BA 4PMQA 1ALDA 1JI1A 4PMVA 1E1FA 3NQBA 2VYOA 1FWRA 5DN1A 4ZFMA 3OVGA 3HG5A 1HO4A 3EDFA 4GXWA 4ZSUA 1RJQA 3DERA 1GOMA 1UROA 4JBRA 1VQTA 4OZOA 3F4NA 4D8ZA 4IPNB 1EEPA 1AG1O 3MUXA 3P80A 4Y2WA 1AUSL 1ZLPA 2PGRA 1J5SA 3ZVHB 3GAKA 4ZZ9A 1EC7A 3WMLA 3UG4A 3CO4A 2GJNA 3DG6A 1FBAA 3NZ1A 4IG2A 1L2QA 2VP8A 3STPA 1UW9A 1KFBA 2WSKA 1B9ZA 1FKXA 3L4YA 2FHCA 2AKMA 1BD0A 1OVDA 2BODX 2C1HA 2PAJA 2QCDA 1AMKA 2GJRA 1QNRA 5I3HA 1X98A 3LI1A 1VB9A 3R7MA 1B57A 2O9OA 3U7VA 1ZAJA 2I5IA 4PCFA 2ZX7A 4PMOA 3EWUA 2BZNA 1HP4A 1F3WA 3TIMA 4HN8A 4BFAA 1SR9A 4OKDA 1W3LA 2NT0A 1XXXA 3HPZA 4LUJA 1E1CA 4H4IA 2ASHA 5E70A 4K2SA 4PRRA 5XIMA 1PKNA 2OYKA 1CCWB 3NQVA 2J78A 1KRBC 1SFJA 3GG0A 1XSKA 1ZUAX 1H0GA 5E9AA 1O95A 5EYWA 2X05A 5CBBA 2FFCA 4TO8A 1T8XA 3H24A 1AFSA 2WM0A 3CIVA 3S5SA 1M9HA 2H8XA 5A5WA 3N9SA 4Z2JA 1DJIA 1EH9A 2R1PA 1XINA 3TKFA 4BF7A 4UTUA 1DJZA 4ML9A 4M5PA 1KCLA 1TPFA 4WDUA 3H54A 4WSJA 3ITOA 1PS9A 1XRFA 3VE9A 2DVTA 2R1NA 3HFYA 4J2PA 1JYNA 3OVRA 3D47A 3QPEA 2GLKA 4CEXC 4QHRA 3UWQA 2Y4SA 5D2VA 2FB2A 4WR3A 4PTMA 3S8HA 2NUWA 2QF7A 2W9MA 3HG3A 1I2QA 4QX4A 1VCVA 4U10A 2HQAA 2DSKA 3HQ1A 1B0IA 2YCIX 1Q4NX 3HV8A 1XRTA 1DJHA 2GK1B 2NQ9A 3PB2A 2BY2A 1UR4A 1G69A 4C6FA 1ODZA 1MXSA 3JW7A 1PV8A 4J3SA 1JNDA 3FEMA 2VX7A 3W76A 3DXIA 1TQJA 3NYDA 3R8GA 1OD8A 4PUNA 4A2RA 3G1VA 3PTMA 2CHRA 3W87A 3KFTA 3WH6A 2VZSA 3C0SA 5D9PA 5HAOA 3EMCA 1KM1A 2CHNA 3VDBA 3F4VA 3WJWA 3SGZA 4EXAA 3ITXA 3WL0A 4CQAA 5JUVA 1AJ2A 5K9CA 1XLBA 3U4AA 2PA6A 2XGBA 3W7OA 2GPTA 4PMZA 5BW6A 2PTYA 5D03A 3TA9A 4H9VA 1KB3A 3LTYA 3N2TA 1VEPA 3DESA 3H21A 2WOQA 4B5WA 3BUVA 2ACRA 3EX6A 4BJHA 1QHPA 3NQ6A 4LUTA 1VP5A 2CC0A 1E73M 3PZTA 4HU0A 2HRWA 4KRUA 1A5UA 2D22A 2WLZA 4AEOA 1GVSA 3SI9A 1UOZA 4JQ2A 5G5IA 3V3WA 2VFEA 1MEWA 1PB0A 1XBZA 3PP7A 3P0XA 1E6RA 4XAGA 1K70A 3V36A 3CQKA 3S2NA 3CZEA 2WCGA 4KEUA 4KCTA 3M6YA 2YDRA 4MWAE 3CHFA 3QJAA 2QIIA 2PWVA 3ARUA 3RLUA 3MUIA 1DJYA 3D5HA 1G4EA 2ZTKA 3G1HA 1LL6A 3I10A 3KL0A 1YNYA 3GDRA 2XN1A 3AJ7A 4EACA 1CBGA 3U7BA 1DIDA 4Q7BA 1ICSA 3AMCA 3ZWSA 2NXHA 1FH9A 3BXWA 4PUJA 2VCAA 2ATSA 1X97A 5LNVA 2EPLX 3C2OA 4AAJA 1UR8A 3M0MA 4JYDA 3UCQA 4LVDA 4LY8A 3EKLA 3ABOA 1GHSA 1LOLA 4GIEA 2ZICA 2QW5A 4OUEA 4FOUA 3CPRA 1KA9F 1WA3A 4QCFA 2GVEA 2X16A 4ZQMA 3G1DA 3PZNA 3RLVA 1QBAA 4S39A 5K3VA 2AAMA 3BQ5A 2VOTA 5HR6A 3DUGA 2JEQA 2PZ0A 3DOPA 3O0KA 4PEKA 5DMMA 1UR0A 1ZS2A 1EEXA 2CYGA 3L67A 2OU4A 4DBSA 4B5NA 4G7EB 1K9DA 4S2BA 1KWGA 3C2EA 1QWKA 3EWDA 1MFUA 3LOTA 2PE4A 3KM8A 1OINA 3MI6A 3E0FA 2QAPA 2BTMA 2FH8A 1CNVA 3H4GA 5L6UA 2AKZA 1QJWA 2CBUA 2J75A 4A8IA 1TV2A 3D3AA 3Q2DA 2WWCA 3QLDA 3TJLA 4BA0A 3LHYA 3MKKA 3IJQA 1TWDA 2HE8A 2XSAA 1U30A 5CJMA 2GQ3A 3A5VA 3G0XA 4UNKA 2ZZ7A 3EOLA 1BVZA 4AVNA 3G22A 5FD0A 1XISA 3RGTA 3SFWA 2FMOA 3SDOA 4O4WA 1L6FA 1VYSX 1OGGA 4GC3A 1K03A 1XJBA 4PFHA 3DFYA 5CC6A 1UH3A 3KCOA 3PR2A 4WY0B 2J24A 3GVQA 3NJ3A 3N25A 4FNUA 3QHMA 3M43A 4HHHA 3TU9A 1KTNA 4LVAA 4AZGA 3A3HA 3KHDA 1P1MA 2FH6A 1PE1A 1AVAA 1KRAC 2E09A 4DAIA 3E02A 1XLHA 3A4AA 4CD4A 4ENLA 1RR2A 4YWSA 3UF9A 3WH9A 4GJ1A 1QHZA 4UQEA 4EX4A 3XINA 3PAOA 4M3PA 3K2GA 2VR2A 4JN7A 2MANA 4H9XA 2HPIA 2OEJA 2WB5A 1FFRA 1FDYA 1W9XA 1E72M 3STFA 3PUDA 1G7VA 1H62A 1FXQA 1KXVA 3M0XA 2EGZA 4H9MA 3FVDA 4WJ8A 3SCWA 2DT0A 2YYTA 2QLYA 2W67A 3QW4B 3QSTA 4RCXA 1EDQA 3G2GA 3W6YA 2JFEX 2FDSA 5IM51 3GNOA 3U2CA 3FKKA 2V81A 1PIGA 1TQXA 5HK4A 1LP6A 4R34A 4CD5A 4DWSA 5FJIA 6A3HA 4MY8A 2B0MA 1HG3A 5D2XA 3AROA 1XLLA 4DYKA 4PTDA 4HB7A 1D9EA 1GJPA 3ARZA 1VC4A 4U5IA 4IQDA 4Q8MA 1GZGA 3KVKA 3H2FA 5HWJA 2FHBA 2JKEA 3F03K 4H2HA 4J3TA 1V7AA 2DORA 3UWVA 4IL0A 3GDBA 2Z1WA 4PMJA 4ERGA 3LM7A 2ZRUA 4NZ5A 3DG3A 3TYZA 3NQMA 1UR9A 4LJ3A 1POKA 2DDXA 3TV8A 1CX9A 3GTFA 3ONBA 3WD2A 3M46A 3AOFA 4WX2A 3BL3A 1W3TA 5CCZA 1C8YA 2IMRA 4R9OA 3EKGA 3EYPA 3P67A 4DXKA 3B3DA 3URQA 3SR7A 1V02E 4GYJA 3T8QA 1AQMA 1LM1A 4U2ZA 5KZ6A 3KDOA 2Y1HA 2XFYA 3M5YA 1FWNA 2PS2A 2PD5A 1CI1A 1UJQA 1QFEA 1H1ZA 1XG3A 2XVPA 1I2PA 2E6FA 3VOHA 4EAYA 1W1A1 4PR4A 4PMDA 3NYZA 3W7QA 3GZ3A 4LU0A 2PCEA 3DGRA 2D69A 3E38A 1DTNA 5A94A 1WDPA 3BAJA 4LVBA 4XZNX 3GUWA 2FVKA 1R3TA 1V3JA 1CXFA 3AIVA 1ZCCA 2QJGA 3T2OA 4ZTXA 4WZHA 3UJSA 4QSFA 1I75A 2ATMA 4NNCA 3UJFA 4WKFA 3CEUA 1S2UA 3N6QA 1EYEA 3B8TA 2WHKA 4TV6A 2DH3A 4IQJA 4PTWA 2ZA2A 1JDEA 3HIJA 3CV2A 4DZ5A 1Z48A 2J9YA 5HNUA 3KZSA 5BMWA 4GOAA 4LYRA 5KZDA 1XYLA 1JYVA 5JBDA 1IXQA 1LQ2A 1O94A 3DYOA 4XZ9A 1JFXA 1QUMA 3TSMA 5JBEA 4KMQA 4UQ9A 5AYXA 3VILA 1W8SA 3CH0A 3BH4A 3FEQA 2RUSA 4HA4A 4DB7A 3MUZ1 3KP1A 2J13A 4F2BA 2J9XA 1DQXA 3UCCA 3H4XA 4L64A 3QPZA 1OFDA 1HJQA 1NF7A 4HSHA 1UZ1A 3S9ZA 1OJXA 3PPGA 4JR5A 2VDGA 1UMYA 4FZIA 3KLKA 3A13A 1JZ2A 4V33A 3W02A 5AN7A 3ISIX 3RG6A 3QOMA 4ZQPA 3QMSA 2V2CA 4V28A 3STCA 4CU6A 1HVQA 2Y2WA 3S6TA 1Q45A 4B3LA 3M5ZA 3LGDA 5M17A 1EJWC 2OSWA 5CBIA 2QHAA 3RMJA 2NQ5A 4ML4A 2ZXBA 2QGHA 4OQVA 1UBSA 5J5DA 4JYEA 2XWEA 1H7NA 3D46A 1SYTA 3U2ZA 1AL8A 2NWRA 4L4PA 4MNLA 4MJMA 2ZUSA 3LK6A 3MTWA 2HJPA 1VR6A 4AU0A 3QV6A 1L6YA 4Q8NA 3S42A 2VC9A 1RV8A 4EPDC 3GDKA 2FVLA 3ZJ6A 3W1RA 3EB2A 4AY1A 4W87A 3E9AA 2OWXA 4YJ5A 5JIPA 3GTHA 3DAQA 4ERAA 4ECLA 3L68A 1H0IA 5H91A 4FX6M 4LYPA 1IT7A 1V6XA 1BYBA 1E6PA 1E4MM 3TJXA 2WSYA 1JZ5A 4ZB2A 1KGUA 4ORMA 3GHSA 1TX2A 1VIWA 1JD9A 2YGYA 1REQA 3SADA 5JMUA 4N02A 5CC5A 2CBIA 1DJNA 2OQYA 2B7QA 2QS8A 1I0DA 2UBPC 1VKFA 2GGGA 1R47A 4JIIX 1ME7A 4C6PA 3P5ZA 5I7GA 4MB3A 1UB3A 3KHJA 2EG7A 5A2BA 2WXDM 2PBGA 1JEZA 3CAKA 4W9TA 4GGHA 2BOGX 2UV8G 2A6LA 1D8CA 1DWIM 2V68A 4X61A 4DJFD 4MAVA 5LGZA 5GNZA 3VFLA 4RL3A 3LENA 2AMXA 2AAAA 2OELA 3AYRA 2OSYA 1EKOA 4IG2B 3WMCA 2ZDSA 4TQTA 1J0YA 4X2PA 4TTUA 3GXTA 4XAPA 5I00A 1IEXA 4GLEA 2P0IA 3QFEA 1NP2A 1J4EA 1EA0A 2CETA 1NWRA 1A4LA 4HNCA 3VAVA 4GO8A 2TMDA 4PL1A 1MRAA 1W3KA 3TYBA 1S2TA 2UY2A 3W70A 5JH2A 5CZKA 1DWGM 2GGIA 3VZZA 3CWNA 4H7ZA 3BLOA 4MHBA 4DWDA 1JF5A 1GOWA 5DMNA 3AXKA 2XGZA 4JX4A 2J8GA 5D9NA 3E2VA 3UVAA 1VFLA 2PWEA 3F1QA 2C3ZA 5I6SA 4O4VA 1DP0A 4L61A 1EHAA 1OZQA 3LXAA 1QI2A 3LCWA 4ZQOA 3CBWA 2QCMA 3WNLA 1AQHA 3MBFA 5BU6A 4Y9MA 3VNMA 3EMQA 4L4LA 4H6RA 1KD0A 1J18A 3HPAA 1ONEA 4AEEA 3DU0A 3TJ4A 3TLQA 2VZUA 4KCWA 2HDJA 4HZ6A 4ES4A 3TTOA 1VFMA 4UFHA 1Q8AA 4R7JA 3UETA 2H3BA 3L0KA 1VAHA 5DF0A 1J0IA 4EANA 4F0RA 4EIVA 4GUIA 3EB3A 4LF1A 3W4RA 3VX1A 3WLHA 3DFQA 1PCKA 3N3TA 1LOQA 3QZ6A 4B9ZA 1KGWA 1R0MA 4A35A 2PURA 1F6YA 1NY1A 1CLVA 1ZL1A 3MZ2A 1AW1A 3RM8A 2GZXA 4QQ3A 5HINA 3MCNA 1FA2A 3IJ6A 3VKBA 1OQFA 4O8AA 3LZ3A 1MQPA 1K9TA 5CC3A 4E8CA 2RDTA 3BURA 2QUTA 3N3MA 3S1WA 2TYSA 1PTAA 5CPNA 5KSWA 3EBVA 1YX1A 4U28A 5AC5A 3L5LA 1ZGDA 4JNMA 5FF7A 2A7RA 3CZ8A 5T9CE 3VOJA 3B0UX 1KRCC 3VMOA 3PFMA 1JYXA 3BWWA 3SRKA 1XP3A 1MRQA 2ACSA 3CL6A 4WKHA 2R6OA 3QQ0A 3N19B 5KETA 3RYSA 3SQSA 4KCUA 4AIBA 1JYWA 4H8HA 4N9CA 1SZEA 4XD5A 3UEQA 4RV8A 2I7GA 3MUY1 4FS9A 5ABFB 2DSZA 3E74A 3RNDA 1P7TB 5AYZA 1LL4A 3VCCA 5A8OA 2INZA 4LV4A 2G5WA 2C79A 2E9MA 5CJ5A 3TQ0A 4S3DA 2QNEA 2XUCA 3EX3A 4QROA 3UT0A 3DBPA 4DN1A 2DV0A 3STEA 1Q2SA 2Y7FA 2H8ZA 1A5BA 1JDAA 2VGBA 1DWAM 4OUIA 4DAFA 5C5YA 5HMSA 1RY0A 3M6DA 4YNGA 4JDYA 4E2DA 4US5D 4FXJA 3RO8A 2VCBA 1PWMA 3C8FA 2BB0A 4HT3A 1OT2A 3T78A 4I7WA 3TYCA 2CLOA 4O52A 5I5RA 2YYUA 1BXNA 1OG6A 4R9XA 4MPQA 3BG5A 1E6NA 2E77A 3TMQA 3CXOA 1X7IA 4PMNA 4FI4A 2P76A 3TZFA 2QPSA 3OZPA 1B3OA 1IIHA 3N34A 4C6LA 3MDUA 1KXHA 2ZE0A 2WVVA 1UHVA 1JCMP 1A5CA 1JVNA 2PP1A 5I3FA 1QASA 3N73A 5H8PA 1JULA 4ALDA 7REQB 1KV8A 3KP0A 1FCBA 1RCXB 7ENLA 2PLJA 2GJXB 3WQPA 1XQKA 4JTAA 1W9UA 4YWIA 5HUPA 1UC5A 1A5AA 4MWAD 1KM3A 3VIIA 2WMIB 5D2TA 2VELA 3TW6A 4H7CA 5EU9A 4IGNA 4K39A 4XKMA 4Y8FA 1DOSA 3CHVA 1LTDA 4H19A 4ACZA 1R9ZA 4HPJA 2JIEA 2NVDA 2UWFA 2P0OA 3KOZA 4MY1A 5FJRA 1IF2A 3VINA 3G6MA 2FZDA 3WEMA 1DXIA 4KS0A 3WBYA 1S38A 3DN5A 3CU2A 3QBUA 4A05A 3WLMA 3QHOA 1H1YA 2PF8A 4IISA 1JXKA 4LAOA 1XC6A 1H11A 3CTTA 3E0VA 2VEMA 3K5XA 1S5MA 2CFFA 3F2DA 5FCZA 3W1QA 4W8BA 4KESA 1M68A 4UTLA 4B5XA 5LHEA 3B0PA 3GAYA 1V77A 2YW3A 4ACYA 5AECA 2ICSA 3SRHA 3QYQA 1UR1A 4O13A 4IFOA 3BANA 4F0HA 4NAFA 2B7PA 3EA3A 3CV6A 2WWDA 3V4BA 3GSMA 3GKAA 2V5LA 4E8GA 4RE0A 4RXFA 4RLIA 4QDMA 1S5NA 1EJRC 2ZDRA 4OE7A 5HMDA 1DIOA 3HURA 5FEXA 3NQFA 2GJLA 3G1RA 4DX3A 3TONA 3POCA 4F0LA 3MMDA 1X1NA 3WLLA 3WN6A 4ICMA 4DJFA 2ACUA 2YDSA 3GNPA 3WK1A 4GH3A 3ZO9A 2OWCA 3FYPA 1IEVA 4O16A 1OC5A 5XINA 3TXZA 3OLIA 4W86A 4CCCA 3NGJA 4LS1A 4IQEA 5TF0A 4GVGA 3NR0A 1KKOA 4DBWA 4Y6GA 1N8WA 2G96A 1OX6A 1EZWA 4YTTA 3H26A 1VRXA 2XVGA 2NX1A 3MANA 4EWND 3EEGA 3NURA 2ALDA 4KEMA 4OU1A 4X63A 5IFPA 1E5NA 4QG8A 3KDNA 1FCVA 1WQ5A 4ZR8A 2GUUA 4WK9A 4M7SA 5K9DA 1XLCA 4IX0A 5A6MA 3W1TA 3GBEA 4UTMA 2FQIA 3RDKA 3E2QA 1C8QA 1K7FA 1WBJA 3LI0A 2WLYA 4UXDA 3C2VA 3LCHA 5FJJA 3L4TA 2ZUWA 2PGFA 4Q3MA 4BQ4A 1QBBA 1F4AA 3U5UA 3VM5A 2QJIA 1W9BM 5AHFA 4BQ2A 2GDQA 2C91A 3JZUA 1J10A 2XDFA 1GYMA 1M53A 3RXZA 4HU4A 5FOOA 4GKTA 2BY1A 1XBVA 1GTHA 1SJAA 3UU0A 4D6EA 4JTQA 1FH8A 4HMEA 2PMQA 3WQ6A 4WLCA 3NOEA 3E0IA 1B5TA 1HJUA 4UQDA 3PC0A 4A3QA 5F1UA 4MJZA 4JKKA 4LT9A 1CGWA 5TAOA 4HOZA 2Z1SA 1UUQA 1XX1A 3RHGA 3WNKA 4AZCA 1L6SA 4UC5A 1JZ4A 4Q4SA 4KQNA 4ILSA 4J3UA 4MLJA 3EXRA 4MVAA 3GB6A 4NP7A 2VR4A 1CGUA 3NL5A 2X8RA 1ADDA 2OKTA 2IPFA 3MHUA 4CU8A 1XSIA 4HNUA 1JL8A 4S23A 1XIGA 2B7OA 1I60A 3B8UA 4B5SA 3VE7A 2HPMA 2WMJA 3LCLA 4N9BA 1IEWA 4GI8A 3NZQA 2YLAA 2GQ9A 1BGAA 2DIJA 1QK2A 1NFGA 3WUFA 4V15A 4HYWA 7ODCA 1JFHA 4FOJA 4GWEA 4WD0A 5HPOA 1PKYA 2J7EA 3CJPA 3SM0A 2WVSA 4CCZA 2JIWA 4HHLA 5IXEA 1V3MA 1JAEA 4AX7A 1ODUA 1IXOA 4O10A 4Z2KA 3RX2A 1OBAA 1ELSA 3IVSA 4JQ4A 5HANA 1VFOA 2ZVRA 4CEUC 2YJQA 3NXLA 4KF1A 1EIBA 4JL2A 2Z7KA 2GVGA 3BG9A 1OFPA 3BPWA 4H9UA 2AL2A 4IUOA 1Q66A 3GIYA 4W84A 1E1EA 2FMNA 3W01A 1KCZA 5C9UA 4S1FA 4HA3A 2KZHA 1E4NA 3TFCA 3K8MA 3CT7A 2D2HA 1GT8A 1E15A 1ADOA 2WJZA 1JDCA 4JTEA 2W62A 3GVWA 1SZNA 4IGMA 1OX5A 4X60A 3L4XA 4GNVA 1TJ0A 4YVVA 4LS2A 2PTWA 3E96A 4D72A 5J5RA 3GM8A 1KM6A 4LRTA 1YXYA 1ZPTA 5BXTA 2A4AA 1XPGA 2BLEA 4N0RA 3FX4A 2VT0A 1Q7QA 3CASA 2JGYA 1OSEA 3W2NA 1E6ZA 3GH5A 3ES7A 3WJXA 2CLHA 3R25A 5E9XA 1D3CA 1WXYA 2WNQA 3SCTA 4M19A 4U31A 1PKLA 2WC3A 4IFKA 1W5OA 1UH4A 2A5HA 3FS2A 1XBYA 3A22A 3T0DA 4LXFA 3LD5A 1TR9A 4S2CA 3T9PA 1JJKA 1F6PA 3PZOA 3M44A 4TVUA 3I7QA 2EF9A 3Q37A 1KKRA 4A8LA 4ATWA 3GXFA 4J3VA 3BW4A 2C0AA 3T81A 4HYRA 3HA1A 1KO0A 3MWCA 4UZSA 4TVDA 4AWEA 3AISA 1H7OA 2ZZ2A 1NDWA 4AXNA 3HPSA 4O12A 2YCLB 5EGRA 5I23A 5A8QA 4CUCA 4S3JA 4W89A 1O60A 3APGA 1HKMA 4U5KA 1TJ1A 1N8FA 3OO2A 5HUOA 4DLMA 2BVDA 1BPLB 2F9RA 1TR1A 7CGTA 4ROQA 3TA6A 4Q4OA 2WZIA 2R1KA 3EOEA 1RP9A 5PTDA 3U6WA 1S5TA 2BBFA 4H9ZA 1OFEA 3URAA 1BXCA 1O4UA 4Q8VA 2VRKA 5FA5A 3UXLA 3KOYA 3URNA 4CN6A 3KE0A 2E0PA 2J79A 1XGDA 1Y5WA 3NGFA 3EWWA 6CGTA 2XN2A 4O8RA 2DZAA 4AF0A 4KH2A 2CESA 1LOSA 2GUYA 1J2BA 3WH5A 4K68A 3QR0A 4NXKA 1US3A 3LBCA 5FL1A 3AMGA 2CZEA 3FSUA 1CTNA 4S3GA 1JRBA 3DFHA 3N2BA 1TPC1 2VC6A 1CXIA 1PUDA 2W91A 3A47A 5LNUA 1H7XA 3KTXA 1G9HA 4REQA 3OGSA 3SJNA 4Q7IA 4JHOA 4PMXA 3YPIA 2J66A 1NDYA 1BEUA 2C8NA 1FP8A 4F40A 4E5TA 1O5XA 3KRBA 1NWSA 4QIUA 3TAOA 3JUGA 3LHVA 3KWXA 3N13A 3PZGA 3CQHA 2IPWA 4O28A 2BXYA 3IIZA 4A3RA 3SY8A 2NV1A 4M6VA 2O7SA 4YTUA 3QGAC 2VX5A 3GC5A 4JPGA 3BLDA 1VEMA 3I7SA 2ZX8A 2VD8A 2WCSA 4UTFA 1R2SA 4ZVJA 4Q6JA 1IT0A 3TTSA 3GR4A 2FJUB 4GVHA 3OVPA 1AA1B 4QNEA 4YVXA 1XYZA 1YEYA 2BS9A 2Y70A 1P5BA 2QCCA 4LVGA 2C16A 4GISA 1OG0A 3LHWA 1LQ0A 4ZCWA 1XR2A 3WSUA 2RJGA 4GQRA 1H4PA 3AHTA 4U2YA 4EP8C 3EGJA 1Y5XA 4L6OA 4LWWA 5BZAA 3LXCA 2PDYA 3QXBA 4DXVA 1K9EA 3MV01 3R4IA 3L66A 4C90A 4Z17A 5CBJA 2GUBA 1JZ8A 2Q8LA 1PZ1A 1ZU8A 1RK5A 5HPCA 3QKZA 1JRCA 1JI2A 1OGSA 4H00A 1EDTA 2DZBA 3UJEA 1DWFM 1XGZA 4I8DA 3UWYA 2R94A 2XZ9A 3R0UA 4LCSA 4XB3A 4AMAA 4HMNA 2OLSA 5RUBA 1QNSA 3QV7A 1GZ1A 2YZ5A 2BXZA 1V0LA 4JFSA 4MDOA 4GI6A 4UBPC 1HKWA 1TPDA 4Q4KA 1UD5A 1QR7A 3PJUA 4Y7EA 2VEKA 1ITUA 1U5VA 2AGTA 2BWGA 1P0EA 4KEZA 1W37A 1V0KA 4S3CA 4F79A 4KIRA 2PDWA 2PRMA 1ZBWA 4Q6XA 4EPEC 1W54A 3DKJA 2QYGA 1YMYA 2W66A 1ZNNA 2OZ0A 2WKLA 4US6A 4RJEA 2OB3A 1NOWA 3C3UA 1MFVA 4DXXA 3BLPX 4QE5A 4CNOA 4OT7A 1D7KA 2RKXA 5E0CA 2NQJA 2VO5A 1JG9A 1DL3A 1IQ8A 4O1FA 2OOFA 4J3WA 2QDGA 5J04A 3DYPA 2W79A 2TODA 4TOQA 4C6QA 1ZFJA 5BOEA 4BF5A 3L0GA 3I3EA 5AHMA 3W28A 3GHRA 3UR7A 3VGDA 4O54A 1GQLA 3H4WA 1KFKA 4QM1A 2O9PA 2OO6A 3N4EA 4GA8A 1HJWA 3TNBA 4WF7A 4QLJA 3JS3A 2I9UA 3AO0A 4DYEA 3GTXA 4V27A 2HSAA 4RDZA 5LA1A 3DENA 3S6DA 1A50A 4PCTA 4NJHA 3FNDA 2J7GA 1SR0A 2AOSA 3T2QA 2VMFA 2PWHA 3CQIA 4IMEA 4NILA 3NQEA 3TVAA 1CB7B 1RCQA 1TTQA 1A0DA 2YFOA 5HBFA 3N2CA 4RZBA 4D6GA 4IHCA 1OFBA 2YFNA 2E5CA 4N6FA 3AFBA 5KZMA 2W92A 1VD6A 3S83A 1GONA 3QYSA 4C65A 4NNBA 2FGLA 3VYLA 1B9BA 1PDZA 5DX7A 3HV9A 3OLDA 4B3KA 1HF6A 1OK4A 1NAL1 3N2OA 1XPYA 1QRQA 3B4YA 4TTGA 3NDYA 1I1XA 3STGA 3CL7A 5D37A 3W86A 1QPOA 4JTGA 1GJWA 4B92A 4HKPA 3QZEA 2PDQA 3W74A 4HN4A 2J62A 4C1KA 3OGVA 6ENLA 2PDMA 1H5VA 1FQ0A 3CQJA 2QCNA 2GVJA 5C70A 1ONWA 2CITA 2A1YA 2YA2A 4DM1A 3MHFA 1N82A 5G1MA 4PMUA 3U4FA 2HZGA 3IUDA 3M0KA 3IK2A 4LAMA 3I65A 1GYLA 4UTTA 4MKSA 2PLKA 1HNYA 4Z1CA 3VNDA 3WF2A 5CPSA 3C61A 2ZRZA 5LNSA 2X0YA 1NARA 1UA3A 3C4UA 3CV1A 3S1GA 3LPFA 2CLKA 3U48A 1MDRA 2XPKA 3MMTA 3G3DA 4IPJA 4JHZA 3OYZA 1UWAA 4KETA 1BYCA 2ZX5A 1QHOA 4JTUA 2G4JA 1VBHA 3VU2A 3VIOA 3VC5A 3V18A 3IAQA 5H8MA 3MO7A 2FZ9A 1W3JA 5IFTA 3ZXWA 1JD7A 3LCXA 3KRSA 3ZT6A 3JVAA 1F61A 4JIHA 1D3GA 2PDIA 2H3DA 1OADA 1JIBA 2NQHA 3GG1A 3WQEA 2H9AB 3H6OA 3CS2A 1CB2A 1F07A 4G8TA 2CBJA 4HOWA 3P8IA 2NXIA 4AD4A 2REQA 2V5JA 5LA2A 3UZWA 3GVGA 3HPFA 3R13A 3LERA 4I3GA 1OYAA 1V3IA 3W2UA 4P7NA 1R3RA 1W2PA 1K8XA 3KTSA 5GQBA 4J28A 2YBUA 2PWDA 4XD6A 2FLIA 3W7HA 1MYRA 2RGMA 3EX4A 1AH3A 4FOKA 3MP3A 4DEFA 2A7NA 4XBKA 3KL3A 3HU7A 1NEYA 3OZMA 2DUZA 3PJTA 3SURA 1LUCA 1R46A 5DMLA 1LL7A 3AQUA 1WXJA 4QJ5B 3C56A 2D2GA 3PBMA 5IHSA 3A64A 1MEHA 3QTGA 2PDPA 1O5RA 5FJOA 3VPLA 3S1UA 4DO6A 2WVUA 5D02A 1F8MA 1YDOA 3IACA 4C6MA 4QEEA 4MMWA 1RBOB 1XLEA 5HATA 2ALRA 1X39A 1Q7ZA 2HEJA 3DFNA 3WLRA 2BOEX 4OHQA 7TIMA 3REQB 3WNMA 2BHUA 3R12A 1VJIA 3VKAA 1XCXA 3NVDA 3FJNA 1XUZA 3WLQA 3R6IA 1CGVA 1GVRA 1O5QA 2ESCA 3FGCA 4EE9A 1B3XA 3UNDA 2CHOA 2PDFA 1Q3NA 1Z42A 3CLMA 1EDGA 1X1ZA 1FWCC 3E49A 3BAKA 3TLLA 2ZKMX 2B4GA 5E0FA 1U33A 1YE4A 3AXMA 1X8CA 3G6LA 1YNPA 1GVQA 1S5WA 1V6TA 1TPWA 4NXSA 4FHAA 4E38A 2QV4A 3B9NA 4MZ1A 5D32A 2RAGA 3UZXA 3WIJA 1CYGA 4GACA 4MPKA 6XIAA 2Q8XA 1UWQA 1XYCA 4JN8A 2WBKA 2ZA3A 1V03A 4P8UA 4D8LA 4NY2A 1S39A 3VOGA 1S2VA 3HGSA 3PK7A 2D73A 3ANVA 1TWWA 2YW4A 4O1CA 2I56A 2WCAA 3E2RA 4GUJA 1UD4A 5I07A 3TSDA 3W83A 4PULA 1XLKA 2QMJA 1DHKA 4S38A 4P8VA 3W7DA 2JKPA 4D2JA 3O8AA 1JGIA 4HYVA 5TIMA 2VQUA 4UTKA 1M7OA 2YB1A 3EDKA 1NELA 3B97A 1UIOA 1A0EA 2ISWA 1DJGA 2R1MA 1KM5A 1V6WA 3ZZ1A 2A21A 3MKCA 2YPIA 1EGVA 4O19A 4DPQA 2BASA 4YU1A 2DJXA 2QDHA 3OU8A 2P8CA 1GWJA 5G2HA 3MDWA 3RPMA 4YLWA 1QU4A 3WUGA 4BWLC 2X1SA 3DC8A 4DJEC 1W32A 4MY9A 5KTLA 3BG3A 1ZSXA 1G0CA 1I9CB 4GI4A 3G77A 4B5VA 3EWCA 4C6BA 3LPOA 4RKAA 4HA1A 2OEKA 2YR1A 1VFHA 3B05A 3PUOA 1SW7A 4ERIA 3AU2A 4PUUA 3VCNA 2ON3A 5JVLA 1AD4A 4MJ4A 4WDWA 3PBGA 1W1ZA 1OX4B 2WM1A 3M0YA 4IXXA 5C71A 5CZSA 2HS6A 3DEQA 1CXEA 1O7AA 2W63A 1YDYA 2BSLA 2OZ8A 4XSMA 2XFRA 1RVGA 2INEA 3RLGA 3QSRA 2RDUA 2Z1KA 1MVYA 5M1TA 5GJNA 1M6JA 4YCPA 5EFFA 1F4HA 3A6OA 1UJPA 5D09A 4MADA 2JKAA 4KKXA 3CLWA 4QEHA 3F5LA 2OG9A 1MZRA 4N4PA 3GNXA 4PODA 3GNDA 2ZZ6A 4RW3A 3O0FA 1KBLA 4NHVA 4NZ1A 3M0HA 4LY4A 1TZ9A 1T41A 5BRPA 3DG7A 1E70M 5I3KA 2WK2A 1ONRA 3TC6A 3NPWA 1JCLA 2GDVA 1VFSA 1W0MA 1BKSA 3OYXA 3C0QA 4AZ7A 2DT2A 2CPUA 1QW9A 1WXZA 1G4TA 2PGWA 3LMYA 2X40A 3W7EA 3AS0A 2JBMA 3F4DA 4G7EA 3MT1A 1WP6A 4LRSA 4ZA0A 1P6BA 4B2DA 2OOGA 3K8KA 2J77A 2PWUA 4TX8A 4DWSD 1F7BA 1UMLA 4QP0A 2ZUMA 1XV8A 4MLRA 3ARQA 1XSJA 3GTIA 3CZJA 1FWTA 3N18A 2OGJA 2WSRA 1TA3B 4DO5A 4GY1A 1UKPA 1W3HA 4EOUA 1NFPA 1R5YA 1TPUA 2PC8A 1WNOA 5D2WA 3ARTA 3BGGA 4L4MA 3ARYA 3AHVA 3TR2A 2XH0A 1ZBCA 4BHYA 4HQVA 3BO9A 1TZZA 4WDXA 3UG8A 3GLCA 3FV9A 1PBGA 1SO4A 9RUBA 5A95A 3N9RA 1OYCA 1X6LA 2CZVA 3PTKA 3QHNA 1H61A 2AL1A 4G9PA 3P8JA 4LUSB 1ZJBA 2J8FA 1VFUA 4OVXA 1AW2A 4AWUA 2G4FA 2FDMA 1QNOA 3LS9A 4HZ8A 4MAZA 2V82A 3MI3A 1LWJA 2A3CA 3UPWA 2BP1A 4OECA 2ZRWA 4W5ZA 5A6SA 1W5QA 9XIMA 4HK6A 5C7HA 1JPDX 3H8AA 2BY3A 4UCGA 3BAXA 1OWQA 4WXYA 1V6YA 3Q58A 2W3ZA 3SCUA 3OZYA 5A1AA 1LWIA 1F73A 4LQ1A 3B8WA 4B16A 4QNWA 2REQB 4XZBA 3O07A 3B0XA 2FZMA 4PFMA 2WMGA 3PG8A 2VQTA 1FWIC 3MSYA 5CLWA 2G3IA 4MM1A 3M5VA 1TV5A 2YCJA 2XSXA 3KUMA 3L12A 2XM1A 1Q4WA 3MJMA 2OR2A 3PNUA 5A8NA 1QPKA 3OQ8A 2IQDA 1P48A 2WVTA 1YXDA 3PWIA 5IHRA 4IPPA 3VIFA 8CGTA 4L80A 4DF1A 2Y8KA 1MXGA 3VI2A 1M3UA 4MWAA 1JZ3A 1EO7A 1A49A 3W1LA 2NUYA 2JQXA 4J35A 3WD3A 3NPXA 1ISWA 3UG5A 4ASTA 2IPGA 2QKFA 3ARPA 1E6SM 3S2CA 3ZM8A 3MJYA 4CNUA 1KXTA 1O1HA 4NRSA 1M04A 4IMFA 4V2XA 4IIFA 1TE6A 4DELA 3LRMA 1DWJM 4M81A 1C9WA 4PBEA 3ZSTA 1UD8A 1OK6A 4JIEA 2ZADA 1QATA 2PDCA 4PTXA 2VZOA 4Z2HA 2Z0IA 3ECQA 2PBOA 3WNNA 3M07A 4EAMA 1FVPA 2DZXA 2Z28A 3K4WA 3T05A 4CN4A 2VEFA 4B5UA 1ZQ5A 4Z42C 4M6QA 1TSIA 3EWZA 3WMBA 1Q2RA 3FGCB 4E3TA 2Z29A 2I14A 3NXFA 3BAYA 5FEZA 1FX6A 1YDNA 4HTYA 2PPGA 1O5KA 1WB0A 1E1CB 4B90A 3WL1A 1KV5A 1RSCA 5HA7A 1NQKA 2O9RA 2Y24A 4MKVA 4GD0A 2XIMA 3SCNA 2PDXA 4TX9A 4Q8UA 2X2YA 4AMCA 2BNJA 3HN3A 2QUNA 5HWMA 1VF8A 1TG7A 2Z7GA 2A2IA 3VNLA 4P61A 4OBRA 2GOUA 3PBYA 4XX6A 5IDZA 4JS3A 4DJEA 1V79A 4NAEB 3HQPA 3H2MA 3HJEA 1J11A 1VPXA 2F7FA 1EJSC 2ZXAA 3VIMA 3RAOA 3F2BA 1J79A 5HWNA 3O15A 1W1IE 3EA2A 2QXWA 4DUXA 4FK9A 3MA8A 1HL2A 2NZLA 4KEVA 1EHNA 2OQLA 1PEZA 3W2LA 1NU5A 4FP1A 4GCAA 4JFWA 4LCQA 4JL1A 3WFZA 2OZ3A 4Q22A 5EMYA 1NVMA 4YTQA 5MF5A 3SUSA 2WPBA 5F7UA 4WJXA 1XLIA 4PTNA 2A3BA 4RZ4A 3CYVA 5BROA 1T40A 4LALA 1F3EA 2E6YA 1K02A 1WE5A 3UESA 3ITYA 3W72A 1XHGA 1YIXA 2NVCA 1H63A 3WD1A 5CXPA 4FAMA 3W37A 1GHRA 4CQBA 3AZTA 1C93A 3NDOA 2F84A 1Q6EA 2Z26A 3C3NA 4UFMA 1KBIA 4Q8PA 3Q94A 1MNSA 2WSPA 3BZGA 1R2RA 1C92A 1E9LA 3IUIA 3MWAA 3ME3A 3F4CA 4Q33A 3K13A 1P0DA 3ITLA 3LY0A 5DELA 3D3FA 3SQMA 4UOZA 1PZ3A 1Q6FA 4CNNA 3PAJA 1WO2A 1FWHC 4PCNA 1Q13A 3ZS4A 1H7RA 4F3HA 5BOOA 3DECA 4J3XA 4MNKA 3VD9A 3GDMA 2XHYA 3AHXA 2VZTA 3IJIA 2BHYA 3ZOAA 2V0TA 5C7VA 4BWLA 3EEZA 1Z69A 4ZEPA 3BW3A 5CSRA 1UP2A 4IFRA 3RM9A 3AWNA 4Z1YA 4WVXA 3VZXA 3T08A 2ZRVA 5C54A 1IEIA 2KX9A 2Y63A 2E28A 4XZLX 4AVOA 1GPFA 2BV9A 1V5XA 4Z1BA