3QPYA

Crystal structure of a mutant (k57a) of 3-deoxy-d-manno-octulosonate 8-phosphate synthase (kdo8ps) from neisseria meningitidis
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
276
structure length
250
Chain Sequence
MDIKINDITLGNNSPFVLFGGINVLESLDSTLQTCAHYVEVTRKLGIPYIFKASFDAANRSSIHSYRGVGLEEGLKIFEKVKAEFGIPVITDVHEPHQCQPVAEVCDVIQLPAFLARQTDLVVAMAKTGNVVNIKKPQFLSPSQMKNIVEKFHEAGNGKLILCERGSSFGYDNLVVDMLGFGVMKQTCGNLPVIFDVTHSLQGRRAQALDLALAGMATRLAGLFLESLHLLEDFLIRIKALDDLIKSQPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-dehydro-3-deoxyphosphooctonate aldolase
publication title Targeting the role of a key conserved motif for substrate selection and catalysis by 3-deoxy-D-manno-octulosonate 8-phosphate synthase
pubmed doi rcsb
source organism Neisseria meningitidis
molecule tags Transferase
total genus 75
structure length 250
sequence length 276
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.55: 3-deoxy-8-phosphooctulonate synthase.
pdb deposition date 2011-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00793 DAHP_synth_1 DAHP synthetase I family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3qpyA00
1VGAA 1YXDA 4IPIA 2G95A 3DFSA 3MJYA 2DZUA 4FNRA 3W75A 3TMQA 4FIRA 4HNTA 1SQ7A 2V5LA 3W1MA 4NNBA 3HMJG 1TB3A 4UMBA 4IWWA 2DZXA 1DQXA 1UUMA 1BWKA 1SR9A 2QF7A 4FX6M 3TSDA 1LYXA 1ADOA 4YL2A 5HWJA 4JTEA 5E0KA 4DPQA 4WX2A 3HJZA 5LKYA 5EY5A 1BWLA 2BSLA 3NPVA 1LRTA 1ONRA 1Z41A 3P8IA 3MYOA 2C14A 4YLWA 1WDWA 1KFCA 1TCDA 4A2RA 4LY8A 1W54A 2NLIA 2JGYA 3C52A 1OFEA 3HO8A 1I45A 3TJLA 3EXTA 3W6YA 4M19A 3ZWSA 1PCKA 3NZRA 1Z48A 1P0KA 3G3DA 1TQXA 4OHQA 1OYCA 5F4SA 3O05A 1HL2A 2WSRA 3U6WA 3NDOA 4QNWA 1K7EA 2XN0A 3DZ1A 3OHIA 1KM3A 3MYPA 4UC5A 2EPHA 2QCDA 3NOEA 4UTIA 3E02A 4HSNA 1G7VA 1B4KA 5BMWA 3T40A 4ALDA 4MJZA 2HTMA 1GVOA 5D38A 3TMLA 5CZSA 1Q45A 2RDWA 1TTPA 4TIMA 5U7SA 1MEIA 1GVQA 4UUIA 3FOKA 3LHTA 3MO7A 3U2OA 1O4UA 1W3TA 5K2ZA 1TYGA 3NGJA 4IMDA 3NQAA 3IIPA 3MHUA 5K9XA 3DAQA 4PC8A 3CQ0A 2VFIA 4TO8A 2V9DA 1VH7A 5SWUA 3R5EA 2GPTA 2QCGA 4N4QA 2EKCA 1JCXA 3LCFA 3C2VA 2OJPA 3W7RA 4IMGA 3TQVA 4JTGA 2V2CA 4DO6A 1IIHA 2OT0A 2PC4A 4GRSA 5HMSA 3IEBA 1R2TA 5DLCA 3B04A 4NJKA 1IIGA 1KV8A 3B06A 3NNTA 2H8ZA 1QO5A 1YXYA 1SFJA 3LHYA 2Y85A 3DHFA 5KZMA 1PHWA 1S5TA 3QW4B 2J27A 2WSQA 4LWWA 5HR7A 1W3IA 3GB6A 4LVBA 3QMRA 4UR8A 4RZ6A 4TMBA 1K8XA 2ISVA 4NQ1A 2WO5A 4EOUA 3H53A 4LUIA 2FPYA 3LXCA 3UXDA 1FDJA 2E68A 1YDOA 4IGHA 2J24A 4O57A 4EF8A 4O1BA 1JVNA 1ZHAA 3L66A 1DHPA 2B7PA 3NQMA 4GBUA 4Q33A 1JULA 4ADSA 3JRKA 1NVMA 3SR7A 4P2VA 1ZALA 3MBFA 4N4PA 4NX0A 5CZJA 3SZ8A 3TSMA 3VE7A 4FO4A 4Y90A 3HGOA 4O53A 3O8AA 1N7KA 3OG3A 4WQ6A 5IM51 1VYRA 2VEIA 1TPWA 2ZYFA 3DBPA 3HQ1A 3TC7A 1YADA 4NX5A 1PVNA 2DZWA 1XKYA 4I7WA 4QISA 1GG1A 3W1TA 5LGXA 4O8RA 3LHVA 4N02A 4FXSA 3L0NA 2OT1A 3OVPA 1WOAA 5G2IA 1VC4A 1EP3A 1O5KA 4R34A 1NAL1 4NJHA 3NR0A 4NU7A 4UTUA 3IGSA 1LDCA 1ZENA 3W2MA 3NG3A 3L2IA 3BGGA 5G4EA 2UV8G 4AWTA 2FFCA 3VE9A 2Y62A 4WOZA 4O11A 2A7RA 1JJKA 1TTIA 2VEMA 4UMCA 3FYPA 3P8JA 2H90A 5CPNA 1Q6LA 1GPWA 4JDBA 5C5YA 1RQBA 3M41A 1XUZA 5DBUA 6TIMA 3DFNA 5G4WA 3FA5A 3S0CA 4Z0JA 4ORMA 1PS9A 1OFRA 4P61A 5AHEA 2ZDRA 1NF7A 2VFFA 4EWND 3UWYA 1SSGA 1DJNA 2FLIA 4PL2A 5L6UA 3ZFHA 1QNVA 4A22A 2Z0IA 4UFMA 1GWJA 4IX2A 3CIWA 5CKSA 2ZTJA 5BMXA 3FS2A 1W8SA 1FDZA 1KM0A 4FNSA 1DOSA 4LU0A 4JTTA 4JX5A 1WX0A 1JCMP 1HO4A 1EX5A 1OFDA 4FF7A 3FLUA 3NAVA 4XQ6A 2QCDB 1EP2A 5F2MA 1KFBA 1TRDA 2F7FA 3T78A 4K7VA 4UTTA 1R46A 5DCDA 1GZGA 4TR9A 5D2VA 1Q3NA 4QIUA 2CFFA 2YYUA 5D32A 3S1WA 4DEFA 3W1RA 4YMZA 2RFGA 4JGDA 3QMTA 3N2MA 5AC6A 1FWTA 2IQTA 2R91A 4O4VA 1YTEA 3P84A 3GAYA 1VS1A 1ALDA 1RZMA 2PE4A 2DZSA 2H6RA 3NQVA 1VR6A 1DJQA 4Z1DA 4BI6A 2OCZA 3PVFA 1ME8A 3UY7A 3LI1A 3UQNA 1TJPA 3TH6A 3B8DA 3BLEA 4OQVA 3CC1A 2DP3A 2VC6A 3QH2A 3M43A 5DY3A 2X1UA 3C4UA 4MZ1A 3GDTA 1AL7A 3BG3A 2E5CA 2Z6JA 4CQ9A 3SW6A 4Z0SA 5CPOA 1V5XA 3TK7A 1TTJA 3NO5A 3USBA 5EA9A 4O17A 1LLZA 1ZAIA 2VEPA 3EXSA 1LBFA 1NF0A 4LC6A 3KAOA 2ZA2A 3Q37A 1G4EA 4WOQA 1DQWA 3TR2A 3P5ZA 1KBIA 4D2JA 4JTIA 1R47A 1QPNA 3DXIA 1AL8A 2CW6A 2ABBA 3NL6A 3NM1A 4WJEA 1H7NA 3TXVA 4HPXA 2Q8LA 3M5VA 3O1NA 3IVTA 4L4MA 4DQWA 1D3GA 1OABA 3BW2A 2OMAA 3EWXA 1QDSA 2ZA3A 4CNPA 5K7JA 5I3FA 4ZQPA 3UWWA 4MUZA 5TIMA 4YCPA 3TW7A 2NWSA 7TIMA 5GVJA 3G1VA 4Y8FA 2A7NA 4YCOA 3RK8A 3W7EA 2GJLA 5CGQA 4DO4A 1OYAA 3EX4A 1JCNA 1DKWA 1KFKA 2RHGA 3G1YA 2A4AA 1OFOA 1K7XA 2RDUA 3NQGA 4AB4A 4CCCA 2QAFA 3STCA 1L9WA 4AXKA 5D2TA 2TYSA 3MP4A 5ABTA 5E93A 4LVAA 1RVGA 3C2OA 5AC7A 1OF6A 3L5AA 4N6FA 4NJGA 4Y9AA 5H2ZA 2CLMA 4S2CA 1YXCA 4HSOA 1P0NA 1KM5A 2AGKA 3W22A 1WV2A 2ZRWA 3CM4A 4M6VA 1DORA 3QRHA 4RR4A 3CHVA 1RR2A 4OU1A 1G4TA 4POCA 1CX9A 3PWAA 3O63A 3TCEA 1Z44A 4UFHA 1H60A 4ORIA 3W7PA 3CPRA 4ADUA 4PA8A 3L9CA 3VKJA 5KSWA 1ZCOA 2FB2A 2C15A 2NX3A 4UTLA 3E96A 4IXXA 1AW1A 3PM6A 4NZFA 4O28A 3QEZA 3O6YX 3STEA 3BO9A 4NXKA 3P7YA 3FFSA 2CLHA 3F03K 3NQ6A 3S1VA 3G18A 1TPH1 3MHGA 4DBDA 4RCXA 4NUWA 3KXQA 1I2OA 1T96A 1O94A 2E09A 2VFDA 1XFBA 5AHMA 3F4NA 1G4SA 2V5BA 1X6UA 4K7YA 1M5WA 1JQVA 3K30A 4MLJA 1ME7A 2Y70A 1ICQA 2EGZA 3G22A 1D3HA 1KM6A 4WY0B 1DVJA 4XBKA 1T0OA 2A85A 1K8ZA 2EF9A 2C19A 1VZWA 3W1UA 4MKNA 5E1QA 4K38A 4QJ1A 1XBVA 3L5LA 1GVFA 5G5IA 3O07A 3IIVA 1O60A 3HPZA 2B4GA 2I9EA 2ZRUA 3NPWA 4E0CA 3RLUA 4O13A 4AH7A 3STGA 1R2RA 5HUPA 1XC4A 3RU6A 5K4XA 3A24A 1TV8A 4XBSA 3JS3A 4Y6GA 1EA0A 1OFAA 3W73A 1FCUA 3TAOA 1FXQA 5HJLA 3R8RA 4X2RA 4UXDA 4ICNA 5G1YA 5AHNA 3A22A 3QPZA 1W1ZA 4MY1A 1QPOA 4WY0F 3NQ7A 3PUEA 3W1NA 5AYZA 3DENA 4BR1A 3I7QA 4JYEA 3HG2A 4JR5A 3LXAA 1TPUA 1F2JA 3KRZA 3M0ZA 4N9EA 3QSRA 4C1KA 3LLFA 2QR6A 4E2BA 2QUVA 3W87A 3OBKA 4AWSA 4LNYA 3CLMA 2CLEA 2QUTA 3LHWA 4GXMA 4RXFA 4JTLA 3F1QA 5CSSA 5CPLA 2CU0A 1R2SA 2VKZG 1I2RA 5F2GA 1KLYA 2WJZA 4S1FA 1YYAA 4NVTA 5F4XA 3V75A 1LRNA 3W2UA 1GVSA 3BG5A 3Q94A 2J9ZA 4XZ9A 3SJ3A 4JIPA 5LHEA 4MVAA 3JR2A 4O12A 2R8WA 1WBJA 5IBXA 3W74A 3NPXA 4FX8A 4G1KA 3M5XA 3TJXA 1BKSA 1XCFA 1AMKA 3GDMA 1H7WA 2ZZ3A 4JTSA 1K03A 1SPQA 3DI0A 3P5YA 5K4ZA 2I1OA 2V0TA 3IRDA 3M1ZA 3ABOA 4PCFA 1P5BA 1QOQA 1LTDA 5FEWA 2BLEA 3HG4A 4QITA 5BNKA 1T8XA 2BWGA 4W9TA 2Z1BA 5C6MA 4PODA 2A0NA 1TQJA 1NEYA 4A21A 1EWEA 1KFJA 3KVKA 5F1VA 1SO5A 3DFTA 1X1ZA 1ZNNA 1LRQA 4MYXA 3W85A 3W86A 3DHDA 1G67A 4UCGA 2YCEA 4RZ4A 2ABAA 2TRSA 1KTBA 4K8EA 1FWRA 3M47A 1SUXA 3C2FA 3GXTA 3M6YA 3QJAA 3WJXA 1WA3A 4HPJA 4UNLA 5AB3A 3WK3A 1ZFJA 2QCHA 1ICPA 3DU0A 4RLIA 1W31A 5LHFA 4ZQRA 3EB2A 3S5ZA 2JKPA 3ANYA 1F05A 2YFOA 4UR7A 1FY6A 4CNOA 3W7LA 5D2XA 3IIXA 2WNZA 5D2WA 5FEXA 2WOQA 5L9FA 3H55A 5KITA 1OYBA 1VQTA 3LB0A 5IBXC 3NL5A 2PRLA 4BI7A 1ZAHA 1XL9A 4QM1A 1XDLA 4O4WA 4IJBA 5AOUA 5CZTA 4LUJA 3C2RA 1YDVA 5LNRA 3G3MA 3UY8A 2X1RA 4LS0A 8TIMA 1W5OA 1S5WA 5HWNA 3UXAA 1ICSA 4I9AA 1O95A 1TV5A 1QPRA 3BW4A 3CEUA 2QCEA 3PC0A 4KFPA 2YDAA 3C6CA 5EBUA 3SIZA 2BXVA 3MP5A 3SGZA 5C54A 3QQ0A 4UFLA 5G2WA 1PV8A 1VHNA 4DF2A 4X9SA 4KWWA 4CCDA 2B0MA 2ZZ4A 4OWGA 3V1PA 2BX7A 2A6NA 4MZYA 3TQKA 5MHBA 1OF8A 5FESA 3W1QA 5FF0A 5DELA 3WJSA 4JX4A 3PSWA 1L6WA 4FNQA 2V2DA 3OVRA 4DF0A 1KM2A 2YGYA 4MY8A 3S1XA 2B7OA 1I2QA 3HIJA 4AF0A 3S1UA 4GJ1A 1FCQA 3KVMA 3DFQA 3B4UA 4MIMA 3CT7A 3WJYA 3FKRA 1GG0A 3PUOA 5TQLA 2QKFA 1AG1O 4OV9A 3TA6A 4ZL1A 3GX9A 3QPYA 4N9BA 5FEPA 4RZ5A 4NZJA 3TU9A 3WJWA 2WPBA 2Y7GA 3MW7A 3PBWA 3ABSA 5D37A 1W5PA 1WBHA 1SZGA 3N14A 4M7SA 3AJXA 5HULA 1QFEA 5D30A 3NEVA 1JUBA 4MLRA 1W5NA 3W2JA 3ZWTA 1TJRA 4NT0A 1G7UA 2OZ0A 4JTUA 2WKJA 2ISSA 3NA8A 1Q6OA 2YYTA 2NXGA 3BARA 4DF1A 2BTMA 1IGSA 4M6QA 2GVLA 3IVUA 3LCIA 4M5PA 3W1XA 1LOSA 1LLWA 4XTDA 2NUWA 1UCWA 1GVRA 4A2SA 1KA9F 3T7VA 3RNDA 4NNCA 2AAMA 4PEKA 3HB9A 3O15A 4GUGA 4H4IA 2YPIA 3KHJA 4ZQCA 3MWAA 1YLVA 1VYPX 1X8FA 1Y0EA 4LV9A 1CI1A 3CEPA 1CW2A 1TO3A 3HG5A 3TW6A 1PE1A 4JY9A 1LORA 2VEKA 1RV8A 1KM4A 2JK2A 1W37A 3EWZA 3QF0A 4CQ8A 3S5OA 3PAJA 5DN1A 2C3ZA 3R2GA 3HGRA 4JY8A 3TUUA 5HINA 4Z08A 1FCVA 4N2YA 2D73A 3ZS4A 2V81A 1IXOA 3LCGA 3LV6A 1AK5A 2CLOA 2VENA 3W71A 2A5HA 1Q6RA 5KZDA 2DJLA 3GKAA 1EIXA 3W2KA 2QJGA 5I3KA 1SW0A 2Y7DA 2ZFAA 1VPXA 3NZ1A 5FEZA 3F4WA 3NM3A 2QCNA 5G2HA 2A1YA 4K37A 3UWVA 1K3UA 3HBLA 1TPVA 2Y7FA 3LRLA 3INPA 5LZLA 1EB3A 3GLCA 4Q4KA 5TBOA 1SZEA 3GYEA 3UWQA 2QCFA 1LROA 5D09A 5C2XA 3LBCA 4R7JA 2J9YA 1GYLA 3NQ8A 4MJMA 4PFMA 3MUXA 3KFTA 2ZQ0A 4CQAA 3TSBA 4O14A 2YZRA 2QCMA 2V8ZA 1FX6A 3LRMA 1QCWA 4JX6A 4DXVA 3FYOA 2X1SA 3LI0A 3IVSA 4E38A 4FB7A 1YTKA 1GOXA 3LCWA 3PBVA 4S2BA 4YWIA 1RQEA 3NQDA 5AYXA 3QZEA 3W7NA 1QMLA 4DPPA 4E2DA 4H3DA 2GQ9A 4NJJA 3T55A 4UFIA 1P4CA 2Q3RA 1B57A 3UWZA 2CZ5A 3GR7A 4Z1AA 1WAUA 3MP3A 2B7NA 3TAKA 1TSIA 1A53A 5D33A 5FF7A 5EL1A 3QC3A 1H61A 4XTIA 1RPXA 2KZHA 3M7WA 1TTQA 4TX9A 2NX1A 4JD4A 3GZ3A 3NL2A 3QQ1A 4KKXA 2Y88A 2W6RA 3W7GA 3TFCA 2Q3OA 4RXGA 1I4NA 3LDVA 4FEZA 4OE7A 1DV7A 3PS7A 3W1LA 3LGEA 1A5CA 5AHLA 2FJKA 1EEPA 5HWMA 1SO4A 2NV2A 1MSSA 1OX4A 2J9XA 3M9YA 4AAJA 2H3BA 2NXIA 1KFLA 1KFEA 2LLEA 1M7OA 3EEGA 1W3NA 4AHOA 3MI3A 4LVDA 4X3ZA 4UTMA 4LVGA 1Q6QA 1QWGA 3EXRA 1JCYA 3H54A 4WXZA 2VFHA 3BG9A 4AF0B 3TDFA 3GK0A 1H51A 3GNDA 3C3NA 3LCHA 3W88A 2E6DA 5I3GA 3C61A 3PUDA 3GKFA 5HNRA 1KW1A 2HMCA 1I2PA 4MYAA 3O6CA 3DFOA 1GYNA 3DKLA 3IIOA 2YXGA 3GIYA 1OK6A 1UBSA 3RFAA 3U8GA 3N3MA 3N9SA 5H91A 2FTPA 1SO3A 1KM1A 2XN2A 5AHIA 3S5NA 1WQ5A 1XBXA 4U28A 3SGUA 3FIGA 1J2WA 2QJHA 1A5AA 3KX6A 1JCJA 1TPEA 2VOMA 4WUIA 4I7UA 2QCCA 3TQ0A 3DGRA 1L6SA 2A7PA 2E5DA 4OGZA 3W7CA 3MI2A 2G5WA 3W7QA 1B4EA 4R53A 5DXXA 2QAPA 2CLFA 3OVQA 2CLLA 2QDHA 2X2GA 1WYIA 3W07A 1H7OA 5HQEA 1RQHA 2EHHA 1I8JA 3QSTA 3L5MA 5I3IA 3TC6A 3W7KA 3HGJA 3EX1A 5FF2A 3M44A 3T4CA 1YTDA 4NJIA 4AMAA 3LCLA 3B05A 5LNVA 1JRBA 1DL3A 2V82A 2H3DA 4GUIA 5CPMA 2X1TA 1OX5A 4JTJA 3VI2A 1ML1A 3W7HA 3MI6A 1M6JA 3NQ2A 1ZY9A 2GVJA 3R12A 3PBUA 4DO5A 2QCLA 3AO0A 1OJXA 4IX0A 3A23A 3BK0A 1VCVA 2CLIA 3NVTA 5KTLA 4UTWA 5CG7A 2W79A 1F7BA 3L0GA 3PY2A 5LNWA 3A21A 1L2UA 3LCXA 4K36A 3M5YA 2Z2UA 4O16A 3STFA 3UZ5A 4UFKA 3WFAA 4GUHA 4UTHA 1LOLA 3LOTA 1TPB1 2V30A 5AHFA 3GNNA 2YR1A 3MBDA 3CB8A 4M7TA 3HF3A 4JEQA 3KOFA 1KBJA 2FIQA 2YFNA 3EKLA 3PG9A 3GR8A 4CCEA 1MEWA 2GQAA 5DBTA 3S6DA 1K7FA 4LS1A 4JS3A 2Q8ZA 4QSHA 1UJPA 1O5XA 1MZHA 3T44A 5HUOA 1QO2A 4LOCA 4MZ8A 1A5BA 2NWRA 3G1DA 1GQNA 5DCBA 5J5DA 2NXHA 3RLVA 5LGZA 4BWLA 2ZTKA 2HSAA 4N9DA 3G24A 1SO6A 2FQIA 3PB0A 2GQ8A 1TV7A 4JYDA 3BPWA 4IMFA 2VFGA 2BZNA 3RMJA 3LV5A 4ZQNA 4BK9A 5EMUA 1OHLA 4YXGA 2JKEA 2HS8A 3Q2DA 1H63A 4UMAA 1QAPA 4O1DA 4UTWC 2A6LA 4RX0A 5F2IA 3TX9A 4HNVA 3PR2A 3G1SA 1OFQA 4ZZ9A 2ZZ1A 3UNDA 2NUXA 1F74A 2V2HA 1VYSX 3S5YA 4RK8A 2YX0A 3CWNA 4K39A 3O6DA 2P1FA 1QPQA 4HIBA 2DZTA 4PH6A 2DORA 4BI5A 2ZRYA 5D02A 3P74A 4OV4A 4XKYA 1U5JA 3B0UX 1B3OA 2Z6IA 1OX4B 1XM3A 3P61A 1TIMA 1SZFA 2GUUA 1ME9A 2VFEA 5HR6A 4JTHA 4KFOA 1WOBA 2X16A 3L65A 1PCWA 3PULA 1W56A 1X7FA 3LBMA 1EUAA 2PURA 3HG3A 3P60A 3ABRA 5FI8A 3G0UA 1OVDA 2CZFA 5BW6A 3YPIA 3QM3A 2GOUA 4I7VA 4FNUA 1GJPA 1N8FA 3E49A 1C29A 2NV1A 5AN7A 3CTLA 3N2XA 4R33A 1C9DA 3KRSA 2QDGA 3G8EA 3P82A 2DJXA 4FIQA 4BWLC 1BTMA 3KRUA 5KINA 4BF9A 5EYWA 3SI9A 4UTJA 1FQ0A 3N9RA 4UFJA 1VJIA 5K9DA 1J4EA 2G96A 1MXSA 3EWYA 1G69A 3CWOX 2YW4A 2FDSA 5D03A 1HTIA 2Y63A 3DH7A 3QW3A 2ATMA 4QQ3A 3UPBA 2YW3A 4HKPA 3W2LA 5K3VA 1F5ZA 3CU2A 2XN1A 3ZR4A 1P1XA 4WXYA 5AYYA 1FCBA 4GUFA 4IMCA 2DZVA 3TROA 3W83A 1H7RA 3NQCA 1LBLA 2O7SA 5F1UA 5FF3A 3NXFA 1XXXA 3EX3A 3TE9A 2WSYA 3FEMA 3GAKA 3WK0A 3OA3A 4GWEA 2F84A 3E9AA 3EX6A 3TFXA 4KWVA 2ZZ6A 3EWWA 1H7PA 3THAA 2WV8A 1TPFA 4X22A 4OBTA 2DZPA 2JGQA 4FNPA 4IQLA 2FPTA 4LTSA 4MFDA 1IXNA 4ZQMA 5AFDA 1C8VA 2A21A 3W2NA 1AW5A 1JR1A 1G6CA 3P80A 1YPIA 1HFBA 1SU5A 4XUGA 4O1AA 3LHUA 1N55A 2Y89A 3NL3A 1F6PA 4FXRA 1J5TA 3N34A 4LRTA 3EKZA 1NFBA 1HG3A 5FF4A 1H7XA 2VELA 4HNNA 4A29A 5I3JA 1QOPA 3PG8A 2HS6A 3ABQA 1E51A 3NQEA 2B7QA 1H1YA 5A5WA 1H50A 3O16A 4AHQA 3M5ZA 3NYZA 5CSRA 2ZBTA 3P62A 1FWWA 5DXYA 4U4MA 3I68A 5BRBA 2H8XA 2QUUA 4MPQA 1PHQA 2C16A 3FKKA 6ALDA 2JKAA 4ML9A 4EF9A 1V7YA 3CIXA 4O19A 1GEQA 1RD5A 1R30A 4FHAA 3R89A 1XI3A 1VCFA 2W0UA 5T26A 1PIIA 4N9CA 4DELA 4EVZA 3HPSA 1SZNA 4PL1A 1KTCA 2Y61A 3TNOA 3GDLA 3BLFA 3LRKA 5KZEA 1IXPA 2ATSA 3C2EA 1VRDA 2E5BA 3SFKA 3N19B 1MO0A 1FXPA 1LCOA 2ZRZA 3LERA 1FWSA 1W5MA 3UPWA 2C0AA 4JXCA 1THFD 2RKXA 1SW7A 1GTEA 4LW7A 3UZJA 1JCLA 3S9YA 5CZ0A 3W72A 4J9JA 4GE8A 3B0PA 1KLZA 3C8FA 3QFEA 3TV8A 3BW3A 1XBZA 1TRIA 3UWUA 2JBMA 3B0VC 3B03A 4N6EA 4QNEA 1AW2A 3IV3A 4HT3A 4HHPA 3S8HA 1K8YA 4WY0A 2E6YA 3A5VA 3L67A 4LV4A 3BVJA 3GDKA 3BLIA 1VLIA 1L6YA 4ZQOA 3I7SA 2RDTA 1SSDA 4XKYB 3W76A 3OEXA 1D9EA 1A50A 3LM7A 2ZRVA 2ZZ7A 4WZHA 3D0CA 3GVGA 4O54A 4MOZA 3PB2A 5K9CA 5F2LA 3R13A 1F73A 2E6AA 1GT8A 5A8GA 2PCQA 1LZOA 1XBYA 1JRCA 5EPDA 1YPFA 4O0ZA 1Z42A 3DFPA 2RH9A 3TXZA 4GUJA 4O10A 4O50A 3ELFA 4ZVJA 1K02A 3EWUA 2FPVA 4MY9A 4UNKA 2PRHA 3VNDA 5F4WA 2NZLA 3ATYA 2I14A 2DU2A 2ZA1A 4O15A 1SFLA 2R14A 2P0OA 4OT7A 1JUEA 3HPXA 4IUOA 4FX7A 4KFNA 1OG0A 2TSYA 5U4NA 3ATZA 3VCRA 4AEOA 2NUYA 4O52A 1TMHA 3UD6A 1XDMA 1TPDA 3W3OA 4EIVA 2OX1A 3W23A 1LP6A 2QJIA 2TMDA 1VCGA 4RKAA 3PSVA 1FBAA 4ADTA 3TKFA 2C18A 3DKJA 3E0IA 2Y6ZA 2G97A 1F76A 3BGJA 3N73A 5AC8A 3W70A 5DCEA 3SY5A 2ISWA 3W1AA 3C56A 3LX9A 4HN4A 2CZEA 4UIOA 4JYFA 3L68A 4UTTC 2O7QA 4RJEA 1X1OA 3W7DA 1GTHA 4AHPA 1EWDA 4JNMA 4LVFA 4JTFA 2C1HA 3G8RA 1IXQA 1KV5A 2EAWA 2X30A 4LRSA 4Y96A 1OFBA 1W0MA 3Q58A 5D05A 1PL9A 3G1FA 3LTYA 3LTSA 3EWBX 2ZZ2A 2ZZ5A 1LOQA 5D04C 1JUKA 1IF2A 4JDYA 4K6AA 3W84A 2XFWA 1LM1A 3W7OA 5LNSA 3P67A 1UASA 4A3UA 5BOOA 2CLKA 4IPJA 2GJNA 3WJZA 4ONVA 1XUUA 4JN6A 4AWUA 1M7PA 4PTNA 3QYQA 3W7MA 3KVLA 2WNQA 5G1TA 1OK4A 4BFAA 4NNAA 4UTKA 2ZRXA 1H62A 4O1CA 1OFPA 3O06A 4NXSA 4O18A 2GVGA 3G1AA 4CLMA 1S3HA 3SECA 3W7JA 3LTPA 4JIQA 4IXHA 2FB3A 1H5YA 2A2IA 2CZDA 4HNUA 2P10A 3QMSA 1UUOA 2R94A 3NPUA 4XWUA 3EX2A 3THQA 1G4PA 4WD0A 3LXBA 2WNNA 4L4LA 5D2YA 4IMEA 1T99A 3A9IA 2C6QA 1A5SA 3KVJA 1B9BA 2E77A 3I65A 1FWNA 4GC4A 1H1ZA 1UB3A 3LLDA 1HO1A 3RF9A 3HGSA 2NX9A 1LBMA 1F6KA 4B5NA 4ZMGA 3W7IA 3HOJA 3C0JA 4LC8A 3TIMA 1OX6A 2TPSA 4M6PA 3FJ6A 1ZJIA 2J88A 3IGUA 4LS2A 3WK1A 4MFEA 3GXPA 3L21A 2YSWA 1FUYA 1JQXA 4Q32A 4IOTA 3I6RA 2E1DA 5LNUA 3FJLA 1EPXA 3PF3A 1NSJA 3DI1A 2WQPA 4JTKA 3SSJA 5KMYA 1VHCA 3W1PA 3M16A 4DBEA 3G1HA 1YDNA 1WXJA 3L0KA 3E12A 4O0KA 3S42A 2E6FA 2CWNA 4Z1BA 4GNJA 2C13A 3UYCA 3P81A 5I3HA 1ZAJA 3GXNA 2Y7EA 5LSMA 4TU1A 2QEZA 5EKYA 1VLWA 4LT9A 1TPC1 1KTNA 3IIZA 4H6KA 4AVFA 5DY2A 3MHFA 1W5QA 3MMTA 3W9ZA 4Z1CA 5C55A 3BV4A 3G1XA 3G0XA 4QAIA 4FNTA 1DBTA 3A5FA 2ALDA 3IGXA 3VFLA 1S5VA 4JICA 2ZCGA 1BEUA 4GFSA 3GDRA 1HUVA 4K8HA 4CNNA 2PRMA 1QR7A 1EP1A 2AQWA 3PBYA 3WK2A 1SW3A 4C1LA 1I2NA 2VXNA 1EUNA 3I7RA 1U83A 2J6XA 3NQFA 4RV8A 4TMCA 3OIXA 1TREA 1FDYA 3LHZA 5J5RA 1MEHA 3G0SA
chains in the Genus database with same CATH superfamily
1W9DM 1YXDA 1OZQA 2G95A 2BHZA 3T0BA 3DFSA 3QYSA 3H24A 1XRTA 3KS5A 3TMQA 1VKFA 2ZC1A 2X42A 4NNBA 4UMBA 2I9UA 4IWWA 3SCQA 1BWKA 3AXMA 4LUSB 3WBXA 2YXOA 1BD0A 1QRQA 4JKLA 4LAMA 3AS0A 4JTEA 4DPQA 3UYIA 5EY5A 3CPGA 3IUHA 1F3TA 3PN8A 3MYOA 5C9UA 1XHGA 4A2RA 5BWAA 3KOWA 1W54A 2JGYA 3C52A 4U5IA 3A3WA 1ISZA 5HNTA 3ITYA 1V3HA 1PO9A 3EXTA 1US2A 3OGSA 3ID7A 4DJDC 1Z48A 1P0KA 1OYCA 1VFOA 3BXWA 4F40A 2WSRA 3NDOA 1KM3A 4CQCA 3P3BA 2VZOA 3E02A 3KOYA 3VGDA 3R10A 1PZ3A 3I3BA 4UOJA 2GGHA 4AY1A 3EEZA 1GVOA 1T41A 2UBPC 3LU2A 3BLDA 3HTWA 4UUIA 2GGJA 3FOKA 3F2DA 3LHTA 2DGAA 1SYTA 4Q4QA 1IQ8A 1TYGA 3NGJA 4CN1A 3MHUA 2XISA 3DAQA 5B80A 5I2UA 3Q65A 1UPMB 1Y65A 2V9DA 1VH7A 2X0SA 5SWUA 3WLTA 2QCGA 3N15A 1RALA 3CBWA 4XB3A 2OXNA 3C2VA 4EK7A 3W7RA 3A12A 1UUQA 4H2CA 3VD9A 4IGSA 2OT0A 4GRSA 3PP7A 1FRBA 3AIWA 3C0LA 1LF1A 1PZ2A 3P0WA 3B04A 1IIGA 2H8ZA 3F5JA 2WKGA 1EBGA 1CXIA 1J12A 1QNRA 1J01A 2WHLA 1JD7A 4EXQA 3T05A 2FKPA 5HR7A 3SSZA 2PTDA 4LVBA 1GOQA 3R1ZA 4IZGA 2W62A 3GTNA 3UXDA 1FDJA 3E3HA 4IGHA 1DJHA 2Z7KA 1QBAA 4O1BA 3ARWA 4YVVA 1YE4A 2XH2A 2DFAA 4ADSA 4AZ5A 2E8ZA 5D8ZA 2RGLA 5JXQA 3BMXA 1GZ1A 1QNOA 4OOZA 4N4PA 2PF8A 5CZJA 3SZ8A 2QUMA 1N7KA 4GCAA 1DXFA 1J0HA 3WF2A 2W92A 1SFSA 2VEIA 2ZYFA 1E6RA 5M1TA 4DUOA 1YADA 4I7WA 1EO7A 4QISA 4S3DA 2YCJA 4QGCA 1LT8A 5M17A 2OELA 1GJWA 3H4XA 2V5DA 3XIMA 5G2IA 4HSHA 4B90A 4PCNA 4GZ7A 2O55A 3K8MA 3KS6A 3O9NA 4R34A 1F8MA 5JIPA 2YBTA 5MKGB 4UTUA 3ENLA 3ARTA 3W2MA 2JF7A 2VO5A 4AG0A 5G4EA 4AWTA 4QCFA 3Q4DA 3GVWA 3VYLA 1SJCA 3SN0A 1EC9A 1VJSA 4RDVA 3G6LA 3GG7A 2J7FA 3BURA 1XUZA 2WC4A 3OZMA 6TIMA 1QJWA 4N7QA 4Z0JA 4ORMA 5T91A 1PS9A 1ZJHA 1EOKA 1WZMA 4JEJA 4KGLA 2ACRA 1QNVA 1B1YA 4QS5A 1W1PA 2R9RA 3APGA 3FS2A 2Q8XA 4FNSA 1DOSA 4LU0A 3WELA 1TVPA 1UOZA 4JHOA 1HO4A 1QXLA 4XD6A 3QHOA 1MXDA 4GQBA 2EG6A 1DWIM 4XQ6A 2QCDB 4M1BA 3T78A 4K7VA 5CZKA 2PDFA 1Q3NA 2Z7GA 4DEFA 3W1RA 1PZ1A 3SCVA 1U30A 1W8GA 3OG2A 4O4VA 1YTEA 3FXGA 3NYDA 1PX4A 3GAYA 3NQVA 2PWHA 1VR6A 4J3WA 3SCTA 3VPLA 3UWEA 4FAMA 2E67A 3PVFA 3RN6A 1A5NC 3LI1A 1Q63A 3TH6A 3BLEA 3R94A 2OPJA 1E3ZA 3CC1A 1FWIC 2WWDA 4C6KA 4GIAA 3GH7A 1KGWA 2CNCA 3M43A 5DY3A 1UP0A 2VL4A 3M46A 4MZ1A 1NWTA 4F0SA 4QSFA 2WBKA 1AJ0A 3RM4A 1TTJA 3EKGA 3NO5A 3USBA 5EA9A 1ZAIA 2PWDA 3EXSA 4LC6A 2O9RA 1DQWA 1WNOA 4B5SA 3P5ZA 1P43A 1KCXA 1XYBA 4J3UA 3TYCA 3N4FA 1R47A 2DSWA 2SFPA 4FXFA 2E8YA 5EB8A 3MT1A 2CW6A 2ABBA 3NM1A 2BVTA 3IJIA 4ATWA 2C79A 2Q02A 1H7NA 1Z7AA 3WY1A 3M5VA 4JIEA 2WYSA 1NDYA 3WLPA 4DQWA 5I77A 1IZJA 2OSYA 2IPWA 4CNPA 5I3FA 1TMLA 3CTTA 1XR2A 4YCPA 3TW7A 2NWSA 2GGEA 3ES7A 7TIMA 4HNLA 4DJFA 1KR0A 4DWSA 4Q8NA 3RK8A 1ITXA 2GJLA 5CGQA 1DIEA 1OYAA 3EX4A 2QJJA 3G1YA 3DBNA 2HXUA 5AC4A 3SCSA 3NQGA 1AMYA 3EOSA 1ZSXA 4PSRA 2TYSA 3BANA 5E93A 1OF6A 3T6CA 3PPHA 3E2VA 4N6FA 1NQ6A 4EXBA 4Y9AA 1LWJA 4JCLA 2I5GA 2CLMA 1P0NA 3KDOA 1KM5A 4I9MA 4TUFA 2A79A 4GZJA 4B3LA 4RR4A 1RR2A 3IWPA 3GG1A 3B8SA 1G4TA 4POCA 4UCFA 1CX9A 2P88A 5FJUA 4PTDA 4UFHA 3CPRA 1KXTA 4D6IA 5KSWA 4PUEA 4XG1A 2EQDA 2FB2A 3CHEA 4ATDA 5M3WA 3MANA 1BXNA 3QR1A 4IXXA 4O28A 3RLHA 3PWGA 3WDIA 1TJ1A 3ALFA 3F03K 2Y1HA 4S3BA 2WVSA 2OGYA 1PX3A 3MHGA 4L61A 5GQBA 2E09A 2VFDA 1G4SA 1X6UA 2ZVRA 3E0FA 4DB7A 3CQKA 1RBLA 4MLJA 1ME7A 2Y70A 3CQJA 2VZSA 1ICQA 2DW6A 3G22A 1D3HA 4WY0B 1T0OA 2A85A 5LXXA 3FHAA 3OO2A 1CWYA 2VZVA 3W1UA 9XIMA 1W3LA 3ARQA 3M0VA 3OQEA 4YHGA 3L4WA 5E1QA 4K38A 3M64A 2F2KA 3UERA 2VX7A 3IUDA 4MNKA 2HDJA 2B4GA 3CUIA 2MNRA 7CGTA 3NPWA 4HA0A 4AH7A 5HUPA 3RU6A 3IANA 3JS3A 1EA0A 1RVKA 3W73A 4ZEPA 3TAOA 3KL5A 5HJLA 4F0MA 5D9NA 3QKZA 4X2RA 3R8RA 1VFUA 1QI3A 3WLQA 3AAMA 3QPZA 3AYRA 4MY1A 4WY0F 4LH8A 3PUEA 1P6WA 1IR1A 4CNTA 5AYZA 4JYEA 4JR5A 5H1WA 4ZTYA 3KRZA 4N9EA 4C1KA 2NSOA 3QSRA 5REQB 1JZ6A 2QDDA 3LLFA 1DJGA 3KW3A 1CZ1A 3OBKA 2UZ9A 4AWSA 4LNYA 3H22A 1UR0A 3H7RA 2BY0A 3LHWA 4JTLA 4L1GA 2XWEA 3CV7A 1W1VA 1R2SA 3LQGA 2VKZG 1I2RA 5F2GA 2P8BA 3VNMA 3V75A 2Z1SA 1GNXA 1LRNA 1GVSA 2J9ZA 3MUAA 3W6MA 4XZ9A 4MVAA 3I4EA 1J0ZA 2W91A 2CETA 4DLMA 1WBJA 7PTDA 3HJEA 2Y8KA 1M03A 4Y9NA 2OLAA 4C6CA 3LMYA 3M5XA 4IL2A 5HATA 1UR1A 2GUBA 1H7WA 4JTSA 2J8TA 4GPNA 3P5YA 1K9FA 3IRDA 1E6ZA 3ABOA 1N8IA 4KESA 1XINA 3W81A 1GKPA 5FEWA 3VIIA 3L2MA 4QITA 5BNKA 1T8XA 2BWGA 5C6MA 2A0NA 3II1A 4GI8A 1TQJA 3EZ4A 5F1VA 3BAYA 3MS8A 4HHMA 3TTYA 3W86A 2DT1A 4B4HA 2YCEA 4RNHA 1EJUC 1NWUA 4GO8A 4K8EA 1FWRA 1TFVA 1V03A 3M47A 3GXTA 4A8LA 3QJAA 3WJXA 2XSXA 4HPJA 4UNLA 4GYPC 1EDGA 1ICPA 2Z1VA 4AYSA 4ZQRA 4KCUA 4W8BA 1OSEA 1FY6A 3ZJKA 4CNOA 5D2XA 5D2WA 3BZJA 3UF9A 5L9FA 2EEXA 3NQBA 3B0YA 1WB0A 3NL5A 3C2YA 2PRLA 5DRIA 3RR4A 4O4WA 1PX8A 4Q8UA 1CLVA 3C2RA 2A3LA 3CHFA 1EOMA 3SFWA 5LNRA 1AH0A 1R7OA 3OZOA 1R3YA 3GU1A 1F6YA 1GCYA 3FVMA 5HPCA 4NY2A 1TV5A 4DZ5A 3CEUA 3D6NA 3CWHA 3FV9A 5C54A 1UKPA 3ES8A 4X9SA 4CCDA 5ENLA 2VZTA 3S2MA 1J96A 1OF8A 3IPWA 4AIUA 3PSWA 1L6WA 4DF0A 3S1XA 2YGYA 4MY8A 2B7OA 4E8CA 2QMKA 3DFQA 3WJYA 3FKRA 1E73M 4GVFA 1GQKA 2JF6A 4QBXA 4WHBA 1KCLA 5FEPA 2DQWA 1F4AA 3SY8A 1ODZA 1JZ8A 3MO4A 1GJUA 1XCXA 3AXXA 1Z3NA 4REQB 4M7SA 3N14A 4J1OA 3EMZA 3K8KA 1W5NA 3W2JA 3OLEA 7ENLA 2NT1A 3QV7A 1TJRA 4E4UA 2OZ0A 2GVEA 3HFYA 3RX4A 3WQPA 2ISSA 1IGSA 2ZVIA 1YBQB 4M5PA 1LOSA 4ACZB 2MANA 2NUWA 1GVRA 7XIMA 2V3EA 4A2SA 3T7VA 3RNDA 4AZ7A 4GVHA 2AAMA 2J6VA 4C5YA 1Q6EA 3R43A 4IFOA 1WKYA 4U5KA 1ZBWA 4GUGA 4H4IA 2HEJA 2YPIA 3IS4A 2V3DA 3MWAA 1O12A 3GFZA 2JIWA 4LV9A 3GNRA 1U1JA 1CW2A 1TO3A 1CGUA 3LZ5A 4KT2A 4DXXA 2VEKA 1J6OA 1RV8A 1KM4A 4X60A 5T9BG 1MQRA 2Y8UA 4J27A 3QF0A 3PAJA 4HZMA 2EPMX 3R2GA 2VR5A 3HGRA 3TUUA 1S2TA 4PZVA 4ZE5A 3A47A 2D73A 4C91A 3AIVA 1TWSA 3G5EA 4WEVX 2DJLA 1ELSA 4MB4A 2WXDM 3TP4A 3OBEA 3LA4A 4EE9A 1AUSL 3W2KA 2QJGA 5I3KA 1ZGDA 3O2LA 4G6CA 1TWZA 1UD8A 4DJED 1MMFA 3RLGA 3UR7A 1GW1A 3VIGA 2A1YA 4KIEA 4LX4A 3I3EA 4K37A 2V3FA 4V27A 3UWVA 4HOWA 3LRLA 3M0MA 1EB3A 3GLCA 4Q4KA 3OYXA 5TBOA 3GYEA 3M0JA 3UWQA 4B4FA 5D09A 3PWIA 5C2XA 3LBCA 2ZXAA 3GNOA 4U33A 2GUYA 4C6BA 1EGMA 3NQ8A 4PFMA 3KE0A 3MUXA 3KFTA 2ZQ0A 4YTTA 2A3HA 4ZO6A 1E70M 4QE5A 2PA6A 3LGDA 5HQLA 2QCMA 3T9PA 3LRMA 3O0KA 2X1SA 2W67A 1DXIA 3WH9A 2ZX5A 1AQMA 2P53A 3ZIZA 1QNPA 3NQDA 5AYXA 2QNEA 4HK7A 4LCSA 3KEHA 4NJJA 4GYFA 3GH5A 3T8QA 1B57A 3UWZA 1JZ3A 1WAUA 3E0LA 1XH1A 3BLLA 4XTIA 1RPXA 1SM9A 2KZHA 3KWXA 1EBHA 3GZ3A 3NL2A 4KKXA 3S47A 3GU9A 1Z32X 2W6RA 4RXGA 1XICA 4B2DD 1OCJA 3W1LA 3B97A 1AD1A 1A5CA 5AHLA 1QHOA 3BCDA 5A8OA 4AD1A 3PZGA 1OX4A 2J9XA 4HA3A 4AAJA 1J6PA 2NXIA 4H01A 1BF2A 3UZXA 2VVNA 4UTMA 1RUSA 5DF0A 1OCNA 3EXRA 5DMYA 2X8RA 2VFHA 2ON3A 3GK0A 3LCHA 1ISVA 3MKVA 4B91A 4Z17A 3I4KA 1TX0A 1I2PA 4K3ZA 1K8CA 1GYNA 4QX4A 5ECVA 3U8GA 4QEEA 2OO0A 2OVLA 2FTPA 3GHSA 4AZHA 3F2BA 2Z1KA 4U28A 2YDRA 3GS6A 3SGUA 3FAXA 3N1AA 2WKLA 1PPIA 2VOMA 3N2OA 2J77A 2GFTA 3U7BA 2DVXA 2FFIA 2A7PA 2E5DA 4OGZA 3R8GA 5LA2A 4R53A 1L8PA 5LIYX 3SADA 2D3LA 3ARSA 1UH4A 2XH4A 3OVQA 4DO7A 1I8JA 3L5MA 3NEHA 5I3IA 3HGJA 4YTUA 3CUJA 5LNVA 5CPMA 2X1TA 1OX5A 1ML1A 3NQ2A 3S2NA 3QGKC 1E0WA 4JIHA 5A3HA 4DO5A 1B3XA 4Q8PA 3M4HA 1V3LA 4G7EA 1A80A 4P8UA 3IJ9A 2EJAA 5KTLA 4K1WA 4UTWA 4QE1A 2PDUA 3V7PA 1F7BA 2WMJA 4F48A 1L2UA 3WQFA 4RDYA 1XYFA 1VIWA 1FTXA 2Z2UA 2D22A 3KHDA 1Y5WA 3UZ5A 2PGWA 3PZUA 4WSKA 1LOLA 3LOTA 5AHFA 4BQ2A 4UQAA 2JEPA 2TODA 4FLOA 1WXZA 3CB8A 4JEQA 5AVNA 3WNLA 2XVNA 2IPJA 3VNYA 2QT3A 4Q3MA 4W7WA 4QSHA 3T44A 3BMVA 3B8UA 3G1DA 3KDNA 1GQNA 2X40A 3T81A 2L5HA 2WVUA 2VGFA 4BWLA 4PSPA 2HSAA 2NV9A 3GFYA 1ISWA 4NP7A 1V4YA 3PB0A 3G77A 3ZSTA 1AFSA 4H6QA 3BPWA 2VFGA 1MUCA 4Z2GA 4IIEA 4XZWA 4Z2LA 1BYAA 5EMUA 5FAJA 1OHLA 4IGNA 2HS8A 3Q2DA 4RE3A 1CT5A 3VGFA 1UMYA 1VFFA 4DLFA 3PR2A 2AQVA 3G1SA 1NH6A 3MDWA 3H2OA 3UNDA 1BG9A 1CDGA 2V2HA 2YX0A 2E4TA 3W29A 4XKYA 2WZHA 1HJQA 2VFEA 1K4HA 1SZFA 4A8NA 1F07A 4KFOA 2X16A 3L65A 3HPAA 1REQB 1W56A 3CAVA 3LBMA 2NW0A 5A94A 3G0UA 1ZP3A 3P0XA 3GO2A 4FNUA 5C2CA 1VEOA 3AIBA 3CTLA 4JL2A 1BG4A 4U31A 2DJXA 1BTMA 3DYMA 4UTJA 3VKAA 4UFJA 3DYPA 3CZLA 4XZHA 1MXSA 3EWYA 4O0QA 1PKMA 3K13A 4NF7A 2FDSA 1HTIA 1A3XA 1B3WA 3MVIA 3OLGA 4XO6A 2PTYA 4G7FA 1L8NA 2YBUA 1PDZA 1O5RA 1F5ZA 4Q8OA 3CU2A 3BSGA 1GYMA 1UZ1A 3OOQA 5AYYA 4GUFA 1JEZA 1RH9A 4IMCA 3IARA 2PDMA 5BXRA 3UR8A 4DRSA 1WXYA 2HVMA 4MJ4A 2QUNA 5FF3A 1XXXA 1E6PA 1BKHA 3FEMA 3GAKA 3WK0A 2F84A 4L1WA 1YIXA 3GQYA 2PTXA 1XISA 5EGRA 2DZPA 4AY7A 3PAOA 4W7UA 4LTSA 1IXNA 1EJVC 1C8VA 2A21A 1PJ9A 2I5QA 3KTCA 1K6AA 2Z4GA 3P80A 4X2PA 2Y89A 1F6PA 2WHJA 4KWOA 1H7XA 3PG8A 1KWGA 3AXIA 3UCQA 2B7QA 1N82A 1H1YA 3N25A 3BE7A 5BXSA 2IKGA 1GOWA 3I68A 4MPQA 2D0FA 2RJGA 3NSXA 4ML9A 2E25A 5E6YA 4BCEA 4MWAD 1AH3A 5BCAA 3GNPA 3CIXA 3VD3A 3DC8A 1VENA 1TUFA 4WJXA 1H1NA 4FHAA 4GA8A 1VCFA 3U5YA 4N9CA 3HPSA 3TNOA 4Q7NA 3URBA 1TVLA 4KCVA 2ATSA 4I8DA 3MZ2A 3VILA 3WDHA 2E5BA 3SFKA 5CC6A 3LERA 4HP5A 3KOZA 2C0AA 1NFGA 3CIVA 4JXCA 5E70A 1THFD 3LS9A 2VR4A 4LW7A 3DHUA 3R11A 1UR8A 2XFFA 4J9JA 5FJJA 2POZA 4L6HA 3AMGA 3QFEA 1EJRC 3E2RA 1BYCA 1C8YA 3EOEA 2F38A 5IDIA 1IWBA 4DJEA 2DT2A 4BF5A 1I9CB 2D3NA 4WY0A 5CEWA 3A5VA 4AIEA 5DMMA 3BLIA 4ROQA 2PWVA 1H41A 1VFHA 3I7SA 1SSDA 3IK2A 2ZRVA 1NQKA 2DV0A 5K9CA 4W5ZA 5F2LA 3R13A 5I23A 3M6DA 4ZOEA 4S3AA 1Z89A 2PCQA 4QLJA 1YPFA 3NFUA 4O0ZA 3L4XA 1D3CA 2CCRA 3Q67A 4E2OA 2EBNA 4O50A 4Q8WA 4NASA 4AZIA 4B16A 2FPVA 1XYAA 4UNKA 4V2XA 2QZRA 3OGVA 2NZLA 4CKQA 2WJEA 3GUGA 1E0VA 1GKRA 2R14A 2FHCA 1SJDA 2AL2B 3BL3A 3GTIA 1OG0A 4GQGA 3L4YA 3GC5A 3VCRA 1QK0A 4CQDA 4O52A 1TMHA 1G1YA 2PZ0A 6ENLA 1HW6A 3H21A 3BUVA 2QJIA 2TMDA 4MWAE 1QOXA 4C6QA 3FXYA 2C18A 3DKJA 4B2DA 2WVVB 2G97A 3N73A 4GKTA 5AC8A 1P7TB 1X38A 4S3GA 3GVQA 4HN4A 4JYFA 2Z1WA 1CEOA 2O7QA 4W84A 1XLHA 3AC0A 1E9YB 1CLXA 1EWDA 4AHPA 1UOKA 4LVFA 4JTFA 3VDCA 1YPXA 4YIWA 2J13A 4LRSA 2QHAA 1R3QA 4Y96A 3TN6A 5D05A 5A6LA 3W27A 2ZZ2A 4E3TA 1CYGA 2F6UA 3W84A 1UH3A 2XFWA 3ECQA 4NZCA 3W7OA 1DJZA 4DIAA 1ONWA 3P67A 3MC5A 4ZTXA 3VIJA 2CLKA 1A5KC 3NO3A 4D6CA 4LCQA 1M68A 4AWUA 3KVLA 1BFNA 4C6OA 2Y4SA 2GVGA 3G1AA 2BNJA 3SECA 1GVYA 4JIQA 5EMJA 4W93A 2ANUA 4HNUA 1G9HA 1OGBA 2D23A 1FP8A 4A6GA 4YHEA 2VGBA 4NZ5A 2GWNA 4XWUA 1R85A 3M0HA 3EX2A 3TYDA 4P8WA 1JG9A 4AEEA 2WNNA 4IMEA 3CLWA 1ZS2A 2C6QA 2Z24A 3KVJA 4FLQA 1HJXA 3CUFA 3I65A 4GC4A 2E1WA 4MNMA 1H1ZA 1UB3A 3LLDA 2J47A 2JE8A 1HO1A 3UVIA 3ZJ8A 4ZMGA 3WLOA 3C0JA 4LC8A 2OZ8A 2TPSA 4M6PA 1LJYA 2J88A 3WK1A 3GXPA 3L21A 4L56A 4RE4A 2VC7A 1JQXA 1CGWA 3WMBA 3I6RA 2AAAA 1EPXA 4QE4A 1YNPA 4JTKA 3U4AA 3G1HA 1GW9A 1R6WA 3GXDA 5I3HA 4MMWA 4GVGA 1OT1A 1UD6A 4TU1A 1E72M 5EKYA 1VLWA 2QPXA 4H6KA 5GJNA 4AVFA 4XAGA 3MMTA 3BV4A 3U4FA 1S5VA 4JICA 2ZCGA 1HJWA 3SUSA 4GFSA 4D1IA 1AZ1A 1CGTA 2QF8A 4K8HA 1ZPTA 3R8HA 5I07A 1EP1A 4DJDD 3WK2A 1EGVA 4C1LA 1Q8AA 1E9ZB 1ADDA 3BOFA 3I7RA 3NQFA 4LAOA 1WZAA 4TMCA 1VBJA 1TJ2A 1D2KA 3G0SA 3SQSA 4S3KA 2DQXA 3E0WA 4YYFA 3WLHA 5C8BB 3UXKA 4Q4RA 4YYCA 4FNRA 3U57A 3PJUA 1ZP4A 4H04A 1UUMA 4UQBA 1AA1B 4YL2A 3V0SA 1V08A 3ARXA 5E0KA 1XLJA 4WX2A 3HJZA 1V3KA 2VX5A 1BWLA 3NPVA 1ONRA 2NQZA 1Z41A 3P8IA 1KFCA 1TCDA 4JHZA 1Q6GA 3NURA 4LY8A 4D6DA 1XYCA 5CG0A 5I5RA 4J3VA 1TG7A 2BMBA 4US5D 3MMDA 3HO8A 1UD3A 2F61A 4M24A 1I45A 3TJLA 2PZNA 1TUXA 3W6YA 3VNKA 4M19A 1PCKA 1NWRA 4GY1A 4OHQA 3E5PA 4P7QA 5LYRA 2KAUC 2XN0A 3DZ1A 3OHIA 3MYPA 2EPHA 4UTIA 3UG3A 4HSNA 1G7VA 1RBOB 4Z2KA 3VGGA 1EC7A 3RMEA 1TR1A 1UZDA 1B4KA 4CGTA 1AVAA 5CZSA 4A4AA 1TTPA 3LQLA 5CPSA 4JN7A 5DT7A 3DECA 1DP0A 2HV5A 5A8MA 1GGOA 2EKGA 3LEPA 3NQAA 2QGHA 5K9XA 3P93A 1RJRA 4M1RA 5HMFA 4XD5A 3U7VA 4IPPA 5EU9A 3HPFA 3WQVA 2PU1A 3OBAA 2OJPA 3UJRA 1OADA 2GK1B 3CUZA 2PDPA 3N6JA 4I8YA 3RCNA 5HMSA 5HNUA 1E6QM 2PSNA 4XX6A 1KV8A 2NQLA 3EAUA 3LHYA 1WDSA 5KZMA 4A3QA 4YN5A 1U1HA 3DX5A 1S1RA 3S3GA 2J27A 3B9NA 2WSQA 4LWWA 3NOYA 1GK8A 1XPGA 4HVXA 3GB6A 2WB5A 3QMRA 4WCJA 4XD3A 1RP9A 3EDKA 2PCEA 4PCSA 4EOUA 2E68A 3DG6A 1YDOA 1E0TA 3PBMA 3RCMA 4O57A 1JVNA 3B4YA 1ZHAA 3L66A 3PTQA 1NVMA 3SR7A 3AHZA 5CBJA 3W4RA 3MBFA 4B5XA 3SRHA 1XYZA 1EC8A 1NOWA 3UBPC 4S23A 4NX0A 3R0DA 3CHDA 3HGOA 4AXNA 3G6MA 1UP3A 1VAHA 3QV8A 1VIZA 3SB0A 3DBPA 4NKCA 1WKFA 1XKYA 4P8VA 3SCPA 1HT6A 1LWHA 3W1TA 3QN3A 4IL0A 1JXKA 3KZPA 1SJAA 4BEQA 5CAHA 3GBDA 3VVGA 4N02A 2IKJA 2OT1A 3OVPA 1EP3A 4H9UA 1O5KA 3UZYA 3CPUA 2WSKA 1RLDA 2W9MA 4NJHA 4NU7A 3BLKA 3MU7A 5CH9A 1F4HA 3VZXA 2VX4A 4D1JA 2BS9A 3ZOAA 2R6OA 1HN1A 1RK6A 2VM8A 3KM8A 4PMDA 3UETA 3VE9A 3AU6A 1TWWA 1MW1A 2Y62A 1PUDA 1TTIA 5FJRA 3DESA 1CPUA 1RK5A 4UMCA 3FYPA 2WC7A 2QIIA 3P8JA 2H90A 3UJFA 1Q6LA 3UPMA 4AWEA 2HCVA 4A8RA 1OC7A 3WQ5A 5DBUA 3Q45A 1V0NA 4G2DA 5CGTA 4AZBA 2XG9A 4M6UA 1XLBA 3OA5A 1OFRA 3ITCA 2ZDRA 1NF7A 2VFFA 3GXIA 1SSGA 1FH9A 2FLIA 4PL2A 4DI9A 1Y7VA 3UZZA 3BAKA 2BP1A 3LPPA 4IX2A 3CB3A 4Y7EA 3MSYA 4XAZA 5I24A 4JTTA 3OHMB 1DJWA 4JX5A 3IJLA 4AW7A 1WX0A 1JCMP 3HQNA 1FWFC 1O6IA 1ZZMA 3WLIA 4FF7A 1AODA 1DYSA 2VRKA 5FSEC 3WD4A 5F2MA 2PWEA 2F7FA 2O9TA 3DC0A 3LSBA 2XH7A 4Q7BA 2XGIA 1GZGA 1R9ZA 4QIUA 2YYUA 2WK2A 4UWMA 2GQ3A 2W3ZA 4JIIX 4YMZA 2RFGA 3QMTA 2R91A 2XIJA 3P84A 1RZMA 2PE4A 2YL6A 4ZB5A 3E5BA 1EYEA 5A2CA 3KTSA 1CBGA 3MMWA 3U9IA 2CBJA 3UQNA 4IGMA 3TN3A 4OQVA 4H9ZA 2OWWA 3VIMA 2X1UA 3GG0A 3GDTA 1SJBA 2DDXA 2E5CA 4PGLA 4CQ9A 3PFRA 4CNSA 2IXUA 3QLDA 3I10A 5CPOA 3VUSA 1V5XA 3CNYA 1M7JA 1IT7A 2VEPA 3N04A 1LBFA 2HVNA 5BRPA 3N3TA 4GYKA 4WOQA 2A3AA 1KBIA 1FKXA 4DUXA 4NIRA 3R7MA 3BLPX 1S2VA 3DXIA 1YEYA 1PXGA 3NL6A 3H2CA 4WJEA 1EKOA 2J74A 3O1NA 3IVTA 2PBGA 1S2CA 4WKHA 4GHRA 1GQIA 3EWXA 2ZA3A 4H41A 1P6CA 3D5HA 3CQIA 4GYJA 1VB9A 4MAVA 4Y8FA 4HPNA 5I3DA 4K1GA 3W7EA 4J3SA 1D8WA 1JCNA 1DKWA 1KFKA 5I09A 2VVSA 1WDDA 4DUWA 1OFOA 3UJSA 3A4AA 1QI0A 4L9XA 2RDUA 5IOBA 4CCCA 1B3YA 2ADAA 1MUMA 2IPGA 3G2GA 3ONCA 4YNGA 4LVAA 3SDOA 5XINA 2D0HA 4NJGA 1UKTA 3LD5A 4LPCA 1YXCA 4HSOA 5BOFA 2FJUB 1WV2A 3CM4A 3B9DA 4AYGA 5A2BA 1DORA 1CNVA 1XLMA 1JPHA 3ORWA 3REQA 2VGIA 1FA2A 3WF0A 3VDGA 2XIBA 1UKQA 2RGMA 2BY2A 4D8AA 4L4OA 1UKOA 2J79A 3FY1A 3WH5A 4ADUA 1DJIA 1XLIA 2ZUSA 3L9CA 3BZGA 3VKJA 3AMKA 1B30A 1TZ9A 4Q7IA 3AS1A 2XWDA 2NX3A 1BSIA 1AW1A 3STEA 3P7YA 3FFSA 1JF6A 2Q01A 3R6IA 2OZTA 1XIFA 3TTEA 3G18A 4DBDA 4XZNX 3VINA 4NUWA 2CWXA 1FHVA 3O0FA 4URIA 3VNZA 1T96A 4DJFC 4DWSC 3F4NA 1JPDX 4K7YA 3MUZ1 3OU8A 2J66A 1JQVA 4ICMA 1P0EA 2IW0A 5XIMA 3RPMA 3WNKA 1DVJA 2HISA 3VXGA 3N2BA 1LLOA 1QW7A 1Z69A 2C19A 1AQ0A 1FWJC 3S9IA 2ZWYA 4FPSA 1CLKA 4AFYA 4JNYA 3GW3A 4QJ1A 1M04A 1UWQA 3GHTA 5EFDA 1XLAA 1GVFA 3O07A 1BRLA 1O60A 3HPZA 2DIJA 1Z9AA 2ZRUA 4LY4A 1UHVA 4O13A 4S3FA 4HOZA 1R2RA 3LNMA 5K4XA 4Y6GA 1FCUA 3VIOA 4UXDA 4ICNA 5G1YA 1YNQA 2OWXA 3A22A 2HXTA 4HHHA 4B5TA 3NQ7A 1HKMA 4JZ5A 4KF1A 2XGBA 3HG2A 1MW0A 2NQHA 3LXAA 1TPUA 1F2JA 3GDBA 3M0ZA 4IICA 3AJ7A 2QUVA 4HU4A 3CZ8A 3WNOA 1H4PA 1UR9A 2UY2A 3H23A 3CLMA 2QUTA 4HTYA 1T6MA 3GBEA 3F1QA 1VFSA 3B8TA 2RJHA 3S6OA 2WJZA 4B5VA 4NVTA 1XH2A 3CL6A 3EPMA 3Q94A 3RITA 3SJ3A 1TZ7A 3JR2A 3WLRA 3AICA 2PD5A 2YLAA 1IZCA 1Z8AA 2R8WA 1Q4NX 3MA8A 3JZEA 3W74A 2VI0A 4G1KA 1HP5A 1X98A 3GDMA 4R3UA 2PLJA 2WBGA 1UKSA 4H00A 1SPQA 2BY1A 2XU2A 2I1OA 2V0TA 6REQA 3C5QA 3PZ9A 2DUAA 1YE6A 3ZYZA 2WZMA 4NSBA 2PF0A 4DWSB 3EDDA 3HG4A 3MUY1 1GVEA 5FL0A 2Z1BA 3WBEA 4PODA 4A21A 4UQ9A 3W85A 3DHDA 1G67A 4UCGA 1YQ2A 1WO2A 3NCOA 4M51A 4RZ4A 2H9AA 4NAEA 1HF6A 2XH0A 1ECQA 3C2FA 3M6YA 2BOGX 3DU0A 1PB0A 3VD4A 2JKPA 3ANYA 1F05A 1KXQA 1OCQA 3ZVHA 3MSDA 3W7LA 3WL1A 1RCXB 2WNZA 3GFXA 4BF7A 2WOQA 4L1XA 5DT5A 1OYBA 4GH1A 2VWTA 1UWUA 2FTWA 3LYEA 4BI7A 2ZE3A 4QM1A 4LUJA 3ZLGA 2BFGA 1HX0A 3G3MA 1PYFA 3UY8A 2V5JA 4KEVA 4ZO7A 1S5WA 4V15A 1JF5A 4I9AA 1O95A 2QQ6A 2R82A 2GSJA 2BDQA 4GIYA 2YZ5A 4KFPA 3SIZA 2YDAA 5EBUA 2VT0A 2CPUA 3GR4A 5G2WA 5A6TC 4KWWA 4NI8A 4DZIA 4DHGA 3PPCA 1MFUA 4F2BA 3V1PA 2A6NA 4GFIA 4JX4A 5EMYA 2Z00A 3OVRA 3PZVA 1OZMA 1J0IA 3T0CA 3P2VA 4CD7A 1XLDA 3IGHX 1I2QA 3HIJA 4AF0A 4Q6XA 3S1UA 4QS6A 3TQPA 3F4VA 4GJ1A 1FCQA 4AD4A 3B4UA 4R88A 4ZL1A 3GX9A 2CHNA 3TU9A 3TN5A 2Y7GA 3PBWA 4CNUA 3M0YA 4LALA 2V67A 1SZGA 4NZ4A 5HULA 5HMDA 1QFEA 3W25A 3K4DA 4GINA 3EA3A 1G7UA 2Y2WA 3NA8A 2VCBA 3N4AA 2BTMA 2HROA 4GX8A 4M6QA 3IVUA 1UQZA 3LCIA 3W1XA 3THDA 2J7BA 1UCWA 1KCZA 4PTVA 3HB9A 2Q6ZA 3KHJA 4ZQCA 4LEFA 2J4GA 1CI1A 4DI8A 4L64A 1N2VA 1PE1A 1ZJAA 3WH7A 2Z27A 4WSJA 4DBSA 4CN6A 2JEQA 3VNLA 5HOSA 4YPJA 2I7GA 3S5OA 2C3ZA 4QROA 1EA9C 3ZZ1A 1G5AA 2PDKA 4H9TA 4N2YA 3ZS4A 3JUGA 3LCGA 1MI3A 5A8PA 2VENA 5JH2A 2DVTA 2ZE0A 4D6JA 2PU0A 1RPKA 2R1KA 2ZFAA 1VPXA 3F4WA 3NM3A 2QCNA 3GG8A 5G2HA 1UWSA 3VOCA 5FCZA 3WD2A 4H2HA 4UQEA 2C71A 3WUEA 1K3UA 3HBLA 2BOFX 3INPA 5LZLA 2VDHA 1NJJA 4ML4A 5JQ9A 3OLIA 2QCFA 4I90A 4JFVA 1TIWA 1UP2A 2ODOA 2P76A 4MJMA 3ONBA 4KETA 4HGXA 2ONEA 2WJDA 2VUYA 3TSBA 5EFFA 4O14A 1D7FA 1QCWA 4JX6A 3TOYA 5GPRA 1ONEA 1CCWB 3IVSA 4AMCA 1MYRA 4PE8A 1RQEA 4RE2A 2QXWA 1QMLA 1Q65A 3ANUA 4G8TA 2HVOA 6TAAA 4JN8A 4JFUA 2Q3RA 2CZ5A 1BTCA 4Z1AA 4RNFA 1J5SA 1EF2A 2B7NA 3KBVA 3TAKA 2DEPA 5D33A 5EL1A 1H61A 5BXPA 4LNCA 3RG6A 1UH2A 3F7JA 1SMDA 2BODX 2WCGA 5TNVA 4V28A 2PLMA 4QLKA 1I4NA 3LDVA 1J93A 4FEZA 3I6EA 1DV7A 2GJXA 1A0CA 4R85A 2F2HA 2XIOA 3LK6A 4HZ7A 4FOKA 2PODA 2NV2A 2DUZA 2AGTA 4LB4A 2E9BA 1KFEA 5C9RA 2P3EA 4AHOA 4X3ZA 2Z2AA 3CAQA 4FF5A 1Q6CA 3LY0A 3GNXA 1Q6QA 1QWGA 4LYKA 3BG9A 3MCMA 4DZHA 1JPKA 1JFHA 3W88A 3C61A 3PUDA 1C92A 3S1GA 3VOGA 4MYAA 4J3ZA 1KKOA 3DKLA 2EXOA 3GIYA 1UBSA 3BGAA 3RFAA 3L23A 4IHCA 2RDXA 4F0HA 1NDZA 5H91A 1DHKA 1SO3A 2QGYA 1EL3A 2FZMA 5E5CA 1DWFM 1XLLA 3ZJ7A 3B0XA 1KRCC 1WQ5A 5CPQA 2QIWA 2GK1A 1V7AA 7REQB 4GQQA 1A5AA 4PTWA 5CLTA 1UWAA 2QDEA 4IQDA 1W32A 1L6SA 1H0IA 1TE6A 2G5WA 3QR0A 4IFKA 1XYLA 2YDSA 3BDKA 2CLLA 3W07A 4CD4A 4S38A 2X1IA 1RQHA 2EHHA 3POCA 1CGVA 3TC6A 4M3PA 2JFEX 3QKEA 5FF2A 3T4CA 3AI0A 3V18A 3HN3A 4NJIA 3B05A 4MTVA 4OBRA 4XBJA 1PEZA 1Q66A 4GBDA 2V82A 4ICCX 4EACA 4WJ8A 2WLZA 3W7HA 3PZQA 2YA2A 1OG6A 1V6UA 1KC7A 2GVJA 4KRUA 1C90A 5D9OA 3PBUA 2G50A 2J8GA 3BK0A 1POJA 3ABXA 4RDWA 3WEMA 5CG7A 2W79A 3PY2A 3PJXA 4OFCA 3LCXA 1BYDA 5B7YA 1BXCA 3T2QA 4OUIA 5JVLA 3USZA 3SUWA 4GUHA 1QW8A 4FA3A 1TPB1 4FOUA 5EBAA 1E5NA 3CZEA 3MBDA 5LA1A 1CB2A 3HF3A 3KBSA 1Q8JA 4YVPA 3PG9A 1FHDA 4GKLA 3S6DA 1K7FA 3LPOA 5JH1A 2UY4A 4AZGA 4PTMA 5CCZA 2Q8ZA 4HK5A 3QOMA 1IYXA 4GYPA 1RJQA 1QO2A 4QJ3B 4H6EA 2VYOA 4IUGA 5DCBA 5I06A 3H2MA 1HJSA 3B3DA 5LGZA 4P7NA 1XLCA 2ZTKA 2FMNA 1SO6A 2FQIA 3H2AA 4PUJA 1TV7A 2BZNA 3L2LA 2DUXA 3BCFA 4BK9A 1E4NA 4RNJA 5TD4A 5TF0A 2JKEA 4QDWA 4UMAA 1QAPA 4XIAA 4UTWC 2A6LA 1KRMA 3MB9A 4PUKA 3TX9A 1E1CA 1QNQA 4A8IA 3RM8A 2ZZ1A 3WD1A 3KLKA 3RAOA 4RUBA 2G0WA 4RK8A 4AEFA 3NZQA 3CWNA 1QPQA 4BI5A 2OGJA 2HQAA 1W3HA 3S46A 1B3OA 1OX4B 4UR9A 3ZMRA 3L4TA 4WGXA 1WOBA 3SQMA 1PCWA 4FXJA 4XZMX 1BVNP 4JNZA 1EUAA 5FI8A 3U2EA 1TWIA 2DZAA 4MGGA 1OCBA 2GOUA 1RY0A 2XM1A 2G3JA 1BAGA 5D9PA 1E9IA 1C29A 1EXPA 5M2FX 2IQ0A 2NV1A 3EB3A 4ZBCA 1V6WA 1HVXA 3CK5A 4MSSA 3N2XA 4HJWA 3U2ZA 4FIQA 4BWLC 4LJ3A 4DWDA 4W7VA 5BOEA 1Q6DA 1FQ0A 1LUCB 2X09A 3VCNA 1GHRA 3FYYA 4B9ZA 4Y9OA 3F2CA 2I57A 1OC6A 2YW4A 4J2MA 2Y63A 2ATMA 4QQ3A 3RPTA 3UPBA 3SRFA 1C8XA 2G3FA 2YW3A 3W2LA 1T8QA 4US6A 1P48A 3V36A 3LUTA 3EOUA 4HCLA 2DSKA 4CU8A 3LZ3A 3VGHA 3HQPA 4WR3A 1V6VA 3NQCA 2OZ3A 2O7SA 1WUEA 3NXFA 3EX3A 3TE9A 3FCPA 3E9AA 2PTZA 3EX6A 4KWVA 1H7PA 3THAA 1AJ2A 1XIHA 2X05A 2JGQA 4IQLA 2EJ1A 1I60A 3EA1A 3BOXA 5AFDA 2PTWA 4WRHA 4G7EB 4C7GA 1HFBA 1SU5A 4XUGA 1B90A 1J0JA 2GVYA 4FXRA 1UQYA 3N34A 3EKZA 5FF4A 1R9YA 5I3JA 3RO8A 2HS6A 3ABQA 1RCQA 1H50A 4XVDA 2BG5A 3NYZA 5CSRA 5CXPA 3PJTA 4FZIA 1FWWA 1A5UA 1ZB5A 5DXYA 5BRBA 2C16A 2JKAA 3MQTA 4PRRA 1V7YA 3UNTA 4ERIA 3U3HA 4O19A 1Q2RA 2EPOA 1CXEA 1BSLA 1JZ5A 2WJFA 4LQ1A 1M3UA 3UP8A 1J8VA 4UQDA 5T26A 2D2JA 1DTNA 5DO8A 3K8LA 3GDLA 1IXPA 1VRDA 5C70A 2G8ZA 1K9TA 2ZRZA 1FWSA 1MXGA 2J7HA 1SW7A 1GTEA 3UZJA 3WNMA 2V5KA 5CZ0A 2OX4A 4GE8A 3B0PA 4JAWA 2FH8A 3TV8A 3OIHA 2YJQA 3UWUA 2JBMA 4HCHA 3B03A 3I6TA 2GDVA 3KOXA 1K8YA 3QZ6A 2E40A 1Z6KA 3N6HA 4LV4A 3BVJA 4M8UA 5GNYA 1GUVA 2ZUUA 1MQQA 1ZLPA 4ZQOA 2W4XA 4XKYB 3W76A 1D9EA 1IEXA 4GQRA 5D4YA 1BPLB 3PB2A 1Q85A 1F73A 2E28A 5EMMA 3PJWA 4X63A 5KZ6A 1JRCA 4S3EA 4C7DA 5EPDA 3TYBA 1Z42A 3WLSA 3SY1A 1T7LA 2G3IA 1C8QA 4G56A 1V0KA 1QI5A 2GDUA 4PMQA 1K02A 4MY9A 4LSBA 3WUBA 2WCSA 4HPGA 2I14A 4MB1A 3HURA 2DU2A 2ZA1A 2E9MA 2P0OA 4OT7A 3SO7A 1U5HA 4PMYA 3WQEA 3HPXA 4DAFA 3QGVA 2TSYA 3AYSA 1IZKA 3ATZA 4TXEA 3ARRA 3E2QA 2GGIA 3N12A 4FSAA 4AU0A 2IMRA 2BGSA 3PPGA 1VPYA 1FWHC 1DWGM 5CC3A 2RUSA 1I75A 1LP6A 3OGRA 3VCCA 1VCGA 3PSVA 5LIWX 4N42A 1ZL1A 3E0IA 4EPEC 3E2SA 4J4KA 2OOGA 4JTQA 1HIZA 1F61A 2PP3A 2CEQA 2ISWA 3RO6A 3W1AA 4UTTC 3BQ6A 4H19A 1X1OA 2WMIA 4ZOAA 1TV4A 1E6NA 1J10A 1WCGA 3MCOA 3SUUA 4AIBA 5A95A 2ZIDA 4KWUA 4QTGA 3Q58A 3TYUA 1PL9A 1R9XA 3G1FA 1Q7QA 2ZZ5A 3BAIA 3QQWA 1JUKA 1GOIA 4E5TA 4XAPA 3WQOA 4J40A 4MKSA 4TX6A 5LNSA 4A3UA 3WMCA 3T0AA 3VD7A 1S5NA 1M01A 2OYMA 1XGEA 2GJNA 3WJZA 3BH4A 1BGGA 2OYLA 3EWCA 3N17A 1M7PA 3QYQA 3RX2A 1A5OC 5G1TA 4GY0A 4HN8A 4UTKA 3RJXA 4CLMA 3W7JA 1XDJA 1E40A 5ABGA 3WN6A 2FB3A 2P10A 2R24A 2R94A 2VDIA 4GQ0A 2PDCA 3DG3A 2PP1A 3LXBA 3ITXA 1EEXA 1K9EA 4L4LA 1JFXA 4TTUA 4ZENA 2QPUA 1X97A 2X7VA 2OLHA 4GX9A 5T8GA 2WCAA 2FVMA 1A5SA 1B9BA 3RF9A 3HGSA 3RCYA 2WSPA 2ZUMA 5EMLA 3TIMA 4Z1YA 1W1IE 3OZYA 2IKHA 5ABFB 2YSWA 3DGBA 4Q32A 4IOTA 3FJLA 3SSJA 1F3EA 2WQPA 1VHCA 3M16A 3ZR5A 1YDNA 3L0KA 3E12A 4O0KA 3S42A 1TV2A 3EDJA 4GNJA 3UYCA 1LG2A 2P0IA 3NSMA 3VOHA 3GXNA 2WWCA 3WF4A 2NLYA 3QV6A 1QATA 1TPC1 1KTNA 3IIZA 4IH3A 3PZTA 3MHFA 2D1ZA 1ZCCA 3G0XA 1DBTA 2PDJA 3PZNA 5HDRA 5I00A 4ZODA 1X7IA 3VFLA 4JFWA 1BEUA 1X96A 2C1GA 2PRMA 3UGVA 4HA1A 3T2OA 2YLLA 5G1MA 1SW3A 3KBJA 3OIXA 3TA9A 2QJNA 5FF7A 4OKDA 4XO7A 2FH6A 3SN4A 3APYA 3WL0A 3ZT7A 4IPIA 3MJYA 4PMJA 1XIDA 3WEZA 3W75A 4FIRA 1H11A 2V5LA 5EMKA 1TB3A 2DZXA 1DQUA 4HPHA 1TWDA 4I5RA 1XD0A 2QF7A 1SR9A 4FX6M 3FK4A 4KEZA 1HZYA 1AQHA 5JMUA 4EPBC 3WF1A 4I6KA 5IHRA 5LKYA 1XP3A 2HPIA 3T4WA 2BSLA 3GD6A 2C14A 2YOCA 1A5MC 4YLWA 4IP7A 1WDWA 5FJOA 1O7AA 2VC9A 1V0MA 3IJDA 1OIMA 4GCXA 1HKKA 2NLIA 5KETA 1IE7C 4O1EA 1KGXA 2C7FA 1NU5A 3ZWSA 3B8WA 1YNYA 3G3DA 4QXIA 1I1WA 3O05A 4U2ZA 3U6WA 1W2PA 4OOUA 3NOEA 1JXJA 1AD4A 3GVRA 3FW6A 1ITQA 3QC0A 1UA3A 3T40A 4MJZA 2HTMA 4J28A 3PTKA 4M0XA 3TMLA 2VEFA 1Q45A 4TIMA 1MEIA 1H2JA 1GVQA 2WM1A 2G41A 3EOLA 4QDMA 3URQA 3U2OA 3N18A 1EF3A 4HMEA 1O4UA 1W3TA 5K2ZA 3IIPA 4XISA 4K2SA 3N13A 3CQ0A 3GSMA 3UFYA 4GZEA 4AVNA 3VK5A 3QFWA 2VFIA 2B31A 4TO8A 4N4QA 3AOFA 2PDNA 2EKCA 1XFCA 4W8LA 4LEQA 4GGHA 3PTDA 4PR4A 3W26A 4IMGA 3TQVA 3HA1A 3R58A 2X2YA 3EB4A 1R2TA 1NY1A 2OQYA 4NJKA 3VGBA 2VCCA 2Y85A 3QY6A 3R79A 1PHWA 1V8EA 1S2AA 4HHLA 3CQHA 3BV7A 4G1NA 4AQLA 4KMQA 4UR8A 1K8XA 4NQ1A 2WO5A 1G0CA 3ZSSA 2FPYA 3IJ7A 1K6WA 2Y0FA 4EF8A 3WNPA 3TWBA 1DHPA 3N11A 2B7PA 3NQMA 5IHSA 1E4IA 1R8LA 1JULA 2YCIX 3VA8A 3BAXA 3JRKA 4M81A 4P2VA 3IV8A 4YTSA 1ZALA 2XHYA 2NVDA 1KRAC 1PKYA 3UU0A 3TSMA 4QG6A 4O53A 1V93A 3O8AA 4WSHA 3OG3A 2XDFA 5IM51 4EANA 5HQMA 1JDDA 1VEPA 1TPWA 3HQ1A 3TC7A 3QV9A 1TKKA 4R27A 3DG7A 1GG1A 1CXKA 5LGXA 4O8RA 5BRQA 3LHVA 4FXSA 3AWNA 3RU8X 3IACA 1WOAA 3WMLA 1HKVA 3AROA 3FJNA 3C0QA 2FZ9A 2Q71A 1NAL1 3NR0A 3V5CA 3AZSA 1CIUA 4A3YA 4E8GA 2GJPA 3B9EA 3D3AA 1BYBA 3FDKA 3IJ6A 3L2IA 4GH3A 3VMNA 2FFCA 3IAQA 2HE5A 7REQA 1EJSC 4O11A 2A7RA 1JJKA 5CC5A 2R1NA 2VRJA 1LQAA 2J62A 1QW9A 5IFPA 4JDBA 1Q6FA 1RXOB 1RQBA 1XQKA 2QVHA 2ZUWA 3WUGA 3M41A 3N4EA 3AMLA 3DFNA 5G4WA 4MNJA 3FA5A 5GJMA 3UXIA 3KP1A 4E3VA 1RA5A 5AHEA 3CV1A 4HJFA 4EWND 3UWYA 3VM5A 1DJNA 1TELA 5L6UA 2GSEA 4A22A 2Z0IA 2PI6A 2EPNA 3CIWA 1W8SA 5DANA 1KM0A 1UG6A 4PBFA 4J35A 4ZA0A 4IG2A 4P8XA 1FKWA 2WPGA 1OFDA 1JAEA 3FLUA 1XLGA 3NAVA 4AC1X 1EP2A 3DERA 3RILA 3HV9A 1R46A 5DCDA 1JGIA 2ACQA 4CU7A 5D32A 3S1WA 1BXBA 1FP9A 5AC6A 2IQTA 4B5UA 1TV3A 1A0EA 1ALDA 5AC5A 4AISA 2H6RA 2OCZA 3VC6A 4H7VA 1WKDA 4OTKA 1TJPA 3B8DA 1EHAA 4BY3A 1M65A 4HYVA 4KWSA 3BJSA 2DSUA 2VHLA 5H8UA 3TVAA 1OGSA 2YKKA 3BG3A 4XZBA 3TWAA 3TLLA 2Z6JA 1CGXA 4GJIA 3ZLFA 4JFSA 3K1GA 4O17A 4D6GA 1HNYA 1B54A 4HNOA 3KAOA 1E4LA 2ZA2A 3Q37A 2BVDA 3TR2A 4P7LA 2HE8A 4OIFA 1TZZA 4D2JA 4JTIA 3TLQA 1NM9A 1QPNA 1AL8A 3V16A 3CGTA 3TXVA 4HPXA 2Q8LA 4AC7C 3WQ4A 1C7SA 4YTQA 4L4MA 2OMAA 3T8LA 3NGFA 1QDSA 3H2NA 4ZQPA 4MPKA 5TIMA 3B8VA 3H26A 5C9XA 1XSJA 1XJBA 2WQDA 2XZ7A 4PCPA 5GVJA 2DIEA 3G1VA 2A7NA 2ZXDA 4YCOA 3FGCA 4DO4A 2YB4A 1UIPA 3M0LA 4ZOCA 2RHGA 4C6DA 2ACSA 1K7XA 1WE5A 2XFRA 3V0UA 4DJFD 2QAFA 3STCA 4DWSD 1L9WA 3CUXA 1PTAA 4AXKA 1JD9A 4JTCA 3SCOA 1SVDA 1E0UA 3PBGA 4MWAB 3QLLA 5AC7A 2G4JA 3HV8A 3L5AA 3AMDA 4PUMA 1WAWA 3F5KA 5ECUA 1E71M 3HQOA 4S2CA 1XLFA 4YWSA 3KRBA 3TC3A 2AGKA 2YBVA 3S9ZA 2ZXQA 3H7UA 2RAGA 2WLYA 3W22A 2ZRWA 3ZJ6A 3V3WA 4OU1A 5AYIA 1LUCA 3FNDA 4C6EA 4KW2A 2XIIA 1H60A 3W7PA 4NILA 3VIPA 4UOZA 2B81A 3ARPA 3QY7A 2BV9A 2Y5SA 3ARUA 2C15A 1H3GA 4UTLA 3E96A 3PM6A 3QEZA 3O6YX 5BYWA 4NXKA 2CLHA 3S1VA 4NRRA 2PLKA 3AXKA 4RCXA 1VBRA 3NXLA 2GWGA 3KXQA 9CGTA 1I2OA 2BGQA 2ZC8A 5AHMA 1XFBA 4DX3A 4KQNA 3OP2A 1BHGA 5FIPA 2EGZA 2DPEA 1K8ZA 2EF9A 4HK6A 2PWFA 2PGFA 3E38A 1OM0A 1P0BA 3O6AA 3AUOA 4MKNA 3L7RA 1OEPA 3K1DA 5JBEA 2YL8A 3NZGA 4CD8A 2PGEA 4K8GA 4RV3A 3VGEA 4TVCA 1DPMA 3GY1A 3J7HA 3A24A 4ZFMA 4XBSA 1OFAA 4U10A 5CJ5A 2OYKA 3GXFA 4H9MA 4GGBA 1CTNA 1NDVA 5AHNA 4LBUA 3RJYA 1MDRA 1R7AA 3QBUA 1W1ZA 2OG9A 4GI9A 2VEGA 4MJ2A 3DENA 4BR1A 3I7QA 1ZQ5A 4ZO9A 3WQGA 4HB7A 2QR6A 1XV8A 2P3ZA 2GSHA 1W3KA 2PGRA 4GACA 4W8AA 4RXFA 3WBYA 1HGYA 2VC5A 3ZVIA 5D8WA 5CSSA 2PS2A 2CU0A 1J9YA 3WH6A 1KR1A 1Q4WA 3VIHA 1EDQA 3M07A 3CYVA 2XIQA 3F4CA 5FACA 5A8QA 3CT2A 4JIPA 4JPGA 3WDRA 1GPFA 5IBXA 4WDUA 4C5ZA 3B40A 2PDXA 3V1HA 4LFYA 1J0KA 1OD0A 3NPXA 4RE0A 4JBRA 4QEHA 1XCFA 4EP8C 3QXBA 4GABA 2VUNA 2ZZ3A 2CESA 1K03A 4FOJA 4Q8MA 2Y5JA 2HRWA 2PC8A 4IIBA 2XVLA 3M1ZA 1WDPA 2P50A 3TJ4A 1JPIA 1NTHA 1LTDA 2BLEA 3TTQA 4W9TA 5A69A 4M29A 1NEYA 2PUZA 1KFJA 3KVKA 3UZWA 1SO5A 3DFTA 4GI4A 4MYXA 1XIIA 5M5DA 1V3IA 2ABAA 2FZDA 1MQPA 4AX6A 1QPKA 1JI1A 4MAZA 3WLLA 3W53A 2D2GA 5C7HA 5AZ0A 5AB3A 1ZFJA 3N29A 1W31A 5LHFA 1XCWA 3WZ0E 1J0YA 3S5ZA 4NZ1A 1PWLA 2YFOA 4UR7A 4GOAA 4Y8EA 3GW0A 3REQB 3IIXA 3TYZA 5FEXA 3W6LA 4C1NA 3H55A 3DIPA 4O8AA 1VQTA 5JU6A 3WQ8A 3WNNA 1ZAHA 1XL9A 2XSAA 4NAFB 2GLKA 3PANA 2DH2A 4FALA 1YDVA 4Q6JA 4AVOA 5H6HA 4XKMA 3K5XA 3U0HA 2WMKA 1A3HA 1W2VA 4LANA 3RHGA 1U5VA 4KPLA 2XZ9A 1LQ2A 3AALA 4LS0A 3AIUA 8TIMA 5J8LA 1W5OA 5HWNA 2QVNA 3UXAA 3NDYA 3LN3A 1PKNA 2J7EA 2NT0A 1EH9A 1ICSA 2VTFA 4ERGA 3PC0A 2BXVA 3AXHA 3SGZA 4G5DA 3QQ0A 3VMOA 1VHNA 4TX8A 1US0A 1KKRA 1RJPA 2ZZ4A 4H7CA 4OWGA 4AX7A 4I5UA 2FZBA 5MHBA 3TQKA 5FESA 3W1QA 4UZUA 5GNXA 3WJSA 3EDFA 2V2DA 4F0KA 1KM2A 2POTA 1ENUA 3CV6A 2CBIA 3GTXA 2CBUA 2E0PA 1BRLB 3KVMA 4MIMA 2R1PA 1B31A 2QKFA 1AG1O 4Z42C 3TA6A 3QPYA 4UOQA 2WPBA 4L9YA 1ZBKA 3MW7A 2EO7A 4UQCA 2GYIA 1VF8A 3ABSA 5D37A 4EXAA 1WBHA 4PTXA 4LF2A 1X1NA 1EJXC 3ANVA 5DEZA 1G94A 1JUBA 4MLRA 3CZJA 4JTUA 2WKJA 1VBUA 2NXGA 2W27A 3BC9A 3B8IA 1XWYA 4ACYA 1LLWA 2YDQA 4CVWA 3W82A 9XIAA 3MKKA 3CZGA 4NNCA 4PEKA 3O15A 4J2PA 1L0PA 1VYPX 2HK0A 3H4GA 4RW5A 1Y0EA 3CEPA