3QQ1A

Crystal structure of a double mutant [a58p, del(n59)] of 3-deoxy-d-manno-octulosonate 8-phosphate synthase (kdo8ps) from neisseria meningitidis
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
276
structure length
249
Chain Sequence
b'MDIKINDITLGNNSPFVLFGGINVLESLDSTLQTCAHYVEVTRKLGIPYIFKASFDKPRSSIHSYRGVGLEEGLKIFEKVKAEFGIPVITDVHEPHQCQPVAEVCDVIQLPAFLARQTDLVVAMAKTGNVVNIKKPQFLSPSQMKNIVEKFHEAGNGKLILCERGSSFGYDNLVVDMLGFGVMKQTCGNLPVIFDVTHSLQGRRAQALDLALAGMATRLAGLFLELHLLEDFLIRIKALDDLIKSQPIL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-dehydro-3-deoxyphosphooctonate aldolase
publication title Targeting the role of a key conserved motif for substrate selection and catalysis by 3-deoxy-D-manno-octulosonate 8-phosphate synthase
pubmed doi rcsb
source organism Neisseria meningitidis
molecule tags Transferase
total genus 79
structure length 249
sequence length 276
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.55: 3-deoxy-8-phosphooctulonate synthase.
pdb deposition date 2011-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00793 DAHP_synth_1 DAHP synthetase I family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3qq1A00
3F03K 3LCHA 3FJ6A 3OBKA 3LM7A 3PF3A 3ELFA 3HQ1A 1XBZA 4HIBA 4FEZA 4K36A 2NV1A 5D04C 3FKKA 6ALDA 2GJNA 2RHGA 2PURA 3HOJA 1EUNA 1FXQA 3GDRA 3KX6A 1LDCA 2YW4A 3UWUA 3DFPA 1K8YA 3V1PA 4UR8A 5KZEA 4MLRA 5E93A 3W2UA 3C61A 2C3ZA 2BZNA 1XKYA 1X7FA 1JVNA 3M6YA 4JTFA 3LXAA 4O54A 2DZUA 3EB2A 1FUYA 4ADTA 2CZFA 1KFJA 3NYZA 2E6AA 5E1QA 2YXGA 2G95A 5FF7A 3GNDA 3IIPA 4UFIA 1NSJA 2ZZ5A 4XUGA 3UY8A 1YXDA 3WJZA 1JCLA 1IIHA 2X1UA 4U28A 1FWWA 3VKJA 1W3IA 2Y70A 3HB9A 3SFKA 3QPZA 4CCEA 2ZRYA 1KFBA 4N6EA 1HFBA 2A1YA 3KAOA 4JX4A 1U5JA 4IUOA 1PIIA 2O7SA 2Q3RA 3PBWA 1QPRA 4IGHA 3P8JA 1JRBA 4N9EA 3TA6A 4YLWA 4BI7A 1YPFA 1LTDA 2B7NA 1UASA 3HG5A 3RU6A 5IM51 1JUEA 5K9CA 4M19A 3HGJA 1TPB1 4DF2A 3EXSA 1ZCOA 5C55A 3PULA 2E09A 3W1TA 1F76A 5DBUA 3DI0A 1UUOA 1G6CA 4NX5A 3ATZA 2F84A 3CTLA 3EWUA 1UCWA 1W31A 2ZRZA 4JTTA 1KBJA 4CQ9A 1QWGA 4UTKA 1H1ZA 3L0GA 5J5RA 1G4PA 3LCGA 1LCOA 1W3TA 5U4NA 4GXMA 3PY2A 4P61A 2TRSA 3MYPA 2H8XA 3C2RA 4PTNA 3TFCA 1QCWA 3P74A 1GEQA 3MP4A 5TIMA 4N2YA 5C2XA 3B0UX 2BWGA 3NGJA 3NQGA 1NEYA 1TJPA 2C18A 4XKYB 3UYCA 1SW3A 3EXRA 4PA8A 3DXIA 1OFQA 3IIXA 1IF2A 1YXCA 1K02A 3WJXA 1VPXA 2V2CA 4DO4A 4LC6A 3RLVA 4N4PA 3HIJA 2Y61A 4KFNA 1RD5A 1LBMA 1ZAIA 2VELA 4RLIA 1YDNA 3BW2A 3PG9A 4UFMA 4NXSA 1SO4A 3MMTA 3VNDA 1L9WA 3EX1A 3N9RA 4EF8A 2V82A 5AOUA 4JTIA 2YYTA 3HO8A 4ADUA 2ABBA 3GKAA 1L6WA 4MFEA 3M43A 4DPPA 5D2XA 3N9SA 4NZJA 4RR4A 2CFFA 3IEBA 4KFPA 3W22A 3IGXA 5CZJA 3LRLA 4NJHA 4X3ZA 3PUOA 3ZR4A 2GVJA 2TPSA 3M47A 4MFDA 2E6YA 3A5FA 3G0XA 2I14A 3EX6A 1RPXA 4IX2A 5LGZA 3BO9A 2GOUA 3IV3A 1QOQA 3UWVA 5BMWA 3DENA 3W1RA 5TBOA 4NVTA 3P5YA 1JCNA 3WFAA 2NX9A 1BWKA 4AMAA 2CLMA 4O0ZA 3TXVA 5HWMA 1S5WA 3L21A 2I9EA 3GLCA 2A4AA 1I4NA 3N2MA 3CT7A 4LVBA 3G0UA 1H63A 1QPQA 4G1KA 1OVDA 1KFEA 5EBUA 4XTDA 4WJEA 4UTIA 4JTSA 3TC7A 1EUAA 4N9BA 3YPIA 3ABQA 4WZHA 3RMJA 1T8XA 4IMEA 1SO5A 5KTLA 4OBTA 3ZFHA 1VJIA 3FS2A 4M6VA 4ZQPA 4R53A 1FCBA 3MUXA 2A7NA 2P1FA 2YYUA 3T78A 3DGRA 3LOTA 2DZVA 3Q2DA 2Y63A 4K7VA 5C6MA 4O4VA 3S5OA 1XI3A 1VRDA 2DZSA 2CZEA 4WOQA 5BNKA 1T0OA 3L5LA 2QCCA 4AWTA 3QJAA 3P8IA 1RQBA 1QMLA 1IIGA 5D2VA 3MJYA 4JY8A 2A21A 2H3BA 1LP6A 5F1UA 1W5OA 3GXPA 2Y88A 3PG8A 4O17A 1YTDA 5F1VA 1ZY9A 1DHPA 3EX3A 3CB8A 1QOPA 5L9FA 3LLDA 3QH2A 5CPLA 2QAFA 4S2BA 4NJJA 2NWSA 2J27A 3EKZA 5HUPA 3QMRA 2DZXA 2ZZ3A 5C5YA 3GDTA 3UWQA 5DCBA 3BVJA 4TMBA 4QM1A 5H2ZA 4IXHA 1ZAJA 5AHLA 3PBUA 3B06A 3OVQA 4O53A 4GRSA 3G24A 5SWUA 5CZSA 1VGAA 2FPTA 5A5WA 2WNZA 3OVPA 4DBEA 3SGUA 5C54A 4POCA 5G1YA 5LZLA 5EA9A 3L2IA 2V81A 2V5LA 5DY2A 4O0KA 2B7PA 5G4WA 1DJQA 4DO5A 3STGA 3TDFA 2W79A 4M7TA 3BG9A 4IMFA 3BG3A 4CCDA 1HUVA 3TAKA 1R2RA 4FX7A 4GC4A 4ZZ9A 5BRBA 3QQ0A 4GE8A 3E0IA 2JKEA 3N34A 3W7OA 2W6RA 1ZAHA 4O50A 3SW6A 1Z48A 2X1TA 1GZGA 1H7PA 1QPOA 3W7MA 3T4CA 1B4EA 4K39A 5K4ZA 1GVRA 4O10A 3MBFA 3NQAA 1MEIA 3GXNA 2ZA1A 1IXOA 4O1BA 1OFOA 1JULA 3GYEA 1LYXA 3KRSA 3JRKA 1XUUA 4IQLA 1QPNA 3LTYA 1T96A 3KOFA 1BTMA 3DU0A 1P5BA 1DQXA 4LS2A 1CX9A 3W7LA 4EIVA 5KZDA 4LY8A 4AWSA 1R46A 3CU2A 1TPEA 3PBYA 1HTIA 2YSWA 3M9YA 4RK8A 1P4CA 3S5ZA 1TRIA 2QDHA 2DJLA 1ICQA 1M6JA 3DI1A 2R14A 3BGJA 3F4WA 2WNNA 1LRTA 4L4LA 3I7SA 1KM4A 1Q6OA 4BFAA 1TTQA 4LVGA 4R7JA 1ZJIA 1W5QA 4FHAA 1K7XA 2OX1A 2O7QA 1TPH1 1GYNA 2J9XA 5AFDA 1WOBA 4ZQOA 3KVLA 4BK9A 3LI0A 3HMJG 3FKRA 4BWLC 1ONRA 2CU0A 1I8JA 3A23A 4Y90A 1QR7A 1N7KA 2A7RA 3C56A 1O5XA 3O1NA 4N9CA 2NXGA 1SSDA 1SR9A 3HGRA 2GPTA 1G7UA 1JUBA 5HR7A 1VYSX 3KVKA 3O05A 3BK0A 3R13A 1A53A 3L68A 2CLOA 4MVAA 3UQNA 4KWVA 2FFCA 5DXXA 4N6FA 3NO5A 3IIVA 4L4MA 1M5WA 5BOOA 1M7PA 3W71A 5DCDA 2X16A 4IOTA 2Q8ZA 2NUYA 4A2SA 3E49A 4Y8FA 5FEZA 4GNJA 1O60A 2QCMA 3G1AA 3QSTA 1GOXA 4O4WA 3A5VA 3W7RA 3DFSA 1R2TA 2D73A 3C2EA 4GUFA 4FX8A 2Q3OA 3L5AA 4UFHA 1I2QA 2X1RA 3KHJA 4UCGA 1AK5A 2JKPA 2Q8LA 3W7DA 3DKJA 2QCEA 6TIMA 1KA9F 3NQMA 4N9DA 3W70A 2YFOA 3L65A 4UXDA 3W2LA 1OG0A 3QMSA 1OYBA 4GBUA 5T26A 4DEFA 4LS1A 4E38A 1JRCA 2QAPA 4LC8A 1OJXA 3AO0A 2QCFA 3CQ0A 3FEMA 1GVQA 5AN7A 3P5ZA 1FX6A 1TCDA 2CLHA 4H6KA 1LBLA 1XUZA 3EKLA 3UZJA 2RDUA 2EGZA 4LW7A 4A29A 1AW2A 2GQ9A 2E77A 2J6XA 3CLMA 4MUZA 4Y9AA 1J5TA 5EKYA 1F05A 4HT3A 3IIOA 3LCXA 3W6YA 3O6CA 5G1TA 3H54A 5H91A 3LTSA 3M5YA 4NQ1A 1LRQA 1SU5A 4LRSA 1FWRA 1G69A 2BTMA 1SPQA 3IGSA 1DBTA 1XBXA 2C14A 5D32A 4JTGA 4E0CA 1FCQA 2ZTJA 2E6DA 4Z08A 5AB3A 2QEZA 4QJ1A 3UPWA 1VHCA 2Y85A 1GG0A 3TUUA 4HKPA 4QSHA 1TIMA 5AHFA 2CWNA 8TIMA 3HGSA 3W72A 4A2RA 3TJLA 3BLEA 1Q6LA 1RQHA 3LBCA 2YCEA 3TSMA 2Z6JA 1VZWA 4FIQA 1QAPA 2EF9A 4CCCA 2GJLA 1SQ7A 3W88A 1TQXA 3BLIA 1IXNA 4NT0A 2CLLA 3QFEA 1SW7A 3E9AA 1K7EA 2NV2A 5DLCA 1L6SA 4PL2A 1YTEA 4GWEA 1F7BA 1XM3A 3SSJA 1TTJA 3PAJA 4D2JA 5AC6A 4O8RA 1B3OA 2VEKA 5DY3A 2V30A 4FF7A 1R30A 3L0NA 4CNOA 1SO6A 1GTHA 4K37A 4IPIA 1D9EA 3LCLA 3O16A 1TV8A 3ATYA 1GQNA 1KTBA 2ABAA 3I7QA 2B0MA 4KKXA 3S1WA 3BARA 2VFHA 1GJPA 4QNEA 4AHOA 3INPA 5LSMA 4RXFA 5DCEA 3E12A 3TXZA 1O94A 3C4UA 3CM4A 4AB4A 2BXVA 1YTKA 4ZVJA 2H6RA 3LHZA 1TREA 4NNCA 5F4XA 3FFSA 4M5PA 1LOLA 1AL7A 3NM3A 4UMAA 2FLIA 2Z2UA 3W1UA 2ZZ2A 3HG4A 1W54A 2WSRA 3GAYA 1KM5A 3BG5A 4XBKA 4JTLA 3QPYA 4HNVA 3HJZA 1EWDA 1MEWA 3P67A 4LWWA 3A9IA 4RJEA 4YMZA 3LHWA 3QYQA 2G5WA 3ZS4A 2FQIA 2E5DA 4FNRA 3MI2A 1P0KA 5K2ZA 2CZDA 4MYAA 3HG2A 4N02A 4UTWA 3NQ2A 3UXAA 2E5CA 1PL9A 5AC7A 5LNSA 1TV7A 4PEKA 1Q3NA 2H8ZA 3TW6A 4HNTA 3MI3A 3MO7A 1X6UA 4OV4A 1EIXA 1VYPX 3B04A 4UTJA 4JDBA 4LV4A 4DO6A 4JR5A 2ISSA 3AJXA 5AYXA 1JCMP 1A5BA 1OK4A 2ZZ6A 4WQ6A 2FDSA 4TX9A 1KLZA 1LLZA 4YXGA 4GUHA 4UNLA 5TQLA 3M44A 5AC8A 5K3VA 4HNNA 3LHVA 1Z42A 5HMSA 2OMAA 4MIMA 4JICA 1SO3A 3UNDA 2TMDA 3BW3A 3LHUA 5F4WA 3T40A 3GKFA 3EX2A 2DORA 1Q45A 1OFDA 3MHGA 5AHNA 3NAVA 3S1UA 2GQAA 4JIPA 4FNSA 3W1AA 3LTPA 5AHMA 1W1ZA 2CLFA 1RQEA 2FJKA 5EMUA 2QCHA 1AW5A 2DP3A 3GDMA 3NL3A 4LVFA 4K7YA 2ZCGA 3HPZA 4CNNA 4DF0A 3LRKA 1DL3A 1K3UA 3SY5A 3NPWA 4GUGA 1K8ZA 2NZLA 1PV8A 2OZ0A 5LGXA 4NJKA 4M6QA 2CZ5A 3M0ZA 1FDZA 2ATMA 2PRMA 3NNTA 5AYYA 3HPXA 4AH7A 1JQXA 4FIRA 4LU0A 4ZQMA 3EWZA 3LHYA 2QCDA 2EAWA 1SZEA 3TE9A 4LUIA 2ISVA 3W9ZA 5BW6A 4O1CA 3W1MA 3S5NA 2ZA2A 4UFJA 3O6DA 4K38A 3G22A 3MI6A 3GDKA 4OE7A 1PHWA 1KM0A 4ADSA 1TV5A 3PB2A 3DFNA 4HPXA 4OQVA 2WSYA 1VS1A 1TPVA 1BWLA 4WXZA 1KFLA 4X22A 2IQTA 4EOUA 3DKLA 3LDVA 1LM1A 1NAL1 2QUTA 5HULA 1K8XA 3B0PA 3DBPA 1DORA 4TIMA 1G4TA 3NQ8A 3W2JA 4O14A 4JX5A 5G2HA 1F6KA 2C13A 1ZALA 1I2RA 1LROA 2JBMA 1OF8A 1VCFA 2F7FA 5BMXA 3O6YX 3JR2A 3BV4A 1EB3A 4IMDA 5I3JA 4IWWA 3L67A 1B4KA 4R34A 1D3HA 3SECA 2OJPA 4N4QA 4AHPA 3N14A 4JGDA 1KV8A 1OK6A 1P1XA 1LZOA 1SFLA 4IPJA 4O15A 4C1KA 1JCJA 3IVUA 2H90A 4NUWA 5ABTA 2JK2A 4S1FA 3HPSA 3H55A 1UUMA 5KSWA 3WK2A 3M5XA 3W1LA 1RZMA 1R2SA 2ZRXA 3QRHA 5L6UA 2AGKA 3SGZA 3L66A 5HQEA 5HUOA 3WK1A 3OVRA 4O52A 4JTKA 2X2GA 1TPDA 4LNYA 1YDOA 1JJKA 3VE7A 1W5PA 4O18A 4ORMA 2J9ZA 4XZ9A 4UTTC 3PB0A 4JTJA 1OFBA 2QCDB 4UNKA 4MZ8A 3GIYA 4JYFA 4JX6A 2BSLA 4A3UA 4XWUA 4QNWA 3NDOA 3A22A 1VHNA 3OHIA 1I2NA 1B57A 2ZZ7A 3FLUA 3KFTA 3W86A 2BLEA 3PS7A 3UY7A 4HN4A 2VEMA 2C16A 5CGQA 3CWNA 4O57A 3W73A 4JYDA 5D37A 3B03A 1WV2A 1LRNA 2WO5A 1LORA 4LT9A 4LV9A 2PCQA 1JQVA 4JEQA 1OX4A 4JD4A 4UMCA 4E2DA 3WJYA 1ICSA 4ZMGA 3MP5A 4Q32A 1TPFA 1ALDA 3NL5A 5IBXC 3LBMA 4O12A 5HWNA 3ZWTA 3G1VA 1WAUA 2ZFAA 5K9DA 3DHDA 4J9JA 4KWWA 3H53A 3MWAA 4LRTA 2V5BA 4MLJA 1A5AA 3W1QA 4JNMA 1AW1A 2UV8G 2G97A 3NQCA 3B4UA 2NXHA 1OFPA 5LHFA 1J4EA 3U6WA 1R47A 1W3NA 3I68A 3W2NA 3DFTA 3M1ZA 3QF0A 5KINA 3P81A 5HJLA 2RH9A 4KFOA 2Y62A 2VXNA 5LHEA 1ME8A 3W2KA 3G8RA 4PFMA 4JYEA 1JCYA 2VFFA 1O4UA 1OX5A 2WSQA 3QW4B 4E2BA 5J5DA 2GUUA 4H4IA 3TQ0A 3KXQA 4XTIA 3OA3A 4BI5A 3N19B 5FF3A 3G3DA 2VOMA 4NNAA 1OHLA 2CLEA 5HNRA 3IIZA 1OFRA 4YWIA 1QDSA 3TJXA 1FBAA 1L2UA 4IJBA 2Z1BA 3B0VC 1O5KA 1WOAA 1IGSA 4MZYA 4W9TA 3TH6A 1Z44A 5LNWA 3P7YA 3IVTA 3T44A 4NXKA 5F2IA 3ZWSA 7TIMA 4K6AA 1D3GA 2QUVA 2Y7EA 5U7SA 2ZYFA 1EP3A 1UJPA 3G1SA 5G2WA 2V8ZA 1PS9A 4IX0A 1FQ0A 5CPNA 5G4EA 2DJXA 2QF7A 3NQEA 4GUIA 4R33A 4IMGA 2AAMA 3GZ3A 1SUXA 1L6YA 1H7NA 1H7RA 1WX0A 5CG7A 1C9DA 3C8FA 1H61A 2H3DA 3MYOA 1NF0A 1S3HA 1FY6A 2DZTA 2FIQA 1EP2A 1GVFA 1W5NA 3NG3A 3D0CA 3K30A 1N8FA 3G8EA 3NVTA 5FEXA 3C2FA 1KFKA 1OX4B 1UBSA 1H7WA 1P0NA 4FXRA 5FEWA 4TR9A 1MXSA 4HNUA 4OGZA 1YADA 2WKJA 4HHPA 3GR8A 5AHEA 3KVJA 1TMHA 3P84A 4I7UA 3E96A 1EWEA 1HG3A 2X30A 4NJGA 4O28A 1OYCA 3TX9A 1ZFJA 2RFGA 4ZQRA 4MY8A 5CPMA 3NZRA 2VEIA 3W83A 2ZDRA 4WY0A 4JIQA 2G96A 3C2VA 1TTIA 5LKYA 1V5XA 2GVGA 3I7RA 3FA5A 4LOCA 3HGOA 5D33A 1AL8A 1H7XA 3M16A 1FWTA 4LVDA 2Y7FA 1PHQA 4K8HA 1BKSA 2YR1A 2JKAA 3TQKA 1SZFA 2C15A 3TK7A 1WYIA 2B7QA 3C0JA 3PBVA 4DELA 4WX2A 3W74A 5F4SA 4TO8A 3TU9A 3Q58A 1I2OA 3UWYA 1YYAA 3TKFA 2DZWA 1DOSA 3CPRA 4Q33A 3VCRA 1XDLA 1A5CA 3C52A 3LCWA 3CHVA 3W23A 5F2LA 4BR1A 3B05A 3DZ1A 3THAA 1LLWA 2OT1A 3QZEA 2RKXA 1HL2A 5I3GA 4BI6A 1ICPA 2YZRA 1EPXA 4UMBA 5FF2A 3C6CA 4JXCA 1KM2A 3F4NA 1JUKA 1GTEA 3NQFA 1SZNA 2ZRUA 3SI9A 2QJGA 1TO3A 1OFAA 1ME7A 1QO2A 4ORIA 5F2MA 2FPYA 3EWYA 3BPWA 3G1HA 1NFBA 4NX0A 5MHBA 4Z1AA 1H51A 4JS3A 1WBHA 2HS6A 2C1HA 4I7VA 3Q37A 3LXCA 4XBSA 2P0OA 3KVMA 2RDWA 4M6PA 1TJRA 5K7JA 1QFEA 5FF4A 1TSIA 5EPDA 4MY1A 4UFKA 4HPJA 3TSBA 1THFD 4LS0A 2HSAA 3HBLA 5I3IA 3O8AA 2PRLA 5D2WA 3TC6A 4JTHA 4AWUA 3PM6A 1DJNA 3NPVA 2C19A 1GYLA 1KW1A 4IXXA 4OU1A 3RNDA 2ISWA 5D2TA 1PCWA 3R12A 2VKZG 3G1DA 1AMKA 1GT8A 3N3MA 4WY0B 1CI1A 3HF3A 1F74A 3B8DA 3OIXA 4JY9A 5EYWA 3W85A 2ATSA 1MO0A 3THQA 3SJ3A 4H3DA 4XKYA 4UFLA 2YX0A 4WOZA 1SW0A 1KTCA 1EEPA 3P82A 4EVZA 3EWWA 1H62A 4YL2A 3QSRA 3N73A 3N2XA 3RK8A 4MPQA 4A21A 1VLWA 1MEHA 2CLKA 4RZ4A 4BWLA 2JGQA 3VFLA 2X1SA 3W1PA 4I9AA 4O1DA 3LB0A 4O11A 1Y0EA 3UD6A 3PWAA 4YCOA 1VCVA 3ABOA 4EF9A 5D02A 2Y7DA 4FX6M 3RLUA 2E1DA 5D05A 1GPWA 4MJMA 1OF6A 3NA8A 4LTSA 4ZL1A 2NX1A 4O13A 4ONVA 1HO1A 4O16A 3TCEA 4XQ6A 5AYZA 2QCNA 3QC3A 4PC8A 3MHUA 1VCGA 2ZBTA 1RV8A 5I3HA 3CEPA 4FNPA 2GQ8A 4PODA 5FI8A 2PC4A 2WV8A 3W3OA 4PH6A 3QW3A 5LNRA 4ICNA 3WK3A 4O19A 3C2OA 5CKSA 1BEUA 3PVFA 4TU1A 5I3KA 3FJLA 2XN0A 3PR2A 1YLVA 3BW4A 3TROA 5HR6A 2BX7A 3O63A 1XXXA 3S1XA 1VQTA 5DBTA 2R91A 1ME9A 1SFJA 2ZTKA 5HWJA 1A50A 2NWRA 2V9DA 2OT0A 2Z0IA 3W75A 2FB3A 3PSVA 4QQ3A 2FPVA 3R89A 3SZ8A 4MJZA 2WQPA 2YW3A 1FXPA 1G4SA 2QDGA 3UPBA 5G2IA 4MYXA 4HSOA 1G67A 1TPC1 4AXKA 1VYRA 2WPBA 4MY9A 4QIUA 3LHTA 1J2WA 2B4GA 3ANYA 4FB7A 4RV8A 3W87A 3TMQA 4YCPA 4UTMA 5EL1A 4S2CA 4UR7A 3LI1A 4FNQA 2AQWA 1FCUA 5F2GA 5CZ0A 1TTPA 3WK0A 1M7OA 4X2RA 1H50A 3G18A 2C6QA 1FCVA 2YDAA 3KRUA 3OEXA 1F6PA 3S5YA 4ML9A 4B5NA 3L5MA 4MOZA 1H60A 3W7PA 1KM1A 3L0KA 3F1QA 5HINA 1GWJA 3DFQA 1WDWA 4UTHA 2VFGA 1ML1A 2R8WA 1Q6QA 2EHHA 2ZRVA 3U8GA 4K8EA 4PL1A 5GVJA 3GDLA 4UUIA 3R2GA 1OYAA 3JS3A 3LXBA 3NPXA 3LV5A 4OWGA 4M7SA 3O15A 2A7PA 3GNNA 2ALDA 3USBA 3WJWA 2EKCA 3BGGA 3GB6A 4JN6A 2PE4A 1HO4A 2XFWA 4HSNA 2A6LA 1AG1O 2VFIA 1XCFA 2Y89A 1YXYA 2V2DA 3NM1A 3TFXA 1K7FA 2NUXA 1IXQA 5D2YA 1KV5A 3S9YA 4O1AA 1VR6A 1W5MA 2NX3A 3GR7A 4AEOA 1TB3A 1QNVA 2V2HA 1TPWA 3S8HA 2QCLA 1W0MA 3U2OA 4Z0SA 3NZ1A 4Z1CA 2W0UA 3PSWA 3M41A 1WBJA 1WQ5A 4RZ6A 5CPOA 4QAIA 3LERA 1XDMA 3NQ7A 1DKWA 3W7CA 1NF7A 1H7OA 2P10A 3FYOA 1W8SA 3NEVA 2VFDA 4CQ8A 1EP1A 1JCXA 1KBIA 1TRDA 4RXGA 2FB2A 4EWND 1DQWA 1E51A 3LCFA 5CSRA 1RVGA 2A6NA 2TSYA 4UTUA 2CW6A 3ABSA 3W76A 4RCXA 1GVOA 5KITA 2A85A 3G1XA 2XN1A 3DH7A 1U83A 4FNTA 3NQVA 4MKNA 4FXSA 4FO4A 4WY0F 1XC4A 5D09A 3W7JA 1KM6A 2QJIA 2ZZ1A 3NL2A 1OX6A 4CQAA 2FTPA 2E5BA 1KFCA 3M7WA 3FYPA 3NOEA 4UC5A 1KM3A 5K9XA 3NXFA 1RR2A 1H5YA 5CSSA 3CC1A 3GAKA 2HS8A 2V0TA 3P61A 2ZRWA 1F2JA 3G1FA 2J9YA 3WJSA 2I1OA 3STCA 1X8FA 2DZPA 3CIWA 2VFEA 3MHFA 1G7VA 3UWZA 5DN1A 5FF0A 3TNOA 1MZHA 3G1YA 4JTUA 3O07A 1GVSA 5K4XA 2TYSA 3P60A 2PRHA 3GX9A 5D38A 1A5SA 3TW7A 3IRDA 1FDYA 3W7HA 1FWSA 2GVLA 2B7OA 2R94A 3EWXA 1G4EA 2ZA3A 3CWOX 1CW2A 3EWBX 1EX5A 5E0KA 1T99A 3NQDA 3T7VA 1F5ZA 3BLFA 3QQ1A 3RFAA 3W2MA 3TSDA 5KMYA 3EXTA 3W1XA 4AHQA 4NNBA 3VI2A 1X1ZA 3QM3A 2Y6ZA 1NVMA 1EA0A 3W7EA 3UXDA 4AAJA 4RKAA 3LX9A 2JGYA 3TAOA 3A21A 3MW7A 3RF9A 3DFOA 2YFNA 2J24A 3S0CA 3O06A 3T55A 4RZ5A 1FWNA 3KRZA 3W7NA 2YGYA 4DXVA 1S5TA 1QO5A 3LRMA 3IVSA 1TPUA 4LUJA 3R5EA 5EY5A 1Z41A 1XBVA 3S1VA 2CLIA 4IMCA 1O95A 2NLIA 1TQJA 1K03A 3HG3A 2QJHA 5FESA 5LNUA 1V7YA 5G5IA 2E6FA 3G0SA 3MP3A 2ZQ0A 1LBFA 1WA3A 1JR1A 4UTLA 5DXYA 4MZ1A 3SIZA 1Q6RA 3A24A 1C29A 1FDJA 3PUDA 1OABA 3EX4A 2NUWA 2HMCA 2QKFA 3PUEA 4GUJA 4NU7A 5I3FA 4ZQNA 4AF0A 3R8RA 4QITA 1TYGA 2Z6IA 1UB3A 3W1NA 4JTEA 3NR0A 3LCIA 5A8GA 3SR7A 1I2PA 3EEGA 5AHIA 5KZMA 3GXTA 2VEPA 1PCKA 2DU2A 4PCFA 1PVNA 3GK0A 2E68A 2A5HA 2WNQA 4DBDA 3NL6A 1OFEA 2WJZA 2A2IA 3W7KA 4JDYA 3VE9A 1IXPA 1ADOA 2QCGA 2QR6A 3V75A 1DVJA 3TMLA 4NJIA 1C8VA 3S42A 4Z1BA 1ZHAA 4DF1A 2VENA 5D03A 3W07A 3P62A 3QMTA 1DV7A 4C1LA 3I6RA 3LV6A 4OHQA 1SSGA 3STEA 2OCZA 4TMCA 1XL9A 4X9SA 3L9CA 4UTWC 5LNVA 4RX0A 4CLMA 1GG1A 2Y7GA 4A22A 3NPUA 4QISA 3E02A 4Q4KA 3LGEA 2LLEA 3M5ZA 4UTTA 2WOQA 1XBYA 2RDTA 3MBDA 1KLYA 1LOQA 3IGUA 1I45A 3Q94A 1B9BA 4WUIA 3FIGA 3STFA 4OT7A 2QUUA 4Y6GA 1LOSA 1W56A 1YDVA 3P80A 1ZENA 4Z0JA 3S6DA 4AVFA 3NQ6A 2VC6A 2YPIA 3LLFA 1W37A 3DAQA 5CZTA 3TR2A 4U4MA 1XFBA 4ZQCA 2A0NA 4BF9A 4DQWA 2KZHA 4I7WA 4OV9A 4DPQA 2J88A 4UIOA 3UZ5A 3W7GA 4FNUA 3PC0A 2NXIA 1VLIA 1VH7A 5FEPA 4WXYA 4AF0B 3TV8A 3W7QA 4GFSA 2ZZ4A 3TQVA 4Z1DA 1VC4A 4GJ1A 5IBXA 3G3MA 3UWWA 4Y96A 4LVAA 4NZFA 1MSSA 3CEUA 1S5VA 3TIMA 3M5VA 1N55A 1ZNNA 3ABRA 3DHFA 1H1YA 1PE1A 3W7IA 2HTMA 1KTNA 3GVGA 2EPHA 3CIXA 1WXJA 1F73A 1X1OA 4ALDA 4P2VA 4CNPA 1SZGA 5DELA 3W84A 3C3NA 3QEZA 5D30A 2C0AA 3OG3A 4WD0A 3I65A 1YPIA 2XN2A 3FOKA
chains in the Genus database with same CATH superfamily
4H2HA 3SN1A 3LM7A 1UD3A 1OINA 9RUBA 5CSUA 5D04C 1GOMA 6ALDA 2GJNA 2BVYA 4S3CA 2RHGA 3HOJA 1DP0A 1IZJA 4OUEA 3VCCA 2ZKMX 3DFPA 3SRFA 2YB1A 4KWOA 1GHSA 5E93A 2ZUTA 5AYBA 3W2UA 3C61A 2C3ZA 1YMYA 3CTTA 3VD5A 4AZ5A 3WLKX 1I0DA 1WO2A 1PKNA 4WSJA 3AMKA 3AXMA 3PN8A 3R79A 1TELA 2YXGA 4R88A 5FF7A 3IIPA 2ZZ5A 4PRTA 4IF2A 4XUGA 3WJZA 2V68A 1JCLA 3B40A 1W3IA 2Y70A 5C70A 1CXKA 2J7FA 3QPZA 4CCEA 3DYPA 4N6EA 4YNGA 3PUGA 2A1YA 1P0BA 1EC8A 1U5JA 4IUOA 2Q3RA 3VOGA 2QHAA 4YHEA 4EPBC 4H6QA 3P8JA 1JRBA 2OO6A 4HU8A 3LG3A 2J25A 2ZVIA 1TPB1 2WMJA 3VD7A 1ZCOA 3PULA 2WXDM 1BXBA 3B8TA 1SFTA 1Y65A 1NDYA 3CTLA 4JTTA 2Z24A 1FFQA 3L0GA 3GTNA 3LCGA 3OBAA 4IL2A 3GH7A 1F3EA 1W3TA 3RM8A 3GU1A 4H8HA 4KERA 2W4XA 3NSMA 4GMEA 5JIWA 3D5HA 4B90A 3TFCA 7ODCA 1DWAM 3GR4A 4ZTYA 5TIMA 4KW2A 3GC4A 3NQGA 3GHUA 3THCA 5EBAA 2OYKA 4XKYB 3DDMA 3ISIX 3EXRA 3G1RA 3LNPA 4GOAA 2VR4A 4QSFA 4WSHA 4LC6A 1TVLA 3SQMA 4N4PA 3WUFA 1XIMA 4LAZA 2ACSA 1AQMA 4KFNA 1LBMA 1ZAIA 1FWDC 1GKQA 3PG9A 3PJTA 4ASTA 4TVDA 2GWNA 3MMTA 5DF0A 3EX1A 1KXHA 4JTIA 4ERAA 4KEVA 3WLQA 4ADUA 3GKAA 5BYWA 5AVHA 5JBEA 3PZMA 3WDRA 3C0QA 5D2XA 3P14A 2HBXA 4NRRA 3G5EA 1E1FA 4X3ZA 3PUOA 3OGVA 3ZR4A 2J7CA 1WE5A 3CUHA 1WXYA 2E6YA 5HNUA 3WD4A 3G0XA 2I14A 3W6LA 1B3YA 5LGZA 1SZRA 1YKWA 1KCZA 2PDUA 4TX6A 3CHFA 1HF6A 2J66A 4NVTA 1JCNA 2OYMA 4M0XA 1BWKA 3WF1A 2GQ3A 5BROA 3TXVA 3TLQA 3REQA 4DVOA 4TV5A 1LG1A 2V6AA 5EBUA 4WJEA 3BJTA 2G3NA 4N9BA 1IYXA 3YPIA 1PTGA 3CUIA 3GTHA 4GIYA 1O66A 2JF6A 1T8XA 2UBPC 2WKGA 2VGGA 4NZ5A 4M6VA 4M81A 3CUJA 4HMEA 4XVDA 4DM2A 1W9PA 2VVNA 4O4VA 4A3RA 4QLLA 3S5OA 3R25A 4ZE5A 3EOSA 2CZEA 3GG0A 1GGOA 1H2JA 3MDWA 3W81A 5CAKA 1RQBA 2WZIA 2XIIA 4R3UA 5D2VA 5HXMA 1EJXC 2A21A 1Q7MA 3PG8A 4O17A 3HFYA 2VX6A 1BKHA 4Q4PA 3SCNA 4DJFC 3CB8A 2QAFA 2NWSA 4E8GA 3QMRA 4TMBA 1W9BM 2QJMA 1EC9A 5H2ZA 3MANA 3NURA 3CH9A 4IIFA 4O53A 2DDXA 4GRSA 3G24A 4J5NA 1P7TA 2GGGA 2J7HA 2WM0A 2CITA 1VGAA 2FPTA 2WNZA 1ISWA 2VZUA 5G1YA 4LAMA 5LZLA 2PGRA 2V81A 3BLLA 1RLDA 2VQUA 4QDPA 2QV5A 2PFHA 4DO5A 3L2MA 4DWSD 4EACA 3BG3A 1HUVA 2CYGA 3QQ0A 4PB4A 2QVNA 1EXPA 1Z48A 4H6RA 5BXSA 4C5ZA 1GW1A 1QPOA 4MKVA 4DUWA 3A4XA 2O4QA 4O10A 1XLHA 2EPKX 3MBFA 4BQ3A 2ZA1A 4O1BA 2PDNA 4XZIA 1JULA 2BXYA 3GYEA 4D8ZA 3QN3A 4IQLA 5GQBA 4S39A 1QPNA 1FHVA 1T96A 5A6AA 2BHUA 1DQXA 3BH4A 4EIVA 4XB3A 1UPMB 3FVMA 3LA4A 1HTIA 3UG3A 1TRIA 1XJBA 3KUMA 4IP7A 4KH2A 9XIAA 2VZOA 2GDQA 4BFAA 3OP2A 4HMCA 4HMNA 4R7JA 1ZJIA 3WLTA 1UH3A 1V6TA 4JQ1A 1TPH1 1GYNA 3R43A 1WOBA 4P8XA 2G0WA 5FJRA 3DC0A 1L8NA 4BWLC 1ONRA 1UUQA 4K1GA 1QR7A 2CHNA 3O1NA 1SSDA 3HGRA 3VA8A 3ZM8A 3CK5A 3KVKA 3O05A 2PU0A 5IHRA 3BK0A 1J0ZA 3OLIA 4BHYA 3WYZA 4MVAA 3UQNA 1I0BA 2FFCA 4EX4A 4HPNA 2NVCA 3CHDA 3MSRA 5DCDA 4ZEPA 1XGEA 4DJDD 3E49A 5FCZA 4Y8FA 3TYAA 1UWUA 3TJIA 1XKJA 1FHLA 1ELSA 3QSTA 1B0IA 4LCSA 4O4WA 1H11A 4GGHA 3DFSA 4U10A 4FX8A 5B7ZA 3L5AA 4L9ZA 4NZ4A 3R4IA 2WBKA 2HK0A 1AK5A 1K8CA 1R8LA 4GY7A 3W7DA 3WQ4A 5GJPA 2QCEA 1BRLA 2WBGA 1KA9F 4DLMA 1M7XA 5KEZA 3UW6A 1OG0A 2Q8XA 4PUEA 4DAIA 5HQMA 5T26A 3W24A 4HOXA 2Y4SA 4DEFA 1EF3A 1XIIA 1W2PA 4AD3A 3FEMA 1GVQA 1DYSA 1E6ZA 2BXZA 2CLHA 1LBLA 4LW7A 2QMKA 1WXZA 1J0IA 2R1NA 5MF5A 3CPUA 3CLMA 1XIGA 2AKMA 2PTZA 1J5TA 3M0JA 3RX4A 2PWHA 4HK6A 3B9EA 2D3LA 3HURA 1UWAA 4N7QA 2R1PA 3QHOA 5CJMA 3O6CA 3K4WA 5G1TA 3W6YA 2YLAA 4JOMA 3LTSA 4B5XA 3QHNA 4NQ1A 4LRSA 1EJ7L 1OQFA 1XBXA 4DZAA 5D32A 3F7JA 5FL1A 4HKPA 4QSHA 4U3AA 2V38A 2CWNA 5JU6A 3W72A 1FRBA 4K8GA 1RQHA 2POZA 1QASA 3LBCA 3RYSA 1Y5WA 3WLJA 1VZWA 2AL2A 1QAPA 4BF5A 2GJLA 5T9CE 4FXJA 1SQ7A 3W88A 3BLIA 3T05A 1DXIA 1X98A 1SW7A 1XLDA 4US5D 1TZZA 1F7BA 3T0AA 3PAJA 2GWGA 5AC6A 3DOPA 4JIIX 3UEQA 3PWGA 3ANUA 4ZB0A 4C1NA 1GTHA 3AIVA 1D9EA 3GVVA 3W25A 4BQ2A 2HVMA 1S1RA 5JUVA 4D6HA 1SVDA 3BARA 2VFHA 5I2UA 4KETA 3INPA 3WLMA 5LSMA 2R9RA 1MW1A 3E12A 1O94A 3C4UA 3WNOA 3LHZA 3MMDA 2H9AB 4ZO7A 3RUBL 4UMAA 4PZVA 4KF1A 4CVUA 1YNYA 2WSRA 1UMYA 2Q02A 1UBPC 4MNLA 4LWWA 3IV8A 3N18A 4RJEA 1RPKA 3ITVA 2WJDA 5HATA 1ZL1A 3MI2A 2VRQA 4MYAA 3WEMA 3AIBA 1R38A 2H8ZA 4I5RA 3MO7A 1VYPX 3SY1A 4JKMA 2DIKA 1A5BA 3G2GA 4H9TA 3EOOA 4GUHA 4UNLA 1DIDA 4EAYA 2JEPA 1FWBC 3K8KA 1SJDA 1Z42A 1AJZA 4J28A 3UNDA 3BW3A 2Y5SA 3FNDA 4O1FA 5CPSA 4FOJA 1OD8A 4ENLA 3RU8X 1XFCA 3GTIA 1A3XA 4EKJA 2QDDA 2DP3A 3NL3A 3OYZA 4DF0A 2PGFA 1DL3A 1K3UA 3SY5A 3KDNA 3NPWA 4Z17A 5A94A 1HN1A 1K8ZA 2NZLA 3ITLA 5FAGA 1TG7A 4NJKA 4AZIA 2FZMA 1VFHA 2PRMA 7PTDA 1RP9A 2FHFA 3HPXA 1CCWB 4AIUA 1JQXA 2QGYA 3OB8A 4FIRA 1QRQA 2QCDA 2EAWA 1RJRA 2DT0A 4U3CA 1B5TA 5BW6A 5ABGA 4UFJA 3O6DA 4K38A 1JGIA 3MI6A 5JVLA 3GDKA 4OE7A 2YCKX 3PB2A 3APTA 1VS1A 1E43A 3GDBA 4Z2HA 2OO0A 4RDYA 5HMFA 1BWLA 4WXZA 1V4YA 1MWOA 3D46A 3AMLA 2W5FA 4RDWA 3DESA 5XINA 4TIMA 5EMJA 4MWAA 4AEFA 1X6LA 1G4TA 2OELA 3ZR5A 4Q8MA 4JCMA 4YPJA 4YS1A 4D6DA 1ZALA 2BHZA 1KQYA 1PKLA 4GI6A 1LROA 3GYCA 3AU6A 2YA2A 1EEXA 3ZO9A 1NIUA 3O6YX 3JR2A 2BOEX 2TODA 1B4KA 1D3HA 4OFCA 2NQLA 1KD0A 4AHPA 3P93A 4H9VA 1KV8A 1P1XA 3BOLA 1EHAA 4O15A 1QHZA 1UZ4A 3K1GA 1OD0A 1E3XA 1DJXA 1TUXA 2JK2A 1KGUA 2NV9A 3WZ0E 5KSWA 3ORWA 1PAMA 2WZMA 3ALGA 1R2SA 1JI1A 3QRHA 1E0UA 1K6WA 3WQEA 2DT1A 3GFXA 5HUOA 1WKEA 2ZWYA 3UU0A 3WK1A 1XQLA 1BTCA 1WDDA 4JTDA 4RPPA 3BE7A 5FA5A 4JTKA 2ZE3A 2ISDA 3FXGA 1YDOA 3VE7A 4O18A 4ORMA 1P0DA 4IICA 4W5ZA 5EMLA 5JH2A 1VJSA 1X8CA 1ENUA 1VIZA 4UNKA 5CAHA 3GIYA 3BURA 5I02A 3WQ6A 4GZIA 1C7TA 3A22A 3OHIA 4NZCA 3U5UA 4GZ7A 3WLSA 1BSIA 5I06A 4ZO9A 2BLEA 3UY7A 2C16A 1ISZA 4L61A 4BZYA 3B03A 4MAVA 3R8HA 1KQZA 3FDKA 1W3KA 4DZ5A 4LV9A 2GJRA 1US2A 2I7GA 1WUFA 1JQVA 2ZXQA 1OX4A 5FL0A 1EGZA 4JFSA 4CD5A 1UMLA 1V77A 4LYRA 4ZMGA 3MP5A 4WVXA 3NL5A 3THDA 4B92A 2VURA 1CIUA 1WAUA 2FZDA 3DHDA 4J9JA 1AMYA 3AMCA 1FFRA 2E1WA 4W8LA 3MWAA 4LRTA 4YVVA 3GS6A 3A6OA 1PX8A 2PMQA 4REQB 2UV8G 3B4UA 2NXHA 2DUAA 3U6WA 1BD0A 3HM7A 5KINA 2P76A 4E3VA 2VXNA 4WKHA 5LHEA 1ZBVA 6REQA 5LIYX 1OX5A 3QW4B 5A2AA 4XTIA 3OA3A 3UXIA 1UQZA 2CLEA 3IIZA 1QDSA 3TJXA 4C6PA 4PMYA 1LUCB 3TTSA 2XIBA 2REQB 3ZJ8A 4W9TA 4W88A 1D7FA 1I9CB 3IVTA 3VZZA 5F2IA 4H7CA 4WIWA 1TR1A 3ZWSA 4I3GA 1ZJBA 4HSHA 5CPTA 5U7SA 1EP3A 1UJPA 3G1SA 4F0HA 2V8ZA 1PS9A 3F2BA 2Y24A 3FSTA 1TA3A 3UERA 1ZJAA 4IMGA 1NJJA 3GU9A 2AAMA 3GZ3A 1SUXA 5A3HA 1L6YA 4HJWA 1WX0A 1QI4A 1H61A 2H3DA 3QGAC 1NF0A 3TWAA 3WBEA 4J2MA 3VX1A 1HKVA 3H6OA 3C2FA 3QTGA 3QVQA 1UBSA 3LZ5A 3CAVA 1QW7A 5FEWA 1MXSA 3H2CA 3L4XA 3WBAA 4P7LA 4MG4A 1BF6A 2XVPA 3IUDA 4LXFA 2DQWA 1TVNA 2GGEA 3AISA 1PDYA 1E4LA 1EWEA 4PTVA 2X30A 1WNOA 4O28A 1E73M 3TX9A 5BZAA 5I03A 1YDYA 3H7RA 4L56A 1F4HA 5T9BG 2OWWA 3DUGA 5AZ1A 1QK0A 3VGEA 2DEPA 3ZQ9A 1MFUA 4RW3A 1AL8A 4INFA 2EPNA 3ARQA 4CN1A 3KOXA 1PHQA 3OW1A 1U2YA 1BKSA 4YYCA 4Q8UA 4TXEA 2I5GA 4DJEA 3R11A 3L4VA 4DELA 1UC4A 4FOKA 2PDHA 1FWEC 2VEFA 4TO8A 3BANA 3UWYA 1W32A 3ES7A 3TC3A 3TKFA 4ML4A 1E6PA 1DOSA 3VCRA 1IZCA 1A5CA 3C52A 2NVDA 3K1DA 3KS6A 1J8VA 3FEQA 2OT1A 3QZEA 1H0IA 4BI6A 3ARXA 1L6GA 1ICPA 1P43A 3IPWA 5DANA 1PZ1A 1EPXA 4UMBA 3C6CA 4JXCA 4QEEA 1UP3A 5MKGA 3ARVA 3IJ9A 3LEPA 3NQFA 3SI9A 2QJGA 5DT7A 1EDQA 1TO3A 2C8NA 1QO2A 4IMAA 3N29A 4C6DA 1K4HA 2QUNA 3BOFA 4OZOA 4JPGA 4M56A 3U48A 1DWFM 4M6PA 1TJ2A 1G01A 2P88A 1KNWA 1FOBA 1S38A 5I0DA 1OT1A 2E0PA 1JPMA 4MKSA 5I3IA 1BYCA 3O8AA 2PRLA 3TC6A 4AWUA 3PM6A 3NPVA 4XD4A 1UW9A 2C19A 2WAGA 4AD4A 5D8WA 5CC5A 1XYBA 1A0EA 2X2YA 3R12A 3R7MA 1AMKA 3EEZA 4MB1A 1GT8A 4WY0B 4I5UA 3W85A 1MO0A 3THQA 3CHCA 3SJ3A 1UR3M 1HKMA 1PX3A 4H3DA 4KRTA 4UFLA 2YX0A 3ENLA 2Z7KA 3KOYA 1EEPA 3DG7A 4EVZA 4EWJA 3N73A 4MPQA 4RZ4A 4BWLA 2JGQA 3VFLA 4KBXA 3PBMA 3W1PA 1FTXA 3LB0A 5I00A 3UD6A 4N42A 5B80A 2PTWA 3H4WA 4QG8A 4LTSA 1IWPA 4O13A 4O16A 4LBRA 2QPXA 4XIAA 1NFPA 3CXOA 4PC8A 3U2EA 5I24A 1RV8A 3SBFA 5H1WA 2E8YA 3U2ZA 4ACZA 5FI8A 3KS5A 1RBOB 4E4PA 4JFWA 3HV9A 4ECLA 2CEQA 3QY8A 1TWSA 3QW3A 5LNRA 1KWGA 3N17A 4HOWA 4O19A 3XIMA 5C9ZA 4TU1A 1NELA 4AZCB 1VQTA 4NAFB 5DBTA 4QE1A 2R91A 1HL9A 3LGDA 1VFSA 3PANA 2Z7GA 4QTGA 2Z0IA 2PTDA 3ZIZA 2PDQA 4IHCA 4F0RA 4Q8VA 1G4SA 5G2IA 1TWDA 1CGTA 1VYRA 4C1NB 3LHTA 3ANYA 4WCJA 1JXKA 3W87A 3VIOA 4YCPA 2P5NA 4R7OA 3R0KA 3LI1A 5A6BD 2DV0A 3NSXA 4YN5A 4XVEA 4LY4A 1R87A 5M2FX 1MXGA 3S2JA 1GW9A 3M0MA 2OFJA 2OKOA 4X2RA 2C6QA 3GG8A 4PUDA 5CH9A 1ESWA 2VD9A 3KRUA 3OEXA 5M03A 2NW0A 4M8UA 3N2OA 4HZ7A 3VNIA 3L5MA 4XZNX 1KM1A 3L0KA 3F1QA 1DIOA 1GWJA 3TTEA 4D6FA 5A6JA 3DFQA 1V3LA 1X1NA 3EMCA 1HKWA 4IQJA 1ML1A 4PN2A 4XO7A 3RAOA 4Q22A 1DJGA 3U8GA 4K8EA 4JFTA 1SJAA 4PL1A 5T91A 3GDLA 1E1CA 5FJOA 4CU6A 1O1ZA 3LXBA 1Q6EA 4QBXA 1QOXA 3GNNA 7REQA 1JG9A 3WJWA 2EKCA 1GVEA 4JN6A 2XFWA 4P7OA 4FZIA 2A6LA 1AG1O 3EWCA 3KL0A 2C91A 4XAGA 3J7HA 4QCEA 1U1UA 4QEHA 1DE5A 4J3SA 3BOXA 1QNVA 4FOUA 3S8HA 2HBVA 3CO8A 3ECQA 4B3ZA 3AHZA 1A5UA 3U2OA 4LF2A 3RHGA 3PSWA 4ICMA 2V3GA 1WQ5A 4QAIA 3NQ7A 1X97A 1LLOA 3W7CA 1H7OA 2GGHA 3FYOA 2VHLA 2VFDA 1VPYA 1V51A 1EP1A 1IEWA 1TRDA 4JTQA 4EWND 3URNA 2FTWA 1VFFA 1E51A 3PTMA 1XQKA 1O68A 2XH2A 3DX5A 5KITA 4HCDA 3SCQA 1JF5A 3PTQA 4UZUA 4P7RA 2W67A 1FWFC 8RUCA 1U22A 4MKNA 1EFZA 4FXSA 1JZ8A 1EBHA 3GWQA 4FO4A 1XC4A 5D09A 3W7JA 1KM6A 2ZZ1A 1VBRA 3WH5A 5E9XA 1V8EA 2D3NA 3FYPA 4J27A 4ZODA 4UTFA 3DIPA 3GBDA 4IFKA 2PGWA 2HS8A 3P61A 2ZRWA 3G1FA 4ATWA 2XH4A 3QOMA 1M7JA 3STCA 3PNUA 1ITXA 1X8FA 3CIWA 5FF0A 1G7VA 2FZ8A 2P8BA 3G1YA 3A4JA 1GVSA 4TQTA 2DVUA 3P60A 3E0FA 1W1YA 2HPIA 5D38A 3R94A 3TW7A 2HWGA 4UWMA 2X7WA 1FWSA 2GVLA 1YEYA 5C2GA 2V5CA 1WZMA 1G4EA 1EX5A 1QXLA 1DJHA 3NQDA 3E38A 3T7VA 2IKIA 1A5NC 3QQ1A 1US0A 2D0HA 3W2MA 3E2VA 5KMYA 4NNBA 3B8UA 3VI2A 1BVNP 1U1HA 2CHRA 4DWSA 1NVMA 4S3BA 5C0QA 5A95A 1FKWA 1GQJA 5CEWA 3LX9A 2JFEX 4GXPA 1T5AA 4MJ4A 3H4GA 3ITTA 4IGSA 3NYDA 1ONXA 1KCLA 1R5YA 4HK7A 2YA1A 3IVSA 1TPUA 5EY5A 4A8IA 1XBVA 2DGAA 3GXMA 1R3RA 2DQXA 1PWLA 3WQFA 1TQJA 1K03A 5H6HA 5DX7A 5LNUA 4LAKA 1CZ1A 3G0SA 4KT2A 2VGBA 3LPFA 1VKFA 3BAKA 4Z42C 3ITYA 4B5VA 1MW0A 3EX4A 4CEXC 3VU2A 4GUJA 3WH8A 5I3FA 1QVBA 4QITA 4GO8A 3WBYA 4DB7A 1EJUC 3L23A 5CLTA 3SR7A 1I2PA 3T8QA 3GXTA 2E3ZA 2HROA 1PCKA 2DU2A 3GK0A 2J7GA 2E68A 4ZFMA 2A5HA 2PTYA 4B5TA 2XZ9A 1IXPA 3V75A 1DVJA 4CD8A 4Z2KA 4D72A 1CBGA 3UXLA 2BP1A 4PMJA 2ZX5A 1OB0A 1CLKA 5BCAA 1DV7A 4C1LA 4GIRA 3QBUA 2OCZA 2X1IA 1BYAA 1YE4A 4X9SA 3VIJA 4RX0A 2Y7GA 3AXIA 2X7VA 3IK4A 5TD4A 2DT2A 4JFVA 5A8NA 2WOQA 3CL6A 1XBYA 4M6UA 1NWTA 3MBDA 3IGUA 1E72M 3Q94A 1UIPA 3FIGA 4OT7A 1W1VA 4Y6GA 1LOSA 2P53A 4Q8OA 1C8XA 1S2TA 1IWAA 1AZ1A 4BS0A 1RVKA 4AVFA 1XFBA 2Y5JA 1XYMA 3VGDA 4DQWA 2KZHA 1XLAA 3GH5A 4UIOA 3UZ5A 3W7GA 1XWYA 2ZXAA 3BCFA 1Q6GA 3STPA 1V02E 1ONEA 4RNFA 2NXIA 1VLIA 4IJRA 4AF0B 3TV8A 2D0FA 2HISA 5A6LA 4ERGA 3BICA 1UYQA 1A49A 2R82A 1VC4A 1MW2A 2I17A 1JDDA 1TWZA 3TONA 2ZC8A 1MSSA 4IPLA 5CPQA 3AUJA 5FJUA 1P48A 1N55A 1ZNNA 3ABRA 3IJDA 4H7ZA 3VDAA 3GVGA 2XIQA 1WXJA 2B81A 2YZ5A 3C0LA 1SZGA 4IFRA 4IIGA 4LEQA 5DELA 3V5CA 3UG5A 1VP5A 1YPIA 4J40A 3NDYA 3FOKA 4R7WA 2GUYA 3LCHA 1W1A1 3OBKA 2UY5A 3PF3A 4P7QA 2BVWA 3PK7A 4W87A 2WHLA 1W3LA 3M46A 3VC6A 4R85A 4K36A 1FWGC 2J13A 4AD1A 3GNRA 1F3XA 3FAXA 2PURA 4PUMA 2XYLA 3HN3A 1EUNA 4GNVA 2J4GA 1RY0A 4WJ8A 3GDRA 3SCOA 3KX6A 5C7VA 2YW4A 3I3DA 1V3HA 1CLVA 3ZLFA 5KZEA 4UR8A 4MLRA 2R1KA 4L1WA 2VZSA 1XKYA 4AZ7A 1JVNA 3M6YA 4US5A 1FWCC 2HVOA 2G8ZA 3Q65A 1TZ9A 1JIBA 3SGGA 1G0CA 2G95A 3AYRA 4E8DA 3W27A 1Q6FA 4UFIA 1NSJA 2JEQA 3K4AA 3BUVA 4ICCX 2D69A 1IIHA 1E9LA 2XWDA 4U28A 3N12A 1FWWA 3HB9A 2PWFA 2ZRYA 3RJYA 1KFBA 1GQLA 2BDQA 1HFBA 4JX4A 1JYXA 1VBHA 3QGKC 4KIRA 5GPRA 3WD1A 1ITCA 3ITGA 2B31A 1UR2A 4MNMA 4IGHA 4PBEA 4YLWA 3M0LA 1WDPA 1YBQA 2X41A 3EAUA 3IUIA 1JUEA 5K9CA 5CGMA 3HGJA 4J3VA 3EXSA 3ARPA 2PDGA 5C55A 1VBGA 2XG9A 3TOYA 1F76A 4F0KA 5DBUA 1UUOA 2OEKA 1LT8A 4CN4A 4B5UA 2F84A 2VRJA 1UCWA 3D6NA 1W31A 2ZRZA 1KBJA 3RR4A 1XIJA 1H1ZA 2D22A 5J5RA 2IPJA 3SQLA 3FGCA 1F4AA 3QV6A 4D6IA 4P61A 1R0MA 3H21A 3C2RA 5A6TC 1QCWA 1GEQA 3OZYA 2VCAA 3NGJA 2X42A 4TVCA 2C18A 3M64A 1M01A 4IL0A 4FLQA 4AMCA 4IQEA 3WJXA 3H2OA 2V2CA 2O92A 3SRKA 4DO4A 2BY0A 4QLJA 3DEQA 3WLNA 5M3WA 3H24A 2Y61A 3OZMA 3VTRA 2VELA 4RLIA 3BW2A 4GZEA 4B5SA 5HA7A 3S5SA 5RUBA 5REQB 4KESA 1JDFA 5AOUA 3WLHA 2JF7A 2YYTA 1R3YA 4KPLA 2ABBA 4RR4A 2CFFA 3AXXA 3IEBA 3W22A 2ZX7A 1NDWA 3KDOA 5CZJA 1V6VA 2V63A 3U3HA 4DY1A 5A6MA 3FA3A 3EX6A 1RPXA 4ACZB 3IJLA 2YB4A 4M1BA 3UZXA 2I56A 1AQHA 3VNMA 3IV3A 2YKKA 1QOQA 5FSEC 5BMWA 3DENA 5LIXX 5TBOA 3SN0A 3WFAA 2NX9A 2WC3A 4C6LA 3NUKA 1Y8BA 5HWMA 1JPIA 2PWVA 2A4AA 3CT7A 3H2AA 3G0UA 1Q5MA 1NP2A 3ARSA 1BG9A 2QIWA 4CNUA 4XTDA 4H7VA 4ATDA 3W02A 4RDVA 4GIAA 1UKOA 1X39A 4BEQA 5C2CA 2KX9A 4GYPC 4FR1A 3BWWA 4OBTA 3B4YA 1DJIA 3FS2A 1MUMA 1FCBA 3NFUA 3TLLA 2A7NA 3MUXA 2YYUA 2FYMA 2GK1A 3DGRA 3LOTA 4YIWA 2QVHA 5CJNA 3ZLHA 2Y63A 1T7LA 4CCZA 3AZTA 1JD9A 5HJXA 2DZSA 2W3ZA 3CV7A 3S2MA 4YTRA 3L5LA 2WHMA 2WW5A 2QCCA 4AWTA 2G50A 3GUWA 3QJAA 1JZ7A 2UY3A 1QMLA 4U33A 2Z1XA 1QI2A 3MJYA 4JY8A 1W5OA 1TE1A 1U5VA 3CS2A 3EX3A 4DLFA 1HJVA 3LLDA 4F66A 2DIJA 1R7OA 1W1B1 2GZXA 4NJJA 4S2BA 2J27A 5HUPA 3CYJA 4GYKA 2ZZ3A 1QHPA 1DXFA 3BVJA 4RNIA 4RV3A 3BSHA 1AZ2A 1ZAJA 3MCNA 1Q2RA 2P8CA 1TCMA 4NZ1A 3T0TA 3PBUA 1E1CB 2DPEA 1ITUA 3EB4A 4PCNA 3SRDA 3ZSTA 5SWUA 7REQB 4EXBA 3UNTA 5CZSA 3LU2A 5A5WA 3SGUA 4IM4A 3L2IA 2O0TA 4K68A 1YNPA 3STGA 3TDFA 4IMFA 3SQSA 4AZHA 3TAKA 1R2RA 4FX7A 4U5KA 1S46A 3KBNA 3BC9A 4GE8A 3VUSA 3N34A 2WZEA 1ZAHA 1KCKA 2Z2BA 2YOCA 1IEIA 2X1TA 1GZGA 1UD5A 3QZAA 3NSNA 1MEIA 4FA3A 2WJFA 1LWIA 4H2CA 3GXNA 4QJ4B 1NTHA 1LYXA 3KRSA 1XUUA 1A3HA 2WYSA 3KOFA 4AVOA 1EDTA 1P5BA 1DJWA 1B2YA 3GC2A 4S3FA 1CX9A 2FFIA 4LY8A 5A8PA 1TPEA 2QPUA 3SUTA 4RK8A 1FWAC 1P4CA 3F4VA 2QDHA 3CQKA 2DJLA 1ICQA 3BCDA 3DI1A 3BGJA 4OBRA 2WNNA 1LRTA 1Q6OA 3OHMB 1AQ0A 1TTQA 4LVGA 1Z89A 3ZT5A 1W5QA 4BQ5A 2I57A 3JU2A 1K7XA 2O7QA 3KE0A 3KVLA 3QR1A 3P3BA 1GJUA 2CU0A 3A23A 1AD1A 1D3CA 3AXHA 7XIMA 3C56A 3ZJ6A 5CQ1A 3VKAA 4LUSA 4XAYA 1YHTA 1V3IA 1SR9A 1PYMA 1JUBA 3GBEA 4RL3A 3FA4A 2V5DA 1VEMA 1A53A 3VINA 4PMQA 3E0WA 1CB7B 2VP8A 5DXXA 1Z32X 2DUZA 4FMVA 3NO5A 2DVXA 1XLFA 1VEOA 1M5WA 4B3LA 3W71A 2X16A 2ONEA 2CZVA 3RM4A 5FEZA 2PODA 1UZ1A 2D2GA 4GNJA 3QPEA 2QCMA 3G77A 4Q7NA 2OLSA 3PZTA 5B7YA 3ZJKA 1XCWA 4HPGA 3C2EA 2RGLA 2PDKA 3GNXA 3M0YA 2Q3OA 3S4TA 1REQA 1I2QA 2X1RA 3MKKA 4IUGA 4AZGA 1E0VA 2JKPA 2Q8LA 3DKJA 1EGVA 6TIMA 4MSSA 2DZBA 4X0NA 4Y9PA 4Q6JA 3L65A 3QMSA 3RMEA 4Z2IA 4GBUA 4D1IA 3OLGA 3FAWA 4LS1A 1JRCA 2QAPA 3HQOA 4JZ5A 1OJXA 1W9VA 4TTUA 3KCLA 5AN7A 3P5ZA 3PNZA 3ID7A 1TCDA 5LIWX 3WY1A 2RDUA 3VOCA 4A29A 2E77A 5I7GA 1NQKA 4GZJA 4HVXA 1BLIA 1LF1A 3MC5A 1DHKA 5EKYA 1F05A 3C0SA 4HT3A 6XIAA 3IIOA 2PI6A 3BMVA 1LT7A 3M5YA 3R0UA 3E2SA 1SU5A 1QI0A 5JIPA 1FWRA 1G69A 1SPQA 3VNJA 1GNXA 2Z29A 1A4LA 4Q4OA 4E0CA 5CGTA 4XO6A 4GKTA 4QJ1A 3UPWA 1GG0A 4J4KA 2NQJA 1TIMA 5AHFA 1AH0A 4L64A 3MUIA 1GOIA 3TSMA 1GOKA 3WMSA 1AH4A 2Z6JA 2O55A 2WVVA 5EGRA 1P1MA 3AC0A 1L6SA 3SSJA 1TTJA 5E0FA 1EJVC 2WJEA 5LA0A 3MS8A 1EH9A 4FF7A 4E8CA 3L0NA 1MW3A 4IT1A 4K37A 4DUOA 4H19A 2V3EA 1OCQA 3UT0A 4KWSA 1N82A 3O16A 1DE6A 3QY6A 5BXTA 1KTBA 4GH3A 3RLGA 1GJPA 2CETA 2XSBA 4XBJA 5DCEA 1QNSA 3TXZA 3DHUA 4S38A 2GJXA 3EPMA 3TYBA 1EJSC 4NNCA 4NRSA 5F4XA 2YCJA 2Z27A 4PMOA 3W1UA 3AIQA 2VDGA 3HG4A 1UZDA 3UJRA 2HK1A 4HNVA 1XYZA 1JDCA 1EJTC 3P67A 3A9IA 4YMZA 1CECA 1JPDX 4KS0A 3VFCA 1IR1A 1JYVA 4NF7A 5K2ZA 4PUWA 4B9YA 5FJJA 5IDIA 2OZ8A 1QNQA 3CT2A 1J5SA 4PEKA 3TW6A 4HNTA 3VGFA 1X6UA 4OV4A 3VUPA 1TIWA 4UTJA 1X6NA 2DH2A 2FVLA 3NWRA 3GH4A 1JCMP 1HJUA 1OK4A 3RM9A 1LLZA 1RCOB 3M44A 5K3VA 1US3A 4HNNA 4ZGYA 1LL7A 1Q2SA 4JICA 1XP3A 2TMDA 2BS9A 3T40A 3GKFA 2WKLA 1MMFA 4XAFA 3SCVA 1I1WA 3VMOA 3NAVA 1OADA 2VDHA 2G4FA 3W1AA 4FNSA 3TYCA 1W1ZA 2FJKA 4GD0A 5EMUA 4XIMA 3GDMA 4LVFA 2ZCGA 1L6FA 2FGBA 4DO7A 3NVDA 4GUGA 2PD5A 1BWVA 2OZ0A 2VEGA 3QLDA 1AUSL 4AD0A 3M0ZA 2ATMA 1G5AA 3T07A 4LU0A 3EWZA 3LHYA 3CBWA 1SZEA 2JIWA 2ISVA 5A6BA 3MMWA 1KXQA 3W9ZA 4U2YA 4X2PA 1V6WA 3WLPA 4EAMA 1TVPA 3VNKA 2KAUC 4Q4MA 2J8FA 3IACA 1R3TA 2QS8A 4ZOAA 3VNYA 3DKLA 3LDVA 3EPNA 2HXTA 3LY0A 1S3TC 3DBPA 1YE6A 4RDZA 1L8PA 3M0XA 2CIPA 4O14A 4JX5A 5G2HA 2YCLB 3DG6A 4IP5A 4DHGA 1OF8A 1VCFA 1PXGA 2F7FA 1CGVA 1ZUAX 3TQPA 2XFFA 3C86A 4G7EB 1V93A 5I3JA 3L67A 4R34A 1C8QA 2CC0A 1JDAA 3N2CA 2GJPA 3B3DA 3VKDA 1HXJA 4FR6A 4LGXA 1UG6A 4HB7A 1UIOA 4JGDA 2GDUA 2VNCA 5J8LA 3N04A 3T6CA 5ABHA 2WWDA 5I6SA 4IPJA 1XICA 3JZUA 4IIDA 4S23A 3IVUA 2H90A 4NUWA 4OOZA 3ZVHA 1E40A 5CZKA 3KHDA 1BQCA 3QTPA 3M5XA 3W1LA 1Q85A 5L6UA 3L66A 5HQEA 5GNXA 4CU8A 3B8SA 3OVRA 4TOQA 2XH7A 2X2GA 1TPDA 3WN6A 1JJKA 4XZ9A 4AUBA 4H8NA 3ARWA 5LXXA 4MWAE 4GQBA 3UR8A 5D8ZA 4GQRA 2BSLA 3F4CA 4BA0A 2GLKA 1I2NA 3FLUA 1DQUA 3PS7A 2XDFA 5CLWA 4W8AA 3WFLA 3CL8A 3ZYZA 4JN7A 3AS3A 4M51A 4MDPA 1LORA 4JQ4A 4FLOA 1QNPA 4JEQA 3OG2A 4UMCA 4A3HA 3CV1A 1W6TA 5IBXC 3ZWTA 2ZFAA 5CBJA 5DT5A 2HEJA 3PAOA 4KWWA 3OO2A 3RG6A 3KOWA 4DXKA 4JNMA 1AW1A 2ZUVA 3NQCA 3N6JA 1OFPA 1JNDA 1J4EA 3W2NA 3DFTA 3M1ZA 1RLCL 2OXNA 3P81A 2CERA 5FJTA 3B9OA 4KFOA 2Y62A 1ME8A 2VJXA 4JKKA 4GG9A 2X09A 4AG0A 1JCYA 1KFWA 1U33A 2F6UA 4H4IA 3VKBA 1T8QA 3AI0A 3TQ0A 4BI5A 3VMPA 5FF3A 2VOMA 5HNRA 4D6JA 1BQGA 4IJBA 1QBBA 2G41A 1O5KA 3E2QA 1R6WA 3N6HA 3TH6A 3SADA 5LNWA 2EXOA 3U9IA 3DGBA 3ITOA 1ZZMA 4K6AA 4EP8C 1KRCC 1R7AA 2Y7EA 2PZNA 2W27A 1A4MA 3KTXA 3VYLA 1MNZA 4NSBA 1HJSA 1EHNA 2Z4GA 4IX0A 5CPNA 3BAJA 3GSMA 2RUSA 1GONA 3P6LA 4GUIA 4R5EA 3DHPA 4DZIA 2X05A 3W53A 4X61A 1P0EA 1H7RA 3VZYA 2O9RA 4PFHA 3MYOA 1KBLA 3N4EA 3R10A 5D9NA 1S3HA 2DZTA 1EP2A 4PUNA 3VOFA 3D0CA 4GYPA 5DMMA 3NVTA 3CMJA 1KFKA 4J2PA 1H7WA 1P0NA 5GNZA 1CXLA 1ECQA 2D24A 3IJIA 3KVJA 3WSUA 5GJNA 2WVSA 1TMHA 4HZ8A 3VM7A 2VR2A 1IV8A 1OYCA 4ZO6A 3KTSA 2X8RA 2VEIA 4IJCA 2ZDRA 4JIQA 1RBLA 4G2DA 2HRWA 3C2VA 5LKYA 2J77A 2GVGA 4NI3A 5D33A 4K2SA 3ERPA 1GOOA 3M16A 4HHLA 3U57A 4IGNA 4HA1A 4K8HA 5E70A 2JKAA 2WM1A 5FKYA 1ODUA 3W74A 5F4SA 2Z1VA 1YYAA 2OQHA 4LAUA 1IZKA 2Y8KA 3KM8A 3LCWA 4AU0A 2HQAA 2I16A 3B05A 3KL5A 1U5HA 2OR2A 3THAA 1LLWA 1EYEA 1HL2A 1J12A 5I3GA 3VD4A 2YZRA 4P8UA 1FWHC 2WZTA 3DCPA 3QFWA 1CGWA 1JUKA 4YWSA 3LQGA 2ZRUA 1KGWA 2EG7A 1LL4A 1OFAA 1MDRA 2FPYA 3BPWA 4LB4A 1NFBA 1EA9C 1ZRQA 4Z1AA 1EX1A 3A4WA 1TMQA 3Q37A 2D2OA 3KVMA 5K7JA 4D8LA 1QFEA 1GZJA 5FF4A 4P8VA 4GKLA 4HPJA 2VGFA 3TSBA 1THFD 4LS0A 3OZOA 3HBLA 5D2WA 3ITCA 3M6DA 2BNJA 1PPIA 1TV3A 2VKZG 3G1DA 2Y8UA 3ARRA 1WCGA 1UOZA 4GVGA 4MWAC 1B54A 4QDWA 3OIXA 5A69A 4L65A 2OODA 1M41A 3GFZA 3GE7A 4JNZA 3KL3A 3SCUA 3WQGA 4NYYA 4DI9A 1JFHA 5BRQA 2DSZA 2DIEA 2VM8A 1KTCA 4NG3A 3E0VA 4GI4A 4PMRA 3P82A 3RPTA 3EWWA 3POHA 1LQ2A 3GXFA 4YL2A 3QSRA 3N2XA 1VLWA 5GJMA 4F40A 1ZBKA 2XFRA 3UPMA 3FHAA 3MUCA 1TJ0A 4O1DA 1HJXA 2G3FA 1CDGA 3PWAA 4TX8A 3ABOA 4EF9A 2Y7DA 1T6MA 3RLUA 2XIJA 1E6XM 1QW8A 4ONVA 3TCEA 6PTDA 1LL6A 1JGMA 2PDCA 4FNPA 3BLDA 2CHOA 3VILA 5LA2A 1BVZA 2QJJA 2WV8A 3GZAA 1V0LA 6XIMA 3C2OA 5CKSA 1VIWA 3GIPA 4W7UA 4XSMA 3FJLA 3CV6A 2XN0A 4QRNA 2WVTA 3H12A 2PDMA 1J0YA 3MSDA 3S1XA 1XSIA 4NAEB 3KBWA 1K70A 1SFJA 5HWJA 1VFLA 1A50A 3URAA 2OT0A 2FB3A 3N1AA 1M65A 4QQ3A 4WSKA 3R89A 3SZ8A 1H1NA 2YW3A 4OTKA 1I1XA 3UPBA 4GI9A 5CXPA 4AXKA 1B3VA 4MY9A 3V5OA 1J0KA 4QIUA 3AYTA 1IQ8A 4KEUA 3FJNA 3RJXA 4UR7A 2XIOA 4FNQA 3TZFA 3EA2A 4H9XA 5CZ0A 4MDOA 4Q8QA 1PTDA 1TTPA 2WC7A 3I4EA 1LQAA 2ACRA 3VOHA 1E55A 4LUTA 4JQ2A 1J0JA 1J9YA 4ML9A 4B5NA 1H60A 2D0GA 4GY0A 3BQ6A 4QFUA 2ACQA 1TZ7A 4UTHA 4PUJA 4DN1A 4JQAA 3HQPA 5IXEA 1TX2A 4KRUA 4QR6A 3N11A 3Q45A 2R8WA 3KW3A 5AC4A 1U30A 1FVPA 3LGGA 3JS3A 5GNYA 4PE8A 4M7SA 3SCTA 4XAZA 4W7WA 2A7PA 4W7VA 1GOWA 3D3FA 3WQOA 3GB6A 2PE4A 1PYFA 2XZ7A 4IGMA 4HSNA 3PTKA 1K1DA 2PDPA 4FLRA 1XCFA 2Y89A 3TFXA 1V6XA 5ABFB 1IXQA 2HJPA 3S9YA 1UOKA 2NX3A 3SEPA 2V2HA 4XD5A 1B3ZA 1TPWA 3KBVA 3V0UA 2QCLA 2NT0A 1W0MA 3PZNA 5CC3A 5J04A 4QG9A 4FK9A 3NZ1A 4Z1CA 3V7PA 3M41A 3S3GA 3E5PA 1EYWA 4HCHA 4A3QA 1XDMA 3KCOA 5T8GA 1DKWA 2HNHA 5IFTA 1NF7A 2P10A 5G1MA 3N2BA 1Q4WA 4Q4RA 3DYMA 1JCXA 4RXGA 3RXZA 2ZX8A 1TKKA 2J62A 1BGAA 1JEZA 4UTUA 3W76A 1JZ2A 1XYCA 5AECA 2FZBA 2NQZA 3OQ8A 4FNTA 4WJXA 4P7NA 3NQVA 2X0HA 4WY0F 3P0WA 3NL2A 4WR3A 1OX6A 4B16A 4HA0A 4DJEC 1HVQA 1KM3A 5K9XA 2WANA 2J9YA 3WJSA 1NWRA 4G7FA 3MHFA 1CEOA 4OIFA 3U7VA 3UWZA 5C9XA 4JTUA 3EDEA 3AWNA 5K4XA 3WF4A 2TYSA 3COTA 2OU4A 3IRDA 3W7HA 4RPQA 1C93A 4W8BA 2F6KA 2VWTA 1EZ2A 3H7UA 1F5ZA 4L1GA 4GLEA 4DX3A 3PFMA 2FTYA 3QM3A 4CVWA 3ZVHB 1S2CA 4G5DA 3GU2A 3B97A 1K6AA 3PZOA 3DFOA 3AMDA 3T55A 1B3WA 4I9MA 1E71M 4DXVA 2YGYA 3GNOA 1QO5A 1V0NA 3R5EA 3GXDA 4LBSA 5LYRA 4NYUA 7CGTA 4Q8TA 1JZ3A 1V7YA 4S3DA 2CBUA 3APGA 1EOKA 1GZ1A 2O9TA 2ZQ0A 1B31A 1WA3A 4F0SA 5DXYA 1QI5A 2QT3A 4PMDA 2EG8A 4MZ1A 3SIZA 1SYTA 3PUDA 3VNLA 4XD3A 2F61A 4RNHA 2HMCA 2FH8A 1GKRA 4AISA 1TYGA 2Z6IA 4PGLA 3WL1A 1E9YB 1EQCA 1UB3A 3WENA 2XGZA 1G1YA 3LCIA 5A8GA 4JHMA 4HNLA 3MVTA 3R8GA 1OGGA 1S5MA 4OKDA 4JHOA 1PVNA 4XK2A 3ONCA 4NASA 2WCSA 2WNQA 3B8IA 1OFEA 3W7KA 3VE9A 1ADOA 1EF2A 3CZLA 3T4WA 1WPCA 4E2OA 2YDQA 2IXVA 3S42A 1MQRA 5D9MA 1I6NA 4XZWA 3W07A 3P62A 3K8MA 4HK5A 3WNPA 3LV6A 3CUXA 4OHQA 4TMCA 1XL9A 4NL1A 1ZTVA 1GG1A 2OX4A 3F2DA 3E02A 4Q4KA 3LGEA 4RZBA 1H3GA 1BVWA 4PSPA 2RDTA 3OPSA 1KLYA 2E8ZA 1A0DA 1I45A 1BPLB 4LUYA 2XM1A 1RHCA 3CIVA 1N2VA 5CBBA 2IQDA 3HFTA 2ICSA 2WMKA 2GFTA 3WQVA 4ZE4A 4ZSTA 2IQ0A 1PX4A 4GPNA 3MMUA 3T0DA 1W37A 1AH3A 3OU8A 3ITXA 4OV9A 3O9NA 2X0SA 4EK7A 4LSBA 3NOYA 4AC7C 4FNUA 3PC0A 2F9RA 1H49A 4PB3A 1VH7A 4WXYA 4PTXA 2ZZ4A 3FK4A 3H70A 3TQVA 1P6BA 5IBXA 4DBWA 3G3MA 4GBDA 1WB0A 2PWEA 1UKPA 1TJ1A 4V27A 1FWIC 1H1YA 1PE1A 2OZTA 3MSYA 3CIXA 3CASA 1F73A 1C92A 4PCPA 1XLLA 4PMXA 1I75A 3C3NA 3R58A 3QEZA 5D30A 3H26A 3UVAA 1FH7A 2XSAA 4EANA 2XN2A 2DY3A 3F03K 3Q67A 1PJ9A 3S2LA 1OY0A 4M3PA 3MUAA 1RY8A 3HQ1A 1XBZA 2QQ6A 3QKEA 4HIBA 2VO5A 2YIHA 4C60A 4FEZA 4UOJA 1DWJM 3UJFA 2WQDA 2C1GA 1TUFA 4U2ZA 3MUZ1 3WQDA 4MJ2A 1GEHA 1FXQA 2G3IA 4Y8EA 5IDZA 3UWUA 1K8YA 3V1PA 5BWAA 4F48A 3CZKA 5G4HC 2BZNA 3VGBA 4UQDA 4JTFA 4J35A 1TV4A 4O54A 4HMDA 1FUYA 1KFJA 3NYZA 2E6AA 3LSBA 1W9UA 3WF2A 3GNDA 2EKGA 4MNJA 3GC5A 4MB3A 4NY2A 2W63A 3JVAA 4DBSA 2V5KA 3UY8A 1YXDA 3ME3A 3QR3A 2X1UA 3SFKA 3W29A 2YBUA 2Y8VA 1E9IA 2O7SA 4DZHA 1H4PA 4HU0A 3PBWA 1QPRA 3I3BA 3E74A 1F3TA 2X40A 3VDGA 3TYZA 4BI7A 1YPFA 1LTDA 2B7NA 5FD0A 3RU6A 5IM51 4J3TA 3XINA 2E09A 4A8NA 4D71A 5TAOA 2G3JA 4PMNA 3ZT7A 5ECVA 1G6CA 4R9XA 1NOWA 3EWUA 4C7FA 4CQ9A 4UTKA 3EMZA 3BSMA 3UA3A 4JFUA 2A79A 3H8AA 5U4NA 4BEUA 4D6EA 3N15A 3PY2A 2TRSA 3MYPA 2XM2A 2XH0A 1XRFA 2HE8A 4A4AA 4JQ3A 4KMQA 3MP4A 1V3JA 4N2YA 5C2XA 2BWGA 1XCXA 1E70M 1W3HA 3K4DA 3BLPX 1XLMA 3UYCA 4QP0A 1DIEA 5H8PA 3DXIA 3FHQA 4WDTA 3IIXA 1GQKA 4DYKA 1VPXA 4BKNA 2CXEA 2XUCA 3IJQA 3KOZA 3RLVA 3SAZA 2ZWZA 5I77A 2W62A 3HIJA 3SUSA 4DM1A 1KRMA 1RD5A 4XKMA 1F6YA 3BDKA 4UFMA 3EPOA 1SO4A 1Y5VA 4DWSC 1L9WA 4EF8A 2QULA 1JAKA 4Y2WA 3HO8A 4MFEA 1L6WA 4L9XA 3M43A 4DPPA 3N9SA 4NZJA 2R1LA 4KFPA 3IGXA 4NJHA 2QF8A 2TPSA 3VIPA 3A5FA 4MTVA 1AODA 3OA5A 3BO9A 1F9CA 2A3LA 3UWVA 3W1RA 1OCNA 2CLMA 2QLYA 4O0ZA 5HOSA 2E28A 5JBFA 1C3FA 2Y5EA 3NJ3A 1X96A 3L21A 3WH9A 1YW1A 1GYMA 2WPGA 3WBXA 5HBFA 4U5IA 1QPQA 1KFEA 1E0WA 3ARTA 3T08A 4NILA 2EJ1A 4QDMA 3TC7A 1EUAA 2NT1A 6A3HA 3ABQA 3RMJA 1OCBA 3O7UA 5KTLA 3ZFHA 3ALFA 1XGZA 4ZQPA 3KBJA 3V36A 2GUBA 3EDFA 3PZUA 4JBRA 1XIFA 5C6MA 2UY4A 3LMYA 1HVXA 1W9DM 4WOQA 5BNKA 1T0OA 4Y9OA 1UD6A 3TTQA 5A8OA 5E5CA 1KRAC 3G6LA 3IWPA 3T0BA 2H3BA 2OVLA 3PZVA 3LSCA 1LP6A 2GSEA 3GXPA 1XH1A 1B90A 1YTDA 3CGTA 1ZY9A 1DHPA 5F1VA 3SUVA 3LLXA 4DJDC 3QH2A 3RX3A 3EKZA 2ZUNA 2DZXA 3R0DA 3WH7A 3GDTA 3UWQA 1XLBA 4XG1A 3AXKA 4IXHA 1MRAA 5AHLA 3A3HA 1K9DA 3B06A 3OVQA 4HNCA 3SSZA 4HA4A 4IZGA 1WZKA 2I9UA 2DW6A 4B2DD 1W8GA 4DBEA 5C54A 4DNHA 4HTBA 5EA9A 1SMAA 2V5LA 1WKYA 4O0KA 2B7PA 5G4WA 1DJQA 2Q6ZA 4H8VA 3REQB 2VZVA 4M7TA 3T8LA 4ZB5A 1UHVA 4CCDA 2L5HA 4ZZ9A 5BRBA 2ZXDA 3W7OA 4MGGA 2RJGA 3AIUA 3CWHA 4LX4A 3W7MA 4K39A 5K4ZA 2V69A 1GVRA 4UB9A 3NQAA 3WQ5A 2Z1SA 3WBWA 3LTYA 1M03A 4YTQA 1BTMA 5I07A 3VIGA 4LS2A 4J3ZA 3W4RA 1HGYA 3W7LA 4AY7A 5KZDA 4AWSA 1GK8A 3AHXA 3RO8A 2PEVA 1R46A 2OSXA 3AS1A 2NSOA 3KP0A 3PZGA 2YSWA 2WMHA 4AX6A 2BBFA 3S5ZA 2NQ5A 3HV8A 1M6JA 1VPQA 4JTAA 1G9HA 1V3KA 3SUUA 3CNYA 4HPHA 4GK8A 3I7SA 1KM4A 1TMLA 2EO7A 5IFPA 3WEOA 1A5OC 1GCYA 1JFXA 4FHAA 2OX1A 2J9XA 4ZQOA 1J93A 4C6NA 3H4XA 3UGVA 1XR2A 5HANA 1N7KA 2PU1A 2A7RA 4M82A 2BG5A 1O5XA 1PO9A 2NXGA 4AIOA 2DVTA 2GPTA 1G7UA 1P7TB 3N9KA 1KBKA 3KLKA 4WF7A 5HR7A 4YYFA 2QDEA 3L68A 1MQPA 4N6FA 3IUHA 2BODX 2JE8A 4W85A 3IIVA 4DI8A 4PTWA 4WLCA 5BOOA 1M7PA 2GSJA 4JN8A 4IOTA 5HNNA 4DJFD 1OM0A 1W1IE 2Q8ZA 4A2SA 4MUPA 4Z2GA 1A3WA 4MADA 2YL8A 2Q09A 2UY2A 3G1AA 5IHSA 3UYIA 3QV7A 4I6KA 3A5VA 1HIZA 3W7RA 4ZBCA 2CXGA 1R2TA 2NSXA 2A3EA 2WMFA 4UFHA 3KHJA 3S47A 3QOKA 4C6OA 1H41A 3NQMA 3VIFA 2BHYA 2FMOA 2BVDA 1OYBA 3B0XA 1UWTA 4FI4A 1BF2A 1V6UA 3NXLA 3WELA 5EFFA 4E38A 4PR4A 3CHEA 4LC8A 1O7AA 3GM8A 3AO0A 3CQ0A 4H6KA 3CMFA 4CD6A 2HNEA 4CQDA 1OC7A 3EKLA 3UZJA 2OSYA 2P0IA 1EJWC 5I79A 2GQ9A 3G6MA 3UZYA 1J18A 3H23A 4MUZA 4Y9AA 3TN6A 1XH2A 2PAJA 3H2MA 2F6XA 3WDPP 4I90A 3LCXA 4MPKA 3H54A 1XYFA 3VIHA 3IJ7A 1LRQA 3VNZA 3I6EA 1DBTA 3DFHA 2C14A 1VENA 4JTGA 4PULA 2E6DA 1F61A 1QHOA 1VHCA 2Y85A 4QGCA 4AZBA 8TIMA 3TJLA 2V67A 3BLEA 1Q6LA 3URQA 3AOFA 1JPKA 2YCEA 3M0VA 1CXHA 4FIQA 2CNCA 1TQXA 4NT0A 3QFEA 3II1A 3VGHA 3E9AA 1K7EA 2NV2A 4W93A 4GQ0A 2PLCA 4GWEA 3QY7A 1JAEA 1O5RA 1EL3A 2XVLA 4O8RA 5CSYA 1B3OA 2VEKA 4AXNA 1SO6A 3BV7A 1DJZA 3CUFA 3F2CA 3LCLA 1TV8A 4A8RA 1BRLB 1NH6A 2BV9A 3ATYA 1PDZA 4S3JA 1GQNA 2ABAA 3HJEA 4W5UA 4QNEA 3DERA 4GO9A 1IE7C 4RXFA 4KGLA 1YRRA 4JCLA 4AB4A 2BXVA 1YTKA 2V3FA 2H6RA 1TREA 3ZLGA 1IT8A 3FFSA 3QKZA 4M5PA 1AL7A 2FGLA 4JIRA 2FLIA 1UROA 3AYSA 1UR4A 3KWXA 4WDUA 3RPMA 3BG5A 2OLHA 3WO8A 4JTLA 3QPYA 2YBTA 3WLIA 3AROA 8XIMA 1MEWA 1XD0A 4DIAA 4LPCA 3LHWA 1Q8AA 3B9DA 3B9NA 2G5WA 4WRHA 3RCNA 2FQIA 2E5DA 4FNRA 3CAQA 5HQLA 2VZTA 3HG2A 3NQ2A 2VVSA 3UXAA 4IIHA 1KR1A 2DSUA 3VIKA 5LNSA 1Q3NA 1B1YA 1EIXA 3VIMA 2Q01A 4LV4A 4DO6A 1JL8A 1XPYA 2WNWA 2ISSA 3L4WA 5AYXA 2ZZ6A 4WQ6A 2FDSA 4TX9A 4PTMA 1MI3A 2ZVRA 3KBSA 5TQLA 4AC1X 1HKJA 1HP5A 2AL2B 4MIMA 4YJ5A 2ADAA 1E0TA 1SO3A 1ONWA 2QJNA 1OBAA 1QU4A 3MA8A 5F4WA 2C0HA 4B4FA 1WDRA 1SR0A 4HHMA 3EX2A 5HPCA 1Q45A 1JZ5A 3WLLA 3MHGA 5AHNA 2GQAA 3LTPA 1RQEA 2J79A 3PTDA 3RCYA 4GIEA 1AW5A 3C5QA 1CENA 3BZJA 1MNSA 4Q8WA 1BSLA 1FHUA 3CQHA 1PV8A 1DPMA 5E09A 4M6QA 3NTYA 1BFNA 2CZ5A 4HCLA 3NO3A 3NNTA 4ZQMA 4WGHA 3UESA 3BAXA 4HU3A 3TE9A 4LUIA 4Q4SA 4B15A 3N4AA 1UKSA 3AJ7A 4O1CA 3W1MA 2OYLA 3S5NA 1EGMA 2ZA2A 3VGGA 3TA9A 1PHWA 1KM0A 2BY3A 2R6OA 4ADSA 1ZJHA 3QR0A 3GRIA 1TV5A 2ACUA 4A35A 4C6MA 2PBGA 4J1OA 3GY1A 1KFLA 4EOUA 1LM1A 4ZXLA 3EOLA 3CL7A 3B0PA 1DORA 1LG2A 3NQ8A 3W2JA 4KWUA 4HA3A 1SMDA 2NLYA 8CGTA 3FVDA 4AZ6A 2JBMA 2BGQA 6CGTA 5BMXA 1Q6DA 5A2BA 4PBFA 4IWWA 2VI0A 2OJPA 3E5BA 2XFYA 3IGHX 3MZ2A 4REQA 2VX4A 3K8LA 2E4TA 2NQHA 3C8NA 1LZOA 1SFLA 3MWCA 1XSKA 3A47A 1JCJA 1RBAA 3H55A 1RD6A 1RUSA 1XDJA 4C6FA 2BOGX 2ZRXA 2O56A 4LJ3A 4MAZA