3QQ1A

Crystal structure of a double mutant [a58p, del(n59)] of 3-deoxy-d-manno-octulosonate 8-phosphate synthase (kdo8ps) from neisseria meningitidis
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
276
structure length
249
Chain Sequence
MDIKINDITLGNNSPFVLFGGINVLESLDSTLQTCAHYVEVTRKLGIPYIFKASFDKPRSSIHSYRGVGLEEGLKIFEKVKAEFGIPVITDVHEPHQCQPVAEVCDVIQLPAFLARQTDLVVAMAKTGNVVNIKKPQFLSPSQMKNIVEKFHEAGNGKLILCERGSSFGYDNLVVDMLGFGVMKQTCGNLPVIFDVTHSLQGRRAQALDLALAGMATRLAGLFLELHLLEDFLIRIKALDDLIKSQPIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Targeting the role of a key conserved motif for substrate selection and catalysis by 3-deoxy-D-manno-octulosonate 8-phosphate synthase
pubmed doi rcsb
source organism Neisseria meningitidis
molecule tags Transferase
molecule keywords 2-dehydro-3-deoxyphosphooctonate aldolase
total genus 79
structure length 249
sequence length 276
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.55: 3-deoxy-8-phosphooctulonate synthase.
pdb deposition date 2011-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00793 DAHP_synth_1 DAHP synthetase I family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3qq1A00
4RZ6A 3LTYA 2X30A 1TPVA 3C2EA 3HBLA 3BW4A 3QM3A 4BWLA 4LVBA 5CSSA 1C8VA 1FCBA 1R2TA 1VHCA 1XXXA 3MYPA 3BVJA 4UR8A 4IUOA 4UFKA 2A1YA 3P67A 2HSAA 1W3NA 2QJHA 5D30A 3CQ0A 1DBTA 3UWWA 3PM6A 1CW2A 3P8IA 3NO5A 2VFEA 5SWUA 2TYSA 4R34A 1BWLA 5K2ZA 1WBHA 4FX6M 3TE9A 1T99A 1ZAHA 2YGYA 1SFLA 3E49A 3HG4A 4Y90A 4UMAA 3QMSA 1TSIA 2HMCA 3P5YA 2ZRZA 4UTWC 4G1KA 2B0MA 3TMLA 1KFCA 3NDOA 1ZHAA 4K39A 3B04A 4NX0A 4GUIA 1KFJA 4N6EA 2E5DA 5F1VA 1H51A 3LDVA 3BGJA 4N9EA 1NFBA 3UPBA 4Y8FA 1X6UA 2IQTA 2YX0A 1VS1A 2CLOA 1X1OA 2FB3A 1H7OA 4BI6A 4FNQA 2JGQA 3PF3A 1KFLA 3PY2A 3W7MA 2XN1A 3UWQA 4IJBA 4UFIA 3SGZA 2H90A 1JVNA 1MZHA 4IX2A 3SJ3A 1VYPX 2ZA3A 3LM7A 2JKPA 3GDRA 1W5MA 5TQLA 3W1QA 1VGAA 3N9SA 1F6PA 3W7GA 3OHIA 2Z2UA 4WD0A 1KFKA 1FUYA 3E0IA 5BNKA 2H6RA 1JUKA 4QJ1A 3RF9A 5KZMA 4Z0SA 4QNEA 1HO4A 3EWZA 4OBTA 1VYRA 1W3TA 2VXNA 4FNRA 3M44A 2OZ0A 5LGXA 3WJZA 3MHGA 3TAOA 3O6YX 1SPQA 3YPIA 1NF7A 5G2HA 3DZ1A 3M6YA 5AC6A 3M5ZA 1WQ5A 4UMCA 3Q37A 1W54A 5AYXA 2C1HA 4LW7A 3CU2A 2DORA 1P0NA 1OFAA 5F4SA 3QPZA 4OHQA 3LCXA 4FF7A 5DLCA 3W85A 3ZFHA 5I3IA 3W3OA 1ZCOA 3G1DA 1VZWA 2XN0A 4MJZA 5HR6A 1JULA 1TO3A 2H3BA 8TIMA 3NL5A 3USBA 1YDVA 3TH6A 4HPJA 2DJXA 3TW6A 4BI7A 1IF2A 2GJNA 2QCLA 3S42A 3B03A 3TSMA 4QITA 3TAKA 1U83A 3LHWA 3STFA 3LHUA 3DFNA 2BSLA 1TPDA 5D05A 4H4IA 2C0AA 5KZEA 3P84A 1OFEA 3VE7A 1FDYA 4FIRA 4O1AA 3W1AA 3ABSA 2VEMA 1K8YA 4PEKA 2E77A 5D37A 4R53A 2GPTA 1ML1A 3DFSA 3TFXA 1O4UA 2WOQA 4RZ4A 4JTKA 3NPXA 1W8SA 4I7UA 3VFLA 3EX3A 3CEUA 4M6VA 4JTUA 1DQXA 1WXJA 3G1VA 1PCKA 2VFFA 2PRLA 3STCA 1KM5A 2JK2A 2Q3RA 1GG0A 3WJXA 1XKYA 4EF9A 1JJKA 1RZMA 3PUOA 2E6AA 4L4LA 3A5FA 1W5QA 1M7PA 4QSHA 3T40A 1L2UA 1V7YA 2ALDA 4MVAA 3MJYA 3N34A 4GC4A 3W87A 1EPXA 3MHFA 2GOUA 2B7OA 5EYWA 2RDTA 4NNCA 5KMYA 3G0UA 4XZ9A 2J27A 2RHGA 3EWYA 1GOXA 4RLIA 3JRKA 4WOZA 4GJ1A 1LRQA 1SZGA 4JTIA 1LP6A 3NYZA 4WY0B 3CLMA 1WOAA 3GK0A 5F4XA 3W1NA 2V9DA 4GXMA 1D9EA 3GXTA 3L5LA 2X1UA 2AQWA 4WQ6A 4ZQRA 1UUOA 3NPVA 3S1UA 1TQJA 4DXVA 3V1PA 3ZWTA 3KVMA 3THAA 2JKAA 1TPUA 3M1ZA 4RXGA 3QH2A 3R89A 1W31A 3W73A 4Z1CA 3SECA 5D38A 1AL7A 3LRLA 3M41A 4UFLA 1A5CA 3IGSA 3B06A 3C2FA 2DZXA 2UV8G 3NQFA 3QYQA 4YCOA 5G5IA 2H8ZA 3I6RA 2CU0A 3BGGA 3ABOA 2GUUA 2QUTA 1KM1A 4IX0A 3CC1A 5AHLA 4TMBA 1QOQA 1JCYA 1GTEA 4GUFA 1XDMA 5TBOA 4WY0F 4HNNA 5EL1A 2YXGA 3DAQA 3N3MA 2TSYA 3NZRA 3G1SA 3OVPA 4WXYA 4A21A 3HQ1A 4NZJA 5I3GA 1SW3A 4JICA 3KRUA 3S5OA 4ADTA 1JCLA 3S5YA 3FFSA 3LV6A 3FKRA 3UPWA 3DFPA 3PBVA 1XBZA 5AHEA 3KX6A 3PAJA 5LKYA 4LS2A 3R5EA 3UY8A 1ZJIA 1Q45A 2FPTA 3W1TA 3PR2A 3BW3A 3LI1A 3V75A 5IBXA 3RLUA 2I14A 4JN6A 4RZ5A 5F2IA 3M5VA 1H1YA 3EKZA 5CGQA 1PCWA 1YTDA 4MLJA 4HNUA 1T8XA 4NJGA 2O7QA 5I3JA 3W1RA 2V30A 3L21A 4CLMA 2I9EA 4KFPA 3H55A 3MI3A 2ZZ6A 1EEPA 4R7JA 5KINA 4LUJA 3IRDA 4K7YA 5F2MA 5TIMA 3GVGA 3LBMA 4DF0A 3W72A 1GVSA 2A7RA 1MSSA 3W2MA 3KRZA 1ZALA 3LI0A 4M6PA 1JUEA 1R2RA 5CPOA 3MI6A 3LCIA 4PFMA 2A4AA 2PE4A 4UUIA 1PE1A 2VELA 3B4UA 1HUVA 2ZRUA 4AHQA 2R14A 4KKXA 1FWTA 5LNSA 5DY2A 3NPWA 1FCQA 3NOEA 3TW7A 2NUYA 1MEHA 4LY8A 4GFSA 4O19A 3QMTA 4UR7A 2DP3A 4EWND 1QDSA 1JQXA 5D2YA 4Y96A 2QCCA 1FQ0A 3W2NA 3NQDA 4YXGA 3LHTA 1S5WA 4AF0A 1DHPA 1FY6A 3M5YA 3KVJA 3T78A 4RJEA 1P0KA 4LNYA 4DO4A 3LXAA 2Y63A 2ZQ0A 4N9CA 1TV8A 4WZHA 3DH7A 3QQ1A 4GBUA 3TR2A 4EIVA 1G4EA 1F73A 3EX1A 3ABQA 1OFPA 1FCVA 2A7PA 2E09A 2ZZ5A 4UC5A 3O63A 2QCEA 1PS9A 3BLFA 1FX6A 3MHUA 4S1FA 2QUVA 1LROA 1TMHA 4JTSA 4BWLC 2C18A 4HNTA 1HTIA 3P80A 3FLUA 3I7QA 1ZFJA 3ZR4A 1ME8A 4B5NA 4N4PA 1B3OA 2GVGA 2NLIA 5HNRA 5K9CA 5D02A 1TRDA 3SI9A 2FPYA 1FCUA 3S8HA 5E1QA 3E02A 3W7JA 4UTTA 3P5ZA 1VR6A 1TTPA 3HG5A 4OQVA 4ZMGA 2FJKA 3IVUA 1DOSA 5CKSA 1PL9A 4K38A 5AFDA 3MBDA 1DJNA 2AGKA 2QAPA 1QPRA 2E5BA 3K30A 3NXFA 1DL3A 4DPPA 2OJPA 1XC4A 2E68A 3ZS4A 4K8HA 4FEZA 4MYAA 1ZENA 4JTGA 3U8GA 1G4TA 4DQWA 3B8DA 3HPZA 2C13A 4KWWA 3IVSA 2E6FA 4YMZA 4EF8A 4IMFA 1EIXA 3MW7A 5F2GA 3WK1A 4UNKA 4OGZA 4HKPA 1VJIA 4NNAA 2B7NA 2A2IA 1YADA 1IXPA 2NZLA 1YPIA 3G18A 3NQVA 1LORA 4MJMA 3W7QA 4Z1AA 2FLIA 1HFBA 4FNTA 3I7RA 5L9FA 4TX9A 3QF0A 4QISA 3PB0A 3OIXA 3L5AA 1BTMA 4LUIA 3WJYA 3WFAA 4Q4KA 2E1DA 1KA9F 4HNVA 1K03A 2YPIA 3BG9A 1Z42A 4K8EA 3SGUA 4P61A 4POCA 4DO6A 1AL8A 2CZFA 3GB6A 3MP4A 4NJIA 3R13A 3W9ZA 3SIZA 3C2VA 1GEQA 3PBWA 2V0TA 1AK5A 1XCFA 2QDHA 4JTTA 2J24A 3UNDA 1W5PA 1YXCA 5E93A 1TTQA 1LTDA 5F4WA 1ONRA 3UXAA 5C5YA 3NVTA 1FWNA 4YCPA 3M16A 4DELA 3DFOA 1B4KA 2G96A 2VOMA 2PC4A 4CQ8A 1B9BA 3LRMA 3RU6A 1KFBA 1H7PA 4DBEA 2XFWA 1EA0A 1I2OA 3L0KA 5FF4A 1LLWA 5AHMA 2DZWA 2LLEA 3G0SA 3OEXA 4UTLA 5FF3A 1PVNA 4M7SA 1QFEA 3W2LA 1NEYA 2PURA 4DO5A 5AOUA 4Q32A 1EB3A 2H3DA 2TRSA 4FIQA 2QDGA 3A9IA 4JTLA 4N9DA 4MIMA 3DHDA 3Q94A 5BRBA 4NJJA 3L9CA 3SR7A 3NQ7A 3TIMA 3PC0A 3PG8A 4O50A 1VRDA 1IXOA 1XDLA 4XKYA 4DPQA 3O6CA 4LVDA 2ZTJA 2CZDA 3H53A 4DEFA 1H60A 1MXSA 4IMDA 1SFJA 2I1OA 1TJPA 1TV5A 2RDWA 1LRNA 1QAPA 1K02A 3E9AA 3NL3A 4HPXA 1P4CA 2ZZ3A 1Z48A 3GDLA 3BK0A 2BX7A 5A5WA 4EVZA 3NG3A 3W1PA 5F2LA 1H50A 1R46A 2AAMA 4MZYA 1W5NA 5DCDA 1XUUA 3LB0A 5IBXC 1PHQA 2GQ9A 1Q6RA 3DU0A 1WX0A 2C15A 1P1XA 5HUOA 5AB3A 4GE8A 3N14A 3BG5A 5C54A 3W7RA 4A2SA 4O54A 1HL2A 3TDFA 3IV3A 1WDWA 1BEUA 2NUXA 5D2XA 3BV4A 3M47A 4OV4A 5DBUA 1OVDA 2FIQA 3TFCA 5BW6A 2G95A 4M19A 4K36A 4X2RA 2ZA1A 5G2WA 3LCLA 5DXYA 4HSOA 4LS0A 5I3FA 1KTCA 2YDAA 5HWNA 2YZRA 5U4NA 4GRSA 2J6XA 3DI1A 3S6DA 1LOSA 2QUUA 4AXKA 3LLFA 4RV8A 2WJZA 4IXXA 3FKKA 2ZCGA 3LXBA 2A5HA 3CEPA 3TV8A 4HT3A 1LYXA 3AO0A 2V82A 4LV4A 1SZFA 2F84A 4O13A 2YSWA 3ZWSA 2NV1A 4PL2A 3OA3A 2CW6A 2CLEA 3DFTA 3EB2A 4LVAA 3UQNA 3EWBX 1TTJA 4FXSA 4AB4A 3IEBA 3KVLA 5E0KA 3DXIA 4LOCA 1ZNNA 3W84A 3WK3A 4TMCA 2C16A 5H91A 4UMBA 1XFBA 3T4CA 4ADUA 4IMEA 4FX7A 1QMLA 1X1ZA 3UY7A 2ATMA 4ZQMA 4MFDA 4RKAA 3W7HA 1EWEA 1R47A 4XUGA 3TQVA 4LV9A 1MEWA 2GQ8A 2ZZ1A 1LZOA 2DZPA 3HB9A 3PBUA 5G4EA 2R94A 4A22A 1TPB1 4NT0A 1FBAA 3NGJA 4PCFA 3ATYA 1XI3A 2TPSA 3TQ0A 2ZDRA 1KBJA 2NXGA 1J5TA 5G2IA 1QOPA 1SO3A 2CLFA 1L6SA 1KTNA 1YTKA 1SO6A 1VC4A 4O8RA 1WOBA 4PA8A 1TJRA 3GYEA 5KZDA 2WSQA 1F05A 3GR7A 2W6RA 4XWUA 5CSRA 1VLWA 3SFKA 4ZZ9A 3DENA 1XUZA 4UTWA 2ZBTA 4O4WA 4H6KA 4E2DA 3EEGA 1GYNA 4MOZA 2ISWA 3NQ6A 3VI2A 1LBMA 5CPLA 5DCEA 1OK6A 1KBIA 2PRHA 1R30A 2NXIA 1GVRA 5G1YA 2ZRVA 4KFNA 1J2WA 3NL2A 2B4GA 5FF0A 2V81A 3EX6A 2Y7GA 5K9XA 2OCZA 1VQTA 1I45A 3WK2A 1KV5A 1SSGA 2ZYFA 2EGZA 3BPWA 4FHAA 1QWGA 3S1XA 2WV8A 3QSTA 4MY9A 3PB2A 2J88A 5LHFA 3P62A 1SW7A 1YYAA 3RK8A 4KFOA 1W5OA 4FX8A 1EP3A 2DZUA 3NEVA 1VLIA 3NNTA 3GKFA 3DGRA 3GIYA 3VCRA 1D3GA 4PL1A 1U5JA 4C1KA 1DV7A 4CCDA 4O17A 3L0NA 1TPFA 3LCGA 1B57A 2R8WA 1Z44A 1MEIA 1I2PA 3S5ZA 2CFFA 2YFOA 2FB2A 5K4ZA 2ABAA 3HPSA 2ABBA 4DBDA 4JEQA 4QIUA 4AWSA 1S3HA 1Q6QA 5D2TA 3G3MA 4NXSA 1ME9A 3SY5A 3M9YA 5D2VA 3KAOA 3W83A 1FWSA 3BARA 5CZJA 5LNWA 3WJWA 3FIGA 1JRBA 5EKYA 2YCEA 1WYIA 3GNNA 1NSJA 5LHEA 1PIIA 1OX4B 4KWVA 4WJEA 3LBCA 1TTIA 2WQPA 2V5LA 5AC8A 2BXVA 4JX5A 3W7OA 4NXKA 1VH7A 4K37A 1G6CA 5AHIA 1OJXA 3TC6A 4LWWA 4Z0JA 1FDZA 4R33A 4RR4A 2NX9A 4U28A 1A5BA 3W2UA 3QW4B 5EMUA 1H63A 4JR5A 4AEOA 4IXHA 3HMJG 4MPQA 3TKFA 1NF0A 4O1CA 4ZQNA 5D09A 1H62A 3BW2A 3L67A 2P1FA 1Q6LA 3N2XA 5FEPA 3U2OA 3IIXA 2C14A 2BTMA 5FEXA 3QJAA 3NPUA 1EUNA 1RR2A 1OX4A 3N2MA 2X16A 4O1DA 3LRKA 3HJZA 1OYBA 3W1LA 1VCGA 3N9RA 5FI8A 2GVLA 3L0GA 1ALDA 1EX5A 4AHPA 1LCOA 5D2WA 5FEZA 5K4XA 4I9AA 4LVFA 1KLYA 3W7IA 3W6YA 4O14A 1GTHA 2Y7EA 1QNVA 1G69A 2VFHA 4UTUA 5K7JA 2NX1A 3LERA 1FWWA 1N7KA 2VC6A 1H7WA 4IPIA 3EWXA 3VE9A 3LXCA 4GUGA 1I8JA 1JCNA 1EUAA 2Z0IA 4UTJA 1O95A 4TR9A 1UASA 3P8JA 1K7FA 3C2RA 3F4NA 4JDYA 1KM4A 1J4EA 3N19B 3QPYA 4TIMA 4NNBA 4UNLA 5EA9A 3G24A 4JIPA 4XKYB 3GDTA 3JS3A 1M7OA 4AWTA 3JR2A 3P61A 5I3HA 2ATSA 1QPNA 1CI1A 1TPWA 2VENA 3OVQA 5D32A 3MO7A 1TYGA 1S5TA 3CHVA 4AHOA 5CPNA 3TUUA 3EX2A 1OFQA 1Q3NA 3HGJA 2YR1A 4X3ZA 4TU1A 3T7VA 2Q8ZA 1TB3A 5C6MA 2G97A 3GXNA 4JYDA 3M43A 1OG0A 3FJ6A 4GUJA 2QR6A 3NM1A 3W7KA 3Q2DA 1L6YA 1UCWA 4AF0B 4CCCA 2ZTKA 4ALDA 4E2BA 3LCWA 4CQ9A 2ZRWA 4BF9A 2QCHA 5HMSA 2V8ZA 2NUWA 1OX5A 4CNNA 4IWWA 5J5DA 5IM51 2A7NA 2QEZA 3SZ8A 1C29A 3ATZA 2CWNA 1K7EA 3AJXA 3R12A 2VEIA 5CZTA 1DORA 3NQCA 1QPQA 1SU5A 3UWUA 2CZ5A 3TXZA 1O5XA 2GVJA 4H3DA 2WNZA 3TSDA 4JTHA 3STGA 3QW3A 4YWIA 3O8AA 2RFGA 1PHWA 4Y9AA 1IGSA 1A50A 3RMJA 1QCWA 3FS2A 2NX3A 4IQLA 3F4WA 1F2JA 2OT0A 3CM4A 4OV9A 3FA5A 3DHFA 3QSRA 3P74A 4XTDA 1GYLA 1UJPA 2VFDA 1QO5A 3W7EA 1JCJA 1KLZA 2QAFA 1Y0EA 3TU9A 4AMAA 2EKCA 3B0VC 2QF7A 3GAYA 2E5CA 3CT7A 3W2KA 4NU7A 1DVJA 4UXDA 4BI5A 3OG3A 4A29A 3A22A 5FESA 1W1ZA 5D03A 1WBJA 3DFQA 1A5SA 4EOUA 3NR0A 1YDOA 2FQIA 2ZFAA 3GKAA 1ZAJA 3P60A 4O11A 5HR7A 5DELA 2YW4A 2ISVA 4MLRA 4AAJA 3CWOX 4O18A 3QEZA 1N8FA 3NL6A 3W1XA 3W1UA 3F1QA 3LHYA 1Q6OA 4LTSA 3E12A 1RPXA 4MY1A 1TPC1 1SSDA 3MI2A 1G67A 4NUWA 5HWMA 1ICPA 3O15A 3VNDA 2C19A 6TIMA 1LM1A 4O52A 2DZVA 3EXTA 1I4NA 3BLIA 3W2JA 5EBUA 3GXPA 1ZAIA 3E96A 3G22A 4M7TA 1LBLA 3EWWA 4HHPA 2GQAA 3A24A 3C3NA 3SW6A 5J5RA 2KZHA 3C52A 4ZL1A 3P7YA 2WNQA 3IIZA 3UD6A 1SO5A 1AG1O 2YYUA 3R8RA 1KV8A 1OFBA 2QCNA 4FB7A 4JTEA 3IGXA 3MYOA 2CLMA 3LTSA 3QFEA 5GVJA 5K3VA 3LOTA 3A23A 1A53A 3TK7A 2V5BA 2G5WA 3PVFA 1BWKA 4JTFA 2RDUA 5CZSA 2QJGA 1G4PA 3NQ2A 1FXPA 3M5XA 5BMXA 3GR8A 5DY3A 1LDCA 3W07A 3C2OA 1LOLA 3IIVA 5CPMA 4LS1A 4ADSA 1IXNA 1OYAA 1C9DA 4O4VA 3W71A 4OT7A 2JBMA 1AW5A 5AHNA 2QCGA 5KITA 1EP1A 1GQNA 1IIGA 3KFTA 2W0UA 4UTIA 3OVRA 3G1AA 4DF1A 2E6YA 2WSRA 2RKXA 4D2JA 3B0UX 4X9SA 2VEPA 1WA3A 4JTJA 4X22A 2B7QA 2EF9A 2ZRYA 4TO8A 5DN1A 3GLCA 3EX4A 2PRMA 3F03K 4IGHA 3W7LA 6ALDA 1K8XA 1V5XA 1W3IA 4WUIA 4WX2A 3W76A 3O1NA 1KM6A 4PODA 1E51A 4MY8A 4ZQPA 1LOQA 5HUPA 3KRSA 1JRCA 1EP2A 4XBKA 5LSMA 2OT1A 1K3UA 2Z6JA 3UZ5A 2HS8A 2NXHA 2YFNA 2R91A 3TJLA 3CWNA 2WKJA 3W7CA 1DKWA 1RV8A 2HS6A 1ADOA 4RK8A 3WJSA 4UFJA 3STEA 2X1SA 5L6UA 1LLZA 3W70A 2RH9A 4Z08A 3C6CA 2Y7FA 4NZFA 4NVTA 4E0CA 3DKLA 1VHNA 5CZ0A 1EWDA 3O16A 4QQ3A 3TA6A 1SUXA 3QZEA 4FNPA 5HWJA 5AC7A 3NZ1A 4K7VA 4AWUA 2A0NA 3LLDA 4JX6A 2BWGA 4O16A 3Q58A 4UFHA 1KFEA 1QR7A 4GUHA 3I68A 3UYCA 1I2QA 5F1UA 1H61A 4P2VA 5HULA 4FNSA 1AW2A 1M6JA 2BZNA 2QJIA 3NQGA 4N6FA 2VFGA 3H54A 4HIBA 3GAKA 1AW1A 1GVFA 2TMDA 1NVMA 1OFOA 5C55A 4GWEA 3DBPA 1UBSA 3LV5A 1SZEA 3W74A 1ZY9A 1XBYA 4CCEA 2F7FA 2J9YA 2A6LA 3A21A 2XN2A 3G1XA 3HG3A 4JY9A 3UWYA 2YYTA 1NAL1 2BLEA 1GWJA 3FJLA 2Y62A 4MZ8A 4FNUA 1GZGA 1YLVA 3G8EA 3L68A 3C61A 4YLWA 5C2XA 1ICSA 4S2BA 4JXCA 4MZ1A 3HGSA 5BMWA 4UTMA 1W37A 1TPEA 5HQEA 1XBVA 2FFCA 4LRTA 1H5YA 3W7NA 4LRSA 4YL2A 3C0JA 1JUBA 2Y70A 3KOFA 2P10A 4Z1DA 2ZZ4A 1GVQA 1KM3A 1UUMA 1GVOA 3PBYA 1IXQA 1I2NA 2X1RA 3BG3A 5LNRA 3KVKA 4IMCA 4OWGA 5G4WA 3DKJA 2A21A 1X7FA 2A85A 4ZQCA 1W56A 1SQ7A 4FXRA 4AH7A 1R2SA 2OX1A 4OE7A 3BO9A 3QC3A 3W88A 4JGDA 2ISSA 3EWUA 3W7PA 5MHBA 2CLIA 2HTMA 1G7VA 3S1VA 2WO5A 4BK9A 3PUEA 2VEKA 1VPXA 3PS7A 4ONVA 4C1LA 2FTPA 1RD5A 4N02A 1K8ZA 4BFAA 3TJXA 4K6AA 2V2DA 4UCGA 3CIXA 2DZTA 3INPA 5LNVA 1S5VA 1OK4A 1G7UA 4BR1A 3RLVA 1W0MA 3IGUA 3O6DA 4JYEA 4QNWA 3W86A 1YTEA 3C4UA 2Y7DA 5CG7A 3TNOA 2FPVA 3PULA 1H7XA 1TV7A 3P82A 1SO4A 5ABTA 1KM0A 2ZZ7A 1RVGA 5EY5A 4L4MA 4NQ1A 4Z1BA 5DBTA 2DJLA 3PSVA 3CIWA 3EXSA 3UWVA 3HO8A 4N9BA 4MFEA 3S9YA 4UTKA 3HGRA 2PCQA 1K7XA 4MYXA 4UFMA 1I2RA 1TIMA 1MO0A 1YXDA 1YXYA 4DF2A 1B4EA 2V2HA 2C3ZA 3FOKA 4N4QA 4J9JA 1SW0A 2E6DA 2Q8LA 3ABRA 1HO1A 3NQMA 3VKJA 2X2GA 4U4MA 1IIHA 2QKFA 3O07A 5T26A 4AVFA 4O0ZA 1O5KA 3GDMA 1FXQA 4WY0A 4O0KA 1WAUA 4N2YA 3I7SA 2W79A 2NWSA 2VFIA 1QPOA 1TREA 1UB3A 3THQA 3TCEA 3GNDA 3PSWA 3G0XA 3G1FA 3QQ0A 1CX9A 3P81A 3RNDA 1D3HA 3TX9A 3O05A 1QO2A 1JCMP 3TMQA 5U7SA 1PV8A 5LGZA 4LVGA 5FF7A 1GT8A 3D0CA 1FWRA 1F5ZA 3HPXA 2DZSA 1L6WA 4XBSA 1VCVA 4O15A 3EKLA 4GNJA 1RQHA 1H7NA 3TSBA 2CLKA 2GJLA 3KXQA 3FYPA 2JGYA 1KTBA 7TIMA 2WSYA 3LCHA 3HG2A 3HOJA 1L9WA 5EPDA 1THFD 2Y89A 3W1MA 2OMAA 5I3KA 4WXZA 1OF6A 4LC8A 3TROA 1G4SA 3W22A 5D33A 4QM1A 2VKZG 2EHHA 3MP3A 2WNNA 3IIPA 1WV2A 4ORIA 2JKEA 1O94A 3W7DA 2QCDA 4ORMA 5FEWA 4NJKA 4UIOA 3MP5A 5A8GA 3G8RA 3PG9A 2Y6ZA 1GG1A 3C56A 3W23A 3NAVA 3WK0A 1XM3A 3HF3A 4RXFA 1OHLA 3W75A 3MBFA 1F74A 2J9XA 2X1TA 2Y85A 4MUZA 4LU0A 4XQ6A 5H2ZA 2NWRA 5LNUA 4JX4A 1AMKA 4ML9A 3S5NA 1YDNA 1DQWA 1LRTA 3NQ8A 2QCFA 1TQXA 4OU1A 4IPJA 1OF8A 1LBFA 3L5MA 2Y88A 4A2RA 2QCDB 1JQVA 1RQEA 3GX9A 3L66A 4PTNA 1OYCA 4WOQA 1ICQA 3NQEA 1OX6A 5AYYA 3L65A 2CLHA 2B7PA 4CNOA 5AYZA 3B0PA 1H7RA 3EXRA 2J9ZA 4O57A 1VCFA 4JNMA 4LC6A 5BOOA 4RX0A 2Z1BA 3ELFA 4MKNA 2P0OA 1GPWA 3I65A 4RCXA 3T44A 3UZJA 3PUDA 4Q33A 4ZVJA 2ZA2A 2V2CA 5AN7A 3NQAA 3TC7A 3GZ3A 4W9TA 1XBXA 2C6QA 1OFRA 1FDJA 2QCMA 1TCDA 3ANYA 5KSWA 1KW1A 3OBKA 2ZRXA 3HIJA 1SZNA 2CZEA 4NX5A 4XTIA 2FDSA 4JYFA 3IIOA 3BLEA 3LHVA 4FO4A 1OFDA 2Z6IA 1BKSA 4S2CA 4Y6GA 4O1BA 3M7WA 4I7VA 3A5VA 1F7BA 1YPFA 3KHJA 3N73A 4IMGA 3PWAA 1JR1A 3M0ZA 3NA8A 1X8FA 4E38A 4M5PA 3O06A 2O7SA 1DJQA 3UWZA 3B05A 3FYOA 3U6WA 1SR9A 3MWAA 2H8XA 1RQBA 1XL9A 1T0OA 1KM2A 2Q3OA 1F6KA 1VYSX 5DCBA 4HN4A 2EPHA 4JY8A 4UTTC 3LX9A 3NM3A 1A5AA 4CNPA 1Z41A 4NJHA 3TQKA 1N55A 2DU2A 5FF2A 2D73A 2ZZ2A 3DI0A 3L2IA 4O12A 4PH6A 3LGEA 3IVTA 2EAWA 1F76A 4IOTA 3SSJA 4ZQOA 1HG3A 1TRIA 3R2GA 2NV2A 2CLLA 3G1HA 3CTLA 3G3DA 4JDBA 2A6NA 3G1YA 2WPBA 1T96A 3LHZA 4LT9A 1OABA 5HINA 3CB8A 1O60A 4PC8A 5AHFA 3GDKA 3T55A 4HSNA 1P5BA 3LTPA 5LZLA 3FEMA 3LCFA 1ME7A 4A3UA 3RFAA 3C8FA 1M5WA 3UXDA 4JD4A 4CQAA 5K9DA 5G1TA 4QAIA 4JIQA 2Y61A 2YW3A 5HJLA 3MMTA 1TPH1 4O53A 5KTLA 3MUXA 3S1WA 3QRHA 5D04C 4JS3A 5DXXA 4ICNA 4O10A 4M6QA 4I7WA 3S0CA 4O28A 3CPRA 3HGOA 1JCXA 3QMRA 1H1ZA 4UTHA 3TXVA 1GJPA
chains in the Genus database with same CATH superfamily
1XR2A 4RZ6A 3PJUA 4WCJA 2X30A 5BCAA 3WD0A 2PGFA 3RPMA 4QBXA 3BW4A 3BUVA 2DT1A 5MKGA 1C8VA 1VHCA 3MYPA 2PGEA 4UR8A 3POHA 4B3KA 2ZIDA 2FHBA 1HKJA 7TAAA 3UWWA 3PM6A 3P8IA 2IQ0A 4GY1A 2V5DA 3TE9A 1T99A 1ZAHA 4D8LA 3N1AA 2CHNA 3QMSA 3NURA 2CBJA 3P5YA 4G1KA 3QV8A 4K39A 4KRTA 4IGNA 5AECA 4N6EA 2E5DA 1UW9A 2FVLA 3N6JA 3LDVA 3BGJA 3UPBA 4CEUC 4Y8FA 4E6MA 1KXTA 2I5GA 3UG8A 1VS1A 3STPA 4FLSA 1X1OA 2FB3A 2HWGA 4BI6A 3BQ6A 1TMLA 1C9WA 3Q65A 1Q6CA 4MM1A 3ECQA 4QCEA 1MWOA 2XN1A 4TX6A 1TV3A 3E2RA 3SGZA 4DXXA 1JNDA 2ZA3A 3LM7A 3GDRA 4IQDA 4H00A 1FWJC 1KFKA 2BHUA 3E0IA 5BNKA 4Z0SA 4KIRA 1UZ1A 1BXBA 1VYRA 3B4YA 3T07A 1GOMA 4FNRA 4GG9A 2X8RA 3GNRA 3H7RA 2QJJA 2IPGA 3QN3A 5AC6A 4F8XA 4PE8A 1LLOA 2IPFA 4GI6A 4BHYA 2ALRA 3SQSA 3N29A 1V4YA 5DMYA 5F4SA 2XGBA 3XIMA 1ZCOA 3G1DA 1XISA 1EO5A 4MJZA 2H3BA 3U48A 1W1PA 4Q7NA 3GE7A 2DY3A 1UMLA 3TH6A 5BWFA 4HPJA 2DJXA 1OM0A 5TAOA 3LGGA 2QCLA 4QITA 3LHUA 5D05A 4AD4A 5JH2A 1OFEA 3VE7A 2BXYA 1OEPA 2XSBA 4FIRA 4O1AA 3RPTA 3W1AA 1K8YA 1T41A 4CGTA 1E1CB 4XVEA 4PEKA 2E77A 1AQFA 3RO8A 4E2VA 4R53A 1CXKA 2VRQA 4RZ4A 3NPXA 4PCNA 1HGWA 5FIPA 3AIBA 2OG9A 5CAHA 3G1VA 2VFFA 2WZMA 1Q8JA 3STCA 1XLEA 5CSUA 1GG0A 1XKYA 1RHCA 3WMBA 1CCWB 5GNYA 3SFWA 3A5FA 4B15A 1M7JA 4DM2A 1FFRA 1MQQA 5E9XA 4AISA 2OR2A 1NDZA 4Z2IA 3BJTA 2F6XA 1JIBA 2L5HA 1NJJA 3N34A 2FJUB 2RJGA 4B4HA 4O1FA 1R3QA 4AQLA 4KETA 4H7ZA 4J7RA 4M51A 3M0JA 5FAJA 1K70A 4AEFA 1F6YA 1EBGA 2V3EA 3A64A 4GJ1A 1NWSA 3UU0A 1LP6A 3NYZA 4PTXA 3CLMA 5FKYA 1KQZA 1MUWA 4H01A 1OGGA 3W1NA 3EDFA 1AFSA 4GXMA 3GXTA 2OLSA 2AQWA 1KRBC 3H24A 1UUOA 4LAKA 4Y9MA 5FJPA 1BQGA 4FF5A 3AIWA 3VIOA 3V1PA 4DXVA 2PWGA 3KVMA 4DUWA 3DYMA 3THAA 1TPUA 2PDIA 1NP0A 3TYEA 3KLKA 3V18A 3SECA 1MUMA 2HBVA 3M41A 1DJIA 4UFLA 1A5CA 3QV7A 1QHZA 1W1IE 3G6MA 3MZ2A 4RDWA 4YCOA 5G5IA 1W9UA 1LT8A 2H8ZA 3IJIA 4FK9A 3T4WA 1KM1A 3L2MA 3CC1A 1TWDA 1QOQA 1GTEA 1XDMA 5TBOA 4HNNA 3AZSA 3N3MA 1OZQA 4GIRA 5FA5A 4Y9OA 3U5UA 4M0XA 2E9MA 3G1SA 1E0WA 4MADA 3AWOA 3S5OA 4ADTA 3TZNA 2FGZA 4C6DA 1OT1A 4U5IA 4WKHA 1V0NA 2X09A 5A8PA 2E9LA 2YLLA 2R1KA 4P8UA 5LKYA 1ZJIA 4HYWA 4H8VA 3UNTA 1Q45A 3W1TA 4XX6A 3BW3A 1R3YA 3CXOA 3LI1A 1XIJA 3RLUA 3EKZA 5CGQA 3GIQA 1YTDA 4HNUA 3TTEA 3L4VA 3WNLA 1O6IA 1D2KA 3W1RA 3L21A 1OGBA 3B9DA 4CLMA 3EDEA 2XFRA 1DP0A 1QK2A 4R7JA 1EEPA 2ZZ6A 2F8QA 4KF1A 5KINA 3IRDA 4K7YA 5TIMA 3GVGA 1BXCA 1J0IA 3LBMA 3W01A 2OQHA 1MSSA 3W2MA 3MTWA 2X40A 2QXWA 4M6PA 3CUGA 3UZYA 2PDFA 1J0KA 5DF0A 3B4UA 3EPMA 4DX3A 4AHQA 4AIUA 3RO6A 3TW7A 5M03A 2WJDA 1M04A 2VCCA 1KCXA 1FKXA 3A3XA 4XAPA 2DP3A 1QDSA 5A8OA 3VMOA 3DHPA 2FFIA 3O6AA 3T78A 2PU0A 3RHGA 2WCGA 5RUBA 1TV8A 1V8EA 1XYFA 2HK0A 3LEPA 5C9WA 1BTCA 4EIVA 1G4EA 1VPYA 1F73A 3ABQA 4K2SA 2WVVB 3UGVA 3W82A 4XIAA 3OP2A 1UP3A 3B9NA 3LMZA 4L9XA 1FX6A 4C60A 1TMHA 4JTSA 3FHAA 3P80A 2QDDA 2FVMA 1WDPA 3I7QA 4AIBA 1ME8A 2QNEA 4XO7A 4H9TA 1UP2A 1JGMA 5E1QA 4MWAC 3P5ZA 3HG5A 1UKSA 3I6TA 4ZMGA 4KEVA 1PL9A 4MMWA 3WLHA 4MG4A 2JQXA 5BXPA 2QAPA 2D2HA 3MJMA 2E68A 3WDRA 4J3XA 3U8GA 3SBFA 1RCQA 4ZR8A 3VGBA 2XSXA 2J66A 1CT5A 3MMDA 1QJWA 1E3XA 3RDKA 4A4AA 3RXZA 1T7LA 3U9IA 3E0WA 1Z69A 2A2IA 1YADA 1IXPA 4BQ3A 1ITCA 4M3PA 2NQZA 4MJMA 2YL6A 4Z1AA 3I7RA 5L9FA 3BCFA 4DZIA 2WXDM 3L5AA 1BTMA 2P0IA 3WJYA 4AVOA 1EA9C 4W85A 2OWXA 4Q4KA 4JBRA 2E1DA 1PAMA 4HNVA 3DIPA 2CERA 3E38A 5BU9A 2WCSA 1NY1A 3R13A 1IEQA 1GEQA 4IZGA 7CGTA 3TNBA 5E93A 1B54A 1E5JA 1LTDA 1XQKA 3UXAA 2I9UA 1NTHA 4F9JA 4DELA 4YCPA 2FZ8A 4HZ7A 2PF0A 4GH1A 4CQ8A 1B9BA 3LRMA 4H6RA 1EA0A 3L0KA 3QPEA 1LLWA 1A3XA 1UD8A 5AHMA 3LLXA 1EZ2A 5FF3A 3DC8A 2YXXA 3G0SA 3VZYA 2FTWA 5FJTA 4M7SA 4L6OA 1SMAA 2D69A 3PZVA 1LQAA 4DO5A 1WP6A 1XPGA 1E6ZA 2TRSA 4FIQA 3A9IA 2J62A 4N9DA 5ECVA 5XINA 3GTFA 3SR7A 3NQ7A 3R10A 3UZZA 5AC4A 1IXOA 1CGXA 2EJAA 4HTYA 4B5TA 3ARSA 3PTDA 1MXSA 3E9AA 1OIFA 3NL3A 4HHHA 2ZZ3A 1Z48A 4GNKB 4KWSA 4GIAA 2HNHA 3ITTA 5F2LA 1R46A 2AAMA 2WANA 4CEXC 2G8ZA 1NOFA 1V6YA 2O9PA 1U30A 5IBXC 1PHQA 4DN1A 2PTWA 2DSKA 1L6FA 1XP3A 4KBXA 1PTGA 1OG6A 3UXKA 3NZGA 4GE8A 4O54A 2IKIA 4X9YA 2NUXA 3GHRA 4LBRA 4GHRA 4B3ZA 3ISIX 3MCOA 4I9TA 2QS8A 4K36A 3SAZA 2Z1XA 2HBXA 4HSOA 4RNJA 1BFNA 1KTCA 3TTQA 3N2OA 3WKZA 1Q5MA 3KBSA 1QW7A 4GRSA 4UZSA 2J6XA 4PBEA 1EKOA 5H8UA 1DE6A 3MUAA 2PEVA 4IXXA 1TJ1A 3FKKA 1P0BA 3LXBA 3AS1A 4DXKA 3GSMA 1SGJA 1V51A 3CS2A 3BMVA 3QV6A 3RILA 2YSWA 3ID7A 3ZWSA 2OODA 4PUNA 4PL2A 3WF2A 1ZJBA 2PTDA 4AB4A 1ONWA 3IEBA 5E0KA 4FPSA 1ZNNA 3KUMA 4JIIX 3WK3A 5H91A 3APGA 3CUZA 4HVXA 5C9UA 1QWKA 4ZQMA 4YNGA 2VMFA 4F4RA 1ZJAA 1MNZA 1MEWA 2GQ8A 1LZOA 1IHIA 2DZPA 2VRKA 5G4EA 3F2DA 2R94A 4RE3A 2NQJA 2A79A 3BZGA 2DH2A 4PCFA 3DG3A 3ATYA 1TKKA 4NAEB 1UD4A 2NXGA 2CLFA 2A3BA 1KTNA 1YTKA 3RX3A 4QDPA 1BVZA 1P0EA 3CUJA 1WUFA 1A5UA 1TJRA 3URNA 2W6RA 1UD2A 4HQVA 4L1WA 2GWNA 3KBJA 4FXFA 3ZLGA 2ZBTA 3QGVA 5BOFA 4LUTB 4E2DA 1RPKA 2D0FA 3U7VA 1LBMA 1KBIA 1GVYA 1K6WA 2GSEA 1R30A 2NXIA 1GVRA 4J2MA 4KFNA 3NL2A 4W5UA 1XRVA 2OO0A 1I75A 1HKIA 3FJ4A 4AMCA 1I45A 4IJCA 1GORA 1SSGA 3UETA 2PBOA 1X7IA 2EGZA 2OKTA 4RW3A 4KERA 4H8UA 4DZ5A 1QWGA 3I10A 4E8GA 1M1BA 2J7GA 4IMAA 2JALA 4LQ1A 1QI5A 1UC5A 1YYAA 1O1HA 4KFOA 3WQPA 2EQDA 3GKFA 3NNTA 4DM1A 2QPUA 1MFUA 1K4HA 2PWFA 3L0NA 1B57A 3WH8A 1I2PA 3GC5A 4XSMA 4OUIA 4MNKA 2ABBA 1JAEA 4RPPA 4N42A 4MTVA 3OPSA 1JDAA 5D2VA 4IIFA 5BOEA 3K1DA 1FWSA 3H12A 2O92A 4L56A 5AYBA 3FVDA 2EG8A 4H2CA 3GNNA 1OIMA 4KWVA 1ADSA 5IFTA 4JX5A 4NXKA 3URBA 2R1PA 3CUXA 5I09A 4K37A 1G6CA 1OJXA 3ZR6A 3RMEA 1GKPA 4V1XA 1YMYA 4BJHA 4QROA 4U28A 1A5BA 3GVRA 2BASA 4HK5A 3HMJG 4O1CA 2P8BA 3JZUA 4IT1A 5C9RA 5JU6A 1Q6LA 5FEPA 3GU2A 3IIXA 4PRTA 1J18A 4G56A 4L80A 4AD5A 3L0GA 3G77A 5CLTA 4BS0A 1DYSA 5FEZA 2O9RA 4GI8A 1O5RA 9CGTA 1KLYA 4HMEA 4ZSUA 2Y7EA 3LA4A 1G69A 1S38A 3D3AA 1XGZA 5J8LA 4UTUA 1TUXA 2NX1A 5K7JA 1E0UA 3SRHA 1B90A 1N7KA 2VC6A 2P5NA 1NFPA 1LL7A 1CXLA 3LXCA 3PANA 4IIEA 1JCNA 2FHFA 1O95A 4ROQA 5I3DA 1Q4WA 4JDYA 3QZAA 3B8UA 3F4NA 3T0CA 3N19B 3VYLA 2ZX7A 2YDSA 4JIPA 3NTYA 3SB0A 4IQJA 3WLPA 2R6OA 3GDTA 2EPMX 5D4YA 3T05A 3JS3A 1M7OA 3EOSA 4AWTA 3THCA 2CEQA 4DI8A 3P61A 5I3HA 3PK7A 1WDDA 1TPWA 5D32A 3OVQA 3MO7A 1GHSA 1TYGA 3CHVA 1YBQA 1MDRA 5IDZA 2W3ZA 1HGYA 2OEKA 4C5YA 3EGJA 1E9YB 3S46A 3T7VA 2Q8ZA 3IK2A 4PUMA 3M43A 3MUIA 1NP2A 4J3UA 3KP1A 1S2TA 3FJ6A 3WQ8A 1UCWA 4AF0B 5BWAA 3LCWA 4CQ9A 1MDLA 1OX5A 4Y8EA 4C6FA 1DTUA 4DJDA 3BAJA 1UA7A 3BAXA 1Q7ZA 1P48A 4LYPA 3VU2A 1SU5A 4PBFA 5I0DA 3MS8A 1V02A 3TSDA 3STGA 3A4JA 3O8AA 4MB1A 3LQLA 3LGDA 2DFAA 1IGSA 4IQLA 1C3FA 3F4WA 1F2JA 2OT0A 2OEJA 2DZAA 3QSRA 4XTDA 3GHTA 5BRQA 1E3ZA 1E15A 1QO5A 2HVNA 3UR5A 4GABA 1KLZA 3EMZA 1IEXA 3TU9A 3W2KA 3L7RA 3A22A 3CK5A 5D03A 3DESA 2CITA 3TOYA 1A5SA 4EOUA 3AQUA 5B7ZA 4LALA 2ZFAA 3GKAA 1ZAJA 5HR7A 4GVGA 3C8NA 2YW4A 4OIFA 3E2VA 3SUUA 4ILSA 1N8FA 3VOIA 3F1QA 1OY0A 2DH3A 3M0IA 3E12A 5ENLA 5I00A 1SSDA 4GPNA 3WQCA 3MI2A 3WX7A 4PTWA 3BL3A 4U10A 1RD6A 3VNDA 4ML4A 4O52A 1QXLA 4NAEA 3EWWA 5E0FA 3MPGA 1KC7A 4A3YA 2VDIA 4ZL1A 1ZBKA 2F9RA 3T09A 2VX4A 1SO5A 2ZADA 6ENLA 1OFBA 1RCXB 2VTFA 4JTEA 3IGXA 2CLMA 3M0MA 3QFEA 4HP5A 3PPCA 3M5XA 4EX4A 5DY3A 1QI0A 1LOLA 3FA3A 1HNYA 3M0YA 3L4ZA 5I79A 1OYAA 1C9DA 4O4VA 3QY8A 1XLGA 3UW6A 2ZVRA 3BAYA 4HK7A 4HCDA 3DGBA 2JBMA 3UCCA 1AW5A 4ICCX 4M24A 1P43A 3OVRA 3G1AA 2WSRA 4DVOA 4C6MA 2F6KA 3PJTA 2J8TA 4PMQA 5H6HA 3PHAA 1EYWA 4D8ZA 4TO8A 3E0LA 3GLCA 4QG9A 2B81A 3F03K 3AAMA 3UT0A 4WUIA 4WX2A 4H9XA 3W76A 1W9BM 1POJA 1KM6A 4D71A 5HUPA 2PLJA 3KRSA 3RR4A 2OT1A 2PDLA 1EL3A 2FMNA 2UWFA 3VX1A 3TJLA 5CJNA 2WKJA 3W7CA 2E9BA 2WK2A 2HS6A 2GJRA 4IL0A 1FA2A 4RK8A 3STEA 3GW3A 4H7VA 1XW8A 3C6CA 3SJNA 2ZC8A 3VO0A 3TA6A 5AC7A 1PX3A 2XU2A 4DNMA 3QY7A 3KL0A 1DXEA 4US5A 5HNTA 2D3NA 2Y5SA 5LIYX 3U2EA 4UTFA 3GWQA 1MRQA 5DQPA 3RM9A 3R0KA 4RDVA 3VNJA 4HIBA 6XIAA 1ZZMA 2GVEA 2A3EA 5C55A 5CPTA 3DBPA 3W74A 6TAAA 1QW9A 2GUBA 4WRHA 2F7FA 1CXIA 4QDMA 3G1XA 1W1B1 3DHUA 4FNUA 1GZGA 2G3JA 4I8DA 4MZ1A 3Q4DA 5HMFA 1W37A 3GDBA 2FFCA 3W7NA 3C0JA 1IWAA 3RITA 5FJUA 3KOFA 4HU4A 2BB0A 4QQUA 1XYMA 1GVOA 2WM1A 4REQB 3H8AA 1PZ2A 4FR1A 4HU8A 1CECA 4IISA 3NIYA 4IMCA 1K6AA 4PMYA 2GFTA 1X7FA 5CBIA 4ZQCA 1R2SA 1SJBA 2W92A 2D2OA 1UBPC 4GYPA 5GNZA 3VGDA 5MHBA 2CLIA 3S1VA 5ABHA 5I78A 1GEHA 4ONVA 2G3MA 1RD5A 1V77A 1UQZA 2VL4A 4GYFA 3TJXA 3ZJ6A 4FLRA 5IXEA 3NXLA 4H8NA 1OK4A 1G7UA 1HF6A 3M0XA 3RLVA 2Y1HA 3IGUA 3O6DA 3P0WA 3MY9A 3C4UA 5E6YA 3VAVA 3TNOA 2FPVA 4HOWA 1SO4A 3IJ9A 2J7FA 1GCYA 1KM0A 4L6HA 4R3UA 2ZZ7A 1RVGA 5EY5A 4NQ1A 4F9DA 5DBTA 4LH8A 3CIWA 3RGTA 3EXSA 1QI2A 4MFEA 2PCQA 1R7OA 3RX2A 1I2RA 4DF2A 1YXDA 1LUCB 1B4EA 4ZO8A 3TTYA 3RCMA 1VAHA 2Y24A 2Q8LA 5IFPA 1C93A 2CHRA 3G6LA 1HJQA 2X2GA 2YLAA 4B9ZA 1W91A 5HJYA 4CQBA 2QKFA 3O07A 3NVDA 5T26A 4AVFA 4O0ZA 3GDMA 2WC4A 1FXQA 1WAUA 4N2YA 3I7SA 2XM1A 1I0BA 4V27A 1QPOA 5HANA 3TCEA 3GNDA 3PSWA 3KL3A 1TWWA 3GD6A 4AU0A 1D3HA 3WLJA 1F3EA 3T1GA 5U7SA 5LGZA 4FSAA 4EPBC 3P93A 1E40A 1F5ZA 2DZSA 2JIWA 1XD1A 3C0LA 1SMDA 4R85A 4CNUA 1XLMA 4GNJA 1OCBA 1XGDA 1CGWA 3KXQA 3OYZA 3W02A 4WVXA 2WSYA 1XYBA 4JCLA 1V0KA 2ZKMX 4DJFD 1W1VA 1THFD 5CCZA 3HV9A 1OF6A 3AIVA 1G4SA 2EHHA 4HPNA 4MWAE 1XLFA 1FP8A 4Y2WA 2NQ5A 2V5KA 1C8QA 4LYRA 4YTQA 2OQYA 2QCDA 3VKBA 2ACRA 2J78A 2OWWA 3QR3A 1DQUA 5HNUA 2OWCA 1UIPA 1GG1A 3CAVA 3VD3A 4EWJA 2PDPA 3GTNA 1OHLA 1CLVA 3MBFA 2MUCA 2Y85A 3OQ8A 4MUZA 4LU0A 1BSIA 2MANA 5HA7A 4QAWA 1R5YA 1K1DA 4JX4A 4JPGA 1AMKA 3S5NA 4DWSC 1H0IA 4W8LA 1KXVA 2RAGA 1VFHA 2HXUA 4HMDA 3ZVHA 4A2RA 4PTNA 1JQVA 2IXVA 1R38A 1VP5A 4D6JA 4DLMA 4A8LA 3H70A 4D6DA 5AYZA 3CUHA 1XSJA 3WLTA 1VCFA 1TV2A 3ME3A 2Z1BA 4C7FA 3VABA 2Y8VA 1EHNA 3GZ3A 4W9TA 2C6QA 1FDJA 2VGFA 2Z1WA 2QCMA 4ZTXA 3WBEA 1GVIA 2NVAA 3CZGA 3CPUA 1KRAC 2ZRXA 3HIJA 2FDSA 3WSUA 2ZE3A 4JYFA 3BLEA 2Z6IA 1HVXA 1UHVA 3LS9A 4KCWA 1TX2A 3OA5A 4I7VA 2PS2A 3A5VA 3T42A 3P0XA 4C1NB 3UVIA 3C3UA 2UBPC 3NA8A 4LEFA 4E38A 3O06A 1LT7A 1DJQA 3B05A 4XZLX 2AL2A 5HMEA 1XL9A 3RU8X 4QLJA 1VYSX 5DCBA 5A6LA 3NM3A 7A3HA 2DU2A 2GJXA 4AZCA 2DDXA 4L64A 5FF2A 2D73A 3DI0A 3L2IA 3CHFA 3BMXA 3LGEA 3IVTA 2EAWA 1OC5A 1HG3A 3TWAA 1TRIA 4WSKA 1M03A 1MZRA 2OSXA 4JDBA 4AZ5A 5EMMA 4CN6A 2A6NA 3JW7A 2VDGA 4DUOA 1DHKA 5TF0A 3R8GA 2XWEA 3N4EA 3T55A 4MJ2A 3EEZA 1PXGA 4A3UA 3C8FA 4JD4A 2DIKA 3UG5A 4CQAA 3MKKA 4PUJA 1WDSA 4JIQA 2Y61A 2REQA 3B9AA 1TPH1 1DTNA 5CGTA 3MUXA 3S1WA 2V67A 2XVNA 4U31A 1JAKA 4ICNA 1IR2A 5A6MA 1JCXA 3TXVA 1GJPA 1G9HA 2PDXA 2PDWA 3LTYA 3AUJA 3WDJA 4H83A 3HFYA 2A3HA 1PKLA 4LVBA 3QY6A 1FCBA 2V63A 1ZPTA 2HSAA 5D30A 1CW2A 3GFYA 3JZEA 2VFEA 2TYSA 1BWLA 3A9BA 1W32A 1KGUA 1EC9A 1S3TC 1WBHA 4V1YA 2YGYA 1SFLA 3E49A 2QDEA 3L4TA 1KWGA 3GTXA 4LJ3A 1J10A 4IG2B 1NDWA 2XZ9A 3EDJA 2ZRZA 3NEHA 1VRXA 3QVQA 4DWSA 3NDOA 2DQWA 3SQLA 3QOKA 2JFEX 1L8PA 2IPWA 4HB7A 4XSLA 4U33A 5F1VA 1ZUAX 2QUMA 6A3HA 3UR2A 2R1LA 2YX0A 2CLOA 1AODA 3W37A 3BC9A 3RCYA 1H7OA 5FSEC 4FR6A 4FNQA 2JGQA 1JCTA 3PF3A 4PRWA 2Q02A 3BXWA 4Q4MA 1PB0A 1JDCA 3WFLA 3SJ3A 5A6JA 4NZ3A 3ZYZA 1TVNA 1W5MA 3CV1A 3N9SA 5DRCA 1F6PA 3TYUA 5A6AA 3OHIA 3APTA 3U4AA 2H6RA 5KZMA 3RF9A 2W63A 3ABXA 4IPLA 4XBJA 4GACA 1CGYA 5J04A 3M44A 1NIUA 3MHGA 3WJZA 3O6YX 5G2HA 1OSEA 4WSJA 3M6YA 3LMYA 2C1IA 2QUNA 3M5ZA 4PMNA 2FHCA 4WDTA 4UMCA 2HEJA 3Q37A 5AYXA 2C1HA 2DORA 4ES4A 3FA4A 1R86A 1EDQA 1VFUA 5EB8A 3W85A 3OLDA 2WLYA 3ZFHA 3KBNA 5HK4A 3W3OA 1JZ3A 1KCLA 1E4LA 1VZWA 2XN0A 5HR6A 4Z2HA 3PZGA 3WUFA 4ZXLA 3ZZ1A 3MUCA 3WD1A 3NL5A 1YDVA 3OVGA 1TR9A 4BI7A 4K68A 1IF2A 1JDFA 1UWIA 8XIMA 3S42A 4IIHA 1ISVA 1U83A 3LHWA 3STFA 1GQJA 1KRMA 1JPIA 5E0CA 2C0AA 3P84A 5BXTA 1UUQA 3ARTA 3ABSA 2IUZA 1LL4A 4M56A 5D37A 1U2YA 2GPTA 2Y8KA 2AQVA 3GTHA 1HZYA 1O4UA 2Q6ZA 3FEQA 4JTKA 1W8SA 3VFLA 3EX3A 3CEUA 2O4MA 4A8RA 4M6VA 4JTUA 4R27A 1KRCC 3T0AA 1PCKA 3ZSTA 1KM5A 2JK2A 3VZXA 3WJXA 1RZMA 3PUOA 2E6AA 4L4LA 1GW1A 4HZ6A 2YXOA 2J7DA 5JXQA 4JFUA 2OELA 3MMWA 1QPKA 2QIIA 4FOKA 2DUAA 4KQNA 4GC3A 3VIKA 2HNEA 4S23A 1W2VA 5ABFB 3PTQA 5EYWA 4NNCA 1R8LA 2RHGA 4WOZA 3GH5A 1SZGA 4JTIA 2WHMA 1WOAA 5F4XA 1Q85A 4WGXA 4US6A 1D9EA 3RIKA 3GHUA 5I03A 2GGJA 2BOGX 2DT3A 4ZQRA 3S1UA 4B92A 3T0DA 2VC5A 4IFKB 3QH2A 1QNPA 1W31A 1VBGA 2IXUA 2WLZA 4Z1CA 4QFUA 3LRLA 3EB3A 3MSYA 4RNFA 3IGSA 3B06A 3C2FA 1BRLB 1H3GA 3WFZA 2DZXA 5JBFA 4TOQA 1MW0A 3S83A 3NQFA 9RUBA 3URQA 2PDYA 2XIQA 3BGGA 3VGEA 4H41A 2QUTA 4EAYA 4P7RA 2J25A 3DECA 5EL1A 2YXGA 2HCVA 3EWCA 4U2YA 5C2GA 1GVEA 3BJSA 3V0TA 3BANA 5CXPA 2DT2A 2Q71A 2XDFA 1UG6A 3HQ1A 4A21A 5I3GA 1NDVA 4YTUA 3FX4A 1O5QA 4H9YA 3PBVA 4IPNB 4GJIA 3POCA 5JBDA 2WBGA 1Y65A 4NZ1A 2FPTA 4G7EA 2I14A 1RBAA 4RZ5A 3PP7A 3M5VA 1H1YA 4Q8WA 5B80A 4MLJA 3UP8A 1FTXA 1T8XA 2O7QA 4JKLA 2W9MA 4Q3MA 2W4XA 2I9EA 4KFPA 3H55A 3ZT6A 1DPMA 2I16A 1YNPA 5F2MA 1RH9A 1EXBA 1V0LA 2D22A 1X38A 3ARXA 4ACYA 1RA5A 1EQCA 1R2RA 3BTNA 3CQHA 2A4AA 2QMJA 4XG1A 1Q8AA 2PE4A 1PE1A 2VELA 1HUVA 2ZRUA 3OOQA 1XX1A 1LL6A 1QTWA 5HDRA 3GNOA 5MF5A 4ZXOA 5LA1A 4O19A 4UR7A 4EWND 1JQXA 5D2YA 4Y96A 1FQ0A 4WHBA 2D2GA 2YA1A 4CVUA 4AF0A 5C7HA 1DHPA 4E5TA 3FSTA 2BVYA 3V5FA 4DO4A 3LXAA 1E6RA 2ZQ0A 2CHOA 3CMGA 2KAUC 4WZHA 2VWSA 3FDGA 4GBUA 2VZTA 3EX1A 2ASHA 1NH6A 1NWUA 4QEHA 2A7PA 4MPKA 1UROA 2ZZ5A 2V3FA 4D72A 4UC5A 4QTGA 4CD7A 1PS9A 1TWIA 3BURA 3QR0A 2NV9A 2QUVA 1JPDX 1HTIA 5JH1A 3IUHA 4GFIA 2HISA 3MANA 2AL2B 4H1ZA 3WDIA 4OFCA 4HA4A 3ZR4A 3WBYA 4B5NA 1B3OA 4JQ4A 1C7TA 5A6TC 1WZLA 3WUBA 5HNRA 5D02A 3SI9A 2Y0FA 4EACA 3IJ6A 3E02A 4UTTA 1A4LA 2GDUA 3IVUA 3VKAA 4OVXA 4H9MA 3UWEA 3UVAA 2V5JA 2DVTA 3NXFA 1XLLA 3ZS4A 4B2DA 4IGSA 4MYAA 2NQLA 4JTGA 3AYRA 3F4DA 4DQWA 3B8DA 4GO8A 3HPZA 5EMLA 4KWWA 4B91A 1UWQA 2E6FA 3WMCA 4IMFA 1YE4A 4GVFA 5F2GA 4AIEA 4E4UA 4A3QA 2B7NA 5A2AA 5REQB 2EBNA 4LNCA 1UWSA 1LORA 3B3DA 3NQBA 1HFBA 4FNTA 1BYDA 4TX9A 1UD3A 1A5KC 3QF0A 4QISA 2BFGA 3PB0A 3WMLA 1REQB 3WFAA 1AQHA 3AXKA 3EKGA 2EG7A 2PTYA 2DQXA 3A47A 4LXFA 2XG9A 1E9IA 2YBTA 2YPIA 4TV6A 3GYCA 2WMIB 1KO0A 1OCNA 3SGUA 4P61A 4NJIA 3FNDA 1XQLA 4QXIA 4OOZA 4JTTA 1W5PA 4M1RA 4HZMA 1RBOB 5F4WA 5C5YA 1DE5A 2TAAA 3DFOA 1B4KA 3V5CA 1RAKA 4HTBA 1V6XA 1BG4A 1MMFA 3WEMA 5CLWA 2OO6A 1SJDA 4W7WA 2DZBA 4ECLA 2G3IA 2LLEA 1A5MC 2GWGA 2Z2AA 1TJ2A 3UG4A 4DJED 3SCVA 3W26A 4K8GA 4W88A 3VTRA 2XIBA 4EPKA 1LF1A 2W5FA 1EB3A 2H3DA 1AZ2A 1VPQA 3ZXWA 5BRBA 3L9CA 4FZIA 5LYRA 3PG8A 2PPGA 4AG0A 1RJQA 4XKYA 1XDLA 3M4HA 1WDQA 1K9TA 4QRNA 1H60A 4IMDA 4TXEA 1PBGA 3NSNA 4ZB5A 4Q8OA 2I56A 1K02A 4KWOA 4H6QA 3GDLA 1WDRA 2BX7A 2QPSA 5A5WA 3A3WA 3W1PA 4JQAA 1H50A 3CIVA 9XIAA 1W5NA 3WQGA 3LB0A 2VZUA 3VZZA 1Q6RA 1WX0A 4AC1X 1P7TB 4Q7IA 3TTSA 2PGWA 3NOYA 3UF9A 5C54A 3NUKA 3H4WA 3EZ4A 4D6GA 3NSMA 1CLKA 1BEUA 1E0XA 5LIKX 3UBPC 1IR1A 3RUBL 4X2RA 1XG4A 2ZA1A 2PLMA 3WQ6A 1E1EA 1WKYA 2AGTA 3C0QA 1E72M 2YZRA 2VR5A 5B7YA 3S6DA 2QUUA 4AXKA 2WHKA 1PWLA 3LLFA 4MNLA 2YBUA 2ZCGA 3TV8A 3VNMA 4PYSA 4LF1A 1IT0A 4GOAA 1B2YA 4DAIA 4O13A 3LPGA 2PDKA 3MC5A 2OZ3A 4G8TA 3H7VA 1XGEA 1TR1A 3OA3A 4BQ2A 3EB2A 1R3RA 3L4XA 4C6QA 1HP4A 4Q4SA 4CU8A 1MVYA 3WH7A 4CU7A 3UQNA 4HA3A 4FXSA 3LZ5A 4D6HA 3GU9A 3WD4A 4LOCA 2FYMA 3W84A 3R0UA 2C16A 3H21A 4PB4A 4BCEA 1GKRA 1XFBA 4EE9A 3ARWA 3T4CA 1QMLA 3WNOA 1Q6FA 4MFDA 4RKAA 3TQVA 4LV9A 2ZZ1A 2D23A 3HB9A 2WZTA 1TPB1 4XZHA 4NT0A 1W9PA 3NGJA 1V7AA 4MUPA 3UJRA 3K5XA 1XI3A 2TPSA 4HHLA 3TQ0A 1UZHA 5HBFA 4X61A 1R6WA 1J5TA 1SO3A 2PI6A 1L6SA 1A4MA 4NY2A 1K9FA 4ROPA 3CAKA 1E9ZB 3GVVA 4GKLA 2QLYA 3W81A 1DIDA 5KZDA 3U3HA 3V35A 3CL8A 4FOUA 4XWUA 3DC0A 3SFKA 3DENA 4QGCA 3CH9A 8CGTA 4H6KA 1JNEA 3EEGA 4G2DA 4NYUA 1QK0A 3NQ6A 3BOFA 3MDUA 3M64A 1M9HA 1OK6A 4C6CA 1US2A 2PRHA 3WH6A 2WKLA 3MSGA 2AL1A 3P14A 3BCDA 2B4GA 4OECA 2WSPA 2V81A 3EX6A 5K9XA 2OCZA 5C71A 1VQTA 2J13A 3IPWA 3WK2A 1XWYA 3BPWA 3K13A 5CC7A 2WV8A 3QSTA 3CNYA 1B5TA 4S3DA 3P62A 3GG1A 1TWZA 4J3VA 4FX8A 4PL1A 1U5JA 3WF1A 2A3LA 3E0VA 4CCDA 3LCGA 4C91A 2R8WA 1XLHA 5BXSA 3AHXA 3S5ZA 2CFFA 2YFOA 4F40A 1XLBA 3HPSA 4OBSA 3PN8A 4QIUA 1Q6QA 4NXSA 4NASA 3SY5A 1TE6A 3KAOA 4H9UA 3FIGA 2XINA 5EKYA 2GVYA 1WYIA 4DRSA 3ZT7A 1UA3A 1NSJA 1E9LA 4WJEA 1BXNA 3IAPA 2V5LA 2Z24A 4AD2A 1GZ1A 2BXVA 3CZ8A 4C6KA 1I0DA 2XJ7A 3WL0A 4JKMA 4CU6A 1Q65A 2GUYA 2RGLA 5H1WA 3TC6A 1A80A 3L12A 4FMVA 1XCWA 3NWRA 4ZBCA 4R33A 3EDKA 2NX9A 3SCSA 3QW4B 1KB3A 1H63A 4LYQA 3WBXA 4JR5A 3MKVA 3TKFA 4RW5A 4TX8A 3BW2A 3L67A 2BODX 1JFXA 3U2OA 2XVLA 3CHCA 2BMBA 4LCQA 4LCSA 1P1MA 1EUNA 3QXBA 3CMFA 5E9AA 3BZJA 3WCZA 4GKTA 1VCGA 5CG0A 2VYOA 2ISDA 4TV5A 5IDIA 3GUGA 1ALDA 4INFA 3PBGA 5M1TA 3BJFA 4AFYA 1L0PA 2ZXAA 4P7LA 1GTHA 2WC3A 1DJYA 3EWXA 3DEQA 1U5HA 3VE9A 3S2LA 1I8JA 4I5RA 3N4FA 3MCMA 4M80A 4GGHA 1UASA 4E3TA 4MSSA 1XD0A 3QPYA 4NNBA 4UNLA 3EA3A 5EA9A 2WBKA 4JQ1A 4W8BA 3K8MA 4IICA 1GQLA 3KOZA 1G5AA 2ATSA 4WDXA 4AYGA 1CI1A 2VENA 3SIMA 2BG5A 4AHOA 1OQFA 1CLXA 4GH3A 1Q3NA 6REQA 3HGJA 4DIAA 3GG0A 2IW0A 4TU1A 4F0LA 1DWJM 1TB3A 1PTDA 2J7BA 2OXNA 5C6MA 1KCKA 2G97A 5C70A 1D8CA 1F07A 1BQCA 4GUJA 4A05A 1XICA 2PB1A 3AICA 3QR1A 4CCCA 2ZTKA 4XISA 4E2BA 3T0BA 3QOMA 2ZRWA 5HMSA 2V8ZA 4CNNA 1PTAA 4IWWA 5J5DA 3PPGA 5IM51 2A7NA 1PUDA 3HQOA 1K7EA 1GONA 4D8AA 3XISA 2VEIA 1IWBA 1DORA 3NQCA 2CZ5A 1O5XA 5AZ1A 5XIAA 2WNZA 4CD4A 4JTHA 3CUIA 4YWIA 4WDUA 3F5LA 4JL2A 1MXDA 1M01A 2RFGA 4UOJA 3PZUA 4XD5A 4TUFA 2PU1A 2PWUA 3UG3A 3ALFA 2NX3A 3FS2A 3RPDA 3CM4A 1EOMA 2OYMA 3QHMA 3DHFA 3VMPA 1Y5XA 1UJPA 4L5ZA 3IV8A 4MDPA 1MYRA 3CHDA 1K9EA 2Z2BA 4WGHA 2WWCA 3R4IA 3S1GA 1BVNP 3W7EA 2EKCA 4PCSA 3SCPA 4JEJA 1FWHC 1ISXA 1J9YA 3ZIZA 1M41A 3OG3A 4A29A 2PP0A 1BG9A 1S2CA 3REQA 1YE6A 1RALA 1JZ5A 4YYFA 4H9VA 1DWHM 3NR0A 1YDOA 1EH9A 4JOMA 3T8QA 1QW8A 5DELA 2WYSA 4MLRA 1HL9A 1W6TA 3ITGA 2WZHA 5A8QA 1ODUA 3CWOX 3W1XA 3GR4A 2J79A 1TZ7A 2CLPA 1G67A 3GY1A 2EO7A 3H2OA 2VD8A 2OLAA 3MVIA 3W24A 1E55A 5I6SA 3BSHA 1PYFA 3W2JA 3BLIA 3ZMRA 3E96A 3G22A 3EA1A 3C3NA 3PZOA 5GNXA 3C52A 3VOFA 4HSHA 3SUVA 2YDQA 3H2FA 3DFHA 1NQKA 1GQKA 1KV8A 1OWQA 2QCNA 4FB7A 1GOQA 3SN0A 5K3VA 3LOTA 3A23A 2V5BA 2G5WA 3PVFA 1BWKA 4JTFA 3B8WA 2QJGA 4ACZB 3NQ2A 1FXPA 6REQB 3C2OA 2YBVA 3IIVA 5CPMA 5LA0A 4HOZA 2VT0A 1O1ZA 2W67A 3ZO9A 4CN1A 1IIGA 1HN1A 4NRRA 3KFTA 4QP0A 1FWBC 4PTVA 4UTIA 2EPNA 2OOFA 1ECQA 4C6PA 4D2JA 3KEHA 2VEPA 1CXEA 1WA3A 2XHYA 2OX4A 2EF9A 2ZRYA 5DN1A 4G9PA 2PRMA 2BGQA 4IGHA 4QEEA 1K8XA 3ENLA 4ZQPA 4F79A 3LSBA 5ABGA 2QZRA 5LSMA 2BHYA 1K3UA 2Z6JA 3UZ5A 2HS8A 2VR4A 3IRSA 3IJQA 3Q45A 2VGGA 1DKWA 1ADOA 3AZTA 2QMKA 3ZM8A 4Z2GA 5BYWA 3SRFA 3FXGA 4Z08A 2Y7FA 3GNPA 3SCUA 1VHNA 3VDBA 1EWDA 1EJTC 3MSRA 5IHSA 4GK8A 3O16A 4QQ3A 3CQKA 3NZ1A 4K7VA 4AWUA 3K1GA 4HA0A 3MUY1 1QR7A 3IK4A 6XIMA 3BOXA 4NZ4A 1EDGA 4FNSA 5FACA 2FKPA 1AW2A 2Z00A 3UFYA 2WW5A 1H49A 3H54A 1H09A 1NVMA 3QKEA 3EMCA 3KTSA 4BA0A 1UBSA 1SZEA 3IJ7A 1ZY9A 2J9YA 2OU4A 5M3WA 4KWUA 1MRAA 1P6BA 3HG3A 3FJLA 4Q4OA 4MZ8A 4GZEA 2FH8A 5I2UA 1GOWA 1BSLA 3C61A 4YLWA 1XLAA 3UCQA 4M82A 4S2BA 3K4DA 1WKDA 1WKFA 5A6SA 1TPEA 2ODOA 1XBVA 4LRTA 4G1NA 4YL2A 1I60A 5AVHA 2NQ9A 3AS3A 2Z1VA 2VM8A 4Z1DA 2INZA 1KM3A 1UUMA 3WLRA 1X1NA 2V38A 3KLLA 2H9AB 1I2NA 4BEUA 1HX0A 2A21A 4GI9A 4XO6A 1FH9A 4OE7A 5C9ZA 1ZBVA 1W9VA 3BO9A 3QC3A 4AW7A 3A4XA 4NHVA 4K1WA 4F66A 2ISSA 3EWUA 4AX6A 4ZTYA 3IAQA 3KOWA 3MMUA 4JL1A 4BK9A 3PUEA 5C7VA 3PS7A 4JIHA 4H8HA 1K8ZA 2GGIA 1E6PA 4BFAA 3OW1A 1AH0A 3CIXA 5LNVA 1S5VA 1TA3B 5EMKA 1PSCA 1BGGA 1J0JA 4QNWA 3W86A 3BCJA 5CG7A 3VC6A 3PULA 1H7XA 1TV7A 4AY8A 5ABTA 1E6NA 4B3LA 4JNZA 4F0HA 2DJLA 3PFMA 3UWVA 3TC3A 4N9BA 3S9YA 3ITLA 4UTKA 4PB3A 1S1RA 3E74A 5GQBA 2P3EA 1PWMA 3SUSA 3B9EA 3U2CA 1KKRA 4J9JA 3THDA 5JUVA 2XH2A 3PZTA 1ZP4A 3ABRA 1HO1A 3LPOA 4QE5A 4S3AA 3VKJA 5HATA 4WY0A 2G3FA 3AHZA 3Q67A 4Q8VA 2W79A 2VFIA 1TREA 3RYSA 5AKQA 2H9AA 5A3HA 3G0XA 3ZSSA 3G1FA 1WPCA 4G6CA 2Z7KA 3RRXA 3O05A 3E2QA 3UESA 1JCMP 4HD5A 1V93A 1E73M 3MO4A 3TN5A 1GT8A 4EP8C 4A3RA 5FL0A 4R88A 4XBSA 1VCVA 3E2SA 4WIWA 1RQHA 2O56A 1V6WA 1XIMA 2PDGA 3SM0A 4FA3A 2ZUVA 1KTBA 2PWVA 4Q8PA 4C7GA 2E28A 3HG2A 1DXIA 4E4PA 3RJXA 3VIIA 2E0PA 3VNKA 5JBEA 1P6WA 3QBUA 4IFKA 5D33A 4UWMA 4Q4RA 2VKZG 4LBUA 3I3DA 1JPKA 1WV2A 4EXQA 2J7CA 2JKEA 1EJVC 3RLHA 4NJKA 3OO2A 4UIOA 4N0RA 5A8GA 3VD5A 1UKOA 4NL1A 3PG9A 4QJ4B 1XF0A 4PUUA 3W23A 3CH0A 1EX1A 4RXFA 1IEIA 4AWEA 2C71A 2X1TA 1XYLA 1J11A 4KT2A 2WVTA 5GJNA 1Q2RA 4ML9A 1YDNA 1D7FA 1TQXA 2INFA 1K77A 4IPJA 1OF8A 4C6EA 1Q2SA 8A3HA 1MI3A 1F4AA 1TA3A 1YIXA 2ZXDA 3W0KA 2QCDB 2V69A 3L66A 1OYCA 4GQQA 1UMYA 1S2VA 3QGKC 5AYYA 3L65A 4UQ9A 2Q8XA 2CLHA 2ZWYA 4GYJA 3K8KA 5CGMA 3EAUA 1CIUA 4GNVA 1H7RA 3EXRA 4O57A 5ECUA 4YHGA 5BOOA 1AH3A 3ELFA 4O8AA 2P0OA 3WDHA 1WB0A 3LNMA 3VA8A 2YB4A 5AN7A 3NQAA 4RPQA 3PNUA 1XBXA 3T0TA 5KSWA 1KW1A 3WF0A 3OBKA 1EXPA 1C92A 1SZNA 2CZEA 4XTIA 3IIOA 1UH3A 3SCNA 3WH9A 1J12A 1GJWA 3MU7A 3HPAA 3KHJA 3N73A 3PWAA 4ZSTA 1JR1A 3F7JA 1EJRC 4M5PA 3ITOA 1UR8A 2PBGA 1SR9A 3MWAA 2H8XA 1RQBA 1XINA 5KZ6A 5GJMA 1KM2A 2DSZA 1F6KA 4D6IA 1JZ4A 4F3HA 2EPHA 4X63A 3OZOA 3V7PA 3OLIA 3SRKA 4CNPA 1RBLA 4P5UA 4PH6A 1BF2A 4AZ6A 1F76A 1JD9A 4JTQA 4F48A 2NV2A 4HPHA 3G1HA 3CPGA 2EPOA 3HJEA 4CNTA 4G5DA 3K4AA 3TLQA 3VXGA 6PTDA 1JI1A 4LT9A 2RGMA 5HINA 1O60A 4XAZA 3VD7A 4EXBA 1P5BA 4HPGA 3D6NA 5LZLA 3FEMA 1AVAA 3LCFA 1JL8A 1ME7A 4ZB0A 1W1A1 3CL6A 3FXYA 3LPFA 4KESA 1GZJA 2P3ZA 5JVLA 1RK5A 1YDYA 2X1IA 4M8UA 5HJLA 5KTLA 4O53A 4HJWA 4MWAD 4HCHA 3SCQA 5DXXA 4LAMA 2PDNA 2CCRA 3LNPA 1KR0A 5A8NA 3HGOA 3QMRA 2VDHA 3VCCA 5CBBA 3CBWA 4PMVA 5LIXX 1IEVA 1UKTA 3HBLA 3AIEA 2DSWA 4HYVA 3QM3A 4BWLA 3U2ZA 3DX5A 1XXXA 3E1F1 3P67A 1W3NA 1R3WA 1ESWA 2VNCA 3CQ0A 1DBTA 1CBGA 5SWUA 3AYVA 4FX6M 2VGBA 1F9CA 3RM8A 3AISA 3VOCA 1UR3M 4Y90A 3SGGA 1TSIA 1O68A 2PAJA 4KS0A 3ARUA 1ZHAA 4RV3A 5DT7A 3WQ5A 4NX0A 4GUIA 1KFJA 1VEPA 1EPVA 2Z26A 4N9EA 1NFBA 2PZ0A 2PUZA 1X6UA 2IQTA 1EBHA 1Z7AA 2VCBA 3AMLA 1ENUA 1U1HA 3WNKA 3E5BA 4KEUA 3WNMA 1KFLA 2D24A 3W7MA 4IJBA 3CB3A 2OFJA 1FHDA 3BV7A 4Q4PA 3FAWA 1VBRA 3M0LA 1BYAA 2JKPA 3W1QA 1VGAA 4WKAA 3UJ2A 3N11A 4WD0A 1FUYA 1RUSA 3WQOA 1FWIC 2WCAA 4QNEA 1HO4A 1RLCL 1B9ZA 2ZE0A 3EWZA 4OBTA 1W3TA 1IT8A 4EAMA 1F3TA 1GOKA 2OZ0A 3TAOA 1SPQA 3YPIA 3OQEA 3DZ1A 3KBVA 3U7BA 4F2UA 2DSVA 4L7ZA 1WQ5A 2HQAA 4AD1A 3DG6A 2YKKA 4ZENA 2HZGA 1PIGA 3I3BA 4PRRA 3FY1A 4PMUA 4C6BA 1B3ZA 2HROA 3H2NA 3KTCA 4KCVA 8XIAA 3TYDA 3OG2A 4JFTA 3M0KA 4LUSA 3USBA 5F7UA 1AJZA 3TW6A 5A2BA 2BY1A 4IG2A 3B03A 3TSMA 3URAA 4WF7A 3DFNA 3E3HA 2WJFA 1TPDA 1D3CA 4H4IA 1A5LC 2NQHA 1A5OC 2HPMA 4CCZA 3ITYA 4PB5A 1R7AA 1FDYA 3VOGA 3KHDA 1VFOA 4GIYA 4JFVA 2OB3A 3LU2A 1JYVA 1PZ3A 1ML1A 3DFYA 3L4UA 3KP0A 2WOQA 3KDOA 1MW3A 4I7UA 3SY8A 4DZAA 1DQXA 1WXJA 1OCJA 2DV0A 2PRLA 4KMQA 3BLKA 2CXGA 3TONA 2PODA 4EF9A 2ZUMA 5PTDA 1E0VA 1M7PA 1GKQA 4HN8A 2GSJA 2BOFX 1V7YA 1N82A 2HVMA 2X0HA 7ODCA 1BD0A 3AYSA 3MJYA 2CXEA 1EPXA 3MHFA 2CC0A 2GOUA 2RDTA 4XZ9A 2J27A 3M7SA 4U3AA 3UR7A 3EWYA 1GOXA 1RA0A 1V79A 1W9DM 2J8FA 3JRKA 2J4GA 3GUWA 3GNXA 4WY0B 3DG7A 2XFFA 3AHYA 4J2PA 3OZYA 2V9DA 3L5LA 1XG3A 3SUTA 2OQLA 3KOXA 5HOSA 3NPVA 1M68A 1TQJA 1GPFA 3ZWTA 1ISWA 3UERA 4CKQA 2OEMA 1S1PA 3M1ZA 3R89A 5IHRA 5D38A 4FLOA 3G5EA 5D9MA 4IIGA 4W93A 1WO2A 4M81A 3FJNA 1PKYA 3VNZA 1EOKA 3H2EA 1EZWA 3S5SA 2CU0A 3ABOA 1H11A 3T2PA 1VD6A 4KW2A 4QG8A 4IX0A 5AHLA 2BGNE 4TMBA 4GUFA 1EJSC 1R9YA 2J75A 3T2OA 2RUSA 3HTWA 4DJDD 3C86A 3OVPA 1T8QA 4WXYA 3WN6A 2VVNA 3GIPA 2JF6A 2XVGA 1SW3A 4JICA 3S5YA 5AYIA 3FFSA 1RXOB 2ICSA 4I6VA 3DBNA 4IIBA 3UPWA 3L23A 3HPFA 4WLCA 1TG7A 1V6VA 3KX6A 3PAJA 4JCMA 5E5CA 3W28A 2HK1A 3S6TA 4AC7C 1V02E 2ZUWA 2WVUA 3PR2A 3CV2A 4G7EB 3KS5A 2F6UA 5IBXA 2DSUA 4PZVA 5F2IA 1ITXA 3U57A 1TJ0A 2GK1A 1HXJA 1ZBWA 1EHAA 3AROA 4NJGA 3VNIA 2UY4A 4MB5A 4DJFC 2V30A 3S2JA 3VIJA 3ARVA 5FAGA 2OYKA 5I06A 4Q8TA 1ZP3A 2NT1A 1D7KA 4BKNA 3HA1A 3DCPA 1GUVA 4DF0A 1GVSA 4V2XA 2A7RA 4UQEA 4IQEA 1WXZA 4M1BA 4TVCA 3KRZA 2PP1A 1JUEA 3MI6A 3LCIA 5CQ1A 4KKXA 3N6QA 5LNSA 5DY2A 3NPWA 2OGJA 4YPJA 2XIOA 1XLCA 3PNZA 3MV11 2NUYA 1L6GA 3U5YA 1MEHA 1AZ1A 3BH4A 4LY8A 1RLDA 2POTA 1EJXC 3AU2A 3QMTA 3OZMA 4YXGA 4F0RA 3LHTA 3NO1A 4R5EA 2WMJA 3SSZA 1S5WA 2FTYA 1BPLB 2IQDA 5JQ9A 4KGJA 1KWKA 4N9CA 3WQWA 3HM7A 3TR2A 1ITUA 1OFPA 3DYPA 1E0TA 2E09A 2BNJA 3R25A 2QCEA 1GNXA 3BLFA 2WMGA 1DWAM 3CASA 4S1FA 1LROA 4BWLC 4E2OA 4G7FA 2C18A 4HNTA 3VX0A 2XVKA 4D6CA 4HJFA 3FLUA 3RCNA 3VD4A 1ZFJA 2Y5EA 1C91A 4YJ5A 1X98A 1VBJA 2FZDA 1WNOA 2NLIA 3CMJA 3WDPP 1TRDA 1GGOA 4NAFB 1Q6GA 3W7JA 1VR6A 1TTPA 4OQVA 1TE1A 2FJKA 4K38A 3W6MA 3MBDA 1TFVA 4EANA 1G1YA 4DJEA 4ATLA 1ECEA 3BLOA 3AU6A 4L9YA 1DL3A 3TLLA 4DPPA 2OJPA 1XC4A 1XH1A 3JUGA 4FEZA 4NG3A 1ZENA 3N13A 3MWCA 4YMZA 4EF8A 4DJDC 2G4JA 1EIXA 3LYEA 4B9YA 1UOZA 5HQMA 4UNKA 1QBAA 4HKPA 1VJIA 4NNAA 3CZKA 4ZFMA 2NZLA 2YCJA 3WIJA 3W7QA 2FLIA 3LPPA 1QNRA 2ADAA 2C7FA 1KA9F 3CZEA 2E3ZA 3UGRA 1NFGA 4C1NA 1IV8A 4WR3A 4DWDA 1R3TA 1Z42A 4K8EA 2PCEA 1VF8A 4XUYA 4DO6A 3GB6A 3MP4A 3MB9A 3C2VA 2V0TA 2QDHA 2J24A 5REQA 1C8XA 3SRDA 4B5VA 2DUXA 4KRUA 2XIJA 1ONRA 1JDEA 3NVTA 4I9MA 3HFTA 3M16A 2G96A 1MFVA 2PC4A 1I6NA 5FD0A 3GTIA 4PFHA 4LAZA 1KFBA 4UNIA 3A6OA 1H7PA 4DBEA 4E8CA 1I2OA 1PDZA 5FF4A 4UTLA 3ICJA 4RDZA 1Y8BA 3UA4A 4EXAA 5DO8A 3FVMA 3BSGA 4YTRA 3CYVA 3R79A 1NEYA 5AZ0A 3ZVIA 5AOUA 4JTLA 4MIMA 2NW0A 1TMQA 3UPMA 4NKCA 5A1AA 2ZX9A 3PC0A 3LD5A 3FK4A 3ZJ8A 3HZ3A 4DPQA 3ITCA 3G1RA 4Q6JA 3O6CA 2ZTJA 2CZDA 2HVOA 1TJPA 1LRNA 3ZLFA 2QV4A 4F0KA 4HPXA 1P4CA 3UJEA 1C8YA 1YRRA 3BK0A 3VK5A 1X97A 4H04A 2QVNA 1BAGA 4LAUA 3WH5A 4TVDA 4NZCA 2JEQA 1XUUA 3VOJA 2X41A 3DU0A 2VI0A 1J0ZA 5GPRA 2V6AA 4PMDA 4W87A 1P1XA 3N6HA 2Z1KA 5HUOA 4ZOAA 5AB3A 2DIEA 3N14A 3W7RA 1KBKA 4A2SA 1DJZA 1SYTA 1VBUA 1HL2A 1XV8A 4CD8A 4JQ3A 3BV4A 3M47A 4R9OA 5DBUA 1LG1A 1MNSA 4S3JA 1YNQA 5BW6A 4GYPC 4JIEA 1UWAA 5G2WA 3LCLA 5DXYA 3OIHA 1B3WA 5I3FA 1DJHA 3J7HA 1LOSA 4NRSA 2VX7A 4RV8A 1T6MA 1XYAA 2BGSA 3CV7A 1UYQA 2VD9A 3CLWA 3JVAA 4HT3A 1NU5A 2ZUSA 4UQBA 4I8YA 2V82A 4LV4A 2F84A 3TYZA 2NV1A 2CLEA 3EWBX 3KZPA 1TTJA 4PMXA 3VNYA 1MW1A 4LSBA 3IGHX 5FL1A 3WEZA 1BGAA 2E4TA 4UMBA 4N7QA 4IJRA 7REQA 3AMDA 4ADUA 1ODZA 3VKKA 4I5XA 1HP5A 1X1ZA 2SFPA 3UY7A 2ATMA 4V15A 3W7HA 1Q13A 2OOGA 2ISFA 3I4KA 1ZTVA 3PBUA 1FBAA 2C0HA 5CZKA 4ERGA 1KBJA 3AS2A 4YTTA 3V0SA 1ISZA 2I7GA 1FWDC 4KGLA 1VC4A 1SO6A 4O8RA 1HW6A 4W4QA 5HJXA 3GRIA 1Y5WA 3GYEA 4IH3A 2WSQA 2ZVIA 5CSRA 4DWSD 2NT0A 1P6CA 4DB7A 1JDDA 4O4WA 4GO9A 5BZAA 5EMYA 2B31A 3V5OA 3ARRA 3F5JA 3VI2A 2R1NA 4W86A 5T9CE 4Q8MA 1X96A 5G1YA 3GH4A 3LQGA 3WEOA 1J01A 4V28A 1J2WA 2Y7GA 3L2LA 4S3FA 2C91A 3KM8A 1NWTA 1XDJA 2ZYFA 2FZ9A 1RVKA 4FHAA 2YL9A 1NELA 1GK8A 2V68A 2X2YA 4MY9A 3WQ4A 1XIBA 3PB2A 2G3NA 2PC8A 5D8ZA 1WUEA 5BU6A 1FHVA 4B5UA 2F61A 1EP3A 2DZUA 5KEZA 4Q4QA 3U0HA 3GIYA 1FVPA 3CAQA 3GVQA 3SCTA 4MJ4A 4IP5A 5CJMA 1S5MA 3ZQ9A 1TPFA 2EPLX 1Z44A 2CZVA 1MEIA 4IP7A 3FHQA 3R0DA 3MA8A 5K4ZA 2ABAA 2AKZA 2IPJA 4C6JA 4DBDA 3QKZA 3PFRA 1S3HA 3ABZA 3G3MA 1ME9A 1YKWA 2VX6A 3SEPA 3BAKA 4GQ0A 3W83A 5CAKA 1B30A 3BARA 5CZJA 2BVDA 4AD0A 1R0MA 3GVWA 2P8CA 1DWGM 1HT6A 3WJWA 2WSKA 3AHTA 4NSBA 4W89A 1T40A 1V3KA 4DNHA 5LHEA 4AZGA 1PIIA 3PZQA 2WQPA 3T2QA 3VFCA 1JG9A 4ATWA 1VH7A