3QQ1A

Crystal structure of a double mutant [a58p, del(n59)] of 3-deoxy-d-manno-octulosonate 8-phosphate synthase (kdo8ps) from neisseria meningitidis
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
276
structure length
249
Chain Sequence
MDIKINDITLGNNSPFVLFGGINVLESLDSTLQTCAHYVEVTRKLGIPYIFKASFDKPRSSIHSYRGVGLEEGLKIFEKVKAEFGIPVITDVHEPHQCQPVAEVCDVIQLPAFLARQTDLVVAMAKTGNVVNIKKPQFLSPSQMKNIVEKFHEAGNGKLILCERGSSFGYDNLVVDMLGFGVMKQTCGNLPVIFDVTHSLQGRRAQALDLALAGMATRLAGLFLELHLLEDFLIRIKALDDLIKSQPIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Targeting the role of a key conserved motif for substrate selection and catalysis by 3-deoxy-D-manno-octulosonate 8-phosphate synthase
pubmed doi rcsb
source organism Neisseria meningitidis
molecule tags Transferase
molecule keywords 2-dehydro-3-deoxyphosphooctonate aldolase
total genus 79
structure length 249
sequence length 276
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.55: 3-deoxy-8-phosphooctulonate synthase.
pdb deposition date 2011-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00793 DAHP_synth_1 DAHP synthetase I family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3qq1A00
3VE9A 3T7VA 1SZGA 3W2NA 3PG8A 4NJIA 2VOMA 4IX2A 1M7PA 4UTMA 5D2XA 4UMBA 2ZZ5A 5AYZA 1YADA 4DO4A 1H61A 3QF0A 5MHBA 1JUKA 3DENA 3P8JA 1B3OA 4DF1A 2CZEA 4Z1DA 3NQMA 2DP3A 1K7XA 5F4WA 4UMCA 4BI6A 3M41A 1KFJA 3L0KA 1DBTA 3BW3A 5CSRA 2FFCA 3INPA 1GYLA 2CLFA 5H91A 4ZQCA 4WY0F 3OVRA 4RV8A 5C55A 3C3NA 4N4PA 1IXQA 3C2VA 5U4NA 1I2RA 3BLFA 2YCEA 2A5HA 4GUIA 1FQ0A 4UTUA 4JTJA 2QCCA 3EKZA 3LCFA 3MO7A 3ATZA 2Y61A 3T78A 2FIQA 4O1DA 3PG9A 2C16A 3TSDA 1B9BA 3N3MA 2OT0A 3SJ3A 1PVNA 4PEKA 1TPVA 1X7FA 1F05A 1R47A 4U4MA 3W7RA 5BRBA 2R94A 2JK2A 4WOZA 5C2XA 1FWWA 3BG5A 1JULA 4E2DA 4AH7A 3TMLA 1OYBA 4NX0A 1XBZA 3V75A 4RLIA 1W5OA 4ZQOA 2G96A 3SZ8A 2ZRUA 3KRZA 2C19A 1ICPA 4NQ1A 1W5MA 4A3UA 5AHLA 2HTMA 3GYEA 1O95A 4M7SA 1XC4A 3AO0A 4O4WA 3NZRA 3OBKA 1QPOA 3QFEA 3GNNA 3H55A 3SW6A 3W7CA 3GXNA 1H7PA 5LNSA 1E51A 2WSRA 4NZFA 3QW4B 4HSOA 1OK6A 3DFSA 2F7FA 3D0CA 4KFOA 2WKJA 3E02A 4GFSA 1OX5A 3NVTA 4PCFA 5DBUA 2TRSA 3LX9A 3BVJA 3NDOA 1UUMA 3A9IA 2QR6A 2A7PA 4DBEA 1BWKA 1QCWA 4TO8A 1NFBA 4NNAA 3FFSA 1JCLA 2ZTKA 3QC3A 1VS1A 3W07A 4QNEA 3U8GA 4DF0A 3OG3A 2VEMA 4JY8A 1ZAIA 1ZHAA 4Z1CA 3LI1A 3NGJA 3TXVA 3S5ZA 4LW7A 4GUFA 5G2IA 2YFNA 1AW2A 5FEZA 2CLMA 3L2IA 4M19A 1MSSA 1ZCOA 3KRUA 2ZZ6A 1VCVA 4CCCA 1PHWA 1WBHA 2ZRYA 3M44A 2VELA 3C0JA 4AHQA 3TR2A 4W9TA 1W8SA 2Y62A 1OABA 3MHUA 1R46A 5EPDA 1JUEA 4Y96A 1S5WA 1FUYA 1JCJA 4HPXA 5D09A 3PR2A 5FF7A 1C29A 3U2OA 5AB3A 2C1HA 2IQTA 3VCRA 4FNPA 2RDWA 3TMQA 1KM1A 1OX4A 2GVGA 2QAFA 3BGJA 3M9YA 1SFLA 1ZENA 2RH9A 4NXKA 2WO5A 5LSMA 1SZEA 1TTIA 4PFMA 4Z1AA 2J24A 3SGUA 2VEIA 2JKPA 4JTEA 5AHEA 1FCQA 1WOBA 3L9CA 2E5CA 1OFOA 5D30A 1VCGA 3P60A 1HO1A 2A6NA 3N34A 5CZJA 1XKYA 3WFAA 4CLMA 3RLUA 3O6DA 1FCBA 2XN1A 2C18A 3MBFA 2VXNA 4JTTA 3NQDA 5HQEA 1UUOA 5K9XA 3B03A 1GYNA 1QDSA 3PULA 5D33A 3QZEA 1L6SA 3CIXA 3CM4A 3W3OA 3BARA 5G1TA 4WX2A 3DI0A 5U7SA 2V8ZA 2VEKA 3MHGA 4HNNA 1QO2A 2X1RA 2E1DA 1OFQA 4A2SA 1ME9A 4O1BA 2ZZ1A 3LRMA 2YGYA 1KM0A 3TIMA 3P5ZA 3GAKA 3ELFA 3TROA 3SR7A 1TREA 1LYXA 4N02A 2ZA3A 1JCNA 4IMCA 4JNMA 4POCA 4N6FA 2KZHA 1S5TA 2B7OA 1IXOA 4IJBA 3W84A 1YPIA 3L67A 3TAOA 1TJPA 4JTGA 4N6EA 2GVLA 4O4VA 4UXDA 1DJQA 3GKAA 4BF9A 1WDWA 3O6YX 5I3IA 3L5LA 4RXGA 2ZA1A 3CWNA 4UNKA 3M0ZA 5KZEA 1A50A 3PBUA 3NL3A 4LNYA 4LOCA 2CWNA 1P0NA 4R53A 5DCDA 4WY0A 1KFKA 5K9DA 2B7NA 3S9YA 4BI5A 5KZDA 3P7YA 5K9CA 4A29A 5LGZA 3STCA 2Q3OA 1DV7A 3TK7A 2QKFA 2ZZ3A 4UFIA 4HSNA 3NM1A 1D3GA 2NUYA 5AC8A 2C14A 4WY0B 5CGQA 4JXCA 3LCWA 4ZZ9A 2YYUA 5T26A 1KLYA 3USBA 1KA9F 3L68A 2C15A 2QCMA 3HIJA 1GVFA 4AEOA 1I2PA 5HUOA 4IXHA 4B5NA 4BK9A 4LWWA 3E0IA 2GPTA 1ALDA 1JVNA 3NZ1A 3W7LA 2CZ5A 3CIWA 1X1ZA 4KWWA 2BTMA 4AWUA 4MYAA 1SZNA 1TPEA 4RZ6A 2P10A 3R13A 1FWRA 5CPNA 2O7SA 3P8IA 4GUGA 2B7QA 3RNDA 3UY7A 4PH6A 4O57A 4LS1A 3TE9A 1A5SA 1F2JA 3CB8A 1F74A 3NL2A 1TRDA 4O0KA 1MXSA 1X6UA 4YCPA 2JKEA 3W74A 4WOQA 3UXDA 4ALDA 1PL9A 3S42A 2CLIA 2FB2A 4Z1BA 2PURA 5DXXA 2W6RA 4WJEA 4UR7A 4H3DA 3IRDA 5G5IA 2FTPA 1SPQA 3CQ0A 5G2WA 3RFAA 3W7EA 2Z1BA 1KTNA 4WQ6A 2ZBTA 3W83A 1BTMA 3TCEA 1O60A 1OYCA 4CQ9A 4FNSA 1AL7A 1EP3A 3N9RA 1G4EA 1XCFA 1TPC1 3HPZA 5EA9A 4ADUA 3MW7A 5HWNA 2CLKA 3O1NA 2I9EA 2ZRZA 3DAQA 3NQ6A 3DBPA 4YCOA 2PRLA 4N9DA 3R2GA 3NNTA 1OJXA 4YLWA 4FB7A 4L4MA 4NU7A 3S1VA 1G69A 1IGSA 3DKJA 4R34A 3HPXA 3LI0A 5L9FA 1EPXA 1K03A 5KINA 1WA3A 3NXFA 1GWJA 4IUOA 1UB3A 1QPRA 4JTKA 2RKXA 2WOQA 2TMDA 3V1PA 4MOZA 2ALDA 3DFOA 5LNRA 4PTNA 2DZWA 4O28A 4O13A 3EX2A 4UFKA 3M47A 5D37A 3NG3A 1Z41A 3FEMA 5I3GA 1CW2A 1SW3A 1LROA 5D32A 1OHLA 4O11A 4X22A 1OF6A 4JTIA 3GDMA 3O06A 2VC6A 4PL2A 3BG3A 4Z08A 4XTDA 3T55A 3HGRA 1ZALA 4MVAA 4A22A 1ZFJA 3N9SA 1LZOA 4MPQA 5CPMA 3QPZA 4FX6M 3QM3A 1MEIA 2DZXA 1H1ZA 1LM1A 3NEVA 4O1AA 1XI3A 4OWGA 3ABOA 3LHUA 1SSDA 3K30A 1IXNA 3EX1A 2RFGA 3GDLA 3L5MA 5FF2A 4TX9A 1Q6QA 3PAJA 2ISVA 5DLCA 4DQWA 4R33A 2Z6IA 1MZHA 2NX3A 4Q32A 4ZQPA 4YWIA 4J9JA 3EB2A 1LBFA 3N2XA 1L6WA 4IMGA 1JRBA 3QPYA 4JTUA 1YDVA 3ZWTA 1VHNA 5IBXC 4MY1A 4BWLC 2D73A 4QJ1A 1ME8A 2V5LA 2J27A 4AHOA 3MP4A 1KV8A 1W3IA 1LBMA 3HBLA 1B4KA 1W54A 3M6YA 2WNZA 3CLMA 5G4EA 1EA0A 3PS7A 4XTIA 5AYYA 1VPXA 4D2JA 4Y9AA 2JBMA 4WZHA 3TUUA 2Z6JA 4MJMA 3UXAA 2NXGA 3W7IA 2BWGA 3BGGA 4LS0A 1WQ5A 3P81A 2QUUA 1OF8A 1GVSA 2R91A 3GX9A 2ZRXA 4JX5A 5TBOA 3HG2A 3MWAA 4K7YA 2EAWA 5C6MA 2CZDA 3NQAA 3HJZA 4LT9A 3W87A 2CU0A 4N4QA 4UMAA 1L2UA 5I3KA 1B57A 3W1UA 1J5TA 3ATYA 1LRQA 3QQ0A 2EPHA 3FA5A 3G1HA 2AGKA 3LOTA 2NWSA 1SU5A 3NR0A 3UZJA 4WD0A 4KFNA 4P61A 3TH6A 3UD6A 5F4SA 5FF0A 1GT8A 4NJKA 1DOSA 4CQ8A 5L6UA 2VFHA 3C2FA 4IQLA 2Z2UA 4FIRA 1JUBA 1QNVA 5G2HA 3KVLA 1TJRA 3BPWA 3W7GA 1TPWA 1TRIA 3GZ3A 3W7OA 3M5VA 3UWQA 2GJNA 2ZDRA 3CU2A 5BMXA 1NAL1 2QCFA 2VFFA 4DO5A 3EWBX 4O53A 2OCZA 5IM51 1R2RA 2Y6ZA 1SR9A 3HPSA 2QJGA 1G67A 2YYTA 1H62A 2A4AA 1YTKA 4ZQMA 2CLOA 3IIXA 2VFGA 3STEA 4FEZA 1PCKA 2H90A 1RQBA 6ALDA 1RQHA 5J5DA 1XXXA 1GG1A 1I4NA 4ORIA 3KVJA 1W5NA 4A2RA 1O94A 3BW4A 1FDYA 1BKSA 3DFTA 1LOQA 3L65A 4HKPA 3KRSA 2H3BA 2PRMA 2Q3RA 3G0XA 3PB2A 1UBSA 1HTIA 2EKCA 2J9YA 4X3ZA 1LLWA 5HR6A 4GE8A 3M5YA 5D38A 2X1UA 1VLWA 4WUIA 3QMRA 1Q45A 1ICSA 3W1AA 3GLCA 1LCOA 5HULA 3FYPA 4IGHA 3DZ1A 2R8WA 3PVFA 4GNJA 3O8AA 5CPLA 5F4XA 3N2MA 3TSBA 3LCIA 1H60A 4GC4A 3CC1A 1TCDA 2E68A 1SW7A 3SGZA 1L6YA 1XFBA 3IGUA 4EVZA 1ML1A 4DEFA 4PODA 4MJZA 4FF7A 1VH7A 3W2KA 5A8GA 4O19A 3ZS4A 4JY9A 3VFLA 5BNKA 3O6CA 5F1UA 1WBJA 4K36A 3B04A 3Q94A 4DPPA 5TIMA 4N9CA 2X1TA 4MFDA 2V2DA 1AG1O 3LLFA 3S1WA 1PS9A 4RZ5A 3EWUA 1W0MA 1AMKA 3NL5A 2FJKA 1TPFA 3MBDA 3H53A 2Q8ZA 4HNVA 2WJZA 4AF0B 3THQA 2X2GA 3C8FA 2ABBA 1WXJA 1J2WA 3DKLA 4GUHA 4Z0SA 4UTTA 1VZWA 2GQ9A 1PHQA 4QAIA 5LNUA 1VRDA 3Q58A 3P62A 1R2SA 4UFHA 4NJHA 1G7VA 1TTJA 2Q8LA 3NAVA 5FF3A 3CEPA 4ZL1A 3IIVA 1W5PA 3W76A 4ADSA 4BI7A 5CSSA 3W1RA 2PCQA 1T0OA 3N19B 3LHZA 1TPH1 1KFEA 3LCHA 3NPVA 3TC7A 4UUIA 3W1XA 3VKJA 3M43A 4PA8A 4JIQA 4K38A 2V2CA 3GIYA 3GDTA 3EEGA 1QWGA 1KW1A 3HO8A 2YDAA 4JYFA 1PE1A 2DJLA 3H54A 3LDVA 1OYAA 3G8EA 4FO4A 1QMLA 3W73A 1KM6A 4NX5A 4O18A 1H5YA 2DZTA 1CX9A 3NYZA 3P82A 3NQVA 2A7RA 3W75A 1HG3A 3A5VA 4WXZA 4LV4A 1W5QA 3UPWA 3O63A 3PF3A 2J6XA 1TMHA 2NX1A 1EP2A 4JIPA 1O5XA 3EKLA 4LU0A 3W7NA 1YPFA 5LNWA 4UCGA 2V9DA 3SECA 4FX7A 3GXTA 3W7DA 1XBXA 2FB3A 4I9AA 2QEZA 4HNTA 3EWXA 2HSAA 1EWEA 1TV5A 2DORA 2I14A 3ZR4A 4BWLA 3B0UX 5HNRA 3HB9A 5A5WA 4CNOA 1UJPA 2E6DA 2FPYA 4M6VA 2E6YA 2YFOA 1MEHA 2CLHA 3E12A 5D2WA 3UWVA 2WSQA 2ZTJA 3BW2A 3DFNA 4LVDA 4TMCA 2A1YA 1P0KA 3KOFA 1TV8A 3TJLA 3S0CA 1HO4A 3WJZA 3M1ZA 3MUXA 4CCDA 1R2TA 2QJHA 3DH7A 1YLVA 4MY9A 2Y63A 3NL6A 3C2RA 3JS3A 1P4CA 4EOUA 1PV8A 3MI6A 1W3TA 2WNQA 1BWLA 1TPDA 1H7NA 1K02A 1KTCA 5C54A 1SW0A 2XN2A 4MZ1A 1BEUA 3JR2A 4IMEA 3I7RA 3TFXA 1QPNA 2QDGA 3L0NA 5F2IA 3EWYA 4IMDA 4MLRA 4JDBA 1VJIA 2E77A 5AHIA 4O50A 4UFMA 2EGZA 4LC6A 2Y70A 3U6WA 2YXGA 2X16A 1FWTA 2VENA 3I7QA 4AVFA 4OE7A 2EF9A 3DFPA 2O7QA 7TIMA 5KITA 4UR8A 3HQ1A 2JGYA 4Y8FA 3B0PA 4IOTA 3T40A 1B4EA 3G18A 4MUZA 1KFBA 3NQ2A 4NJJA 1G4PA 2RDTA 5D05A 3RK8A 2VKZG 1ME7A 1Q6LA 3GNDA 4LTSA 1FX6A 1P1XA 1KM2A 2WSYA 3VI2A 1H51A 3HG3A 3G1DA 4OHQA 3MP5A 1JR1A 1TV7A 3BO9A 4QITA 2GQ8A 1OFBA 1VQTA 2V82A 2OZ0A 3LB0A 1XDLA 3UNDA 3HGSA 4Z0JA 4R7JA 4K8EA 4QNWA 1GVRA 3I65A 3W72A 2Y89A 1UCWA 4FXSA 5DBTA 1EUNA 4HT3A 1KBIA 4N2YA 1NVMA 3W7MA 2E6AA 5I3JA 3S5YA 1H1YA 3LHYA 1ZAJA 4S2CA 3WK2A 4GXMA 1H50A 4K6AA 3HF3A 1WX0A 1GQNA 2NX9A 1Z48A 4JEQA 3W23A 2ZFAA 3N73A 2JGQA 1H7XA 3FS2A 1YTEA 2H8ZA 2ATMA 1RPXA 2E09A 4UTIA 1O4UA 2ATSA 3W7HA 5K3VA 5CPOA 5D02A 1CI1A 1VLIA 2E5BA 3CT7A 3HOJA 4FIQA 1QOQA 1JRCA 2G97A 1SSGA 4QM1A 5FEPA 3A5FA 1EB3A 1JCYA 1VYPX 3LTPA 2C3ZA 4FX8A 3RU6A 1AW5A 1LP6A 4IWWA 3O15A 3WK0A 5AHFA 3WK1A 3P67A 4AXKA 1O5KA 3VE7A 4LV9A 1TQXA 3MHFA 1I45A 4UTKA 3OEXA 3YPIA 3WJSA 1IXPA 4JGDA 4IPJA 4NJGA 4OU1A 4XBSA 4XQ6A 2Y85A 3HMJG 4Y90A 5HUPA 2GVJA 4UIOA 2R14A 3NQCA 1FCVA 2QUVA 4UTHA 4LC8A 1XUZA 3CTLA 4LVBA 4MZ8A 3EWWA 3PUEA 1G4TA 4LVAA 1SQ7A 3TNOA 1QPQA 4M5PA 5DN1A 3Q37A 1H63A 3UWYA 3LCLA 4JTLA 3S5OA 5I3HA 1JJKA 2HMCA 1YXDA 3KFTA 4MKNA 2CZFA 3KXQA 3TC6A 4UFJA 2B4GA 2HS8A 4GWEA 2W0UA 3G24A 3G1SA 4JD4A 1XUUA 1T99A 3P84A 4XUGA 1KM4A 4AF0A 2P1FA 1H7WA 3O16A 1TQJA 3PM6A 3QMTA 3P5YA 4S1FA 3GKFA 3R89A 1DL3A 1I2NA 1I8JA 1KLZA 3HG4A 1OFRA 4JYDA 1PIIA 4O17A 1AL8A 3KAOA 1FWNA 3DXIA 3LHVA 3Q2DA 3W71A 2QCEA 3CHVA 3R12A 2HS6A 2V0TA 1EP1A 3RF9A 1DORA 4LRSA 2BX7A 3EX6A 4ICNA 4O54A 3ZFHA 3NQFA 1TTQA 4M6PA 4EF8A 5LZLA 3I68A 3F4WA 3P61A 4E2BA 2H8XA 3UYCA 2TPSA 2QAPA 2C13A 3BLIA 5DELA 3SSJA 3FKKA 3W1PA 3GAYA 3UPBA 3BLEA 3CWOX 3GR8A 1QAPA 4HIBA 4RXFA 2CFFA 4IXXA 3KHJA 2A6LA 4UTJA 3PBVA 1AK5A 4K39A 3P74A 3NQEA 1X1OA 5D04C 1LRTA 1J4EA 2V5BA 4S2BA 1TPB1 3EXTA 1VHCA 3HGOA 2GOUA 4JTSA 3CPRA 3F4NA 4O10A 3T44A 3QMSA 3O07A 4L4LA 4YL2A 1Q6OA 3C52A 2PC4A 2VFEA 1RV8A 4JN6A 2FPVA 3A24A 4X2RA 2JKAA 3A22A 1P5BA 2TSYA 4RKAA 2E5DA 3NQ7A 3L66A 3SY5A 5LKYA 2P0OA 5DCEA 3N14A 2QF7A 2DZUA 1LDCA 2WNNA 4E0CA 1U83A 1HFBA 5DXYA 2FQIA 3W2MA 4GBUA 1MO0A 1VC4A 4K7VA 3RMJA 3PB0A 1S3HA 4H4IA 4A21A 3EWZA 3C4UA 3PBYA 1Q3NA 3PUDA 1VYRA 1VYSX 1LOSA 1OFEA 2NLIA 3FOKA 1T96A 3MJYA 1SUXA 1WV2A 1C8VA 2B0MA 4CNNA 1Z44A 3NM3A 4JICA 4AWTA 3A23A 2AAMA 3QQ1A 4LVFA 5HJLA 4AHPA 4FNUA 3DHFA 2ZYFA 3W7KA 4WXYA 3DGRA 5SWUA 3LRKA 2ISWA 1F73A 3GK0A 3NA8A 3TKFA 1EWDA 1TTPA 2DZSA 3G22A 4Y6GA 3LCGA 2DJXA 2QDHA 3B8DA 3CEUA 1NEYA 3BV4A 1XM3A 1LTDA 4MIMA 1K8ZA 3W2JA 4KKXA 2J9XA 1A5AA 4TMBA 3TDFA 3LV6A 5EL1A 3S1UA 3S5NA 2FDSA 4UTWC 1YXYA 1KFCA 1Y0EA 1ZAHA 3PBWA 4M7TA 3LHWA 5D2YA 5CG7A 4LY8A 4AWSA 3TV8A 3IGSA 4BR1A 4AAJA 4MZYA 3G8RA 4ZVJA 3C56A 3S6DA 1IIHA 3NQGA 2NXHA 4I7UA 3THAA 3LERA 1ICQA 3LXAA 5K4ZA 4I7WA 3FKRA 1T8XA 1V7YA 3ANYA 2YR1A 4JX6A 1R30A 2ZZ4A 5DY2A 4MY8A 4ZMGA 3STFA 5AN7A 4MLJA 1UASA 3TQVA 1LORA 2V2HA 1W56A 2NV1A 4KFPA 1XBVA 4TR9A 1GVQA 3W22A 3W1QA 4M6QA 4TIMA 4UFLA 3DI1A 3M16A 1RZMA 1M7OA 1IF2A 1EIXA 5FEWA 1TPUA 1VGAA 2E6FA 1OX4B 1JQXA 5K4XA 1QOPA 3GVGA 1TIMA 1L9WA 5LNVA 1RVGA 3LTSA 2YW4A 4UC5A 2GQAA 2YSWA 3DHDA 2NWRA 5H2ZA 1ZNNA 4RZ4A 3NPUA 4K37A 1LLZA 3C6CA 1NSJA 4JR5A 4OGZA 2BXVA 3PSVA 2OT1A 1KTBA 3NQ8A 3M5ZA 3FIGA 5K7JA 1G4SA 3TW6A 3W1TA 1C9DA 3KX6A 1K7FA 3AJXA 3GDRA 2F84A 3PY2A 3UZ5A 1EEPA 3G1YA 4TU1A 3QH2A 5BMWA 4AB4A 2Y7GA 3I6RA 4HPJA 1A5CA 2YPIA 3OVQA 2ZCGA 4AMAA 2QCDA 3UWUA 3WK3A 1TO3A 2NZLA 4QISA 1W1ZA 3LCXA 3QYQA 5G1YA 4CCEA 1F5ZA 4UTWA 4JYEA 3LXCA 4NZJA 4E38A 3EXSA 3LTYA 1M6JA 4YXGA 1YXCA 1OK4A 5EYWA 1I2OA 3IIOA 3W7QA 2NXIA 3KVKA 2FPTA 5HWMA 3QRHA 4EF9A 3LRLA 5AC7A 2QCDB 1LBLA 3SFKA 1DJNA 2ZZ2A 3TW7A 1F76A 2CLEA 2VFIA 2J88A 5FESA 4LUIA 3LLDA 4QSHA 1WYIA 2UV8G 1G7UA 1JCXA 1FDJA 5D03A 1IIGA 1DHPA 5AHNA 2G5WA 2RHGA 2WQPA 3G1FA 1GPWA 5E93A 1GJPA 1FY6A 4Q33A 3TXZA 5FEXA 1NF7A 4FNQA 3EXRA 3G1AA 2PRHA 4XWUA 3LHTA 3MI3A 2CW6A 3UWWA 1ZJIA 1KBJA 3GXPA 4JDYA 5TQLA 5FI8A 5GVJA 3DFQA 5HINA 3B4UA 5CZTA 4IMFA 3TFCA 3HG5A 1QFEA 4ORMA 4PC8A 3TJXA 2LLEA 4ML9A 3FLUA 1N8FA 1XL9A 3M7WA 3MYPA 4JS3A 2VFDA 3C2EA 4O16A 4NNCA 1D3HA 3STGA 1F7BA 1XDMA 5KMYA 3ABQA 4O14A 2GJLA 3GDKA 4NXSA 5AYXA 2GUUA 4NT0A 5LHFA 2ABAA 2V30A 1DVJA 1LOLA 3IV3A 5J5RA 1KV5A 1FBAA 1I2QA 5E0KA 1N7KA 1FWSA 3BK0A 3LV5A 4HN4A 2PE4A 2TYSA 2VEPA 1V5XA 5CKSA 3IGXA 2ZQ0A 5HWJA 3R8RA 5KTLA 3TQ0A 4GJ1A 5ABTA 3MMTA 3WJXA 4GRSA 2NUWA 2G95A 1OVDA 2BZNA 4DBDA 5K2ZA 1EX5A 3TX9A 2A2IA 5IBXA 1FXPA 3LXBA 4NNBA 4FNTA 3SI9A 3W2UA 2Y7FA 4RCXA 3M5XA 3OHIA 3NO5A 2ZZ7A 2C6QA 2X1SA 3W1MA 4ONVA 3FJLA 5LHEA 5D2TA 1DQXA 2BLEA 2FLIA 1JCMP 5HR7A 3LGEA 4YMZA 5KZMA 2YW3A 3L21A 3MYOA 1XBYA 1K7EA 3W7PA 4OBTA 1QR7A 3TQKA 3B05A 1VR6A 3WJWA 3A21A 2A7NA 4LRTA 3EX3A 4XKYB 4BFAA 4KWVA 1GVOA 3NOEA 4ADTA 4UTLA 3LBMA 2ISSA 1K8XA 1FCUA 5F1VA 3UQNA 3L0GA 3B06A 4HHPA 2WV8A 1KM5A 4MYXA 2A21A 1AW1A 2Z0IA 3E49A 5BOOA 4XZ9A 3HGJA 2YZRA 4GUJA 5AHMA 3QW3A 5F2MA 3RLVA 1SFJA 3IIZA 2Y88A 1TB3A 2QCLA 1K3UA 2QCHA 4QIUA 1YYAA 1OFDA 4LUJA 2RDUA 2NUXA 3QSTA 8TIMA 3C61A 5CZ0A 1Z42A 4P2VA 5EBUA 4ZQNA 4UTTC 3VNDA 1YTDA 2XN0A 1EUAA 4Q4KA 4HNUA 1RR2A 1H7RA 2QJIA 1SO6A 2QUTA 3W2LA 5AOUA 2CLLA 4MFEA 1OFAA 1A53A 1GZGA 1Q6RA 5FF4A 3OVPA 1MEWA 1OX6A 3IVTA 4CNPA 2YX0A 3IEBA 5I3FA 1M5WA 2X30A 2XFWA 2QCGA 5E1QA 1RD5A 4H6KA 1OG0A 1KFLA 1A5BA 4NVTA 4DPQA 6TIMA 3LBCA 1VCFA 2OJPA 4O12A 1NF0A 4JX4A 2ZA2A 2AQWA 4DF2A 5CZSA 3LM7A 2B7PA 1GG0A 4OV9A 3OIXA 3P80A 1OFPA 4RK8A 5BW6A 1RQEA 2C0AA 4XBKA 3OA3A 3W85A 2OX1A 2W79A 3G1VA 2V81A 2H6RA 3KVMA 3QEZA 1HL2A 4LS2A 2OMAA 5F2LA 5KSWA 5D2VA 4FXRA 4FNRA 2J9ZA 1W31A 4CQAA 4IX0A 3MI2A 3EX4A 4RR4A 4IPIA 3R5EA 1GTEA 5EMUA 1THFD 2DZPA 5F2GA 1HUVA 1SZFA 3WJYA 4C1LA 3TAKA 1ZY9A 2Y7DA 1LRNA 3G0UA 1X8FA 5DY3A 3O05A 1YDOA 2ZRVA 4JTHA 3G3DA 3W86A 4N9EA 5LGXA 1FDZA 1SO4A 5G4WA 3PWAA 1H7OA 3W1NA 4O15A 1W37A 4UNLA 4C1KA 1GTHA 3W88A 4EIVA 3TSMA 4EWND 5C5YA 3C2OA 4O1CA 1W3NA 2I1OA 3FJ6A 1U5JA 1GEQA 4U28A 1TYGA 1S5VA 4OQVA 2WPBA 3G1XA 2DU2A 2A0NA 1JQVA 1WAUA 3F1QA 3ABSA 2EHHA 4DELA 1D9EA 3DU0A 3IVUA 4RX0A 3W1LA 4ZQRA 3BG9A 4JTFA 5HMSA 2Y7EA 3E9AA 4O52A 1F6PA 3QSRA 1SO5A 3F03K 4OV4A 1F6KA 2DZVA 4DO6A 1G6CA 4NUWA 2ZRWA 5EY5A 1N55A 1DQWA 3ABRA 4K8HA 5AC6A 4OT7A 1ONRA 3PC0A 3S1XA 3TA6A 3T4CA 1ADOA 5AFDA 4I7VA 4LVGA 3I7SA 1PCWA 3ZWSA 3NPXA 1FXQA 5EKYA 1TSIA 2H3DA 3SIZA 1SO3A 3PSWA 4O8RA 4X9SA 4G1KA 4N9BA 3IIPA 2QCNA 4XKYA 5DCBA 4FHAA 3E96A 3W70A 1DKWA 3MP3A 1YDNA 3B0VC 4DXVA 3TU9A 1QO5A 1K8YA 4PL1A 3UWZA 3W9ZA 4O0ZA 3W7JA 3GB6A 3JRKA 1WOAA 3G3MA 4RJEA 2NV2A 3W6YA 3FYOA 1KM3A 3G0SA 3QJAA 4QQ3A 2A85A 3IVSA 3L5AA 3PUOA 3UY8A 3GR7A 2BSLA 3NPWA 3S8HA 1GOXA
chains in the Genus database with same CATH superfamily
4IX2A 2DW7A 4UTMA 3GG7A 1OZQA 1ZS2A 3RCNA 1JDDA 1WZMA 2GWNA 4HHHA 2ZZ5A 4GH3A 2P88A 2NVAA 1ZBCA 1DJHA 4B5WA 1V0KA 4PTMA 4DF1A 2CZEA 4GYKA 4KW2A 2ALRA 3F2CA 3PZVA 3VKAA 4U2YA 5XIMA 3INPA 2Y2WA 4WY0F 4YYFA 1C9WA 5C55A 1EOKA 1YDYA 1YPXA 1EGMA 2NT1A 4N4PA 1IXQA 1HKJA 1W1YA 2JF7A 3C2VA 4GO8A 7REQB 3BLFA 4GKTA 2A5HA 4GUIA 3RCMA 5HNTA 4WLCA 2NQLA 5B7ZA 1XH1A 3A64A 3MB9A 3OLEA 1XRFA 1TPVA 1LJYA 4JKLA 3C86A 4D6IA 5BRBA 1KFWA 2JK2A 4WOZA 3CGTA 1S2WA 3TMLA 4NX0A 5CPTA 2HDJA 4R27A 1RSCA 2D2GA 4QCEA 4C6FA 4URIA 3GW0A 2XZ9A 2C19A 4NQ1A 3LLXA 2VQTA 5AHLA 4GJIA 1O95A 4H04A 1I0DA 3APGA 4M7SA 1KXVA 2DFAA 3JU2A 1QOXA 4O4WA 3QV6A 3GTNA 1JAKA 1M53A 4DX3A 3ZJKA 3W25A 3L7RA 1KCXA 1H7PA 3EPNA 4NZFA 3GFXA 3QW4B 2XINA 3DFSA 5AZ1A 2O0TA 5DBUA 1UUMA 1XD1A 2QR6A 2A7PA 1QCWA 4H9TA 3KLKA 3UGVA 5DT7A 1Z3NA 3FFSA 1VS1A 4DRSA 3GHRA 1GZJA 3OG3A 4JY8A 1ZHAA 3P14A 2YFNA 5I23A 1XLHA 2GGHA 3KRUA 4CCCA 3AMKA 4DO7A 2ZRYA 2VELA 4AHQA 4JHZA 3CQHA 1UA3A 1CB7B 1W8SA 2Y62A 3MHUA 1UJQA 4OFCA 4ZFCA 4TTGA 2IQDA 4QDPA 1QNOA 3RPMA 3Q67A 3GO2A 3W0KA 4RNFA 2QAFA 3M9YA 1H49A 3WQPA 2RH9A 3ZJ7A 3LZ5A 3VIGA 1SZEA 1TTIA 5DRCA 2VEIA 4HTYA 2WMIA 3VDCA 4JTEA 1JDFA 2YXXA 1R9ZA 4WHBA 3P60A 1HO1A 2A6NA 3VZZA 3N34A 4F2UA 4TV5A 3WFAA 3CMFA 3TYBA 2C18A 1JFHA 2VXNA 4C6EA 5HQEA 1UUOA 2CHOA 4MKSA 3B03A 8XIMA 1JPHA 2VX7A 5JIPA 3U57A 2QGYA 1B3XA 3BARA 4UB9A 1W91A 3DI0A 1VBHA 4WF7A 4JTRA 3GVRA 1J79A 2VEKA 3ITYA 2X1RA 1R7AA 4ZR8A 4UQEA 3OIHA 1UWSA 4A2SA 3UEQA 4KCUA 2DDXA 3FAWA 3GAKA 1J6PA 1PBGA 1CBGA 1FWJC 4JNMA 4N6FA 4W5ZA 3LGGA 1QXLA 4IJBA 3KOXA 3W84A 4EKJA 1TJPA 3BE7A 1US0A 4RZBA 1F6YA 3GKAA 4BF9A 1V3LA 3VINA 4GGHA 2XM2A 3L5LA 4RXGA 2QW5A 3M0ZA 3WQEA 3GS6A 3RM8A 1YNPA 4M3PA 1KFKA 4EACA 2B7NA 1MWOA 2E9LA 2J8TA 3S9YA 1EPVA 1HKKA 5KZDA 4KEVA 5LGZA 4UNIA 4K8GA 1V6WA 3NM1A 2C0HA 4GXWA 2DT0A 1JD7A 3GTFA 4ZZ9A 1OB0A 3USBA 3WEOA 3L68A 3F4VA 3QV7A 2QCMA 2GSJA 1NWSA 1GVFA 3QFWA 4D8AA 5A69A 2PBGA 3BZGA 1ALDA 5T9CE 3W7LA 1UIOA 2XFFA 1OT1A 1X1ZA 1K6AA 2BTMA 4MYAA 1SZNA 4EPKA 1BYCA 3IUIA 3OBEA 2JIEA 3R13A 4QLJA 2F38A 1VPYA 3P8IA 3T2QA 3CBWA 1WXZA 3LPGA 2WSKA 4LS1A 3SRHA 2ZXQA 3MZ2A 3TE9A 3WLKX 1A5SA 1F2JA 4KWSA 2DSVA 3CB8A 3NL2A 4Y7EA 1TRDA 4Q7NA 4O0KA 1X6UA 3S2NA 4YCPA 4JFSA 2PMQA 1KCZA 2ON3A 1SYTA 1PL9A 1T41A 4ZENA 3ARTA 1E6SM 2J8FA 4O8AA 1E71M 4CVUA 3CS2A 1HT6A 4L56A 5DXXA 5TF0A 4DWSA 3W4RA 3IRDA 5G5IA 2FTPA 3CQ0A 2YL9A 2AL2A 2Z1BA 4PBEA 4WQ6A 3H70A 1BTMA 2D20A 3TCEA 1PZ2A 3WEMA 4JTDA 5H8UA 3VNYA 4XD4A 5I09A 4CQ9A 1BSIA 4KMQA 2GK1B 5E5CA 3UJSA 4LF2A 2UY4A 4PSPA 2VHLA 2FZ8A 3O1NA 1Z69A 4Q8NA 5H1WA 3DBPA 4D8LA 3A4AA 4D1JA 4YLWA 4NU7A 4ES4A 1G69A 1OSEA 3L4UA 2OEMA 4UBPC 1EPXA 5CC7A 2D22A 3DX5A 2I7GA 3NXFA 5BRPA 2VRJA 2Y5SA 4IF2A 1QPRA 2RKXA 3ITTA 1SZRA 3QY7A 2TMDA 2G37A 3AQUA 1ITUA 4U3AA 7A3HA 2J79A 4D1IA 4O28A 4UFKA 3M47A 2HROA 1MQPA 1LROA 3VC6A 1E6XM 1KBKA 4O11A 3TTOA 2RJGA 4JTIA 1UD6A 3GDMA 2VC6A 4PL2A 4FK9A 3T55A 4ZGYA 1KB3A 1ZFJA 3N9SA 2I5GA 3QPZA 4FX6M 4C6LA 2DZXA 1LM1A 3NEVA 1NARA 3ZJ8A 5DMLA 1XI3A 4OWGA 2RFGA 3GDLA 3ZT7A 1M9HA 2B31A 4TX9A 2ISVA 5DLCA 4DQWA 2Z6IA 1MZHA 3UCCA 4ZQPA 2Z00A 4IMGA 1OIFA 3N2XA 1JRBA 4O1EA 1Z89A 4YS1A 3UA3A 3KUMA 1A4MA 3ZZ1A 5C0QA 4QJ1A 2J27A 4Z2JA 2YDQA 2FMOA 2OOGA 4B9YA 3ORWA 1EA0A 4LYRA 4D2JA 1KGWA 2XIMA 2JBMA 4MJMA 3KBVA 2NXGA 2PODA 3W7IA 1AH3A 3BGGA 1IEVA 4LS0A 4R85A 3AISA 1OF8A 2E8YA 2ZRXA 3CWHA 2G3JA 1NM9A 3HG2A 3MWAA 2EAWA 3M07A 4L5ZA 3MSDA 4ZOEA 5LIUX 3W87A 3PANA 1WDSA 4N4QA 4UMAA 2O9PA 4PCPA 1J5TA 2QIIA 3ATYA 1LRQA 3QQ0A 3FA5A 3G1HA 1CGUA 1T40A 3WLHA 4XIMA 3UZJA 4P61A 4Q6JA 1OC6A 4V1YA 1NDZA 1OBAA 4CQ8A 5L6UA 3N6QA 3C2FA 4XUYA 4IQLA 1JUBA 1TX0A 4GY1A 3OOQA 3UWQA 2GJNA 4Q4PA 2CC0A 2QCFA 3N13A 3EWBX 2Y6ZA 3CZJA 1ZJHA 3HPSA 3UF9A 1R85A 1H62A 1DJYA 1YTKA 3DYPA 1U33A 1RQBA 1S1PA 3OQ8A 6ALDA 2WB5A 5CAKA 4ORIA 3NIYA 4TOQA 2NQJA 3KVJA 1W5NA 5LIWX 4B5XA 2XSBA 3AYTA 1PJ9A 1GW9A 3C0LA 2H3BA 1IZCA 2PRMA 4ZOAA 1HTIA 3BOXA 3KHDA 4ICMA 4PUMA 3W1AA 1XIBA 1LCOA 4IGHA 3B8TA 4GNJA 3O8AA 5CPLA 2A3LA 3A4JA 2E68A 3IGUA 4EVZA 4PODA 1B3YA 4UOZA 4MJZA 3WDQA 3IGHX 3VILA 1ELSA 3OZMA 4JY9A 5HNUA 1WBJA 1AJZA 2GJRA 2VRQA 4N9CA 5TIMA 1IR1A 2X1TA 4MFDA 3LLFA 3IS4A 4TX6A 4YYCA 4NRSA 3VOJA 4B4FA 3NL5A 2Q8ZA 1RBLA 4GUHA 1J2WA 1Q63A 4Z0SA 4IP4A 5LNUA 2FGLA 3WF3A 1BVNP 2Y8KA 2ZXAA 4NJHA 3NAVA 3NSMA 1ZSXA 2AQOA 3G1RA 3IIVA 1W5PA 1JDAA 3L4TA 3HN3A 1XLCA 1HXJA 1R3TA 4NI8A 4BI7A 2TAAA 2JIWA 2XSAA 3K13A 4DWDA 4XG1A 1KFEA 2J7FA 3TC7A 3W1XA 3SQLA 1WCGA 2PLJA 3PP7A 4XV0A 4JIQA 3FSUA 3GIYA 2QPSA 5LYRA 4DJED 1PE1A 2DJLA 3MMDA 1ZLPA 1OYAA 3CV6A 4H83A 1R86A 1KM6A 3PZIA 2JEPA 5FJJA 1CX9A 2QT3A 3NYZA 2OQYA 3P82A 1EL3A 3TN6A 1DQUA 3MA8A 3MSYA 1WZAA 4MMWA 4WXZA 4GBDA 1W5QA 4OECA 3AZTA 1EP2A 4W5UA 4AY7A 4NAEA 1F61A 3EKLA 3CXOA 4DBSA 5HATA 3OLIA 5DRIA 4NZ1A 1BGGA 4FX7A 2ZKMX 3GXTA 1XBXA 1NP2A 2AQVA 3QZAA 3FXYA 4WEVX 3EWXA 2F8QA 2I14A 3VKDA 2YDSA 5D9PA 3CMGA 5CJMA 1UJPA 2E6DA 2YJQA 3EOEA 2BVYA 2EXOA 3E12A 2WSQA 3DFNA 1XYAA 2A1YA 4OOZA 3WH6A 4IIGA 1Q6DA 3TJLA 1XC6A 1OM0A 4OTKA 5IRPA 1O1ZA 4DXKA 1AQ0A 4RW5A 2D2JA 3WDIA 4LJ3A 3ZLHA 1EJSC 2WHMA 2V5CA 4QG8A 5LA1A 3VIKA 1BEUA 3B0XA 1Q2SA 1UD3A 4Y9PA 3I7RA 3NZQA 3TFXA 1QPNA 3U48A 5CLWA 1Q6EA 3CQIA 4W8BA 4WCJA 1UH4A 4AVFA 2GGGA 3DFPA 2WZTA 3VIIA 3AALA 1MZRA 2O7QA 5I24A 4UR8A 2JGYA 3AHZA 3B0PA 4MUZA 3NQ2A 3LBOA 4NG3A 3MMUA 4GISA 2XVLA 1SJAA 5A6SA 1ME7A 1Q6LA 4HJFA 1UR0A 2IPWA 5FJPA 1J0HA 1P1XA 3WKZA 2I17A 1KM2A 4MNJA 3VI2A 2DW6A 2WW5A 3MP5A 3MQTA 1PX3A 2GQ8A 1OFBA 1UH3A 1KWKA 3UNDA 5FJRA 1GVRA 2Y89A 4X61A 1UCWA 5DBTA 3CZGA 1QTWA 1E0XA 3RYSA 3S5YA 1EKOA 1H1YA 4GNVA 3B8VA 4LGXA 1ZAJA 4S2CA 3WK2A 4DM2A 2J7HA 4GXMA 3L4WA 4K6AA 1OINA 3NOYA 3NFUA 1E4MM 1HJUA 1WDPA 3GTHA 1GQNA 4EPEC 4QCFA 1Z48A 2OR2A 2ZFAA 1TZ7A 2JGQA 1H7XA 4R9XA 1YTEA 1I1WA 3A4WA 4UTIA 3D46A 2ATSA 3WBWA 1B3ZA 5CPOA 1VLIA 3CT7A 3HOJA 3W00A 4QEEA 3E6EA 2VZVA 4JBRA 4QM1A 5DQPA 3TQPA 2C3ZA 3RU6A 3LA4A 3W6MA 3WK0A 2Z2BA 4LCSA 3FN9A 3RX4A 3VE7A 4LV9A 4PYSA 3L4ZA 5CGMA 2W67A 4FI4A 4GPNA 4OU1A 4XQ6A 5HUPA 2GVJA 3NQCA 1UWRA 1UOKA 1WKEA 3BMWA 2QUVA 4H2HA 3BV7A 4LVBA 2PDIA 3EWWA 2INFA 1IQ8A 1V08A 4LVAA 1QPQA 3VYLA 4JTLA 3WY1A 3WENA 4DJDA 3U5UA 2PLCA 1TG7A 2CZFA 4Q4SA 4GYPA 1FH8A 1XWYA 3TC6A 2B4GA 3G1SA 1T99A 1AZ1A 3UESA 2AOSA 4AF0A 1H7WA 3O16A 4GYJA 1R3RA 5CBBA 3R25A 1DL3A 3NSNA 2WCAA 1KLZA 3GBEA 2H9AA 4JYDA 4DYEA 2DPEA 4LYKA 2IS7A 4H9YA 2A3BA 2R82A 3CHVA 2HS6A 5FD0A 3I10A 2XIQA 5BYWA 5JBEA 1GONA 2BX7A 4LRSA 1EX1A 2G0WA 1E6RA 1ISXA 5REQB 3ALGA 4M6PA 3TEVA 3R94A 3S9ZA 3I68A 4CQDA 3VCCA 1QRQA 4GY0A 1XLJA 1JF6A 1FWGC 3PNZA 1C8QA 1E6QM 5FAJA 5DO8A 3W1PA 1V3MA 3NVDA 3BLEA 3THDA 3DG7A 4HA0A 1QAPA 2CFFA 1V6UA 3T2OA 2A6LA 3PBVA 1AK5A 2OLAA 4K39A 2PTXA 5CH9A 5TNVA 1S3TC 2J47A 5D04C 2CLPA 1PTGA 2V5BA 4S2BA 1VHCA 2OO6A 3B40A 2GOUA 4QG9A 3F4NA 4HNLA 3O07A 4IHCA 1RPKA 2J77A 2PC4A 2VFEA 3TW9A 3A24A 4M6UA 4X2RA 3WNPA 3A22A 3UVAA 1Z9AA 2E5DA 3SY5A 4BF7A 2P0OA 5DCEA 2BHYA 4E0CA 1ITCA 1U83A 1HFBA 2VD8A 5DXYA 5A3HA 3PB0A 4A21A 2DVUA 3PUDA 4E8CA 1Q3NA 5M5DA 1VYSX 4LUTB 1OFEA 3T9PA 2JALA 4W7WA 3FOKA 3MJYA 3BCDA 4JICA 1CCWB 3PBMA 1EGZA 1W2PA 1QI3A 3GG1A 4YNGA 4FNUA 4IQEA 2ZYFA 1JF5A 1Y8BA 2HK1A 2ISWA 1F73A 3V16A 3NA8A 3TKFA 1XW8A 1A47A 3WELA 1EF2A 3E5BA 5M2FX 2DZSA 2XGBA 3G22A 4Y6GA 2DJXA 2QDHA 5HMFA 4FXJA 5C8BB 1LTDA 4LBSA 2DEPA 4NAEB 3W2JA 1C91A 3MO4A 4NYYA 2PTWA 3TDFA 3K8LA 3S1UA 5EBAA 4NAFB 4M7TA 3LHWA 4TVUA 2XU2A 4LY8A 4AWSA 4BR1A 1PYFA 2AMXA 2VGFA 1GKQA 1KR1A 3LERA 4A8NA 2OKTA 4JL1A 3CO4A 5JXQA 3ANYA 4K3ZA 4JX6A 1HQTA 1GKPA 4MY8A 5HQLA 4Q22A 3STFA 3TQVA 5HMDA 4GXPA 1W56A 1O5RA 1Q13A 3FA3A 1C7TA 2ACUA 3OA5A 4R7WA 2OSXA 3M16A 1RZMA 2OKOA 3DYMA 3HPAA 1VGAA 3RO8A 1HVQA 1GK8A 2PWFA 4RNHA 4XD6A 4NZ4A 1Z8AA 2GVEA 1UROA 3A3WA 3QLLA 1LWJA 3GVGA 5LNVA 4A35A 4UC5A 1BGAA 2PZ0A 3DHDA 5H2ZA 3UNTA 1WE5A 3RMEA 2Z27A 3MU7A 3PSVA 1HJXA 1QATA 1KTBA 1DJZA 2OT1A 3G6MA 3NQ8A 3M5ZA 3GR4A 5K7JA 3B9DA 3A4XA 3DHUA 1ZTVA 3PY2A 3AZRA 3UZ5A 1FFRA 3FVDA 2QQ6A 4TU1A 3QH2A 1VEMA 3MV01 3I6RA 4QBXA 1H41A 1JPKA 4W88A 3OVQA 3TP4A 2ZCGA 5PTDA 5HDRA 2ZXBA 2NZLA 1LWIA 1BVWA 4AWEA 3LCXA 5G1YA 4UTWA 1F5ZA 3SAZA 1RK5A 4HPHA 5HANA 4JQ4A 3WD3A 4E38A 2QVNA 4GG9A 4HSHA 3NJ3A 3LTYA 1J01A 1A5UA 3SADA 2PBOA 2PDGA 1M6JA 1IZJA 1YXCA 4ZOCA 1I2OA 4HHLA 5H8MA 4EF9A 3VMNA 3LRLA 1W1B1 2QCDB 4PMOA 1LBLA 4UZUA 1Q7ZA 1DJNA 4RDZA 2AMGA 1W9BM 2J88A 1Y5VA 5FESA 4JHOA 3LLDA 4PMNA 1GVEA 5AHNA 1WPCA 4XAYA 4DAFA 2WQPA 3G1FA 4W85A 1TUXA 3VUSA 2Z28A 4ZOBA 1GPWA 1E4NA 4HU3A 5E93A 1G1YA 5FEXA 1NF7A 4FNQA 1VEOA 1MW2A 3LMZA 2BXYA 1XRSA 3WNOA 4JDYA 1CGWA 1XLKA 3PAOA 5FI8A 5GVJA 3D3AA 5CZTA 3TFCA 1QFEA 3K8KA 3OGSA 4ML9A 4HOWA 2J7EA 1XL9A 4O16A 2VFDA 2WMHA 4U33A 4ZCWA 5KMYA 4O14A 4JFVA 5HMEA 2VEGA 2ABAA 2GWGA 1XLEA 5C2GA 5LIKX 3IV3A 2KX9A 1VIZA 1QI4A 5E0KA 4LCQA 4HN4A 2PE4A 3TTYA 1JCTA 5CKSA 2ZQ0A 4GVIA 1EH9A 5HWJA 5KTLA 3WJXA 4GRSA 1RAKA 2NUWA 4C6MA 4PFHA 3T81A 2WPGA 3W28A 5IBXA 4PB3A 3PTKA 3SFWA 1R0MA 3UR8A 4F0LA 3SI9A 1A80A 3EB4A 3M5XA 4IIFA 4D6GA 2ZZ7A 2C6QA 3AZSA 5A6LA 9RUBA 4AIUA 3LS9A 5E6ZA 2EPKX 2YW3A 3L21A 4GX8A 5D4YA 1XBYA 2I57A 1UP2A 1PKMA 1K7EA 4PMJA 4HZMA 3HZ3A 1KQYA 1ZCCA 4PTXA 2E3ZA 4D6HA 2UY5A 2INEA 4KWVA 3FV9A 4GCXA 2PZNA 1GUVA 4ZO7A 3GNOA 3UQNA 4MJ2A 3PNUA 5BOOA 7XIMA 4GZJA 1PO9A 3CV7A 1CTNA 1KQZA 4X60A 4GUJA 3P0WA 5F2MA 1E0WA 3OG2A 1WDQA 1HP5A 2PDJA 1J93A 2QCHA 3R11A 1YYAA 1OFDA 2OXNA 3GU2A 4O0QA 3EDDA 3QSTA 3T42A 3C61A 5CZ0A 1L0PA 2BGQA 1DIEA 3VNDA 1YTDA 2Y4SA 1H7RA 2QJIA 3N4AA 2QUTA 3VZYA 5AOUA 1KCKA 1QBBA 1FWHC 2O55A 1GZGA 3EZ4A 2GGJA 3GZAA 3IVTA 2PC8A 2PFHA 3R0DA 2YX0A 1M5WA 4CN1A 3R4IA 3R1ZA 4PCNA 4H6KA 1XV8A 4J3XA 2OJPA 3KTCA 2A79A 1OQFA 3FJNA 1VRXA 4DF2A 5CZSA 1GJWA 4HQVA 3HPFA 3OIXA 1OFPA 1ONXA 5BW6A 1QVBA 3R8HA 1RQEA 3KRBA 4H1ZA 1GYMA 1JG9A 3G1VA 3LK6A 1F4AA 4HMCA 2VVNA 2OMAA 1BRLA 5KSWA 3WQWA 1EQPA 2QJMA 4LAUA 5D2VA 3T05A 1MRAA 4IPIA 3UG4A 2OOFA 3QY8A 4DY1A 3WJYA 5JBFA 2J6VA 4UQBA 2Y7DA 1LRNA 1QK0A 3WLLA 3LMYA 5DY3A 1YDOA 2ZRVA 3G3DA 3W86A 4AX7A 4NKCA 2PPGA 4N9EA 4HA1A 4HJWA 4IFRA 3RO6A 1W1VA 5G4WA 1H7OA 4C6IA 4GCAA 4C1KA 1GTHA 3W88A 1U1UA 4EPBC 3MZNA 5C9UA 1U5JA 1GEQA 3WUGA 1NDVA 1XJBA 3IJ7A 1TYGA 2AKZA 2X1IA 3AS1A 1ECEA 2WNWA 4HN8A 3ZXWA 4JFUA 5DMMA 3R43A 3ABSA 4DELA 2XIIA 4XZMX 3W1LA 3E2RA 1M41A 2X05A 4JTFA 5CAHA 1F6PA 3BL3A 4DUOA 1BXNA 1TV3A 3K46A 4DO6A 1G6CA 3VC5A 1ODZA 3KE0A 5CC3A 1GQKA 1K4HA 1RJRA 4L1XA 3S1XA 4NYUA 4HZ7A 1OGSA 4PUJA 1ADOA 2ZX6A 3VTRA 2YCLB 4AEEA 1PCWA 2WHKA 1ITQA 3WLRA 5EKYA 1TSIA 4L80A 4GJJA 4O8RA 3CNYA 4X9SA 4AIEA 4JTAA 1BYAA 5DCBA 1F3WA 2PP0A 3W70A 2Z1WA 1DKWA 4KS0A 3TU9A 1K8YA 4PL1A 3W9ZA 5LIYX 3W7JA 2PD9A 1HN1A 3VKCA 2HRWA 4US6A 3W29A 3G3MA 3GH4A 3JZEA 1JZ6A 3OP2A 4XVDA 5JQ9A 4F0MA 2A85A 3IVSA 2WZMA 3PUOA 3UY8A 2ZOXA 2NQZA 2PTDA 3ITLA 2BSLA 4QLKA 3NPWA 4ZO9A 1GOXA 2PWHA 2GOKA 3QHMA 3T7VA 3VE9A 4I5UA 3W2NA 2VOMA 5TAOA 1A3XA 3C2YA 4GVHA 4UMBA 3IANA 3WDRA 3WLMA 1XYCA 4DO4A 1W9PA 2X41A 4A8IA 2J8GA 4Z1DA 3ISIX 2DP3A 2D0FA 4UMCA 4KETA 4R3UA 1DBTA 1OCJA 1GYLA 3V1HA 3QTGA 6REQB 1IT0A 4FOKA 3WDJA 1TX2A 5U4NA 2YCEA 1TV4A 2F2HA 4OUEA 5I07A 1XLDA 1G94A 4JTJA 4RL3A 1NP0A 3EKZA 3T78A 3F2DA 1VPQA 4F40A 4HMDA 1TZZA 1B9BA 1A3HA 4P8WA 3VKBA 3CHDA 2E28A 4XD5A 4P7OA 5ECUA 2VC5A 4DJFC 3PBGA 4E2DA 4AH7A 3V18A 1FRBA 1XBZA 3AIUA 3V75A 3L2LA 1W5OA 3OBAA 4ZQOA 2G96A 2ZRUA 3VIFA 3KRZA 1SR0A 3CZEA 2FZMA 2CZVA 3NYDA 1W5MA 4A3UA 3IK4A 3GYEA 3DFYA 4GK8A 4HK7A 4XZIA 3AO0A 1B3WA 3NZRA 3QHOA 1GHRA 3WFZA 3RLGA 3GXNA 2IPJA 1R9YA 2WSRA 4HSOA 3E02A 2TRSA 3LX9A 1C8XA 1JI2A 3BVJA 3T8LA 2PF8A 3GG0A 3GUGA 2Z26A 3MPGA 4DBEA 4CU6A 4NNAA 3RDKA 2ZTKA 3QC3A 4U3CA 4A8LA 5JH2A 4QNEA 3S9IA 1KRCC 3EMZA 3WQ4A 2GGEA 2C79A 4DF0A 4CD8A 4EX4A 4Z1CA 3S5ZA 2D69A 4ZB0A 4GUFA 2P3EA 1AW2A 3SN4A 5FEZA 2CLMA 3L2IA 1MSSA 1ZCOA 7REQA 1DYSA 2ZZ6A 2POZA 2VCAA 3FSTA 4I90A 3ARUA 1NFPA 1PHWA 4H01A 2OZTA 3C0JA 4EXAA 1DP0A 1G01A 1RCQA 2VGGA 4W9TA 5LXXA 3D5HA 5EPDA 3GC5A 5D09A 1JCJA 4AY8A 5FF7A 1C29A 1U1JA 4QDWA 1FH7A 5AB3A 5ENLA 1RD6A 3BGJA 1SFLA 1NOFA 4H19A 1PZ1A 3UXIA 1BF2A 1W3KA 2BGSA 2WO5A 4IQDA 5LSMA 3HA1A 2J24A 2JKPA 3CUHA 2RUSA 1Q8AA 1WOBA 2FVLA 4WSHA 5D30A 3JW7A 4H2CA 2WMJA 3TZFA 5FL1A 1XKYA 3R58A 4CLMA 1UP3A 3UR5A 1FCBA 3E0FA 4AVOA 4HPGA 2PWDA 3PULA 5D33A 3CYJA 1OWQA 3W3OA 4KQNA 5U7SA 4ERAA 3IUDA 4GC3A 5B80A 3KOWA 1HZYA 3N2BA 3WQCA 1ME9A 4O1BA 2HXTA 3TIMA 4KERA 4N02A 2ZA3A 1PIGA 3KW3A 2KZHA 3E0LA 2BGNE 1U5VA 1N2VA 1YPIA 2C7FA 1E3XA 1CDGA 4FS9A 2DSKA 3C8NA 2BS9A 3HM7A 5ABGA 2GVLA 2R1LA 5E9AA 1UMLA 4IGMA 1XIJA 2VYOA 1DJQA 1JEZA 2YL6A 1WDWA 4JQAA 3O6YX 5I3IA 2EEXA 1P1MA 2ZA1A 1NOWA 3CWNA 4UNKA 3PBUA 2HK0A 2VEFA 4B90A 1WAWA 4LOCA 3B9NA 1XLFA 4HNCA 2I16A 5K9DA 4F0RA 1BXCA 3MY9A 1JZ4A 4HOXA 4A29A 4IIDA 2Q3OA 1DV7A 3LENA 3RN6A 1XGDA 3CQKA 2NUYA 5BU6A 4WY0B 4EWJA 3WUFA 4AG0A 3AS0A 1H09A 1F4HA 1OZMA 3K8MA 1KA9F 5D8WA 1EJUC 3PZGA 3SIMA 3VK5A 2C15A 5CJNA 1SMAA 1XQKA 4MWAB 3T08A 4CNUA 2J7BA 4B5NA 1Z7AA 4QX4A 4INFA 3TNBA 3VIOA 2CZ5A 1FWAC 4ZXLA 1GHSA 4AD1A 5D9OA 2OGJA 4L9ZA 4PSRA 4KWWA 1T7LA 1TA3B 3T1GA 2VZTA 2HEJA 2P10A 2Z4GA 4DBWA 1FWRA 5CPNA 3ZIZA 4PH6A 2EPNA 2PDMA 3ICJA 1DJIA 3CUZA 2GDQA 1TR9A 3N15A 4Q8UA 3WN6A 2XIOA 4QEHA 2JKEA 3R6IA 4LEQA 3W74A 3S2MA 3Q4DA 2CLIA 3BICA 2PURA 1QK2A 2DUAA 2V5JA 2EG7A 2ZBTA 4JOMA 3W83A 3CZLA 3EKGA 3CUJA 4FNSA 1AL7A 4DJFD 1G4EA 4J3UA 5EA9A 4ADUA 5ABHA 3MW7A 5HWNA 2ZRZA 2CXGA 2VUNA 1Q65A 2PRLA 4N9DA 3R2GA 3NNTA 3TONA 4DLMA 4FB7A 3S1VA 4ZEPA 3HPXA 1K03A 2O4MA 2E0PA 4OBSA 4IFKB 3GM8A 3ZT6A 2BMBA 3E0WA 1VFMA 4IUOA 3GWQA 5HXMA 2V5DA 2WVVB 2BY2A 4H9UA 2WOQA 3SUWA 4MOZA 3TTSA 1YEYA 3VKKA 4J28A 1WP6A 2ALDA 1KBLA 1K1DA 4BKNA 1MVYA 4B2DD 1HKMA 3FEMA 5I3GA 3GSMA 5D32A 2OWWA 1OHLA 4DWSD 1V0NA 1MRQA 2P8BA 3BG3A 4Z08A 4XTDA 1VFOA 2VCBA 1VBUA 2PS2A 5ABFA 4QJ4B 1LZOA 3SCQA 3ZSTA 3QM3A 1MEIA 4WRHA 1IEXA 2VGBA 3WLSA 1SSDA 2DT1A 2V3GA 1TUFA 3GTXA 5FF2A 1S46A 3PAJA 1BD0A 3BZJA 4S3AA 4YWIA 5HOSA 3R7MA 1LBFA 1Q4NX 3MCMA 4GQRA 2D0HA 3QPYA 1XPYA 1YDVA 3GG8A 3ZWTA 1XQLA 4BWLC 2D73A 3N4FA 2J66A 1W9VA 3KL0A 3PFRA 3MDUA 3CUGA 2AL2B 3T4WA 1L8PA 3CLMA 5G4EA 1QI5A 3PS7A 1VPXA 1XHGA 2QUNA 4U2ZA 4Y9AA 3TUUA 3TYDA 2V68A 2X42A 4PUDA 2Z1SA 2XIBA 1JYNA 1J10A 4NY2A 4MWAA 4GQ0A 3IRSA 5FAGA 5A6BD 3HJZA 4I8YA 1FHDA 2CU0A 1AFSA 4QJ3B 1B57A 1VJZA 5JBDA 1MW3A 2FH6A 1R3WA 3ALFA 3LOTA 2HJPA 2BY1A 3DGBA 1MNSA 3TH6A 3UD6A 4FXFA 5FF0A 1EO7A 1GT8A 1DOSA 2VFHA 2Z2UA 4FIRA 1QNVA 4ROPA 3TYUA 3KVLA 3BPWA 4ZB2A 2IXUA 3V5CA 3V7PA 1TRIA 3GZ3A 3W7OA 4I9TA 1XIEA 2WCSA 5BMXA 3QR1A 4G56A 4O53A 2OCZA 5IM51 2Z24A 2CPUA 2C91A 1UC4A 1P0DA 1GOMA 2A4AA 4ZQMA 2CLOA 4I8DA 3IIXA 3GNRA 5IDZA 1PCKA 5CG0A 1XXXA 4GI8A 1K4GA 2J75A 1UWTA 1YW1A 1I6NA 1FDYA 1M3UA 3W02A 1LOQA 3L65A 3ZMRA 1EC8A 1XF0A 3BDKA 4HKPA 7PTDA 3KRSA 1DHKA 5A6AA 3KS5A 2J9YA 4W84A 4E6MA 5BXSA 5B7YA 3M5YA 2J7GA 2X1UA 2Q01A 4H6RA 1W1TA 1Q45A 1NOUA 1ICSA 4K2SA 1MW1A 5HULA 3FYPA 2R8WA 3PVFA 2ACRA 5M3WA 3N2MA 3TSBA 4V27A 4AC7C 4GC4A 5J8LA 3UVIA 3CC1A 1IEWA 1TCDA 3UP8A 1XFBA 5REQA 4DEFA 3SRDA 3EMCA 3O6AA 4I9JA 4N7QA 4LQ1A 3W2KA 1DE6A 3L12A 4O19A 3LQGA 2F6UA 1E0TA 1Z6KA 5F1UA 3O0KA 4K36A 3Q94A 4WGXA 3W01A 2PA6A 3MSGA 3F5JA 3S1WA 1K8CA 5I03A 1W0MA 5EU9A 1MYRA 4BF5A 3H53A 2XH2A 5A2AA 3THQA 2XVKA 2X2GA 3C8FA 3DKLA 1WXJA 3QOMA 3K1DA 4QAIA 3V4BA 4CVWA 4TVCA 1R2SA 3SUVA 1TTJA 3IJQA 1DEDA 1W9UA 1BWVA 1FWEC 2PTYA 5LXEA 4ADSA 1RALA 1BQCA 3TOPA 2PCQA 1T0OA 4I9MA 3AFBA 3LHZA 3MV11 1FVPA 4W93A 4C7FA 3VKJA 4PA8A 2P50A 2P53A 3VX0A 1X7IA 4K38A 2D0GA 2V2CA 1BYDA 1PSCA 1QWGA 1E5JA 1KW1A 3HO8A 1D7FA 4FOUA 2YDAA 3STPA 2YIHA 5A8NA 2WKGA 2ZICA 4HU8A 3H54A 1O12A 4FO4A 2ASHA 1QMLA 3W73A 3VOCA 1XFCA 2DZTA 4ZE5A 4HNOA 3A5VA 1J0ZA 3F5KA 2C1IA 4LV4A 1B5TA 1H4PA 3VM7A 3UPWA 3PF3A 4Q8WA 1CWYA 1TMHA 1EXPA 4JIPA 1M03A 3W7NA 4UCGA 4DBUA 5AZ0A 3GH5A 4FR1A 1H2JA 1RA0A 3SECA 1QJWA 1FWDC 3AIRA 5EB8A 4I9AA 3VVGA 2PWUA 4HNTA 1EWEA 2DORA 1CXFA 5A5WA 4PRTA 4CNOA 3ARPA 5HJYA 4M6VA 2OX4A 1MEHA 3BW2A 4TMCA 1P0KA 1TV8A 1HO4A 1O1HA 1YKWA 3POCA 3W53A 3MUXA 2ZUMA 1R2TA 2XISA 3BANA 2QDDA 3VD5A 3DH7A 1YLVA 2Y63A 1TJ1A 3NL6A 3JS3A 4EOUA 2IKGA 1L6FA 1H7NA 2DIJA 3IACA 3WQ8A 4DIAA 1SW0A 5CBJA 4MZ1A 2NQHA 3JR2A 1ZUAX 4CD5A 2GSEA 4IMEA 2FGZA 3AIEA 4MLRA 2CITA 3N18A 2OELA 2TODA 4O50A 4LC6A 2Y70A 2WVUA 2X16A 1FWTA 2VENA 5T91A 1T8QA 1I60A 4OE7A 2EF9A 6PTDA 3MVTA 3UG8A 3HQ1A 1HKVA 1HW6A 4IOTA 1B4EA 2YB4A 4FP1A 1KFBA 2CNCA 3Q65A 5D05A 4U5IA 4M81A 1WUEA 4DZAA 1VFLA 1GOOA 3GNDA 3VIHA 5I02A 5XINA 1H51A 4LPCA 4LUSA 2YCJA 2BBFA 1A5NC 3REQB 4IQJA 1TV7A 3BO9A 4QITA 3WQFA 1VQTA 3EMQA 3HGSA 5C9WA 2GUBA 4K8EA 4QNWA 3W72A 2V6AA 4OJYA 3TWAA 3ITCA 2W4XA 4NL1A 3W7MA 2B81A 1MNZA 4DLFA 3LHYA 4H7VA 1E9IA 1AJ0A 3ZSSA 3A47A 6ENLA 3ABZA 2RGMA 3WYZA 2NX9A 4XB3A 5GJPA 4W86A 3W23A 4DZHA 3N73A 4ZFMA 1TR1A 2Q6ZA 4B5VA 1O4UA 3W7HA 5J04A 5D02A 1CI1A 1E1FA 3AHYA 4W7VA 1JGMA 1QOQA 1GEHA 1A0CA 2G97A 2Z25A 1VYPX 2W62A 2FZNA 2A3EA 4BQ2A 4IWWA 4ACZB 1XIGA 5AHFA 4AXKA 2VTFA 1VKFA 1TQXA 3S6OA 3MHFA 1TWSA 1UD4A 3WJSA 2FKPA 4JGDA 3D47A 3AAMA 4Y90A 1QUMA 4D6FA 2R14A 1ZJAA 3SUSA 4LX4A 4AC1X 4DUVA 1PDYA 5DANA 4F48A 1C90A 4LC8A 1V93A 3CTLA 4S3GA 4MZ8A 1US3A 3H7RA 3CH9A 3RGTA 3WMLA 1FWBC 3SJNA 1SQ7A 1YRRA 4M5PA 3ZR5A 3FX4A 5DN1A 2VQUA 1IYXA 1DWFM 3Q37A 2WJFA 3D6NA 3KCJA 3LCLA 2ZUSA 3S5OA 5I3HA 1JJKA 2VWTA 4MKNA 3KXQA 4HZ8A 1WZKA 2HS8A 4GWEA 2W0UA 2GFTA 3G24A 3WO8A 2PF0A 4XUGA 5G1MA 2DSUA 4GD0A 4Y8EA 2P76A 1YHTA 3PM6A 1BAGA 3QMTA 4XSMA 4L6OA 3R89A 1I8JA 3ERPA 2DZAA 2XJ7A 1FOBA 4J3VA 5CGTA 3VGEA 2XG9A 1E5NA 3Q2DA 3UCDA 3W71A 4RUBA 2YXOA 4XAZA 1RY0A 2UBPC 1PB0A 1XLLA 5D9MA 2HVNA 4ICNA 5C7HA 3ZFHA 5ABFB 4AZCB 5LZLA 3CHEA 3P61A 3QTPA 4XZLX 2H8XA 2TPSA 4PCTA 3G2GA 4QROA 5DELA 3FKKA 3BH4A 3GAYA 3UPBA 3ABXA 5AY7A 1C92A 3OVGA 3VDHA 3I3DA 4HIBA 3KHJA 4C91A 1EHNA 3RLHA 3CUXA 1R38A 4LAKA 3TYEA 3URQA 2YA1A 3L23A 4G9PA 3CPRA 1EBHA 1VBGA 4L4LA 3T07A 3CPUA 3PPFA 1ZGDA 1RV8A 4JN6A 2FPVA 3UXKA 4C6CA 2JKAA 2BOEX 4LANA 1P5BA 2TSYA 3DFHA 2DY3A 4ROQA 1KCLA 3SN0A 3L66A 3PTQA 3GXDA 5LKYA 3N14A 2DZUA 1UQYA 5H6HA 5DF0A 4LSBA 2FGBA 4PUEA 3LSCA 3T09A 2Y24A 4H7CA 3WEZA 5C7VA 1XIMA 3RMJA 1UKSA 1S3HA 3QOKA 2POTA 3XIMA 1QI2A 1VYRA 4LUYA 3BURA 4XKMA 1T96A 3AS2A 4CNNA 3UG5A 1B9ZA 4MWAE 3A23A 3QQWA 3SY1A 4R5EA 3M64A 3QQ1A 4LVFA 1JYXA 1GQIA 1JZ2A 1M68A 1RXOB 3BAJA 3DGRA 5AYIA 5LIXX 5SWUA 4ZODA 3E2VA 3M46A 3VNJA 4MJ4A 1TTPA 4PBFA 1NDWA 4I6VA 3WQ5A 3B8DA 2QV5A 1NEYA 2GVYA 1SJDA 1XM3A 3PHAA 2HE5A 4M1RA 1V77A 4KKXA 4BS0A 2PCEA 1WKFA 3NGFA 1A5AA 3LV6A 1K9DA 5EL1A 1A5KC 3S5NA 2FDSA 4UTWC 1YXYA 1ZAHA 4QAWA 1NWRA 3TV8A 4AAJA 2Z1KA 4MZYA 1F3EA 4AX6A 3G8RA 4ZVJA 4FLRA 2G3MA 1UKQA 2GQ3A 2BOFX 1YNQA 3KTXA 2GSHA 3NQGA 5IXEA 1AQMA 2OQLA 1D8WA 2NXHA 3C5QA 4I7UA 3THAA 3URNA 4ATWA 4YWSA 1ICQA 5KETA 4AIOA 1OT2A 1T8XA 1ZL1A 1DIDA 4AEFA 2NV1A 1I1XA 3MKKA 3XINA 3LNPA 2BXZA 4HB7A 3W22A 2VX6A 4G5DA 3KDOA 3UGRA 3DI1A 2O92A 4LF1A 2G4FA 4F79A 3WBXA 4HA4A 3OLDA 3R79A 1EIXA 1TPUA 2E6FA 3CZ8A 3A6OA 4B5UA 1JQXA 5K4XA 4M1BA 1QOPA 3NCOA 3H4XA 5RUBA 1RVGA 3LTSA 2NWRA 3LN3A 3CIVA 3QGVA 1ZNNA 1ZBKA 4K37A 4UOJA 1VJSA 1HGWA 3TW6A 4L9XA 4F2TA 1TE6A 4MNMA 3FEQA 3AJXA 2F84A 1T5AA 4I5XA 3G1YA 3WLOA 1AJ2A 3APTA 5JIWA 1I9CB 1E6PA 5BMWA 4AB4A 4HPJA 1A5CA 2P8CA 2MNRA 1IEQA 1Q5MA 1W1IE 4DUWA 4AMAA 2QCDA 2QV4A 2QYGA 1TO3A 3WK3A 1YE6A 3BMVA 1CEOA 4UQCA 1W1ZA 1J8VA 2J78A 1WDDA 3QYQA 2IPFA 2CKSA 1X96A 4B2DA 3BLPX 3EXSA 3VOFA 1TA3A 3VNMA 1Q2RA 3WD1A 4GX9A 1OK4A 5EYWA 2HQAA 5HWMA 3QRHA 4S3FA 4Z42C 3ZO9A 1PPIA 4EP8C 3W6LA 3SFKA 3VDBA 4PTVA 3ES7A 3TW7A 4MG4A 4LUIA 3WDPP 3HJEA 1G7UA 5CSUA 1LQ2A 2YZ5A 2VZOA 2G5WA 3PTDA 3GUWA 4Q33A 3AUJA 2GLKA 3BGAA 4XWUA 3BSHA 2JEQA 3PWGA 4J3ZA 1KBJA 1EJXC 2V5KA 3AROA 2H9AB 1VB9A 4QQUA 1P43A 3WUBA 4IMFA 4ORMA 2F6XA 4AD2A 5A2CA 5HA7A 3TJXA 3TLQA 3AMCA 1UPPA 1N8FA 3M7WA 3W37A 1AODA 3QR3A 2UWFA 1QWKA 1E9YB 1Y5WA 1E43A 1TCMA 1W8GA 3OQEA 3I6EA 3T0CA 1XDMA 4X9YA 3B0YA 2CBIA 3B9AA 3ABQA 2GJLA 1GOWA 4Q6XA 7ODCA 4FSAA 2GUUA 5LHFA 2WJDA 1XSJA 2WWCA 3PTMA 4DUXA 2QZRA 3VGDA 3HTWA 4N0RA 3LV5A 4LB4A 1R9XA 3BAXA 3IGXA 4G7EA 5DEZA 3PZQA 3R8RA 4GIEA 4EXBA 5EMKA 4X0NA 4DBDA 3AHXA 4F4RA 3QPEA 4FF5A 4IIEA 3TX9A 3U5YA 3AXMA 4JNZA 1S2TA 3LXBA 3W2UA 2QS8A 3TJIA 4W87A 2VZSA 4RCXA 1L6GA 3OHIA 4B9ZA 3VZXA 1J96A 3ARYA 1DQXA 3FNDA 1GKRA 1F3XA 2FLIA 2YCIX 2QHAA 3R0UA 4YMZA 3EAUA 3MYOA 5FJTA 3W7PA 2J7CA 3B05A 3LG3A 4B4HA 5CBIA 4KCVA 1FP8A 1TIWA 1XYZA 5C9ZA 1HJQA 4A3HA 1QHOA 3NOEA 3LBMA 1ODUA 1U2YA 1FCUA 1S5NA 2WM0A 3L0GA 4HHPA 1K9FA 4MYXA 2A21A 1AW1A 1KRAC 1EC9A 4XZ9A 2F9RA 2YZRA 3FDGA 4HK5A 3AC0A 2EPMX 4J1OA 3QW3A 1VD6A 3N04A 3FYYA 4PUNA 3RU8X 2QCLA 4F8XA 4HMEA 1K3UA 4S3BA 3SQSA 3WF1A 3P3BA 4QIUA 4LUJA 1UC5A 4PB5A 1DXIA 2RDUA 2NUXA 8TIMA 2QMKA 5DT5A 4OZOA 3WX7A 5EBUA 4ZQNA 5FL0A 1SGJA 4Q4MA 1GQLA 4Q4KA 4HNUA 4PUWA 3WLIA 4YU1A 1SO6A 5FSDC 3W2LA 4REQA 4V2XA 4PMDA 4XAFA 2WC7A 5IFTA 2CBUA 5IDIA 4MFEA 1JAEA 4GI6A 4IMAA 1WO2A 3TLLA 3VGHA 3IEBA 1PZ0A 2HXUA 2X30A 2WMKA 2XFWA 1ZZMA 3S2JA 1A5BA 4DPQA 6TIMA 1VCFA 1NF0A 4JX4A 3SCUA 4BA0A 8RUCA 4UR9A 1V3JA 4GQQA 1Q85A 3LM7A 2E67A 5E9XA 1M04A 3H24A 3I6TA 3FHQA 4XBKA 3OA3A 3W85A 4EE9A 5HQMA 3UXLA 4RDWA 2H6RA 3SEPA 5CJ5A 3B9EA 4FXRA 4MB5A 1W31A 4CQAA 1MQRA 1FWCC 4AQLA 4DB7A 2OEJA 4C6PA 5EMUA 1H5VA 1THFD 1HUVA 1SZFA 4C1LA 3O05A 4C6JA 4AZCA 1U1HA 1YX1A 1E73M 1SO4A 3PWAA 5I78A 1QASA 3WF0A 3W1NA 1UW9A 4DJDD 4O15A 1X1NA 1D8CA 1W37A 3WF4A 5C5YA 1RY8A 4J27A 1XYFA 3FJ6A 3S5SA 2WZHA 3LPFA 3P6LA 4U28A 3UPMA 2A0NA 3B9OA 1WAUA 4NRRA 2WM1A 2VR5A 3DU0A 4UCFA 4QS6A 2FVKA 1V51A 3E3HA 4ZQRA 3PPCA 3BG9A 3QSRA 3M0KA 4BZYA 1GOKA 1HJVA 1W1A1 1F6KA 1H0GA 2DZVA 5EY5A 4V1XA 4JQ1A 4K8HA 4Q8VA 5FJUA 1ZPTA 3IAPA 3T6CA 4OT7A 2W66A 2PP3A 3T4CA 1TWWA 3P0XA 7TAAA 4GOAA 3I7SA 3SUUA 1FXQA 4NI3A 1RVKA 4IP5A 3IJLA 5A8PA 4R7OA 3QV8A 2OB3A 4G1KA 3VOIA 3POHA 3ZVHA 1BTCA 1JZ3A 1IHIA 1OIMA 3E96A 2DVTA 2FMNA 1YDNA 4KEUA 3B0VC 4DXVA 3O9NA 4O0ZA 2ZVRA 3ES8A 4IIBA 4RJEA 2NV2A 2XSXA 2Z1VA 2WC3A 3RRXA 2Q8XA 3QJAA 2VC9A 2VRKA 3L5AA 1LUCB 5A8QA 1EYWA 3GR7A 1POKA 3OO2A 2NQ5A 1DTUA 1CGYA 1SZGA 3SQMA 2W9MA 6XIMA 4IP7A 1RH9A 1QNRA 1YADA 4H8UA 2J25A 3BOLA 1J0YA 1H61A 5MHBA 1JUKA 3UJFA 3H2CA 1ADDA 3ARWA 4NZ5A 5F4WA 3K5XA 3DC0A 3COTA 1UKTA 1KFJA 3VU2A 4BY3A 5CSRA 4E5TA 1VFUA 4H7ZA 4ZQCA 3V0TA 4MSSA 3OVRA 4OKDA 4IGSA 3C3NA 1EJWC 3UJEA 3B8IA 1I2RA 2DV0A 4XAGA 3VD9A 4UTUA 2F61A 3THUA 3LCFA 3IJ8A 2Y61A 4M80A 2FIQA 3PG9A 2C16A 3GC2A 3N3MA 3RJXA 4PEKA 1NFGA 1F05A 4UQ9A 1R47A 2VCCA 4U4MA 3W7RA 2R94A 1FWWA 3BG5A 3TTEA 4GLEA 4AZIA 4ASTA 4WJXA 1CXKA 4A4AA 4RLIA 4Q8OA 3EOOA 4M56A 3SZ8A 1GVYA 2ZADA 5E6YA 1RCXB 4HCLA 2ZDSA 2HTMA 4QDMA 3QFEA 3UZXA 3SW6A 3W7CA 1JPMA 3GTIA 4FOJA 1E15A 3PZOA 3D0CA 4KFOA 1E4IA 2WKJA 3VA8A 3U4AA 4PCFA 1XICA 3A9IA 4F66A 2YLAA 4Y9NA 1BWKA 4GVGA 5I77A 5FKYA 3CAKA 1NFBA 2VJXA 3MCOA 3WL1A 3GNXA 2WBGA 3W07A 3AHVA 3GXMA 2EPLX 1MQQA 1IR2A 3U8GA 1AUSL 4FPSA 1UD2A 1AZ2A 2Q02A 1DWJM 3CB3A 3WQ6A 2FTWA 2ZUTA 1ZAIA 3TXVA 3NGJA 1RUSA 4PEEA 2Z7KA 4LW7A 5G2IA 3FVMA 4M19A 1VCVA 4A6GA 1WBHA 3M44A 3E2QA 4AYSA 2OSWA 1OABA 2OPJA 1R46A 2VT0A 1R87A 1JUEA 3ARZA 4Y96A 4HPXA 1FUYA 4C6QA 3U2OA 4ZSUA 2C1HA 2IQTA 4JIRA 2DQXA 3CUFA 3HURA 2RDWA 3TMQA 3MT1A 4UTFA 5EMYA 1JZ8A 3W27A 1S2UA 2G50A 1JNEA 1Q66A 4Q3MA 4NXKA 3OLGA 1DJXA 4Z1AA 2AL1A 4L65A 4G8TA 2WLYA 3FGCB 4BJHA 1VEPA 5AHEA 1FCQA 3L9CA 4QP0A 1OFOA 1VCGA 2YBVA 2JFEX 5CZJA 3GIPA 2RGLA 3O6DA 2XN1A 1EHAA 5JVLA 4JTTA 4PRRA 3NQDA 3W24A 3M0VA 2GYIA 1GYNA 1QDSA 2XTKA 1NIUA 3N12A 1L6SA 3WG6A 3CIXA 4WX2A 4YN5A 4C6DA 4M0XA 3RHGA 2V8ZA 1QO2A 2BVTA 4AVNA 1OFQA 3HV9A 2ZZ1A 1XLGA 3EBVA 4LYQA 3P5ZA 3ELFA 4L4PA 3SR7A 4TV6A 3ID7A 5FACA 2E8ZA 1JCNA 4IMCA 4DWSB 2NVDA 2B7OA 2NV9A 8CGTA 1EJVC 5I3DA 2O56A 2WVVA 1P6CA 2YOCA 3H21A 1Q4WA 4O4VA 4UXDA 1J0KA 5AECA 2BG5A 4ZSTA 3TJ4A 3QGKC 3EOSA 5GJNA 2WHLA 4HVXA 3GFYA 2QPXA 1A50A 3NL3A 4J2PA 4LNYA 2PWGA 2CIPA 1P0NA 4GVFA 4YPJA 1TV2A 3NZPA 3F7JA 4LAMA 4WY0A 1PKNA 3ITGA 1KNWA 3VGFA 2XHYA 2PDUA 2QKFA 2ZZ3A 3S83A 1TFVA 4HSNA 1D3GA 2C14A 1HIZA 3BC9A 4I6KA 2PEVA 4J3WA 4OBRA 2J74A 4JXCA 5CGQA 3LCWA 4ZE4A 4C6KA 3BWWA 2YYUA 1QW8A 4KCTA 1WDRA 3D3FA 3RJYA 5I6SA 3HIJA 3I3EA 4AEOA 1I2PA 2ISDA 4WR3A 5M17A 3K4WA 3H2MA 4J3SA 3E0IA 4LWWA 3AJ7A 2GPTA 1VFTA 1JVNA 3NZ1A 2REQB 3AWOA 4MB1A 1V6XA 1UP0A 4JKMA 2XWDA 4V28A 2EO7A 1ZQ5A 4RZ6A 3L4YA 4PR4A 2O7SA 4GUGA 4AIBA 2B7QA 2ZE3A 3UY7A 4O57A 1PX4A 1LL6A 1F74A 3VD7A 1ISVA 2PUZA 1UWUA 5EGRA 5GNZA 3H6OA 4WOQA 5A6JA 2DSWA 1KRBC 1BF6A 3W38A 1A49A 2FB2A 4Z1BA 2L5HA 2ZC8A 4S3CA 4WJEA 4UR7A 1EA9C 3GVQA 3UWEA 1SPQA 5G2WA 1XX1A 3W7EA 1KTNA 2GDVA 1FA2A 3BUVA 3QV9A 2Y5JA 1UR1A 1UH2A 4IZGA 1UZ1A 1OYCA 4P8UA 3ZQ9A 5HNNA 2VOTA 1XCFA 1TPC1 3ECQA 4JIHA 2CLKA 3NDYA 3DAQA 3NQ6A 1BVZA 2PDNA 2F6KA 1OJXA 1E40A 1IGSA 2HZGA 3KCOA 3G6LA 3LI0A 5L9FA 5KINA 1WA3A 2VX4A 4H6EA 3LYEA 5FJOA 1ZU8A 2CXEA 1REQB 4EAYA 4JTKA 5KEZA 4R9OA 4S3EA 1XLIA 3VFCA 1EF3A 3V1PA 1PDZA 3KBSA 1TKKA 4FLOA 4PTNA 1OD8A 1V3IA 4GZEA 4O13A 3EX2A 1CW2A 3EOLA 4KWUA 4NILA 4Q8QA 2XH4A 4RW3A 3R10A 4FLQA 3O06A 4GZ7A 4PTDA 4DI9A 3KEHA 1MW0A 3CHFA 1ZALA 4MVAA 1JGIA 2IKJA 5CPMA 2VURA 3F2BA 2VR2A 4J2MA 1UA7A 1H1ZA 3SCWA 5BZAA 4L64A 3APYA 3LHUA 4IFOA 3K30A 1YMYA 3EX1A 4Z2LA 4Q4RA 3IJDA 4R33A 2NX3A 2GJPA 2NT0A 2E9MA 1VBRA 1L6WA 1AQHA 4C6OA 4P7LA 4JTUA 5A8MA 3ZM8A 4MY1A 2I5IA 2CKRA 1DWIM 3MP4A 1KV8A 4MB4A 1LBMA 4LAZA 1B4KA 4QGCA 3M6YA 3TA9A 5AYYA 3WD4A 1TWIA 2G3IA 3I3BA 3SCRA 4GYFA 3SBFA 4A8RA 4ENLA 5CZKA 3RXZA 2Z6JA 3VIJA 4WKAA 3K4AA 2REQA 3VCNA 3QXBA 2Q09A 3P81A 1OC7A 2QUUA 3PZ9A 4JX5A 5TBOA 4X2PA 5C6MA 4K7YA 4EXQA 6XIAA 1NQ6A 1XISA 4LT9A 1L2UA 1XSIA 5EMLA 1ONWA 4IFKA 3QC0A 1EBGA 1Q6GA 2EJAA 3GHUA 4IL2A 2EPHA 1V0LA 2AGKA 4XX6A 1SU5A 3NR0A 4WD0A 4KFNA 4Q7BA 5F4SA 4MHBA 2CYGA 4NJKA 1YNYA 1F8MA 3GBDA 4DVOA 1W9XA 2PI6A 4QHRA 3BSGA 1TJRA 4Q7IA 3W7GA 4NP7A 3M5VA 2ICSA 3CU2A 5G4HC 1NAL1 4AZBA 2XPKA 4JTQA 3AYRA 2WWDA 1SR9A 5GQBA 1G67A 8XIAA 5ABEA 1J0JA 4XSLA 2ACQA 1XIHA 4AD3A 2VFGA 3SCSA 3STEA 5FJIA 3S2LA 2V63A 4MKVA 5J5DA 1GG1A 2DIEA 6TAAA 4A2RA 4CNSA 1O94A 1BHGA 2XWEA 3ME3A 2ODOA 3VGBA 4JIEA 5HJXA 1F07A 2Q3RA 3G0XA 4BQ5A 3GDBA 2YL5A 1UBSA 2EKCA 1X8CA 4QLLA 1REQA 1LLWA 5HR6A 5A6MA 5D38A 1G9HA 1D3CA 1VLWA 4WUIA 3QMRA 3UJ2A 7ENLA 4PMZA 5GPRA 3DZ1A 5F4XA 1HJSA 4AZ5A 1R3YA 3LCIA 1H60A 3OPSA 1UKPA 3VPLA 2NSOA 3SGZA 1E1CB 4Q4OA 4FF7A 5A95A 1VH7A 2PGWA 4D6JA 4D6EA 3ZS4A 3VFLA 1MUCA 4JQ2A 2PLMA 3KS6A 2VDHA 3B04A 6REQA 3SCTA 4ZO8A 1LL7A 4XO7A 1AG1O 1XINA 1PS9A 5BXRA 4J35A 2YA0A 4P7NA 3CLWA 1EOMA 3LEPA 1UG6A 4AXNA 2HPMA 1LT8A 3VUPA 4PMYA 2FJKA 4BQ3A 3KZSA 4KRZA 2WK2A 3VXGA 1JZ7A 2DT3A 2EQDA 2G3FA 2WJZA 1XIFA 4UTTA 3FCPA 4NIRA 1JYVA 4IUGA 3DIPA 3VNZA 3P62A 4DNMA 2Q8LA 5F7UA 2UY3A 2ZX8A 3CEPA 4ZL1A 2E7FA 1XYBA 3AS3A 1XLMA 4QFUA 3SSZA 5M03A