3QQ8B

Crystal structure of p97-n in complex with faf1-ubx
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
80
structure length
80
Chain Sequence
AEPVSKLRIRTPSGEFLERRFLASNKLQIVFDFVASKGFPWDEYKLLSTFPRRDVTQLDPNKSLLEVKLFPQETLFLEAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transitional endoplasmic reticulum ATPase
publication title Hierarchical Binding of Cofactors to the AAA ATPase p97.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein/apoptosis
total genus 24
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2011-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00789 UBX UBX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3qq8B00
2BYFA 2KJRA 2GBKA 3A1QA 1Z5SB 4W9LA 1E8YA 2FCNA 3Q3FA 2KXJA 3OJ4B 1V80A 1F9JA 2DHZA 4WJQA 1V5OA 2DYOA 2OOBB 4DHJD 1IYFA 2KWCA 2KJHB 5IAAC 3UQAA 3BY4B 2JPHA 5LLIA 4W9DA 3EHVA 5AZFA 3RULA 3RZFA 4NPNA 3W1SC 1WX8A 3QC8B 4FLHA 4E74A 4W9CA 2KKCA 2Z0DB 3NY5A 5AEKB 1P3QU 4MGZE 3A33B 4NY0A 3ZNZB 1FXTB 2OJRA 3MTNB 4A3OA 1C3TA 3O65B 3KW5B 3QHTA 4KIKB 2LUEA 2IZVB 1KM7A 1V9JA 1U4AA 1WZ0A 2R2QA 3DDCB 3A9KB 4WWPA 4GDLA 5DPWA 3VQIA 1WX9A 5BO4B 4DHJB 2CR5A 2KK8A 1A5RA 4ANXA 4G3XB 2D3GA 4I6NB 3VTVA 3M95A 1GG3A 4GXBA 2KTRB 2LI5A 3ALBA 3PHXB 3APDA 5E6NA 3HHMA 1EUVB 2WYQA 1GJZA 2IO2B 2B3AA 1WR6E 1QZEA 3V6CB 4PYUA 4TQ0A 1UGMA 2GBJA 4EKUA 3CMMB 3PHWB 3WANA 1WXMA 3V60A 4MGKE 3ZIMA 2FCMA 1EF1A 5E6OA 1WXAA 1ZGUB 5CX3A 5DPRA 2G45B 2GBMA 3ZVVA 4BOZB 3PLUA 2N4FA 1S3SG 3VFKA 2LRUA 4TV3A 1KLVA 1P9DU 5L83A 3UINB 4J6IA 3DCGA 3HM3A 4I6PA 4K7SA 4KDIC 4FADA 3B08A 2KWVB 3K9OB 4K1RB 1YX5B 2KDIA 3SHQA 4XZ4A 3X23A 1UBQA 2M17A 3WAPA 4FBJB 2I1KA 2AYOB 1RFAA 2DYBA 3VUWA 2LGYA 2AL3A 1KJTA 3OLMD 2JVCA 3JSVB 3OJ3A 3QA8A 5DPSA 3VTWA 5KHQA 4W9JA 4IM3A 4HDQA 3VXWA 2ZPNA 2ZZPB 4FJYA 1V86A 2ZVNA 3L08A 4K7UA 3ZRCA 5KHOA 4AWJA 1E90A 4DDGD 2M8SA 3W1YA 3ZDTA 2KVRA 2FNJB 4N9F4 1H8CA 2IY1B 2KLGA 2REXA 3ZTCA 3ZW3A 2JWZA 2PE6B 2YLMA 2NBVB 2UYZB 3HIZA 2MP2A 3KVFB 2FIDA 4BKTA 4DDID 2DZJA 1OQYA 4BBNF 1OEYJ 3APCA 4OVUA 3VH4B 1WFYA 4B95A 1SIFA 1WJUA 4WAAA 3PPAA 4KDLB 4IM0A 1R4NI 2RSUA 2C9WB 4GU2A 3WA0A 3QQ8B 2EMSA 3VHTC 4NQKE 4CHKA 2KD0A 3VTUA 3R3MA 4KSLC 3L54A 2K6DB 3PTFC 3B1LX 3DPDA 2GMIC 3ZO5B 4II3B 1LFDA 4GMVA 4W9IA 2IYDB 3UGBB 3VVWB 2L0TA 4AJWA 2PJHA 2BWES 3QARA 2N1VA 4G11A 4I6LB 2O6VD 2EMTA 4GOCA 1WF9A 3MHSD 4GSWA 3K9PB 2DZIA 1WMHA 2KFKA 1RRBA 4TKNA 4JLCA 3ZNGC 4K81A 4ICUA 2L05A 2MW5A 1WGGA 2K8CA 2M0XA 2ZJDA 2KMAA 2V3SA 3UIPB 2D2QA 3P2BA 3PRZA 5CHVC 1E8XA 3LDZE 2N9PC 1UZXB 5J2RA 3TMPB 3M63B 3SD5A 2BF8B 4WWOA 4MSQB 4MSMB 2LXAA 3VDZA 1P0RA 2IO1B 2DZKA 3R66C 4W9EA 3QX1A 3NZSA 3WAMA 2KQSA 2AWTA 2KDBA 1WRDB 2ZNVC 3V62A 4BBNC 1YD8U 1E8WA 2KHWB 5JHBA 2DX5B 2KJ6A 2CHWA 2BPSA 2LGXA 2WX0A 1WJ6A 2NPTB 2JUOA 3HM6X 5IA7A 4BKSA 1JRUA 3KYCD 1IPGA 5D7GA 4WWNA 1T0YA 1WJ4A 2MX2A 3NS8A 4KVGB 2MBOA 3OAWA 2KANA 2XBBC 4MJSB 3KYDD 1TZ1A 2ZCCA 5TR5A 2CS4A 2KC2A 2NVUI 2HJ8A 4KZCA 5LXIB 3C0RB 3PRMB 4DHZB 2I1JA 3JYUA 2KOXA 4MM3A 1MG8A 4FHJA 1J19A 4ICVA 4IWPA 2K8BA 3ZNHB 2IBIB 1R4MI 4LJPB 4CYEA 1KOTA 3H9DA 1WZ3A 2DENB 2KDEB 1WGYA 5G2NA 1I42A 3H7PA 1OEYA 4G50A 4WJNA 1V5TA 1ZW7A 2Y5BB 4DXAB 2MSED 2JZZA 4ZYNA 2JY6A 2L8JA 1RLFA 3B0AA 3PLVA 2L0FA 3A9JB 4PS7A 1WGHA 2O2VB 3V6EB 4ZRKA 3JVZX 4HPLB 3AU4A 1Q1OA 4IC7B 1WIAA 3WAOA 3WIMA 2ASQA 4URKA 1J8CA 3R7QA 4AP4C 4AJYB 4HPMB 3W1SA 4KV2A 1VD2A 2HTHA 2NBUA 3UQBA 3PT2B 5GMVA 4F7ZA 2GBRA 3A1QB 3N3KB 3UF8A 3PVLA 2D10A 2WX1A 2LASA 4MH0E 3ML8A 2L00B 3RT3B 4LDTD 2W9NA 1Q0WB 3T8MA 1NI2A 3DOWA 4HVBA 3H6NA 3M3JA 2EKEC 4IW0A 4NAWA 5J17A 2GBNA 4IUMB 4WQOB 2RR9A 1WM3A 2LXCA 2KMCA 1TGZB 2CHXA 3D32A 2K8HA 3H7SA 1ZKHA 2Z59B 2KWUB 2VRRB 4GB9A 2KN5A 2FIFA 4W9HA 4EOYA 4IG7B 1EF5A 1Z2MA 2MWSB 4A20A 1WJNA 2LD9A 5L95C 3T9LA 1LXDA 5JH5C 3UIOB 1UELA 3NZUA 4LDTB 4GDLB 2V4LA 3AXCA 3TBLD 3AU5A 3ONSA 4ZRIA 4AUQC 5DPTA 1GC7A 1E5WA 2CU1A 2PPHA 3BINA 3CF6E 4KIKA 5HKHA 4FHKA 1E7UA 2MBQA 1UD7A 3A9KA 3MJWA 2KX3A 2C7MB 3IVFA 4E3CA 1BT0A 2N9XA 2XK5B 3VH3B 3L10B 1WGDA 1AARA 2HD5B 3L13A 1EO6A 4FJZA 4G0NB 5G55A 4EEWA 2ZNVB 4GDKB 2AL6A 1P1AA 3L0WB 4WJOA 4MDKE 2CHZA 2M1MA 2KX0A 2JT4B 3KH0A 2V1YA 3QAQA 5CTRC 2KTRA 1C1YB 3GOEA 2DAJA 3KUDB 3SDLC 5D2MB 4FN2A 1UH6A 4II2B 4EZJA 5EDSA 2L7RA 4W9GA 4CO7A 2PEAA 3S2AA 1YJ1A 1SE9A 4BOSC 2Z0EB 2L3ZA 4EZLA 1XD3B 4F1SA 4NQLB 2KZRA 2JXXA 3PGEA 3HK0A 1WE6A 1WY8A 4E71A 2C7NB 3QK0A 1D3ZA 3LJ3A 2G4DB 5D94A 3VAWA 2O6VB 2ZPYA 3DBSA 3NHEB 2KO3A 2LRWA 2MBEA 2KC1A 3U8ZA 1J0GA 2PE9A 4W9FA 1CMXB 2J0KA 3ZTDA 2N1WA 3DVGX 4F8CB 2QHOA 2G4SA 2IY0B 3RYTA 2LGDA 2R2OA 4JIOU 4KZ0A 1WM2A 2LWPA 1TTNA 1GNUA 1LM8B 2AEHA 3QWZB 4MGIE 4NJ6A 5CHFA 1OGWA 5JHAA 1X1MA 2WWZA 4GGQA 4GN1A 3U7DA 3ZNID 2N7DA 1V81A 3JSVA 2ZCBA 1NBFC 4HWIB 2BGFA 2MQJA 2ZEQA 4DK5A 2M4NA 1K8RB 1TBEA 2NS5A 1YX6B 2NBWB 4FJVB 4AOFA 1IP9A 2N7EA 4ZDVA 4NNJB 3QJZA 2MLBA 2MP2B 3DBRI 4IM2A 5C1ZA 3ML9A 1E7VA 4EFOA 4LJOB 3IBEA 3RZWC 2D07B 1WYWB 5E6PA 4RM9A 2A4ZA 3TCAA 3ZDMC 5LXHA 4ANUA 4M8NA 2GOWA 2K39A 3N32A 1RAXA 4FULA 4HDOA 3DBLI 3V61A 2HE7A 3A4SC 4M0WB 3EECA 4ANVA 4RMAA 5D6JB 3PREA 2MA9B 3IHPC 1YQBA 2RD0A 4MELA 4OVVA 3R7RA 4BVUC 3U30A 1WMHB 2KFKB 4A3PA 4JGHB 2DZMA 5DCNA 2XK5A 3PS6A 5FR6A 3NOBA 2WDTB 4NJ7A 4GDKA 3ZKJC 2C60A 3TJPA 1M94A 3DVNU 2YVCA 3ECIA 2C5LC 4P7IA 4FA6A 3I3TB 3AULA 3IFWB 3X0WA 3JW0X 4HK2A 4BKSD 1SGHA 4YL8A 3TIXA 2KQ7A 4DHZE 1WI0A 4DBGA 2BKRB 2NR2A 3KUZA 5JZEB 2K1FA 3RD2A 3QCAA 4TQ1A 1S1QB 5AZHA 2DYMA 2J0MA 1WXVA 1XT9B 3IG3A 3L17A 3L16A 2BKFA 4LCDE 4PS3A 2JZ3B 2O6VA 4XX5A 3GZNI 2LVQA 3CSTA 3QIJA 3ZUNA 4HCPB 3WALA 3AI5A 2FUHB 3DVGY 3ENEA 4MGYE 2BWFA 2FCSA 4RM8A 2KTFA 2IO3B 3A4RA 3PRPB 4HJKA 1PQSA 1HE8A 4HCNB 4PYZA 4EZKA 4ANWA 4WJPA 2JRIB 4HLEA 2NPTA 3KUCB 2RPQA 1WX7A 3DVNV 3RCZA 3TL5A 4DWFA 3N30A 1WXSA 2FCQA 1WE7A 1GC6A 2BYVE 2MCNB 2UWQA 1G6JA 3VUYA 2ZVOA 2KLCA 4IWQA 4MJSA 4B9KA 2FAZA 3CSFA 1NDDA 3ZRFA 1LQBA 2NCNA 4W9KA 4XC2A 4ZRJA 1XQQA 1VCBA 4B6WA 1L2NA 1WH3A 2G3QB 3H7PB 4TUUA 4X57B 5CHWA 1GUAB 1WR1A 3EFUA 3EC8A 4BKGA 3H1UA 1E8ZA 4K7WA 2LVOA 5J18A 1I35A 2D11A 2LJ5A 1OTRB 1UBIA 2N9EB 2JRHA 1V6EA 3DQVA 2DAFA 2KFJA 2XEWA 4GIVA 4HXDA 3ZLZA 2K25A 3DBHI 3SU8X 4MEMA 3RUIB 2J0JA 5C23A 3VUXA 2MBHA 5AZGA 2BYEA 4JL9A 4M8MA 4BFRA 2J7QB 1Q5WB 3M62B 1YIWA 2IO0B 3Q3JA 2L76A 3A9JA 4KSKC 1V49A 2MRPA 1H4RA 3PZDA 1L7YA 4IWOA 2O2VA 1V2YA 3APFA 1P98A 3PSEB 2KNBA 1Y8RC 2C7HA 2KDFB 4PS8A 2MBBB 4EUTA 2RGFA 2LVPA 4JQWC 2K6QA 1WGRA 2A5UA 2CKHB 3PV1A 4ASWC 2JF5A 4NAWB 2LZ6A 1ISNA
chains in the Genus database with same CATH superfamily
2JWUA 2BYFA 1ZE3D 2KJRA 2WGSA 1Z5SB 2Y5CA 3Q2AC 2IGGA 1SEBD 1FNUA 2OOBB 1V1OA 2KJHB 5LLIA 4ARCA 1SBBB 4W9DA 1AW7A 3QC8B 4FLHA 4E74A 1P3QU 2AQ1B 2OJRA 3MTNB 3U2SC 1I4QA 5AUKA 4RH6A 3DDCB 5BO4B 1PYWD 1UUPA 3J9CA 4ANXA 1T6BX 2D3BA 4I6NB 4XDDA 3VTVA 2JYEA 3HUIA 2BBCA 3HHMA 1EUVB 4A90A 2IO2B 1BUIC 4OZCA 2PW9A 1I7HA 3WANA 1WXMA 2ICIA 5E6OA 1WXAA 3ZVVA 5DPRA 3VFKA 2LRUA 1P9DU 3UINB 4KDIC 2QSDA 4FADA 5IKCM 4YTMB 3BZDB 2KDIA 3X23A 2M17A 4FBJB 1VZ7A 2I1KA 1QOAA 2AL3A 1KJTA 3NRZA 4W9JA 2ACZB 5EE1A 3VXWA 1HA5A 4FJYA 3E9SA 2ZVNA 1IGDA 5KHOA 2PKOA 3ZDTA 1H8CA 2FNJB 2KLGA 4NZLB 3ZW3A 2JWZA 3P4QB 3IXSA 2UYZB 1Q10A 2FIDA 1OQYA 1OEYJ 2HTME 1OQQA 1WJUA 3PPAA 3TEZA 4IM0A 1R4NI 2C9WB 2EMSA 4KSLC 3L54A 3TEYA 3ZO5B 3C8YA 3AE1B 1TS5A 4M0WA 2JYTA 3SR6A 1NENB 4I6LB 1VDVA 2O6VD 1WF9A 1V1PB 3K9PB 2DZIA 4ACFA 4RFBA 1C76A 1L4ZB 2KMAA 3AE7B 2W54A 3UIPB 5GXGB 1PGBA 1P7FA 4LK0M 3LDZE 1ZDXA 3TMPB 2GRIA 1NI3A 2DZKA 4W9EA 2VH2A 2NTTA 2WLBA 3I63C 1D6EC 2WX0A 3HM6X 4BKSA 4USAA 2D3CA 1MJDA 3NS8A 3KYDD 1TZ1A 2ONQA 4HJGE 4YSYB 3PRMB 2I1JA 1I4GA 4MM3A 1MG8A 4FHJA 1F52A 4ICVA 1XEEA 4CYEA 3H9DA 4L1BA 2KDEB 2DENB 1OEYA 2MSED 2VZKD 4B0EA 1V8CA 4PS7A 1QOGA 1LO5D 2I2YA 3AU4A 4IC7B 3P4PB 2WXIA 1KFYB 3W1SA 3PO0A 2HTHA 3UQBA 1XLOA 3PT2B 3CWIA 3RPFC 1ZOYB 3PVLA 1KH0A 3ML8A 4RF0A 3T8MA 1RM6C 3DOWA 2MHJA 1VR9A 1HZ5A 4ZHPA 2CHXA 1L6UA 4R3DA 4EOYA 2KN5A 2FIFA 3EUB2 4ZRIA 1E6EB 1GC7A 1YMHE 3MJWA 3TUOA 3VH3B 1AARA 4FJZA 2MJ3A 2ZNVB 4WJOA 3L0WB 2RMMA 2V9HA 4MH8A 4EZJA 2PEAA 1FXAA 2L3ZA 2KZRA 2C7NB 1D3ZA 4RGNA 1I4XA 3NHEB 1D5ZC 2LRWA 2MBEA 3U8ZA 5HG2A 2WXMA 3ZJVA 2G4SA 3NS1A 3RYTA 2MJEA 1FRDA 4O1NA 2LWPA 2AEHA 3QWZB 5CHFA 5JHAA 3T3OA 2ZCBA 3DWMA 2W82A 1FNVA 2BGFA 2WDRB 1K8RB 5C1ZA 3IBEA 1GAQB 5D3IB 1FNWA 1ET6A 1L0VB 4M8NA 2YEPF 2J53A 2K39A 4OZBA 3DBLI 3DBLB 1VJKA 3A4SC 4M0WB 1EM7A 5D6JB 3PREA 2N9LA 2MA9B 2XN9C 2QJLA 2KYWA 5LNK1 2RD0A 4OVVA 3R7RA 3NVYA 4BVUC 4P6VF 3KWVA 5DCNA 1E9MA 2V0GA 2WDTB 2HJ1A 3ZKJC 4C56C 3DVNU 4P7IA 1F0ZA 2AQ3B 1L5PA 2J4XA 3AE4B 2IGDA 3TIXA 2KQ7A 4A55A 5JZEB 1TS4A 2K1FA 3EFCA 3RD2A 4ZRPA 1J7CA 3IG3A 4IKGA 4QAYA 2BKFA 2O6VA 3GZNI 3GZNB 3R2IA 3ZUNA 4RF1A 3WALA 3AI5A 3DVGY 4MGYE 3MP9A 1KTKA 2MH7A 2L32A 4EZKA 1SE2A 2IDYA 2K3UA 2NPTA 3RCZA 2W3RA 5G5GA 4WURA 4S0RA 1WXSA 2FCQA 4MM3B 3OG5A 3Q69A 2MCNB 1G6JA 3IT4B 1FMAD 2JSVX 4LTUA 2MEKA 3ZRFA 2KACA 2KAJA 2G3QB 1IBXA 4TUUA 1I35A 4K7WA 3ZLZA 4RGOS 4MEMA 2MBHA 4K3CA 2IO0B 2L76A 1H4RA 3PZDA 1L7YA 4IWOA 2O2VA 3BK1A 1XO3A 3APFA 1JW9D 3PSEB 1ZUD2 4YSXB 2MBBB 3MFGA 2X8XX 2A5UA 2CKHB 4ASWC 2JF5A 3PZ8A 4WQMA 3KWLA 3Q3FA 1YJJA 1WYGA 3OJ4B 1TKEA 2DHZA 2DYOA 3HVZA 3DBRB 3RULA 4B0MA 4NPNA 3W1SC 4W9CA 3ABVB 5AEKB 1BMLC 1TJEA 5HFYA 3O65B 3KW5B 3QHTA 1VZ8A 2LUEA 1V9JA 4Q2JA 2R2QA 4EE2A 2M56B 2I38A 3LXFA 2L52A 3ZQ4A 3APDA 1TS3A 2WYQA 1GJZA 4US9A 2B3AA 1FM0D 2KWDA 1TYGB 1NVID 3DWGC 4TQ0A 1MHXA 3ZJTA 4EKUA 3PHWB 3V60A 2RDGA 1N62A 5CX3A 2DWQA 4OZAA 1KLVA 2WDVB 3DCGA 4I6PA 2IPKD 2G9HD 4K1RB 1YX5B 3EGRA 1JWAD 1UBQA 2BS4B 2AYOB 1RFAA 2GLSA 1N60A 3VUWA 2LGYA 3OLMD 5DPSA 3VTWA 3OJ3A 3QA8A 5KHQA 4JWUC 2LFIA 4IM3A 3AEBB 2ZPNA 1XF5L 2ZZPB 2WXKA 1F77A 2M8SA 1SE3A 1ZP0B 4FXCA 2IY1B 2WU2B 2REXA 2EELA 2YLMA 2NBVB 4TSSA 3ZYYX 4OVUA 1WFYA 2BS2B 1SIFA 4WAAA 1JROA 4KDLB 2SEBD 4MACA 3WA0A 1MPEA 1QT9A 5TSSA 2H88B 2OJWA 4NQKE 4CHKA 3B2GA 2LGSA 3PTFC 1BXTA 2GMIC 3DHIC 1SIJA 1J7BA 1TIFA 2WHIA 3AE9B 3DHGC 3Q3NC 2ZJDA 2V3SA 3AEEB 2Q5WD 2D2QA 1YQ4B 4XDCA 1P7EA 3P63A 3SD5A 2BF8B 4MSMB 3BIID 3FILA 2KDBA 4M01A 1WRDB 3V62A 1YD8U 2KHWB 1WGKA 2BPSA 1TY2A 2LGXA 1WJ6A 2NPTB 3R2TA 4OHJA 3KYCD 1D5MC 5D7GA 1HXYD 2MX2A 4KVGB 3RI7C 2INPE 4RGMA 2KANA 2XBBC 2CU3A 1ACCA 5LXIB 3JYUA 2PVOD 1IBXB 1XLPA 4IWPA 2K8BA 3ZNHB 4ITKA 4LJPB 1KOTA 1ZXIA 5G2NA 1I42A 2X38A 3NZ3A 1GB4A 1PGXA 1MHHE 4ZYNA 2FE8A 3PLVA 2O2VB 4ZRKA 2BW2A 1WIAA 3SEBA 3R7QA 4AP4C 4HPMB 5BMIA 5IO9A 4KV2A 1VD2A 3AN1A 4ZOHC 4F7ZA 2VZKB 5HHDG 2J42A 2D10A 2LASA 2L00B 4LDTD 3Q3OC 1NI2A 4HVBA 1JWUD 2G1EA 3H6NA 5J17A 5E6JA 4WQOB 2RR9A 3RNAC 1T5XD 2KMCA 2KN4A 3D32A 1ESFA 2Z59B 2KWUB 4W9HA 4US8A 4IG7B 1Z2MA 3OWEB 5L95C 3T9LA 3NZUA 1WXQA 1SXTA 1R4NB 2KT7A 1L0YB 2WXOA 3AU5A 3ONSA 1N5WA 1E5WA 3TEWA 4KIKA 2WXGA 1UNSA 4E3CA 2KX3A 2C7MB 1BT0A 3V05A 3SFEB 2AL6A 4XWTA 2CHZA 1HZ6A 3ZXRA 3KH0A 3QAQA 5CTRC 2KTRA 1C1YB 2DAJA 3KUDB 4KGTA 2MJDA 4FN2A 1UH6A 2Y5PA 4OW0A 4CO7A 1C77A 1XD3B 3KLSX 4NQLB 2JXXA 3HK0A 1FFUA 1SSNA 2H89B 3LJ3A 1STEA 3VAWA 3DBSA 2KO3A 1I4RA 2PE9A 2QMTA 4W9FA 1CMXB 5JXVA 3ZTDA 2N1WA 4F8CB 2QIEB 2QHOA 2IY0B 4IOIE 4KZ0A 4IDIA 4MGIE 4GGQA 3ZNID 3N1ZC 4DK5A 1TBEA 2IGHA 2K5PA 2NBWB 3MC8A 4NNJB 3BVZA 1YQ3B 1Y56A 4LJOB 3RZWC 1IUEA 5E6PA 1QILA 2INCC 4RM9A 2A4ZA 3ZDMC 5LXHA 3N32A 1RAXA 4FULA 1K51A 4HKZE 1WWTA 3EECA 2GI9A 1SB3C 2WU5B 4RMAA 3RMKC 4ANVA 3IHPC 5C2TB 1YQBA 1ENFA 4PT5A 3U30A 4LNIA 1VLBA 4JGHB 2DZMA 1NYQA 2XK5A 3PS6A 3Q3MC 4GDKA 4FA6A 2JXTA 1MVKA 3AULA 3MC0B 3X0WA 3JW0X 5FKAC 1LGRA 1D4BA 1JWBD 2NR2A 1UGJA 3FILB 4BZAA 3I5JC 4TQ1A 5AZHA 1WXVA 1XT9B 3L17A 4KX6B 4LCDE 4XX5A 1FD6A 2LVQA 4HCPB 1N61A 4RGTA 3ENEA 2FCSA 3PRPB 1FFVA 2JRIB 3E56A 3ZXVA 3TL5A 3ZGZA 1WE7A 2K0PA 1GC6A 2ZVOA 2WP9B 2SAKA 2NCNA 4XC2A 4ZRJA 2JX5A 3VRBB 1WR1A 3EC8A 1TZOA 4BKGA 1E8ZA 2LJ5A 1UBIA 3N20C 3ZJUA 2DAFA 2XEWA 3ETRA 3DBHI 3DBHB 3RUIB 2J0JA 5C23A 5C3JB 1Q5WB 3M62B 1YIWA 1PUTA 4H2AA 5AUIA 3A9JA 1IGCA 2DBYA 2EKIA 1XLQA 4BAXA 2KMMA 1Y8RC 1ET9A 2RGFA 1R7SA 2V4LA 2XNAC 1ISNA 3AE8B 4HROA 4W9LA 2GBKA 3A1QA 4A6QA 2FCNA 3AB5A 4AQ7A 2KXJA 1V80A 2NTSA 4LNNA 4DHJD 1IYFA 3CIRB 5AZFA 3EHVA 3RZFA 2QDFA 2Z0DB 4NY0A 3A33B 3ZNZB 5I4DA 1FXTB 3Q8EA 1C3TA 4KIKB 2IZVB 1KM7A 1WZ0A 4GDLA 4WWMA 3VQIA 1WX9A 3URYA 3PZ7A 4G3XB 2D3GA 3M95A 1GG3A 2QCZA 2KTRB 3ALBA 2ON8A 5H8YE 1CK1A 4L2YA 3V6CB 4PYUA 3EA6A 2WDQB 3NVZA 2GBJA 3VR8B 3ZIMA 2FCMA 1EF1A 1MFWA 1CQVA 1SJED 2RDHA 4BOZB 1S3SG 4TV3A 3P4RB 3HM3A 2WXNA 2KWVB 3SHQA 4S17A 3MHZA 3WAPA 2DYBA 1FXIA 1QKZA 2PLPA 4HDQA 1VZ6A 2CJNA 2LGIA 1V86A 3ZRCA 3P4SB 1E90A 4C80A 1T0QC 1EU4A 3R8BA 2BYTA 3ZTCA 2PE6B 3KVFB 4BBNF 3VH4B 5FK9C 1CZPA 2RSUA 2KD0A 3IAS1 4XWWA 4P1BC 4II3B 1LFDA 4GMVA 2IYDB 4YXDB 2L0TA 4AJWA 1EWCA 4KKIA 4G11A 2BWES 1I4PA 2EMTA 3V3XA 4GOCA 2KFKA 1RRBA 3ZNGC 3IT6B 4ICUA 2MW5A 1WGGA 1FO4A 5CHVC 1E8XA 2N9PC 1UZXB 2PVGC 3RNFC 1WRIA 4MSQB 3VDZA 1P0RA 2IO1B 3Q6BA 3NZSA 3WAMA 2KQSA 2AWTA 1E8WA 4WH4A 2DX5B 2BT6A 2CHWA 1T0SC 4HKQA 1JRUA 1T0YA 5IOIA 3OAWA 1C79A 2ZCCA 2CS4A 2KC2A 1XCTL 2HJ8A 3U7ZA 1JMLA 1R4MI 2IBIB 1C78A 3NVWA 1WZ3A 4TMAB 2JQRB 3P42A 4WJNA 1V5TA 3AEGB 1ZW7A 2Y5BB 2LHDA 1L4DB 2L8JA 3B0AA 3A9JB 1WGHA 3JVZX 2DLBA 1E7PB 3WAOA 3WIMA 4URKA 1J8CA 2K9XA 4AJYB 1TKYA 1SE4A 2PIAA 1NYRA 1DOXA 4YWGG 2NBUA 5GMVA 3A1QB 3UF8A 2WX1A 2K22A 2LUMA 2LHEA 2EKEC 3B2FA 4IW0A 1RYJA 4NAWA 2GBNA 4IUMB 2LXCA 1TGZB 2R61A 4K3BA 1ZKHA 2HDEA 1VRAB 4GB9A 4GLSC 1EF5A 4A20A 1WJNA 4JWSC 4N59A 1QQRA 3RNEC 5JH5C 4LDTB 4GDLB 1OQRA 1PDXA 4PK1A 3AXCA 1T3QA 1SF0A 4AUQC 5DPTA 1C4PA 2VH1A 2PPHA 4OVZA 3HVDA 5IP4D 5HKHA 4FHKA 2MBQA 1UD7A 3A9KA 3IVFA 2N9XA 2LEKA 2HD5B 3L13A 5G55A 1EO6A 4EEWA 4G0NB 5D3DA 1P1AA 2M1MA 2BTEA 2JT4B 2OEDA 2KDMA 4N6EB 3SDLC 2PMVA 5D2MB 4II2B 1HEZE 2L7RA 3S2AA 1SE9A 2Z0EB 3PGEA 1N63A 4E71A 2O6VB 2ZPYA 2INNE 4XYCA 3Q8AA 1KF6B 3LB8C 2J0KA 3DVGX 3MC9A 1WSPA 2R2OA 2QEJC 4NJ6A 2V3NA 4GN1A 3U7DA 2N7DA 1V81A 3JSVA 1KLUD 4HWIB 1NBFC 2MQJA 2PTLA 2M4NA 3FAHA 1YX6B 4FJVB 1TKGA 2MLBA 2WXFA 4J3OD 3ML9A 2D07B 1WYWB 1JCKB 1N5XA 1B1ZA 3TCAA 4ANUA 2M0AA 4WAFA 3HRDD 2V3PA 3V61A 3AE3B 2J52A 2Z8LA 4JPSA 1HQRD 1B9RA 2KFKB 3AEAB 4A3PA 3AMZA 1ROEA 5FR6A 3NOBA 1EU3A 2D5GA 2C60A 3TJPA 2ZW0A 1M94A 3ECIA 4YTPB 4UDUC 3U4EG 3I3TB 3NUHB 1XXGA 4YL8A 3Q8FA 4DHZE 1WI0A 4ZHOA 1FIQA 4C4VA 2DYMA 5BMGA 3Q8BA 2J0MA 2WS3B 4C00A 3L16A 1L6VA 1KLGD 1E10A 2FUHB 2BWFA 2KTFA 2IO3B 3A4RA 4HJKA 4KGSA 1HE8A 3WCQA 1YNTE 4DXFA 4LLGM 1N6ZA 3L4PA 4HLEA 2V4IB 1WX7A 4AS1A 3RN9C 2BYVE 1TS2A 4IWQA 2KLCA 1EWYC 4MJSA 4B9KA 3IAM1 1AYFA 1C4CA 4W9KA 1L2NA 4B6WA 1VCBA 1AWDA 1WH3A 2BB6A 1NEKB 1XLNA 1GUAB 3EFUA 1T0RC 3H1UA 2LVOA 3NJTA 2D11A 2N9EB 3DQVA 2KFJA 1TT5B 1PFDA 2K25A 2WNMA 3I57A 2RPVA 3MJ5A 5AZGA 1RWSA 4M8MA 2J7QB 4KSKC 2MRPA 3U52E 5T8IA 1V2YA 4RCOA 3N9YC 1P98A 3NG0A 3W5UB 2C7HA 4ZRQA 2KDFB 1FCLA 2K6QA 4NAWB 1SJHD 2LZ6A 1TY0A 3BWUD 1E8YA 5BYRA 4WJQA 1F9JA 3H8HA 1V5OA 1ZDVA 2KWCA 2QC8A 5IAAC 3UQAA 3Q8CA 3BY4B 1ZXHA 2JPHA 4HEA1 2LMCA 1WX8A 3B9JA 3RFZB 2KKCA 3NY5A 4MGZE 2WXJA 4A3OA 4LNOA 1U4AA 2RDBC 5DPWA 3A9KB 4WWPA 4DHJB 2CR5A 2KK8A 4A9AA 1A5RA 1JQ4A 1K53A 4GXBA 3C19A 2LI5A 3PHXB 5E6NA 3AM9A 4MT5A 2YEPB 1WR6E 1QZEA 1I4HA 1UGMA 3CMMB 1HTOA 3GE3C 4MGKE 4L23A 1ZGUB 2G45B 2GBMA 3RNCC 1FCCC 5EE0A 3AE5B 3PLUA 2N4FA 1C9FA 4CQNA 4A8XC 4DXGA 5L83A 4J6IA 2CJOA 2UU7A 2GB1A 5EE9A 4K7SA 3GS2A 2L83A 3B08A 3K9OB 1D5XC 1JWSD 4JX1C 4XZ4A 1GB1A 1KRHA 2JVCA 3JSVB 1FEHA 3W9CB 4K7UA 3L08A 1L0XB 4AWJA 1HTQA 3AE6B 4DDGD 1AN8A 3W1YA 2FBWB 2KVRA 1A70A 4N9F4 4KKJA 5HI1A 3HIZA 2MP2A 4BKTA 4DDID 2DZJA 4B95A 3APCA 3TEXA 1K52A 1YJIA 4GU2A 3QQ8B 3VHTC 3VTUA 3R3MA 2K6DB 1E0ZA 3B1LX 1FPYA 3DPDA 4W9IA 3VVWB 3UGBB 4D2KA 2B76B 2PJHA 3QARA 2N1VA 3MHSD 4GSWA 1WMHA 4TKNA 4JLCA 4K81A 2L05A 2M0XA 2K8CA 3P2BA 3PRZA 2N0SB 3I9V1 4C4VB 5J2RA 3M63B 4WWOA 2LXAA 4M02A 3AV8A 3R66C 3TSSA 3QX1A 4RNAA 1QLBB 1F1HA 2ZNVC 4HRSA 4BBNC 1JRPA 5JHBA 2W3SA 2KJ6A 5IA7A 2JUOA 1IPGA 4WWNA 3VRAB 4ZYSA 1WJ4A 2MBOA 4MJSB 5TR5A 3GP7A 2NVUI 3LYYA 4KZCA 3AEFB 2WXLA 3C0RB 4DHZB 2KOXA 3O13A 3AH7A 1J19A 1WGYA 3H7PA 3AE2B 4G50A 4DXAB 2E3TA 2W55A 2JZZA 3N1YC 1RFKA 2JY6A 4C7YA 1RLFA 2L0FA 3V6EB 4LNKA 3BVGA 4HPLB 1YOVB 1Q1OA 3N1XC 4HPPA 2ASQA 5G5HA 3VR9B 3FC4A 2BB5A 1M4VA 2GBRA 3N3KB 2WQYB 2OHFA 4MH0E 2BVCA 3RT3B 2W9NA 4C7ZA 4LNFA 1Q0WB 3M3JA 1UWXA 1WM3A 1XCQL 3W2DA 2K8HA 3H7SA 2N7JA 3Q14C 2VRRB 1QOBA 1GOZA 5BYQA 3NVVA 3GE8C 3RNBC 2MWSB 2LD9A 3T3NA 2N9KA 1C4AA 1LXDA 3UIOB 1UELA 2M19A 1CJEA 3TBLD 3DHHC 2WXRA 2CU1A 3BINA 3CF6E 1E7UA 4P16A 1F2RI 2XK5B 3L10B 1UWMA 1WGDA 3BYYB 4GDKB 4MDKE 2KX0A 2V1YA 3GOEA 4REZA 5EDSA 4W9GA 3UI3A 1YJ1A 4BOSC 3KQ4A 5H92C 1YN5A 2FUG1 4EZLA 2WXPA 4F1SA 1WE6A 1WY8A 4NAMA 4P1CC 3QK0A 4M00A 1V97A 2G4DB 5D94A 5BYSA 2TSSA 1F2RC 2KC1A 1J0GA 1DGJA 2JZPA 3P1MA 2LGDA 4JIOU 1WM2A 1GPXA 1TTNA 1GNUA 1LM8B 1OGWA 1X1MA 2BS3B 2WWZA 4KGRA 2ZEQA 2Y3AA 2NS5A 4AOFA 3W5VB 1IP9A 2N7EA 4ZDVA 3QJZA 4DQOC 5IN7A 2MP2B 3DBRI 4IM2A 1E7VA 4EFOA 1JALA 1FRRA 3RNGC 1YN4A 1UF0A 1R4MB 2GOWA 4HDOA 3GB1A 1J7AA 2HE7A 1QF6A 2E6XA 2L1AA 4MELA 1MG4A 1WMHB 2ZW1A 4NJ7A 2YVCA 2C5LC 1V1PA 3IFWB 2BQQA 4HK2A 4BKSD 1SGHA 1DOIA 2AX5A 4DBGA 2BKRB 3KUZA 3BK2A 4ARIA 3QCAA 1S1QB 3AEDB 4NJCA 2AQ2B 4PS3A 2JZ3B 3CSTA 3QIJA 3AECB 3BVMA 4RM8A 1PGAA 1PQSA 1DYQA 4HCNB 4WIPA 5BMHA 4PYZA 2DNFA 4ANWA 4WJPA 3KUCB 1YN3A 1OFFA 2RPQA 3DVNV 4DWFA 5MPOA 3N30A 4YTNB 3FKYA 2KVZA 2UWQA 2IJ0A 3VUYA 4XE0A 2FAZA 3CSFA 1NDDA 1LQBA 1XQQA 1K50A 3H7PB 4X57B 2WXHA 5CHWA 2NMQA 1QOFA 2D3AA 2KQ4X 2LJIA 5J18A 1OTRB 2JRHA 1V6EA 5FR3A 4GIVA 4HXDA 4YT0B 3SU8X 1DOYA 2WXQA 3VUXA 2BYEA 4JL9A 5EE3A 4BFRA 4JE3B 3BYTB 3Q3JA 2JU6X 1V49A 4XGAB 4N58A 1JWMD 2QILA 1MI0A 2KNBA 4YSZB 4PS8A 4EUTA 1ZPSA 2LVPA 4JQWC 1WGRA 3SFDB 3PV1A 2INDC
chains in the Genus database with same CATH topology
2BYFA 2KJRA 2GBKA 3A1QA 1Z5SB 4W9LA 1E8YA 2FCNA 3Q3FA 2KXJA 3OJ4B 1V80A 1F9JA 2DHZA 4WJQA 1V5OA 2DYOA 2OOBB 4DHJD 1IYFA 2KWCA 2KJHB 5IAAC 3UQAA 3BY4B 2JPHA 5LLIA 4W9DA 3EHVA 5AZFA 3RULA 3RZFA 4NPNA 3W1SC 1WX8A 3QC8B 4FLHA 4E74A 4W9CA 2KKCA 2Z0DB 3NY5A 5AEKB 1P3QU 4MGZE 3A33B 4NY0A 3ZNZB 1FXTB 2OJRA 3MTNB 4A3OA 1C3TA 3O65B 3KW5B 3QHTA 4KIKB 2LUEA 2IZVB 1KM7A 1V9JA 1U4AA 1WZ0A 2R2QA 3DDCB 3A9KB 4WWPA 4GDLA 5DPWA 3VQIA 1WX9A 5BO4B 4DHJB 2CR5A 2KK8A 1A5RA 4ANXA 4G3XB 2D3GA 4I6NB 3VTVA 3M95A 1GG3A 4GXBA 2KTRB 2LI5A 3ALBA 3PHXB 3APDA 5E6NA 3HHMA 1EUVB 2WYQA 1GJZA 2IO2B 2B3AA 1WR6E 1QZEA 3V6CB 4PYUA 4TQ0A 1UGMA 2GBJA 4EKUA 3CMMB 3PHWB 3WANA 1WXMA 3V60A 4MGKE 3ZIMA 2FCMA 1EF1A 5E6OA 1WXAA 1ZGUB 5CX3A 5DPRA 2G45B 2GBMA 3ZVVA 4BOZB 3PLUA 2N4FA 1S3SG 3VFKA 2LRUA 4TV3A 1KLVA 1P9DU 5L83A 3UINB 4J6IA 3DCGA 3HM3A 4I6PA 4K7SA 4KDIC 4FADA 3B08A 2KWVB 3K9OB 4K1RB 1YX5B 2KDIA 3SHQA 4XZ4A 3X23A 1UBQA 2M17A 3WAPA 4FBJB 2I1KA 2AYOB 1RFAA 2DYBA 3VUWA 2LGYA 2AL3A 1KJTA 3OLMD 2JVCA 3JSVB 3OJ3A 3QA8A 5DPSA 3VTWA 5KHQA 4W9JA 4IM3A 4HDQA 3VXWA 2ZPNA 2ZZPB 4FJYA 1V86A 2ZVNA 3L08A 4K7UA 3ZRCA 5KHOA 4AWJA 1E90A 4DDGD 2M8SA 3W1YA 3ZDTA 2KVRA 2FNJB 4N9F4 1H8CA 2IY1B 2KLGA 2REXA 3ZTCA 3ZW3A 2JWZA 2PE6B 2YLMA 2NBVB 2UYZB 3HIZA 2MP2A 3KVFB 2FIDA 4BKTA 4DDID 2DZJA 1OQYA 4BBNF 1OEYJ 3APCA 4OVUA 3VH4B 1WFYA 4B95A 1SIFA 1WJUA 4WAAA 3PPAA 4KDLB 4IM0A 1R4NI 2RSUA 2C9WB 4GU2A 3WA0A 3QQ8B 2EMSA 3VHTC 4NQKE 4CHKA 2KD0A 3VTUA 3R3MA 4KSLC 3L54A 2K6DB 3PTFC 3B1LX 3DPDA 2GMIC 3ZO5B 4II3B 1LFDA 4GMVA 4W9IA 2IYDB 3UGBB 3VVWB 2L0TA 4AJWA 2PJHA 2BWES 3QARA 2N1VA 4G11A 4I6LB 2O6VD 2EMTA 4GOCA 1WF9A 3MHSD 4GSWA 3K9PB 2DZIA 1WMHA 2KFKA 1RRBA 4TKNA 4JLCA 3ZNGC 4K81A 4ICUA 2L05A 2MW5A 1WGGA 2K8CA 2M0XA 2ZJDA 2KMAA 2V3SA 3UIPB 2D2QA 3P2BA 3PRZA 5CHVC 1E8XA 3LDZE 2N9PC 1UZXB 5J2RA 3TMPB 3M63B 3SD5A 2BF8B 4WWOA 4MSQB 4MSMB 2LXAA 3VDZA 1P0RA 2IO1B 2DZKA 3R66C 4W9EA 3QX1A 3NZSA 3WAMA 2KQSA 2AWTA 2KDBA 1WRDB 2ZNVC 3V62A 4BBNC 1YD8U 1E8WA 2KHWB 5JHBA 2DX5B 2KJ6A 2CHWA 2BPSA 2LGXA 2WX0A 1WJ6A 2NPTB 2JUOA 3HM6X 5IA7A 4BKSA 1JRUA 3KYCD 1IPGA 5D7GA 4WWNA 1T0YA 1WJ4A 2MX2A 3NS8A 4KVGB 2MBOA 3OAWA 2KANA 2XBBC 4MJSB 3KYDD 1TZ1A 2ZCCA 5TR5A 2CS4A 2KC2A 2NVUI 2HJ8A 4KZCA 5LXIB 3C0RB 3PRMB 4DHZB 2I1JA 3JYUA 2KOXA 4MM3A 1MG8A 4FHJA 1J19A 4ICVA 4IWPA 2K8BA 3ZNHB 2IBIB 1R4MI 4LJPB 4CYEA 1KOTA 3H9DA 1WZ3A 2DENB 2KDEB 1WGYA 5G2NA 1I42A 3H7PA 1OEYA 4G50A 4WJNA 1V5TA 1ZW7A 2Y5BB 4DXAB 2MSED 2JZZA 4ZYNA 2JY6A 2L8JA 1RLFA 3B0AA 3PLVA 2L0FA 3A9JB 4PS7A 1WGHA 2O2VB 3V6EB 4ZRKA 3JVZX 4HPLB 3AU4A 1Q1OA 4IC7B 1WIAA 3WAOA 3WIMA 2ASQA 4URKA 1J8CA 3R7QA 4AP4C 4AJYB 4HPMB 3W1SA 4KV2A 1VD2A 2HTHA 2NBUA 3UQBA 3PT2B 5GMVA 4F7ZA 2GBRA 3A1QB 3N3KB 3UF8A 3PVLA 2D10A 2WX1A 2LASA 4MH0E 3ML8A 2L00B 3RT3B 4LDTD 2W9NA 1Q0WB 3T8MA 1NI2A 3DOWA 4HVBA 3H6NA 3M3JA 2EKEC 4IW0A 4NAWA 5J17A 2GBNA 4IUMB 4WQOB 2RR9A 1WM3A 2LXCA 2KMCA 1TGZB 2CHXA 3D32A 2K8HA 3H7SA 1ZKHA 2Z59B 2KWUB 2VRRB 4GB9A 2KN5A 2FIFA 4W9HA 4EOYA 4IG7B 1EF5A 1Z2MA 2MWSB 4A20A 1WJNA 2LD9A 5L95C 3T9LA 1LXDA 5JH5C 3UIOB 1UELA 3NZUA 4LDTB 4GDLB 2V4LA 3AXCA 3TBLD 3AU5A 3ONSA 4ZRIA 4AUQC 5DPTA 1GC7A 1E5WA 2CU1A 2PPHA 3BINA 3CF6E 4KIKA 5HKHA 4FHKA 1E7UA 2MBQA 1UD7A 3A9KA 3MJWA 2KX3A 2C7MB 3IVFA 4E3CA 1BT0A 2N9XA 2XK5B 3VH3B 3L10B 1WGDA 1AARA 2HD5B 3L13A 1EO6A 4FJZA 4G0NB 5G55A 4EEWA 2ZNVB 4GDKB 2AL6A 1P1AA 3L0WB 4WJOA 4MDKE 2CHZA 2M1MA 2KX0A 2JT4B 3KH0A 2V1YA 3QAQA 5CTRC 2KTRA 1C1YB 3GOEA 2DAJA 3KUDB 3SDLC 5D2MB 4FN2A 1UH6A 4II2B 4EZJA 5EDSA 2L7RA 4W9GA 4CO7A 2PEAA 3S2AA 1YJ1A 1SE9A 4BOSC 2Z0EB 2L3ZA 4EZLA 1XD3B 4F1SA 4NQLB 2KZRA 2JXXA 3PGEA 3HK0A 1WE6A 1WY8A 4E71A 2C7NB 3QK0A 1D3ZA 3LJ3A 2G4DB 5D94A 3VAWA 2O6VB 2ZPYA 3DBSA 3NHEB 2KO3A 2LRWA 2MBEA 2KC1A 3U8ZA 1J0GA 2PE9A 4W9FA 1CMXB 2J0KA 3ZTDA 2N1WA 3DVGX 4F8CB 2QHOA 2G4SA 2IY0B 3RYTA 2LGDA 2R2OA 4JIOU 4KZ0A 1WM2A 2LWPA 1TTNA 1GNUA 1LM8B 2AEHA 3QWZB 4MGIE 4NJ6A 5CHFA 1OGWA 5JHAA 1X1MA 2WWZA 4GGQA 4GN1A 3U7DA 3ZNID 2N7DA 1V81A 3JSVA 2ZCBA 1NBFC 4HWIB 2BGFA 2MQJA 2ZEQA 4DK5A 2M4NA 1K8RB 1TBEA 2NS5A 1YX6B 2NBWB 4FJVB 4AOFA 1IP9A 2N7EA 4ZDVA 4NNJB 3QJZA 2MLBA 2MP2B 3DBRI 4IM2A 5C1ZA 3ML9A 1E7VA 4EFOA 4LJOB 3IBEA 3RZWC 2D07B 1WYWB 5E6PA 4RM9A 2A4ZA 3TCAA 3ZDMC 5LXHA 4ANUA 4M8NA 2GOWA 2K39A 3N32A 1RAXA 4FULA 4HDOA 3DBLI 3V61A 2HE7A 3A4SC 4M0WB 3EECA 4ANVA 4RMAA 5D6JB 3PREA 2MA9B 3IHPC 1YQBA 2RD0A 4MELA 4OVVA 3R7RA 4BVUC 3U30A 1WMHB 2KFKB 4A3PA 4JGHB 2DZMA 5DCNA 2XK5A 3PS6A 5FR6A 3NOBA 2WDTB 4NJ7A 4GDKA 3ZKJC 2C60A 3TJPA 1M94A 3DVNU 2YVCA 3ECIA 2C5LC 4P7IA 4FA6A 3I3TB 3AULA 3IFWB 3X0WA 3JW0X 4HK2A 4BKSD 1SGHA 4YL8A 3TIXA 2KQ7A 4DHZE 1WI0A 4DBGA 2BKRB 2NR2A 3KUZA 5JZEB 2K1FA 3RD2A 3QCAA 4TQ1A 1S1QB 5AZHA 2DYMA 2J0MA 1WXVA 1XT9B 3IG3A 3L17A 3L16A 2BKFA 4LCDE 4PS3A 2JZ3B 2O6VA 4XX5A 3GZNI 2LVQA 3CSTA 3QIJA 3ZUNA 4HCPB 3WALA 3AI5A 2FUHB 3DVGY 3ENEA 4MGYE 2BWFA 2FCSA 4RM8A 2KTFA 2IO3B 3A4RA 3PRPB 4HJKA 1PQSA 1HE8A 4HCNB 4PYZA 4EZKA 4ANWA 4WJPA 2JRIB 4HLEA 2NPTA 3KUCB 2RPQA 1WX7A 3DVNV 3RCZA 3TL5A 4DWFA 3N30A 1WXSA 2FCQA 1WE7A 1GC6A 2BYVE 2MCNB 2UWQA 1G6JA 3VUYA 2ZVOA 2KLCA 4IWQA 4MJSA 4B9KA 2FAZA 3CSFA 1NDDA 3ZRFA 1LQBA 2NCNA 4W9KA 4XC2A 4ZRJA 1XQQA 1VCBA 4B6WA 1L2NA 1WH3A 2G3QB 3H7PB 4TUUA 4X57B 5CHWA 1GUAB 1WR1A 3EFUA 3EC8A 4BKGA 3H1UA 1E8ZA 4K7WA 2LVOA 5J18A 1I35A 2D11A 2LJ5A 1OTRB 1UBIA 2N9EB 2JRHA 1V6EA 3DQVA 2DAFA 2KFJA 2XEWA 4GIVA 4HXDA 3ZLZA 2K25A 3DBHI 3SU8X 4MEMA 3RUIB 2J0JA 5C23A 3VUXA 2MBHA 5AZGA 2BYEA 4JL9A 4M8MA 4BFRA 2J7QB 1Q5WB 3M62B 1YIWA 2IO0B 3Q3JA 2L76A 3A9JA 4KSKC 1V49A 2MRPA 1H4RA 3PZDA 1L7YA 4IWOA 2O2VA 1V2YA 3APFA 1P98A 3PSEB 2KNBA 1Y8RC 2C7HA 2KDFB 4PS8A 2MBBB 4EUTA 2RGFA 2LVPA 4JQWC 2K6QA 1WGRA 2A5UA 2CKHB 3PV1A 4ASWC 2JF5A 4NAWB 2LZ6A 1ISNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BYF A;  2KJR A;  2GBK A;  3A1Q A;  1Z5S B;  4W9L A;  1E8Y A;  2FCN A;  3Q3F A;  2KXJ A;  3OJ4 B;  1V80 A;  1F9J A;  2DHZ A;  4WJQ A;  1V5O A;  2DYO A;  2OOB B;  4DHJ D;  1IYF A;  2KWC A;  2KJH B;  5IAA C;  3UQA A;  3BY4 B;  2JPH A;  5LLI A;  4W9D A;  3EHV A;  5AZF A;  3RUL A;  3RZF A;  4NPN A;  3W1S C;  1WX8 A;  3QC8 B;  4FLH A;  4E74 A;  4W9C A;  2KKC A;  2Z0D B;  3NY5 A;  5AEK B;  1P3Q U;  4MGZ E;  3A33 B;  4NY0 A;  3ZNZ B;  1FXT B;  2OJR A;  3MTN B;  4A3O A;  1C3T A;  3O65 B;  3KW5 B;  3QHT A;  4KIK B;  2LUE A;  2IZV B;  1KM7 A;  1V9J A;  1U4A A;  1WZ0 A;  2R2Q A;  3DDC B;  3A9K B;  4WWP A;  4GDL A;  5DPW A;  3VQI A;  1WX9 A;  5BO4 B;  4DHJ B;  2CR5 A;  2KK8 A;  1A5R A;  4ANX A;  4G3X B;  2D3G A;  4I6N B;  3VTV A;  3M95 A;  1GG3 A;  4GXB A;  2KTR B;  2LI5 A;  3ALB A;  3PHX B;  3APD A;  5E6N A;  3HHM A;  1EUV B;  2WYQ A;  1GJZ A;  2IO2 B;  2B3A A;  1WR6 E;  1QZE A;  3V6C B;  4PYU A;  4TQ0 A;  1UGM A;  2GBJ A;  4EKU A;  3CMM B;  3PHW B;  3WAN A;  1WXM A;  3V60 A;  4MGK E;  3ZIM A;  2FCM A;  1EF1 A;  5E6O A;  1WXA A;  1ZGU B;  5CX3 A;  5DPR A;  2G45 B;  2GBM A;  3ZVV A;  4BOZ B;  3PLU A;  2N4F A;  1S3S G;  3VFK A;  2LRU A;  4TV3 A;  1KLV A;  1P9D U;  5L83 A;  3UIN B;  4J6I A;  3DCG A;  3HM3 A;  4I6P A;  4K7S A;  4KDI C;  4FAD A;  3B08 A;  2KWV B;  3K9O B;  4K1R B;  1YX5 B;  2KDI A;  3SHQ A;  4XZ4 A;  3X23 A;  1UBQ A;  2M17 A;  3WAP A;  4FBJ B;  2I1K A;  2AYO B;  1RFA A;  2DYB A;  3VUW A;  2LGY A;  2AL3 A;  1KJT A;  3OLM D;  2JVC A;  3JSV B;  3OJ3 A;  3QA8 A;  5DPS A;  3VTW A;  5KHQ A;  4W9J A;  4IM3 A;  4HDQ A;  3VXW A;  2ZPN A;  2ZZP B;  4FJY A;  1V86 A;  2ZVN A;  3L08 A;  4K7U A;  3ZRC A;  5KHO A;  4AWJ A;  1E90 A;  4DDG D;  2M8S A;  3W1Y A;  3ZDT A;  2KVR A;  2FNJ B;  4N9F 4;  1H8C A;  2IY1 B;  2KLG A;  2REX A;  3ZTC A;  3ZW3 A;  2JWZ A;  2PE6 B;  2YLM A;  2NBV B;  2UYZ B;  3HIZ A;  2MP2 A;  3KVF B;  2FID A;  4BKT A;  4DDI D;  2DZJ A;  1OQY A;  4BBN F;  1OEY J;  3APC A;  4OVU A;  3VH4 B;  1WFY A;  4B95 A;  1SIF A;  1WJU A;  4WAA A;  3PPA A;  4KDL B;  4IM0 A;  1R4N I;  2RSU A;  2C9W B;  4GU2 A;  3WA0 A;  3QQ8 B;  2EMS A;  3VHT C;  4NQK E;  4CHK A;  2KD0 A;  3VTU A;  3R3M A;  4KSL C;  3L54 A;  2K6D B;  3PTF C;  3B1L X;  3DPD A;  2GMI C;  3ZO5 B;  4II3 B;  1LFD A;  4GMV A;  4W9I A;  2IYD B;  3UGB B;  3VVW B;  2L0T A;  4AJW A;  2PJH A;  2BWE S;  3QAR A;  2N1V A;  4G11 A;  4I6L B;  2O6V D;  2EMT A;  4GOC A;  1WF9 A;  3MHS D;  4GSW A;  3K9P B;  2DZI A;  1WMH A;  2KFK A;  1RRB A;  4TKN A;  4JLC A;  3ZNG C;  4K81 A;  4ICU A;  2L05 A;  2MW5 A;  1WGG A;  2K8C A;  2M0X A;  2ZJD A;  2KMA A;  2V3S A;  3UIP B;  2D2Q A;  3P2B A;  3PRZ A;  5CHV C;  1E8X A;  3LDZ E;  2N9P C;  1UZX B;  5J2R A;  3TMP B;  3M63 B;  3SD5 A;  2BF8 B;  4WWO A;  4MSQ B;  4MSM B;  2LXA A;  3VDZ A;  1P0R A;  2IO1 B;  2DZK A;  3R66 C;  4W9E A;  3QX1 A;  3NZS A;  3WAM A;  2KQS A;  2AWT A;  2KDB A;  1WRD B;  2ZNV C;  3V62 A;  4BBN C;  1YD8 U;  1E8W A;  2KHW B;  5JHB A;  2DX5 B;  2KJ6 A;  2CHW A;  2BPS A;  2LGX A;  2WX0 A;  1WJ6 A;  2NPT B;  2JUO A;  3HM6 X;  5IA7 A;  4BKS A;  1JRU A;  3KYC D;  1IPG A;  5D7G A;  4WWN A;  1T0Y A;  1WJ4 A;  2MX2 A;  3NS8 A;  4KVG B;  2MBO A;  3OAW A;  2KAN A;  2XBB C;  4MJS B;  3KYD D;  1TZ1 A;  2ZCC A;  5TR5 A;  2CS4 A;  2KC2 A;  2NVU I;  2HJ8 A;  4KZC A;  5LXI B;  3C0R B;  3PRM B;  4DHZ B;  2I1J A;  3JYU A;  2KOX A;  4MM3 A;  1MG8 A;  4FHJ A;  1J19 A;  4ICV A;  4IWP A;  2K8B A;  3ZNH B;  2IBI B;  1R4M I;  4LJP B;  4CYE A;  1KOT A;  3H9D A;  1WZ3 A;  2DEN B;  2KDE B;  1WGY A;  5G2N A;  1I42 A;  3H7P A;  1OEY A;  4G50 A;  4WJN A;  1V5T A;  1ZW7 A;  2Y5B B;  4DXA B;  2MSE D;  2JZZ A;  4ZYN A;  2JY6 A;  2L8J A;  1RLF A;  3B0A A;  3PLV A;  2L0F A;  3A9J B;  4PS7 A;  1WGH A;  2O2V B;  3V6E B;  4ZRK A;  3JVZ X;  4HPL B;  3AU4 A;  1Q1O A;  4IC7 B;  1WIA A;  3WAO A;  3WIM A;  2ASQ A;  4URK A;  1J8C A;  3R7Q A;  4AP4 C;  4AJY B;  4HPM B;  3W1S A;  4KV2 A;  1VD2 A;  2HTH A;  2NBU A;  3UQB A;  3PT2 B;  5GMV A;  4F7Z A;  2GBR A;  3A1Q B;  3N3K B;  3UF8 A;  3PVL A;  2D10 A;  2WX1 A;  2LAS A;  4MH0 E;  3ML8 A;  2L00 B;  3RT3 B;  4LDT D;  2W9N A;  1Q0W B;  3T8M A;  1NI2 A;  3DOW A;  4HVB A;  3H6N A;  3M3J A;  2EKE C;  4IW0 A;  4NAW A;  5J17 A;  2GBN A;  4IUM B;  4WQO B;  2RR9 A;  1WM3 A;  2LXC A;  2KMC A;  1TGZ B;  2CHX A;  3D32 A;  2K8H A;  3H7S A;  1ZKH A;  2Z59 B;  2KWU B;  2VRR B;  4GB9 A;  2KN5 A;  2FIF A;  4W9H A;  4EOY A;  4IG7 B;  1EF5 A;  1Z2M A;  2MWS B;  4A20 A;  1WJN A;  2LD9 A;  5L95 C;  3T9L A;  1LXD A;  5JH5 C;  3UIO B;  1UEL A;  3NZU A;  4LDT B;  4GDL B;  2V4L A;  3AXC A;  3TBL D;  3AU5 A;  3ONS A;  4ZRI A;  4AUQ C;  5DPT A;  1GC7 A;  1E5W A;  2CU1 A;  2PPH A;  3BIN A;  3CF6 E;  4KIK A;  5HKH A;  4FHK A;  1E7U A;  2MBQ A;  1UD7 A;  3A9K A;  3MJW A;  2KX3 A;  2C7M B;  3IVF A;  4E3C A;  1BT0 A;  2N9X A;  2XK5 B;  3VH3 B;  3L10 B;  1WGD A;  1AAR A;  2HD5 B;  3L13 A;  1EO6 A;  4FJZ A;  4G0N B;  5G55 A;  4EEW A;  2ZNV B;  4GDK B;  2AL6 A;  1P1A A;  3L0W B;  4WJO A;  4MDK E;  2CHZ A;  2M1M A;  2KX0 A;  2JT4 B;  3KH0 A;  2V1Y A;  3QAQ A;  5CTR C;  2KTR A;  1C1Y B;  3GOE A;  2DAJ A;  3KUD B;  3SDL C;  5D2M B;  4FN2 A;  1UH6 A;  4II2 B;  4EZJ A;  5EDS A;  2L7R A;  4W9G A;  4CO7 A;  2PEA A;  3S2A A;  1YJ1 A;  1SE9 A;  4BOS C;  2Z0E B;  2L3Z A;  4EZL A;  1XD3 B;  4F1S A;  4NQL B;  2KZR A;  2JXX A;  3PGE A;  3HK0 A;  1WE6 A;  1WY8 A;  4E71 A;  2C7N B;  3QK0 A;  1D3Z A;  3LJ3 A;  2G4D B;  5D94 A;  3VAW A;  2O6V B;  2ZPY A;  3DBS A;  3NHE B;  2KO3 A;  2LRW A;  2MBE A;  2KC1 A;  3U8Z A;  1J0G A;  2PE9 A;  4W9F A;  1CMX B;  2J0K A;  3ZTD A;  2N1W A;  3DVG X;  4F8C B;  2QHO A;  2G4S A;  2IY0 B;  3RYT A;  2LGD A;  2R2O A;  4JIO U;  4KZ0 A;  1WM2 A;  2LWP A;  1TTN A;  1GNU A;  1LM8 B;  2AEH A;  3QWZ B;  4MGI E;  4NJ6 A;  5CHF A;  1OGW A;  5JHA A;  1X1M A;  2WWZ A;  4GGQ A;  4GN1 A;  3U7D A;  3ZNI D;  2N7D A;  1V81 A;  3JSV A;  2ZCB A;  1NBF C;  4HWI B;  2BGF A;  2MQJ A;  2ZEQ A;  4DK5 A;  2M4N A;  1K8R B;  1TBE A;  2NS5 A;  1YX6 B;  2NBW B;  4FJV B;  4AOF A;  1IP9 A;  2N7E A;  4ZDV A;  4NNJ B;  3QJZ A;  2MLB A;  2MP2 B;  3DBR I;  4IM2 A;  5C1Z A;  3ML9 A;  1E7V A;  4EFO A;  4LJO B;  3IBE A;  3RZW C;  2D07 B;  1WYW B;  5E6P A;  4RM9 A;  2A4Z A;  3TCA A;  3ZDM C;  5LXH A;  4ANU A;  4M8N A;  2GOW A;  2K39 A;  3N32 A;  1RAX A;  4FUL A;  4HDO A;  3DBL I;  3V61 A;  2HE7 A;  3A4S C;  4M0W B;  3EEC A;  4ANV A;  4RMA A;  5D6J B;  3PRE A;  2MA9 B;  3IHP C;  1YQB A;  2RD0 A;  4MEL A;  4OVV A;  3R7R A;  4BVU C;  3U30 A;  1WMH B;  2KFK B;  4A3P A;  4JGH B;  2DZM A;  5DCN A;  2XK5 A;  3PS6 A;  5FR6 A;  3NOB A;  2WDT B;  4NJ7 A;  4GDK A;  3ZKJ C;  2C60 A;  3TJP A;  1M94 A;  3DVN U;  2YVC A;  3ECI A;  2C5L C;  4P7I A;  4FA6 A;  3I3T B;  3AUL A;  3IFW B;  3X0W A;  3JW0 X;  4HK2 A;  4BKS D;  1SGH A;  4YL8 A;  3TIX A;  2KQ7 A;  4DHZ E;  1WI0 A;  4DBG A;  2BKR B;  2NR2 A;  3KUZ A;  5JZE B;  2K1F A;  3RD2 A;  3QCA A;  4TQ1 A;  1S1Q B;  5AZH A;  2DYM A;  2J0M A;  1WXV A;  1XT9 B;  3IG3 A;  3L17 A;  3L16 A;  2BKF A;  4LCD E;  4PS3 A;  2JZ3 B;  2O6V A;  4XX5 A;  3GZN I;  2LVQ A;  3CST A;  3QIJ A;  3ZUN A;  4HCP B;  3WAL A;  3AI5 A;  2FUH B;  3DVG Y;  3ENE A;  4MGY E;  2BWF A;  2FCS A;  4RM8 A;  2KTF A;  2IO3 B;  3A4R A;  3PRP B;  4HJK A;  1PQS A;  1HE8 A;  4HCN B;  4PYZ A;  4EZK A;  4ANW A;  4WJP A;  2JRI B;  4HLE A;  2NPT A;  3KUC B;  2RPQ A;  1WX7 A;  3DVN V;  3RCZ A;  3TL5 A;  4DWF A;  3N30 A;  1WXS A;  2FCQ A;  1WE7 A;  1GC6 A;  2BYV E;  2MCN B;  2UWQ A;  1G6J A;  3VUY A;  2ZVO A;  2KLC A;  4IWQ A;  4MJS A;  4B9K A;  2FAZ A;  3CSF A;  1NDD A;  3ZRF A;  1LQB A;  2NCN A;  4W9K A;  4XC2 A;  4ZRJ A;  1XQQ A;  1VCB A;  4B6W A;  1L2N A;  1WH3 A;  2G3Q B;  3H7P B;  4TUU A;  4X57 B;  5CHW A;  1GUA B;  1WR1 A;  3EFU A;  3EC8 A;  4BKG A;  3H1U A;  1E8Z A;  4K7W A;  2LVO A;  5J18 A;  1I35 A;  2D11 A;  2LJ5 A;  1OTR B;  1UBI A;  2N9E B;  2JRH A;  1V6E A;  3DQV A;  2DAF A;  2KFJ A;  2XEW A;  4GIV A;  4HXD A;  3ZLZ A;  2K25 A;  3DBH I;  3SU8 X;  4MEM A;  3RUI B;  2J0J A;  5C23 A;  3VUX A;  2MBH A;  5AZG A;  2BYE A;  4JL9 A;  4M8M A;  4BFR A;  2J7Q B;  1Q5W B;  3M62 B;  1YIW A;  2IO0 B;  3Q3J A;  2L76 A;  3A9J A;  4KSK C;  1V49 A;  2MRP A;  1H4R A;  3PZD A;  1L7Y A;  4IWO A;  2O2V A;  1V2Y A;  3APF A;  1P98 A;  3PSE B;  2KNB A;  1Y8R C;  2C7H A;  2KDF B;  4PS8 A;  2MBB B;  4EUT A;  2RGF A;  2LVP A;  4JQW C;  2K6Q A;  1WGR A;  2A5U A;  2CKH B;  3PV1 A;  4ASW C;  2JF5 A;  4NAW B;  2LZ6 A;  1ISN A; 
#chains in the Genus database with same CATH topology
 2JWU A;  2BYF A;  1ZE3 D;  2KJR A;  2WGS A;  1Z5S B;  2Y5C A;  3Q2A C;  2IGG A;  1SEB D;  1FNU A;  2OOB B;  1V1O A;  2KJH B;  5LLI A;  4ARC A;  1SBB B;  4W9D A;  1AW7 A;  3QC8 B;  4FLH A;  4E74 A;  1P3Q U;  2AQ1 B;  2OJR A;  3MTN B;  3U2S C;  1I4Q A;  5AUK A;  4RH6 A;  3DDC B;  5BO4 B;  1PYW D;  1UUP A;  3J9C A;  4ANX A;  1T6B X;  2D3B A;  4I6N B;  4XDD A;  3VTV A;  2JYE A;  3HUI A;  2BBC A;  3HHM A;  1EUV B;  4A90 A;  2IO2 B;  1BUI C;  4OZC A;  2PW9 A;  1I7H A;  3WAN A;  1WXM A;  2ICI A;  5E6O A;  1WXA A;  3ZVV A;  5DPR A;  3VFK A;  2LRU A;  1P9D U;  3UIN B;  4KDI C;  2QSD A;  4FAD A;  5IKC M;  4YTM B;  3BZD B;  2KDI A;  3X23 A;  2M17 A;  4FBJ B;  1VZ7 A;  2I1K A;  1QOA A;  2AL3 A;  1KJT A;  3NRZ A;  4W9J A;  2ACZ B;  5EE1 A;  3VXW A;  1HA5 A;  4FJY A;  3E9S A;  2ZVN A;  1IGD A;  5KHO A;  2PKO A;  3ZDT A;  1H8C A;  2FNJ B;  2KLG A;  4NZL B;  3ZW3 A;  2JWZ A;  3P4Q B;  3IXS A;  2UYZ B;  1Q10 A;  2FID A;  1OQY A;  1OEY J;  2HTM E;  1OQQ A;  1WJU A;  3PPA A;  3TEZ A;  4IM0 A;  1R4N I;  2C9W B;  2EMS A;  4KSL C;  3L54 A;  3TEY A;  3ZO5 B;  3C8Y A;  3AE1 B;  1TS5 A;  4M0W A;  2JYT A;  3SR6 A;  1NEN B;  4I6L B;  1VDV A;  2O6V D;  1WF9 A;  1V1P B;  3K9P B;  2DZI A;  4ACF A;  4RFB A;  1C76 A;  1L4Z B;  2KMA A;  3AE7 B;  2W54 A;  3UIP B;  5GXG B;  1PGB A;  1P7F A;  4LK0 M;  3LDZ E;  1ZDX A;  3TMP B;  2GRI A;  1NI3 A;  2DZK A;  4W9E A;  2VH2 A;  2NTT A;  2WLB A;  3I63 C;  1D6E C;  2WX0 A;  3HM6 X;  4BKS A;  4USA A;  2D3C A;  1MJD A;  3NS8 A;  3KYD D;  1TZ1 A;  2ONQ A;  4HJG E;  4YSY B;  3PRM B;  2I1J A;  1I4G A;  4MM3 A;  1MG8 A;  4FHJ A;  1F52 A;  4ICV A;  1XEE A;  4CYE A;  3H9D A;  4L1B A;  2KDE B;  2DEN B;  1OEY A;  2MSE D;  2VZK D;  4B0E A;  1V8C A;  4PS7 A;  1QOG A;  1LO5 D;  2I2Y A;  3AU4 A;  4IC7 B;  3P4P B;  2WXI A;  1KFY B;  3W1S A;  3PO0 A;  2HTH A;  3UQB A;  1XLO A;  3PT2 B;  3CWI A;  3RPF C;  1ZOY B;  3PVL A;  1KH0 A;  3ML8 A;  4RF0 A;  3T8M A;  1RM6 C;  3DOW A;  2MHJ A;  1VR9 A;  1HZ5 A;  4ZHP A;  2CHX A;  1L6U A;  4R3D A;  4EOY A;  2KN5 A;  2FIF A;  3EUB 2;  4ZRI A;  1E6E B;  1GC7 A;  1YMH E;  3MJW A;  3TUO A;  3VH3 B;  1AAR A;  4FJZ A;  2MJ3 A;  2ZNV B;  4WJO A;  3L0W B;  2RMM A;  2V9H A;  4MH8 A;  4EZJ A;  2PEA A;  1FXA A;  2L3Z A;  2KZR A;  2C7N B;  1D3Z A;  4RGN A;  1I4X A;  3NHE B;  1D5Z C;  2LRW A;  2MBE A;  3U8Z A;  5HG2 A;  2WXM A;  3ZJV A;  2G4S A;  3NS1 A;  3RYT A;  2MJE A;  1FRD A;  4O1N A;  2LWP A;  2AEH A;  3QWZ B;  5CHF A;  5JHA A;  3T3O A;  2ZCB A;  3DWM A;  2W82 A;  1FNV A;  2BGF A;  2WDR B;  1K8R B;  5C1Z A;  3IBE A;  1GAQ B;  5D3I B;  1FNW A;  1ET6 A;  1L0V B;  4M8N A;  2YEP F;  2J53 A;  2K39 A;  4OZB A;  3DBL I;  3DBL B;  1VJK A;  3A4S C;  4M0W B;  1EM7 A;  5D6J B;  3PRE A;  2N9L A;  2MA9 B;  2XN9 C;  2QJL A;  2KYW A;  5LNK 1;  2RD0 A;  4OVV A;  3R7R A;  3NVY A;  4BVU C;  4P6V F;  3KWV A;  5DCN A;  1E9M A;  2V0G A;  2WDT B;  2HJ1 A;  3ZKJ C;  4C56 C;  3DVN U;  4P7I A;  1F0Z A;  2AQ3 B;  1L5P A;  2J4X A;  3AE4 B;  2IGD A;  3TIX A;  2KQ7 A;  4A55 A;  5JZE B;  1TS4 A;  2K1F A;  3EFC A;  3RD2 A;  4ZRP A;  1J7C A;  3IG3 A;  4IKG A;  4QAY A;  2BKF A;  2O6V A;  3GZN I;  3GZN B;  3R2I A;  3ZUN A;  4RF1 A;  3WAL A;  3AI5 A;  3DVG Y;  4MGY E;  3MP9 A;  1KTK A;  2MH7 A;  2L32 A;  4EZK A;  1SE2 A;  2IDY A;  2K3U A;  2NPT A;  3RCZ A;  2W3R A;  5G5G A;  4WUR A;  4S0R A;  1WXS A;  2FCQ A;  4MM3 B;  3OG5 A;  3Q69 A;  2MCN B;  1G6J A;  3IT4 B;  1FMA D;  2JSV X;  4LTU A;  2MEK A;  3ZRF A;  2KAC A;  2KAJ A;  2G3Q B;  1IBX A;  4TUU A;  1I35 A;  4K7W A;  3ZLZ A;  4RGO S;  4MEM A;  2MBH A;  4K3C A;  2IO0 B;  2L76 A;  1H4R A;  3PZD A;  1L7Y A;  4IWO A;  2O2V A;  3BK1 A;  1XO3 A;  3APF A;  1JW9 D;  3PSE B;  1ZUD 2;  4YSX B;  2MBB B;  3MFG A;  2X8X X;  2A5U A;  2CKH B;  4ASW C;  2JF5 A;  3PZ8 A;  4WQM A;  3KWL A;  3Q3F A;  1YJJ A;  1WYG A;  3OJ4 B;  1TKE A;  2DHZ A;  2DYO A;  3HVZ A;  3DBR B;  3RUL A;  4B0M A;  4NPN A;  3W1S C;  4W9C A;  3ABV B;  5AEK B;  1BML C;  1TJE A;  5HFY A;  3O65 B;  3KW5 B;  3QHT A;  1VZ8 A;  2LUE A;  1V9J A;  4Q2J A;  2R2Q A;  4EE2 A;  2M56 B;  2I38 A;  3LXF A;  2L52 A;  3ZQ4 A;  3APD A;  1TS3 A;  2WYQ A;  1GJZ A;  4US9 A;  2B3A A;  1FM0 D;  2KWD A;  1TYG B;  1NVI D;  3DWG C;  4TQ0 A;  1MHX A;  3ZJT A;  4EKU A;  3PHW B;  3V60 A;  2RDG A;  1N62 A;  5CX3 A;  2DWQ A;  4OZA A;  1KLV A;  2WDV B;  3DCG A;  4I6P A;  2IPK D;  2G9H D;  4K1R B;  1YX5 B;  3EGR A;  1JWA D;  1UBQ A;  2BS4 B;  2AYO B;  1RFA A;  2GLS A;  1N60 A;  3VUW A;  2LGY A;  3OLM D;  5DPS A;  3VTW A;  3OJ3 A;  3QA8 A;  5KHQ A;  4JWU C;  2LFI A;  4IM3 A;  3AEB B;  2ZPN A;  1XF5 L;  2ZZP B;  2WXK A;  1F77 A;  2M8S A;  1SE3 A;  1ZP0 B;  4FXC A;  2IY1 B;  2WU2 B;  2REX A;  2EEL A;  2YLM A;  2NBV B;  4TSS A;  3ZYY X;  4OVU A;  1WFY A;  2BS2 B;  1SIF A;  4WAA A;  1JRO A;  4KDL B;  2SEB D;  4MAC A;  3WA0 A;  1MPE A;  1QT9 A;  5TSS A;  2H88 B;  2OJW A;  4NQK E;  4CHK A;  3B2G A;  2LGS A;  3PTF C;  1BXT A;  2GMI C;  3DHI C;  1SIJ A;  1J7B A;  1TIF A;  2WHI A;  3AE9 B;  3DHG C;  3Q3N C;  2ZJD A;  2V3S A;  3AEE B;  2Q5W D;  2D2Q A;  1YQ4 B;  4XDC A;  1P7E A;  3P63 A;  3SD5 A;  2BF8 B;  4MSM B;  3BII D;  3FIL A;  2KDB A;  4M01 A;  1WRD B;  3V62 A;  1YD8 U;  2KHW B;  1WGK A;  2BPS A;  1TY2 A;  2LGX A;  1WJ6 A;  2NPT B;  3R2T A;  4OHJ A;  3KYC D;  1D5M C;  5D7G A;  1HXY D;  2MX2 A;  4KVG B;  3RI7 C;  2INP E;  4RGM A;  2KAN A;  2XBB C;  2CU3 A;  1ACC A;  5LXI B;  3JYU A;  2PVO D;  1IBX B;  1XLP A;  4IWP A;  2K8B A;  3ZNH B;  4ITK A;  4LJP B;  1KOT A;  1ZXI A;  5G2N A;  1I42 A;  2X38 A;  3NZ3 A;  1GB4 A;  1PGX A;  1MHH E;  4ZYN A;  2FE8 A;  3PLV A;  2O2V B;  4ZRK A;  2BW2 A;  1WIA A;  3SEB A;  3R7Q A;  4AP4 C;  4HPM B;  5BMI A;  5IO9 A;  4KV2 A;  1VD2 A;  3AN1 A;  4ZOH C;  4F7Z A;  2VZK B;  5HHD G;  2J42 A;  2D10 A;  2LAS A;  2L00 B;  4LDT D;  3Q3O C;  1NI2 A;  4HVB A;  1JWU D;  2G1E A;  3H6N A;  5J17 A;  5E6J A;  4WQO B;  2RR9 A;  3RNA C;  1T5X D;  2KMC A;  2KN4 A;  3D32 A;  1ESF A;  2Z59 B;  2KWU B;  4W9H A;  4US8 A;  4IG7 B;  1Z2M A;  3OWE B;  5L95 C;  3T9L A;  3NZU A;  1WXQ A;  1SXT A;  1R4N B;  2KT7 A;  1L0Y B;  2WXO A;  3AU5 A;  3ONS A;  1N5W A;  1E5W A;  3TEW A;  4KIK A;  2WXG A;  1UNS A;  4E3C A;  2KX3 A;  2C7M B;  1BT0 A;  3V05 A;  3SFE B;  2AL6 A;  4XWT A;  2CHZ A;  1HZ6 A;  3ZXR A;  3KH0 A;  3QAQ A;  5CTR C;  2KTR A;  1C1Y B;  2DAJ A;  3KUD B;  4KGT A;  2MJD A;  4FN2 A;  1UH6 A;  2Y5P A;  4OW0 A;  4CO7 A;  1C77 A;  1XD3 B;  3KLS X;  4NQL B;  2JXX A;  3HK0 A;  1FFU A;  1SSN A;  2H89 B;  3LJ3 A;  1STE A;  3VAW A;  3DBS A;  2KO3 A;  1I4R A;  2PE9 A;  2QMT A;  4W9F A;  1CMX B;  5JXV A;  3ZTD A;  2N1W A;  4F8C B;  2QIE B;  2QHO A;  2IY0 B;  4IOI E;  4KZ0 A;  4IDI A;  4MGI E;  4GGQ A;  3ZNI D;  3N1Z C;  4DK5 A;  1TBE A;  2IGH A;  2K5P A;  2NBW B;  3MC8 A;  4NNJ B;  3BVZ A;  1YQ3 B;  1Y56 A;  4LJO B;  3RZW C;  1IUE A;  5E6P A;  1QIL A;  2INC C;  4RM9 A;  2A4Z A;  3ZDM C;  5LXH A;  3N32 A;  1RAX A;  4FUL A;  1K51 A;  4HKZ E;  1WWT A;  3EEC A;  2GI9 A;  1SB3 C;  2WU5 B;  4RMA A;  3RMK C;  4ANV A;  3IHP C;  5C2T B;  1YQB A;  1ENF A;  4PT5 A;  3U30 A;  4LNI A;  1VLB A;  4JGH B;  2DZM A;  1NYQ A;  2XK5 A;  3PS6 A;  3Q3M C;  4GDK A;  4FA6 A;  2JXT A;  1MVK A;  3AUL A;  3MC0 B;  3X0W A;  3JW0 X;  5FKA C;  1LGR A;  1D4B A;  1JWB D;  2NR2 A;  1UGJ A;  3FIL B;  4BZA A;  3I5J C;  4TQ1 A;  5AZH A;  1WXV A;  1XT9 B;  3L17 A;  4KX6 B;  4LCD E;  4XX5 A;  1FD6 A;  2LVQ A;  4HCP B;  1N61 A;  4RGT A;  3ENE A;  2FCS A;  3PRP B;  1FFV A;  2JRI B;  3E56 A;  3ZXV A;  3TL5 A;  3ZGZ A;  1WE7 A;  2K0P A;  1GC6 A;  2ZVO A;  2WP9 B;  2SAK A;  2NCN A;  4XC2 A;  4ZRJ A;  2JX5 A;  3VRB B;  1WR1 A;  3EC8 A;  1TZO A;  4BKG A;  1E8Z A;  2LJ5 A;  1UBI A;  3N20 C;  3ZJU A;  2DAF A;  2XEW A;  3ETR A;  3DBH I;  3DBH B;  3RUI B;  2J0J A;  5C23 A;  5C3J B;  1Q5W B;  3M62 B;  1YIW A;  1PUT A;  4H2A A;  5AUI A;  3A9J A;  1IGC A;  2DBY A;  2EKI A;  1XLQ A;  4BAX A;  2KMM A;  1Y8R C;  1ET9 A;  2RGF A;  1R7S A;  2V4L A;  2XNA C;  1ISN A;  3AE8 B;  4HRO A;  4W9L A;  2GBK A;  3A1Q A;  4A6Q A;  2FCN A;  3AB5 A;  4AQ7 A;  2KXJ A;  1V80 A;  2NTS A;  4LNN A;  4DHJ D;  1IYF A;  3CIR B;  5AZF A;  3EHV A;  3RZF A;  2QDF A;  2Z0D B;  4NY0 A;  3A33 B;  3ZNZ B;  5I4D A;  1FXT B;  3Q8E A;  1C3T A;  4KIK B;  2IZV B;  1KM7 A;  1WZ0 A;  4GDL A;  4WWM A;  3VQI A;  1WX9 A;  3URY A;  3PZ7 A;  4G3X B;  2D3G A;  3M95 A;  1GG3 A;  2QCZ A;  2KTR B;  3ALB A;  2ON8 A;  5H8Y E;  1CK1 A;  4L2Y A;  3V6C B;  4PYU A;  3EA6 A;  2WDQ B;  3NVZ A;  2GBJ A;  3VR8 B;  3ZIM A;  2FCM A;  1EF1 A;  1MFW A;  1CQV A;  1SJE D;  2RDH A;  4BOZ B;  1S3S G;  4TV3 A;  3P4R B;  3HM3 A;  2WXN A;  2KWV B;  3SHQ A;  4S17 A;  3MHZ A;  3WAP A;  2DYB A;  1FXI A;  1QKZ A;  2PLP A;  4HDQ A;  1VZ6 A;  2CJN A;  2LGI A;  1V86 A;  3ZRC A;  3P4S B;  1E90 A;  4C80 A;  1T0Q C;  1EU4 A;  3R8B A;  2BYT A;  3ZTC A;  2PE6 B;  3KVF B;  4BBN F;  3VH4 B;  5FK9 C;  1CZP A;  2RSU A;  2KD0 A;  3IAS 1;  4XWW A;  4P1B C;  4II3 B;  1LFD A;  4GMV A;  2IYD B;  4YXD B;  2L0T A;  4AJW A;  1EWC A;  4KKI A;  4G11 A;  2BWE S;  1I4P A;  2EMT A;  3V3X A;  4GOC A;  2KFK A;  1RRB A;  3ZNG C;  3IT6 B;  4ICU A;  2MW5 A;  1WGG A;  1FO4 A;  5CHV C;  1E8X A;  2N9P C;  1UZX B;  2PVG C;  3RNF C;  1WRI A;  4MSQ B;  3VDZ A;  1P0R A;  2IO1 B;  3Q6B A;  3NZS A;  3WAM A;  2KQS A;  2AWT A;  1E8W A;  4WH4 A;  2DX5 B;  2BT6 A;  2CHW A;  1T0S C;  4HKQ A;  1JRU A;  1T0Y A;  5IOI A;  3OAW A;  1C79 A;  2ZCC A;  2CS4 A;  2KC2 A;  1XCT L;  2HJ8 A;  3U7Z A;  1JML A;  1R4M I;  2IBI B;  1C78 A;  3NVW A;  1WZ3 A;  4TMA B;  2JQR B;  3P42 A;  4WJN A;  1V5T A;  3AEG B;  1ZW7 A;  2Y5B B;  2LHD A;  1L4D B;  2L8J A;  3B0A A;  3A9J B;  1WGH A;  3JVZ X;  2DLB A;  1E7P B;  3WAO A;  3WIM A;  4URK A;  1J8C A;  2K9X A;  4AJY B;  1TKY A;  1SE4 A;  2PIA A;  1NYR A;  1DOX A;  4YWG G;  2NBU A;  5GMV A;  3A1Q B;  3UF8 A;  2WX1 A;  2K22 A;  2LUM A;  2LHE A;  2EKE C;  3B2F A;  4IW0 A;  1RYJ A;  4NAW A;  2GBN A;  4IUM B;  2LXC A;  1TGZ B;  2R61 A;  4K3B A;  1ZKH A;  2HDE A;  1VRA B;  4GB9 A;  4GLS C;  1EF5 A;  4A20 A;  1WJN A;  4JWS C;  4N59 A;  1QQR A;  3RNE C;  5JH5 C;  4LDT B;  4GDL B;  1OQR A;  1PDX A;  4PK1 A;  3AXC A;  1T3Q A;  1SF0 A;  4AUQ C;  5DPT A;  1C4P A;  2VH1 A;  2PPH A;  4OVZ A;  3HVD A;  5IP4 D;  5HKH A;  4FHK A;  2MBQ A;  1UD7 A;  3A9K A;  3IVF A;  2N9X A;  2LEK A;  2HD5 B;  3L13 A;  5G55 A;  1EO6 A;  4EEW A;  4G0N B;  5D3D A;  1P1A A;  2M1M A;  2BTE A;  2JT4 B;  2OED A;  2KDM A;  4N6E B;  3SDL C;  2PMV A;  5D2M B;  4II2 B;  1HEZ E;  2L7R A;  3S2A A;  1SE9 A;  2Z0E B;  3PGE A;  1N63 A;  4E71 A;  2O6V B;  2ZPY A;  2INN E;  4XYC A;  3Q8A A;  1KF6 B;  3LB8 C;  2J0K A;  3DVG X;  3MC9 A;  1WSP A;  2R2O A;  2QEJ C;  4NJ6 A;  2V3N A;  4GN1 A;  3U7D A;  2N7D A;  1V81 A;  3JSV A;  1KLU D;  4HWI B;  1NBF C;  2MQJ A;  2PTL A;  2M4N A;  3FAH A;  1YX6 B;  4FJV B;  1TKG A;  2MLB A;  2WXF A;  4J3O D;  3ML9 A;  2D07 B;  1WYW B;  1JCK B;  1N5X A;  1B1Z A;  3TCA A;  4ANU A;  2M0A A;  4WAF A;  3HRD D;  2V3P A;  3V61 A;  3AE3 B;  2J52 A;  2Z8L A;  4JPS A;  1HQR D;  1B9R A;  2KFK B;  3AEA B;  4A3P A;  3AMZ A;  1ROE A;  5FR6 A;  3NOB A;  1EU3 A;  2D5G A;  2C60 A;  3TJP A;  2ZW0 A;  1M94 A;  3ECI A;  4YTP B;  4UDU C;  3U4E G;  3I3T B;  3NUH B;  1XXG A;  4YL8 A;  3Q8F A;  4DHZ E;  1WI0 A;  4ZHO A;  1FIQ A;  4C4V A;  2DYM A;  5BMG A;  3Q8B A;  2J0M A;  2WS3 B;  4C00 A;  3L16 A;  1L6V A;  1KLG D;  1E10 A;  2FUH B;  2BWF A;  2KTF A;  2IO3 B;  3A4R A;  4HJK A;  4KGS A;  1HE8 A;  3WCQ A;  1YNT E;  4DXF A;  4LLG M;  1N6Z A;  3L4P A;  4HLE A;  2V4I B;  1WX7 A;  4AS1 A;  3RN9 C;  2BYV E;  1TS2 A;  4IWQ A;  2KLC A;  1EWY C;  4MJS A;  4B9K A;  3IAM 1;  1AYF A;  1C4C A;  4W9K A;  1L2N A;  4B6W A;  1VCB A;  1AWD A;  1WH3 A;  2BB6 A;  1NEK B;  1XLN A;  1GUA B;  3EFU A;  1T0R C;  3H1U A;  2LVO A;  3NJT A;  2D11 A;  2N9E B;  3DQV A;  2KFJ A;  1TT5 B;  1PFD A;  2K25 A;  2WNM A;  3I57 A;  2RPV A;  3MJ5 A;  5AZG A;  1RWS A;  4M8M A;  2J7Q B;  4KSK C;  2MRP A;  3U52 E;  5T8I A;  1V2Y A;  4RCO A;  3N9Y C;  1P98 A;  3NG0 A;  3W5U B;  2C7H A;  4ZRQ A;  2KDF B;  1FCL A;  2K6Q A;  4NAW B;  1SJH D;  2LZ6 A;  1TY0 A;  3BWU D;  1E8Y A;  5BYR A;  4WJQ A;  1F9J A;  3H8H A;  1V5O A;  1ZDV A;  2KWC A;  2QC8 A;  5IAA C;  3UQA A;  3Q8C A;  3BY4 B;  1ZXH A;  2JPH A;  4HEA 1;  2LMC A;  1WX8 A;  3B9J A;  3RFZ B;  2KKC A;  3NY5 A;  4MGZ E;  2WXJ A;  4A3O A;  4LNO A;  1U4A A;  2RDB C;  5DPW A;  3A9K B;  4WWP A;  4DHJ B;  2CR5 A;  2KK8 A;  4A9A A;  1A5R A;  1JQ4 A;  1K53 A;  4GXB A;  3C19 A;  2LI5 A;  3PHX B;  5E6N A;  3AM9 A;  4MT5 A;  2YEP B;  1WR6 E;  1QZE A;  1I4H A;  1UGM A;  3CMM B;  1HTO A;  3GE3 C;  4MGK E;  4L23 A;  1ZGU B;  2G45 B;  2GBM A;  3RNC C;  1FCC C;  5EE0 A;  3AE5 B;  3PLU A;  2N4F A;  1C9F A;  4CQN A;  4A8X C;  4DXG A;  5L83 A;  4J6I A;  2CJO A;  2UU7 A;  2GB1 A;  5EE9 A;  4K7S A;  3GS2 A;  2L83 A;  3B08 A;  3K9O B;  1D5X C;  1JWS D;  4JX1 C;  4XZ4 A;  1GB1 A;  1KRH A;  2JVC A;  3JSV B;  1FEH A;  3W9C B;  4K7U A;  3L08 A;  1L0X B;  4AWJ A;  1HTQ A;  3AE6 B;  4DDG D;  1AN8 A;  3W1Y A;  2FBW B;  2KVR A;  1A70 A;  4N9F 4;  4KKJ A;  5HI1 A;  3HIZ A;  2MP2 A;  4BKT A;  4DDI D;  2DZJ A;  4B95 A;  3APC A;  3TEX A;  1K52 A;  1YJI A;  4GU2 A;  3QQ8 B;  3VHT C;  3VTU A;  3R3M A;  2K6D B;  1E0Z A;  3B1L X;  1FPY A;  3DPD A;  4W9I A;  3VVW B;  3UGB B;  4D2K A;  2B76 B;  2PJH A;  3QAR A;  2N1V A;  3MHS D;  4GSW A;  1WMH A;  4TKN A;  4JLC A;  4K81 A;  2L05 A;  2M0X A;  2K8C A;  3P2B A;  3PRZ A;  2N0S B;  3I9V 1;  4C4V B;  5J2R A;  3M63 B;  4WWO A;  2LXA A;  4M02 A;  3AV8 A;  3R66 C;  3TSS A;  3QX1 A;  4RNA A;  1QLB B;  1F1H A;  2ZNV C;  4HRS A;  4BBN C;  1JRP A;  5JHB A;  2W3S A;  2KJ6 A;  5IA7 A;  2JUO A;  1IPG A;  4WWN A;  3VRA B;  4ZYS A;  1WJ4 A;  2MBO A;  4MJS B;  5TR5 A;  3GP7 A;  2NVU I;  3LYY A;  4KZC A;  3AEF B;  2WXL A;  3C0R B;  4DHZ B;  2KOX A;  3O13 A;  3AH7 A;  1J19 A;  1WGY A;  3H7P A;  3AE2 B;  4G50 A;  4DXA B;  2E3T A;  2W55 A;  2JZZ A;  3N1Y C;  1RFK A;  2JY6 A;  4C7Y A;  1RLF A;  2L0F A;  3V6E B;  4LNK A;  3BVG A;  4HPL B;  1YOV B;  1Q1O A;  3N1X C;  4HPP A;  2ASQ A;  5G5H A;  3VR9 B;  3FC4 A;  2BB5 A;  1M4V A;  2GBR A;  3N3K B;  2WQY B;  2OHF A;  4MH0 E;  2BVC A;  3RT3 B;  2W9N A;  4C7Z A;  4LNF A;  1Q0W B;  3M3J A;  1UWX A;  1WM3 A;  1XCQ L;  3W2D A;  2K8H A;  3H7S A;  2N7J A;  3Q14 C;  2VRR B;  1QOB A;  1GOZ A;  5BYQ A;  3NVV A;  3GE8 C;  3RNB C;  2MWS B;  2LD9 A;  3T3N A;  2N9K A;  1C4A A;  1LXD A;  3UIO B;  1UEL A;  2M19 A;  1CJE A;  3TBL D;  3DHH C;  2WXR A;  2CU1 A;  3BIN A;  3CF6 E;  1E7U A;  4P16 A;  1F2R I;  2XK5 B;  3L10 B;  1UWM A;  1WGD A;  3BYY B;  4GDK B;  4MDK E;  2KX0 A;  2V1Y A;  3GOE A;  4REZ A;  5EDS A;  4W9G A;  3UI3 A;  1YJ1 A;  4BOS C;  3KQ4 A;  5H92 C;  1YN5 A;  2FUG 1;  4EZL A;  2WXP A;  4F1S A;  1WE6 A;  1WY8 A;  4NAM A;  4P1C C;  3QK0 A;  4M00 A;  1V97 A;  2G4D B;  5D94 A;  5BYS A;  2TSS A;  1F2R C;  2KC1 A;  1J0G A;  1DGJ A;  2JZP A;  3P1M A;  2LGD A;  4JIO U;  1WM2 A;  1GPX A;  1TTN A;  1GNU A;  1LM8 B;  1OGW A;  1X1M A;  2BS3 B;  2WWZ A;  4KGR A;  2ZEQ A;  2Y3A A;  2NS5 A;  4AOF A;  3W5V B;  1IP9 A;  2N7E A;  4ZDV A;  3QJZ A;  4DQO C;  5IN7 A;  2MP2 B;  3DBR I;  4IM2 A;  1E7V A;  4EFO A;  1JAL A;  1FRR A;  3RNG C;  1YN4 A;  1UF0 A;  1R4M B;  2GOW A;  4HDO A;  3GB1 A;  1J7A A;  2HE7 A;  1QF6 A;  2E6X A;  2L1A A;  4MEL A;  1MG4 A;  1WMH B;  2ZW1 A;  4NJ7 A;  2YVC A;  2C5L C;  1V1P A;  3IFW B;  2BQQ A;  4HK2 A;  4BKS D;  1SGH A;  1DOI A;  2AX5 A;  4DBG A;  2BKR B;  3KUZ A;  3BK2 A;  4ARI A;  3QCA A;  1S1Q B;  3AED B;  4NJC A;  2AQ2 B;  4PS3 A;  2JZ3 B;  3CST A;  3QIJ A;  3AEC B;  3BVM A;  4RM8 A;  1PGA A;  1PQS A;  1DYQ A;  4HCN B;  4WIP A;  5BMH A;  4PYZ A;  2DNF A;  4ANW A;  4WJP A;  3KUC B;  1YN3 A;  1OFF A;  2RPQ A;  3DVN V;  4DWF A;  5MPO A;  3N30 A;  4YTN B;  3FKY A;  2KVZ A;  2UWQ A;  2IJ0 A;  3VUY A;  4XE0 A;  2FAZ A;  3CSF A;  1NDD A;  1LQB A;  1XQQ A;  1K50 A;  3H7P B;  4X57 B;  2WXH A;  5CHW A;  2NMQ A;  1QOF A;  2D3A A;  2KQ4 X;  2LJI A;  5J18 A;  1OTR B;  2JRH A;  1V6E A;  5FR3 A;  4GIV A;  4HXD A;  4YT0 B;  3SU8 X;  1DOY A;  2WXQ A;  3VUX A;  2BYE A;  4JL9 A;  5EE3 A;  4BFR A;  4JE3 B;  3BYT B;  3Q3J A;  2JU6 X;  1V49 A;  4XGA B;  4N58 A;  1JWM D;  2QIL A;  1MI0 A;  2KNB A;  4YSZ B;  4PS8 A;  4EUT A;  1ZPS A;  2LVP A;  4JQW C;  1WGR A;  3SFD B;  3PV1 A;  2IND C; 
#chains in the Genus database with same CATH homology
 2BYF A;  2KJR A;  2GBK A;  3A1Q A;  1Z5S B;  4W9L A;  1E8Y A;  2FCN A;  3Q3F A;  2KXJ A;  3OJ4 B;  1V80 A;  1F9J A;  2DHZ A;  4WJQ A;  1V5O A;  2DYO A;  2OOB B;  4DHJ D;  1IYF A;  2KWC A;  2KJH B;  5IAA C;  3UQA A;  3BY4 B;  2JPH A;  5LLI A;  4W9D A;  3EHV A;  5AZF A;  3RUL A;  3RZF A;  4NPN A;  3W1S C;  1WX8 A;  3QC8 B;  4FLH A;  4E74 A;  4W9C A;  2KKC A;  2Z0D B;  3NY5 A;  5AEK B;  1P3Q U;  4MGZ E;  3A33 B;  4NY0 A;  3ZNZ B;  1FXT B;  2OJR A;  3MTN B;  4A3O A;  1C3T A;  3O65 B;  3KW5 B;  3QHT A;  4KIK B;  2LUE A;  2IZV B;  1KM7 A;  1V9J A;  1U4A A;  1WZ0 A;  2R2Q A;  3DDC B;  3A9K B;  4WWP A;  4GDL A;  5DPW A;  3VQI A;  1WX9 A;  5BO4 B;  4DHJ B;  2CR5 A;  2KK8 A;  1A5R A;  4ANX A;  4G3X B;  2D3G A;  4I6N B;  3VTV A;  3M95 A;  1GG3 A;  4GXB A;  2KTR B;  2LI5 A;  3ALB A;  3PHX B;  3APD A;  5E6N A;  3HHM A;  1EUV B;  2WYQ A;  1GJZ A;  2IO2 B;  2B3A A;  1WR6 E;  1QZE A;  3V6C B;  4PYU A;  4TQ0 A;  1UGM A;  2GBJ A;  4EKU A;  3CMM B;  3PHW B;  3WAN A;  1WXM A;  3V60 A;  4MGK E;  3ZIM A;  2FCM A;  1EF1 A;  5E6O A;  1WXA A;  1ZGU B;  5CX3 A;  5DPR A;  2G45 B;  2GBM A;  3ZVV A;  4BOZ B;  3PLU A;  2N4F A;  1S3S G;  3VFK A;  2LRU A;  4TV3 A;  1KLV A;  1P9D U;  5L83 A;  3UIN B;  4J6I A;  3DCG A;  3HM3 A;  4I6P A;  4K7S A;  4KDI C;  4FAD A;  3B08 A;  2KWV B;  3K9O B;  4K1R B;  1YX5 B;  2KDI A;  3SHQ A;  4XZ4 A;  3X23 A;  1UBQ A;  2M17 A;  3WAP A;  4FBJ B;  2I1K A;  2AYO B;  1RFA A;  2DYB A;  3VUW A;  2LGY A;  2AL3 A;  1KJT A;  3OLM D;  2JVC A;  3JSV B;  3OJ3 A;  3QA8 A;  5DPS A;  3VTW A;  5KHQ A;  4W9J A;  4IM3 A;  4HDQ A;  3VXW A;  2ZPN A;  2ZZP B;  4FJY A;  1V86 A;  2ZVN A;  3L08 A;  4K7U A;  3ZRC A;  5KHO A;  4AWJ A;  1E90 A;  4DDG D;  2M8S A;  3W1Y A;  3ZDT A;  2KVR A;  2FNJ B;  4N9F 4;  1H8C A;  2IY1 B;  2KLG A;  2REX A;  3ZTC A;  3ZW3 A;  2JWZ A;  2PE6 B;  2YLM A;  2NBV B;  2UYZ B;  3HIZ A;  2MP2 A;  3KVF B;  2FID A;  4BKT A;  4DDI D;  2DZJ A;  1OQY A;  4BBN F;  1OEY J;  3APC A;  4OVU A;  3VH4 B;  1WFY A;  4B95 A;  1SIF A;  1WJU A;  4WAA A;  3PPA A;  4KDL B;  4IM0 A;  1R4N I;  2RSU A;  2C9W B;  4GU2 A;  3WA0 A;  3QQ8 B;  2EMS A;  3VHT C;  4NQK E;  4CHK A;  2KD0 A;  3VTU A;  3R3M A;  4KSL C;  3L54 A;  2K6D B;  3PTF C;  3B1L X;  3DPD A;  2GMI C;  3ZO5 B;  4II3 B;  1LFD A;  4GMV A;  4W9I A;  2IYD B;  3UGB B;  3VVW B;  2L0T A;  4AJW A;  2PJH A;  2BWE S;  3QAR A;  2N1V A;  4G11 A;  4I6L B;  2O6V D;  2EMT A;  4GOC A;  1WF9 A;  3MHS D;  4GSW A;  3K9P B;  2DZI A;  1WMH A;  2KFK A;  1RRB A;  4TKN A;  4JLC A;  3ZNG C;  4K81 A;  4ICU A;  2L05 A;  2MW5 A;  1WGG A;  2K8C A;  2M0X A;  2ZJD A;  2KMA A;  2V3S A;  3UIP B;  2D2Q A;  3P2B A;  3PRZ A;  5CHV C;  1E8X A;  3LDZ E;  2N9P C;  1UZX B;  5J2R A;  3TMP B;  3M63 B;  3SD5 A;  2BF8 B;  4WWO A;  4MSQ B;  4MSM B;  2LXA A;  3VDZ A;  1P0R A;  2IO1 B;  2DZK A;  3R66 C;  4W9E A;  3QX1 A;  3NZS A;  3WAM A;  2KQS A;  2AWT A;  2KDB A;  1WRD B;  2ZNV C;  3V62 A;  4BBN C;  1YD8 U;  1E8W A;  2KHW B;  5JHB A;  2DX5 B;  2KJ6 A;  2CHW A;  2BPS A;  2LGX A;  2WX0 A;  1WJ6 A;  2NPT B;  2JUO A;  3HM6 X;  5IA7 A;  4BKS A;  1JRU A;  3KYC D;  1IPG A;  5D7G A;  4WWN A;  1T0Y A;  1WJ4 A;  2MX2 A;  3NS8 A;  4KVG B;  2MBO A;  3OAW A;  2KAN A;  2XBB C;  4MJS B;  3KYD D;  1TZ1 A;  2ZCC A;  5TR5 A;  2CS4 A;  2KC2 A;  2NVU I;  2HJ8 A;  4KZC A;  5LXI B;  3C0R B;  3PRM B;  4DHZ B;  2I1J A;  3JYU A;  2KOX A;  4MM3 A;  1MG8 A;  4FHJ A;  1J19 A;  4ICV A;  4IWP A;  2K8B A;  3ZNH B;  2IBI B;  1R4M I;  4LJP B;  4CYE A;  1KOT A;  3H9D A;  1WZ3 A;  2DEN B;  2KDE B;  1WGY A;  5G2N A;  1I42 A;  3H7P A;  1OEY A;  4G50 A;  4WJN A;  1V5T A;  1ZW7 A;  2Y5B B;  4DXA B;  2MSE D;  2JZZ A;  4ZYN A;  2JY6 A;  2L8J A;  1RLF A;  3B0A A;  3PLV A;  2L0F A;  3A9J B;  4PS7 A;  1WGH A;  2O2V B;  3V6E B;  4ZRK A;  3JVZ X;  4HPL B;  3AU4 A;  1Q1O A;  4IC7 B;  1WIA A;  3WAO A;  3WIM A;  2ASQ A;  4URK A;  1J8C A;  3R7Q A;  4AP4 C;  4AJY B;  4HPM B;  3W1S A;  4KV2 A;  1VD2 A;  2HTH A;  2NBU A;  3UQB A;  3PT2 B;  5GMV A;  4F7Z A;  2GBR A;  3A1Q B;  3N3K B;  3UF8 A;  3PVL A;  2D10 A;  2WX1 A;  2LAS A;  4MH0 E;  3ML8 A;  2L00 B;  3RT3 B;  4LDT D;  2W9N A;  1Q0W B;  3T8M A;  1NI2 A;  3DOW A;  4HVB A;  3H6N A;  3M3J A;  2EKE C;  4IW0 A;  4NAW A;  5J17 A;  2GBN A;  4IUM B;  4WQO B;  2RR9 A;  1WM3 A;  2LXC A;  2KMC A;  1TGZ B;  2CHX A;  3D32 A;  2K8H A;  3H7S A;  1ZKH A;  2Z59 B;  2KWU B;  2VRR B;  4GB9 A;  2KN5 A;  2FIF A;  4W9H A;  4EOY A;  4IG7 B;  1EF5 A;  1Z2M A;  2MWS B;  4A20 A;  1WJN A;  2LD9 A;  5L95 C;  3T9L A;  1LXD A;  5JH5 C;  3UIO B;  1UEL A;  3NZU A;  4LDT B;  4GDL B;  2V4L A;  3AXC A;  3TBL D;  3AU5 A;  3ONS A;  4ZRI A;  4AUQ C;  5DPT A;  1GC7 A;  1E5W A;  2CU1 A;  2PPH A;  3BIN A;  3CF6 E;  4KIK A;  5HKH A;  4FHK A;  1E7U A;  2MBQ A;  1UD7 A;  3A9K A;  3MJW A;  2KX3 A;  2C7M B;  3IVF A;  4E3C A;  1BT0 A;  2N9X A;  2XK5 B;  3VH3 B;  3L10 B;  1WGD A;  1AAR A;  2HD5 B;  3L13 A;  1EO6 A;  4FJZ A;  4G0N B;  5G55 A;  4EEW A;  2ZNV B;  4GDK B;  2AL6 A;  1P1A A;  3L0W B;  4WJO A;  4MDK E;  2CHZ A;  2M1M A;  2KX0 A;  2JT4 B;  3KH0 A;  2V1Y A;  3QAQ A;  5CTR C;  2KTR A;  1C1Y B;  3GOE A;  2DAJ A;  3KUD B;  3SDL C;  5D2M B;  4FN2 A;  1UH6 A;  4II2 B;  4EZJ A;  5EDS A;  2L7R A;  4W9G A;  4CO7 A;  2PEA A;  3S2A A;  1YJ1 A;  1SE9 A;  4BOS C;  2Z0E B;  2L3Z A;  4EZL A;  1XD3 B;  4F1S A;  4NQL B;  2KZR A;  2JXX A;  3PGE A;  3HK0 A;  1WE6 A;  1WY8 A;  4E71 A;  2C7N B;  3QK0 A;  1D3Z A;  3LJ3 A;  2G4D B;  5D94 A;  3VAW A;  2O6V B;  2ZPY A;  3DBS A;  3NHE B;  2KO3 A;  2LRW A;  2MBE A;  2KC1 A;  3U8Z A;  1J0G A;  2PE9 A;  4W9F A;  1CMX B;  2J0K A;  3ZTD A;  2N1W A;  3DVG X;  4F8C B;  2QHO A;  2G4S A;  2IY0 B;  3RYT A;  2LGD A;  2R2O A;  4JIO U;  4KZ0 A;  1WM2 A;  2LWP A;  1TTN A;  1GNU A;  1LM8 B;  2AEH A;  3QWZ B;  4MGI E;  4NJ6 A;  5CHF A;  1OGW A;  5JHA A;  1X1M A;  2WWZ A;  4GGQ A;  4GN1 A;  3U7D A;  3ZNI D;  2N7D A;  1V81 A;  3JSV A;  2ZCB A;  1NBF C;  4HWI B;  2BGF A;  2MQJ A;  2ZEQ A;  4DK5 A;  2M4N A;  1K8R B;  1TBE A;  2NS5 A;  1YX6 B;  2NBW B;  4FJV B;  4AOF A;  1IP9 A;  2N7E A;  4ZDV A;  4NNJ B;  3QJZ A;  2MLB A;  2MP2 B;  3DBR I;  4IM2 A;  5C1Z A;  3ML9 A;  1E7V A;  4EFO A;  4LJO B;  3IBE A;  3RZW C;  2D07 B;  1WYW B;  5E6P A;  4RM9 A;  2A4Z A;  3TCA A;  3ZDM C;  5LXH A;  4ANU A;  4M8N A;  2GOW A;  2K39 A;  3N32 A;  1RAX A;  4FUL A;  4HDO A;  3DBL I;  3V61 A;  2HE7 A;  3A4S C;  4M0W B;  3EEC A;  4ANV A;  4RMA A;  5D6J B;  3PRE A;  2MA9 B;  3IHP C;  1YQB A;  2RD0 A;  4MEL A;  4OVV A;  3R7R A;  4BVU C;  3U30 A;  1WMH B;  2KFK B;  4A3P A;  4JGH B;  2DZM A;  5DCN A;  2XK5 A;  3PS6 A;  5FR6 A;  3NOB A;  2WDT B;  4NJ7 A;  4GDK A;  3ZKJ C;  2C60 A;  3TJP A;  1M94 A;  3DVN U;  2YVC A;  3ECI A;  2C5L C;  4P7I A;  4FA6 A;  3I3T B;  3AUL A;  3IFW B;  3X0W A;  3JW0 X;  4HK2 A;  4BKS D;  1SGH A;  4YL8 A;  3TIX A;  2KQ7 A;  4DHZ E;  1WI0 A;  4DBG A;  2BKR B;  2NR2 A;  3KUZ A;  5JZE B;  2K1F A;  3RD2 A;  3QCA A;  4TQ1 A;  1S1Q B;  5AZH A;  2DYM A;  2J0M A;  1WXV A;  1XT9 B;  3IG3 A;  3L17 A;  3L16 A;  2BKF A;  4LCD E;  4PS3 A;  2JZ3 B;  2O6V A;  4XX5 A;  3GZN I;  2LVQ A;  3CST A;  3QIJ A;  3ZUN A;  4HCP B;  3WAL A;  3AI5 A;  2FUH B;  3DVG Y;  3ENE A;  4MGY E;  2BWF A;  2FCS A;  4RM8 A;  2KTF A;  2IO3 B;  3A4R A;  3PRP B;  4HJK A;  1PQS A;  1HE8 A;  4HCN B;  4PYZ A;  4EZK A;  4ANW A;  4WJP A;  2JRI B;  4HLE A;  2NPT A;  3KUC B;  2RPQ A;  1WX7 A;  3DVN V;  3RCZ A;  3TL5 A;  4DWF A;  3N30 A;  1WXS A;  2FCQ A;  1WE7 A;  1GC6 A;  2BYV E;  2MCN B;  2UWQ A;  1G6J A;  3VUY A;  2ZVO A;  2KLC A;  4IWQ A;  4MJS A;  4B9K A;  2FAZ A;  3CSF A;  1NDD A;  3ZRF A;  1LQB A;  2NCN A;  4W9K A;  4XC2 A;  4ZRJ A;  1XQQ A;  1VCB A;  4B6W A;  1L2N A;  1WH3 A;  2G3Q B;  3H7P B;  4TUU A;  4X57 B;  5CHW A;  1GUA B;  1WR1 A;  3EFU A;  3EC8 A;  4BKG A;  3H1U A;  1E8Z A;  4K7W A;  2LVO A;  5J18 A;  1I35 A;  2D11 A;  2LJ5 A;  1OTR B;  1UBI A;  2N9E B;  2JRH A;  1V6E A;  3DQV A;  2DAF A;  2KFJ A;  2XEW A;  4GIV A;  4HXD A;  3ZLZ A;  2K25 A;  3DBH I;  3SU8 X;  4MEM A;  3RUI B;  2J0J A;  5C23 A;  3VUX A;  2MBH A;  5AZG A;  2BYE A;  4JL9 A;  4M8M A;  4BFR A;  2J7Q B;  1Q5W B;  3M62 B;  1YIW A;  2IO0 B;  3Q3J A;  2L76 A;  3A9J A;  4KSK C;  1V49 A;  2MRP A;  1H4R A;  3PZD A;  1L7Y A;  4IWO A;  2O2V A;  1V2Y A;  3APF A;  1P98 A;  3PSE B;  2KNB A;  1Y8R C;  2C7H A;  2KDF B;  4PS8 A;  2MBB B;  4EUT A;  2RGF A;  2LVP A;  4JQW C;  2K6Q A;  1WGR A;  2A5U A;  2CKH B;  3PV1 A;  4ASW C;  2JF5 A;  4NAW B;  2LZ6 A;  1ISN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...