3QQAA

Crystal structures of cmer-bile acid complexes from campylobacter jejuni
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
200
structure length
200
Chain Sequence
TPSQKVLARQEKIKAVALELFLTKGYQETSLSDIIKLSGGSYSNIYDGFKSKEGLFFEILDDICKKHFHLIYSKTQEIKNGTLKEILTSFGLAFIEIFNQPEAVAFGKIIYSQVYDKDRHLANWIENNQQNFSYNILMGFFKQQNNSYMKKNAEKLAVLFCTMLKEPYHHLNVLINAPLKNKKEQKEHVEFVVNVFLNGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of CmeR-bile acid complexes from Campylobacter jejuni.
pubmed doi rcsb
source organism Campylobacter jejuni
molecule tags Transcription
molecule keywords CmeR
total genus 76
structure length 200
sequence length 200
ec nomenclature
pdb deposition date 2011-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3qqaA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3qqaA02
3QQAA 3S14J 1E3OC 3D1NI 2E2IJ 2DA7A 4NN1A 4A69C 1BL0A 3QKXA 3MVPA 1QRYA 1WPKA 4BY1J 2HXOA 1ETYA 1XC5A 3DCFA 4B1RA 4JL3A 3MKLA 1ZR2A 5CXIA 2CQXA 1TWHJ 4IEJA 3BR5A 1MNMC 5E3NA 3A01B 2RHAA 4ME9A 1GT0C 2H1KA 1JTYA 2ECCA 4IHVA 2RASA 2G3BA 3OIOA 3NRGA 3PPBA 2G7GA 3GTMJ 4J19A 3HIMA 3BR2A 1RPWA 2M0CA 3BTLA 4IHXA 3VW0A 3E7LA 2WGBA 1AHDP 1W0UA 2KT0A 3S2DJ 3IH4A 2LTPA 4V2GA 1I50J 3K2AA 2F07A 2FBQA 3UKGA 2Y2ZA 5K7FA 2R5ZA 3GTGJ 1HF0A 3FK7A 3PASA 3K7AJ 2LFBA 1NK3P 1ORKA 3CCYA 4B4CA 4A3IJ 1JJ6C 1LFBA 5IYDJ 4GFLA 2K40A 3HM5A 3HTHA 5H9TA 2JA6J 1MBKA 4A3DJ 2L9RA 3HOWJ 9ANTA 2YVEA 2QCOA 1AU7A 2ZB9A 3O60A 4QTRA 4C3JJ 3G7RA 2XDNA 5EGOB 2HYTA 5DAJA 1BJZA 4QIWN 2XGEA 3FISA 3SFIA 1I3QJ 2GBYA 2OERA 2PBXA 2GUHA 2YUSA 4UUSB 3VIBA 1ZTRA 2QOPA 2K9NA 5GPAA 4Y52J 2X48A 2X9DA 5FKMA 3COLA 3ZQGA 5FJ8J 3S1QJ 2E2JJ 1FTZA 3HGYA 1IC8A 1CQTA 1U78A 5C4YA 2EH3A 1ZKGA 2FD5A 3KKCA 3QPLA 2EZKA 1JKOC 5IYCJ 2W53A 4MFDA 1T33A 1QPIA 2Y30A 3HB9A 2DA6A 4GCKA 3A03A 3ZOBA 3CQZJ 3BTIA 4JP0A 2ID6A 1QVUA 5DS9A 3A02A 3BRUA 1VF9A 1DU0A 3HEFA 5HSZA 4XK4A 1FIPA 3NARA 4QSHA 3V6GA 2L0KA 2EQRA 3LSGA 5IP6A 3PO3J 4DW6A 2L7ZA 4IHWA 1JKPC 2NVYJ 4A3BJ 4UUTA 2QWTA 3LSJA 4AYBN 5FKLA 1LE8A 3WHBA 2DMTA 3IV5A 1ETOA 1OCPA 2JN6A 2Y9ZA 2FX0A 4JYKA 1A5JA 3BTJA 1VNDA 5EYRA 5EGOA 4DYRA 3JRFA 3LHQA 5AQCA 4YZEA 2LVSA 4MLOA 1JGGA 4GCLA 1IGNA 3ZQHA 5F1JA 3BR1A 3CMYA 5EEAA 3ZQCA 3HDDA 1ZQ3P 1FTTA 3JRGA 3AQSA 4PXIA 3OOUA 3JRDA 2KDZA 2NVTJ 3RH2A 2PMZN 3LWJA 2IU5A 2XPVA 3F0CA 4JX5A 3MNLA 5K7HA 4XRSA 1LE8B 3BG3A 4DYCA 3VOXA 3VUQA 3CDLA 1TWCJ 5FLVA 4NELA 1RESA 5D1RA 3DEWA 1FJLA 1RKWA 1MBJA 3W6VA 5M3MJ 3TEDA 3IH2A 5F27A 1H8AC 5K58A 2VPRA 2JA7J 5FLMJ 1TWAJ 2IBDA 3HOUJ 3AQTA 2DTZA 2P81A 3BR6A 3NNRA 2DA5A 3BT9A 3RZDJ 3TW7A 3HOYJ 5CXGA 4D5CA 1JUPA 2HOTA 1TWFJ 2XGDA 1MBHA 1P7JA 3S17J 4JX4A 4FE7A 3I4MJ 5F0HA 3FK6A 1NTCA 4XRSG 1RKTA 5EZHA 3GTPJ 4A3LJ 1K61A 2XB5A 3HBLA 4MK6A 3VVZA 4X1EA 1RR7A 3C2BA 3HOVJ 1FEXA 1HOMA 4M3DA 2DMNA 2GFNA 1SFOJ 2GLOA 1B72A 5FMPA 2JK3A 1JKRC 2HXIA 4M6VA 1ETXA 2NS8A 3H3VK 3DPJA 1HDPA 1IG7A 1GUUA 1WCMJ 5GP9A 2K9SA 4A3FJ 2DMQA 5K7ZA 1ETVA 1B8IA 2NP3A 3NXCA 5C4JJ 5EG0A 1P7IA 1IV6A 2Q24A 2LY9A 2WB1N 2I10A 3S15J 4A3CJ 2QF7A 3KKDA 1XG1A 2G7SA 4ABZA 1BW5A 4CYCA 2UXHA 4JKZA 3NPIA 3O8HA 4BBSJ 5EG0B 2QTQA 3JSJA 2LR8A 3GTJJ 1JJ8C 4UUSA 3GBGA 2HOSA 2ECBA 2LD5A 3Q0UA 4EEFG 2Y9YA 1BA5A 3HGGA 4I6ZA 1LFUP 2DN0A 2O7TA 3S1RJ 2G7LA 5IOYA 1W0TA 3B6AA 5IOZA 1F36A 4BBRJ 5BNGA 1JT6A 2UXPA 2V57A 5F08A 5J1RA 4ICHA 4RDUA 5FKOA 2R7ZJ 1JT0A 1IDZA 4FTHA 3RZOJ 4MO7A 1ETWA 3GZIA 3KZ9A 3JRAA 2ME6A 4CYCB 2ME0A 4IHYA 3BR3A 2TCTA 4XIDA 1IRZA 1TC3C 2EZIA 2HI3A 1F43A 3GTLJ 4A93J 4B3AA 4MFEA 4MXMA 2JA5J 1UHSA 3NAUA 2E2HJ 3Q0WA 4GCTA 1VI0A 2M2EA 5C3EJ 4FISA 3PO2J 3I4NJ 5EF6A 1ETQA 4V2FA 2R92J 3LJLA 1ZGWA 2G0EA 2DG8A 2DA1A 2K9QA 3RKQA 1WI3A 2HDDA 5F0FA 1YRNB 3QBMA 3CJDA 1UI5A 3SJMA 2OF7A 2HQ5A 3GTKJ 3VW1A 3ANPA 1JUSA 1ITYA 1AKHB 3VOKA 4C3IJ 4MIMA 1MBFA 1JKQC 1MSFC 5M5YJ 4DZPA 5IPAA 3ZQLA 2NS7A 2XPUA 2NVQJ 1MSEC 3A01A 2YS9A 5IP7J 2R93J 3HTAA 1Z77A 2COBA 1T56A 3Q3SA 1X2NA 5E3OA 3BNIA 3M3YJ 3RQIA 2FJ1A 3HTJA 3BQYA 1UI6A 3FKIJ 3CWRA 1SGMA 2IEKA 1VFCA 1DU6A 3S16J 3F1BA 5IYBJ 3S2HJ 5CW8A 2ZOZA 1OFCX 3QPSA 4L5EA 3SDGA 2LK2A 4D5FA 3P9TA 3LSRA 2JMWA 2L7FP 4C2MJ 3ON2A 4M3FA 1H89C 3C07A 2HYJA 3VP5A 3IUVA 2NVXJ 4A3KJ 1U9OA 4G12A 4BY7J 3S1NJ 4JNNA 4X6AJ 2B63J 2HKUA 1WH7A 2JJ7A 3HE0A 5EFYA 1PUFB 3V78A 2W48A 3EUPA 2AO9A 2PZ9A 4GFKA 5D18A 4LOCA 4HKUA 2H8RA 5C44J 2WAQN 3L1PA 2XRLA 2JA8J 2N8GA 3T6NA 3ZQIA 5HBUA 1YRNA 5C4XJ 5EDNA 4W1UA 4DZJA 2R5ZB 3S1MJ 1MBGA 1GV5A 1EF4A 4A3MJ 3LSPA 3OSFA 1WH5A 3G1LA 4CGRA 2R0QC 2YU9J 2REKA 2XB0X 3GTOJ 2UXUA 2ID3A 2MGQA 1MH3A 4D7MA 2DMPA 2IAIA 1K83J 2LLKA 3BQZA 3BTCA 1UMQA 2UXOA 2VKEA 2YVHA 5GPCA 4W97A 1H88C 1QVTA 3G1OA 1FIAA 2CUEA 2MW8A 2NP5A 2OPTA 3O8GA 3HOZJ 3FIWA 3M4OJ 2MSYA 2Y0SN 2GM4A 2GENA 3BCGA 5M5WJ 1IUFA 1Q1VA 3VVXA 2XGCA 2DMUA 2XPWA 4S0HB 2LKXA 3HOXJ 4XICA 3VVYA 1ENHA 4D7NA 4L62A 2Y31A 1A6IA 4BKXA 3RD3A 1RETA 1Y1VJ 2X6OA 4AUXA 4M3EA 3VPRA 5M5XJ 2E19A 4A3JJ 2UXIA 3ON4A 1O4XA 1X2MA 1APLC 3JRBA 2NX4A 2DA2A 2QKOA 1SANA 2HOAA 1U8BA 3ANGA 3S5RA 3E7QA 4JX6A 2WV1A 3TP3A 4AC6A 2JWTA 2LP0A 2AHQA 3FRQA 1IJWC 1XS9A 2ZCXA 3NI7A 2DA3A 2M9HA 3TW6A 2CUFA 1R9TJ 1OJLA 2EZHA 1G2HA 3PM1A 2OI8A 3VW2A 1S7EA 2VKVA 2XSDC 4FCYA 3ZQFA 4M3GA 1HDDC 1POGA 1B8IB 1IDYA 2CU7A 2E1OA 4M3BA 5EZGA 2CQQA 4KWAA 2CJJA 2ZCNA 1HCRA 3Q0VA 1UG2A 3LOCA 4HNVA 1MBEA 1NK2P 4FE4A 1ETKA 3KNWA 3G1MA 5IP9J 2ZCMA 4AF5A 3GEUA 3WHCA 1WGXA 2VUMJ 2MG4A 2WUIA 2M8GX 4I76A 3BHQA 3BG9A 5DTDA 4Y7NJ 3B6CA 3JRHA 3JRCA 2EZLA 1ZR4A 5FKKA 1OCTC 2NOGA 3BG5A 2EBIA 2VI6A 2D5VA 4NDLA 3JR9A 3MN2A 3JRIA 1GDTA 3G56A 3HTIA 2TRTA 2RAEA 1Y1WJ 3GTQJ 4UDSA 3TP0A 5FGLA 3IH3A 1MH4A 4DYQA 2FQ4A 5HODA 5HAWA 2O9LA 5J3LA 1I6HJ 2ZOYA 1TWGJ 1U9NA 4ACIA 2M34A 1GVDA 2R5YB 2D6YA 1PUFA 1GV2A 5JLWA 2O8KA 5D19A 2DA4A 3H0GJ 4AC0A 3HKZN 1HLVA 1AKHA 3BR0A 1B72B 5F0CA 4BXXJ 2L7MP 1JUMA 3B81A 5FHPA 3JREA 1D5YA 3EGQA 2O7OA 2DJNA 5J1UA 5E3LA 3CRJA 5JLXA 5J1YA 3LNQA 5E3MA 4A3GJ 2ELKA 4C3HJ 2CRGA 4RBOA 1ZK8A 5M3FJ 4A3EJ 1JTXA 4GFBA 2QIBA 3OSGA 5F04A 1Z0XA 1X58A 4XRMA 1BW6A 2R5YA 2DG7A 3BJBA 5FKNA
chains in the Genus database with same CATH superfamily
1NH3A 3U2RA 2OUMA 3D1NI 3HUGA 1BN5A 5B1AH 4JOMA 5L3DA 3MVPA 1QRYA 2Z3YA 2HXOA 3PFIA 2EIKH 2XRNA 5TGTA 4IRVA 4AIKA 2ESHA 3ZMVA 2KQRA 4RGUA 1MNMC 3DU6A 4P9FA 4IHVA 2RASA 4ZTFA 2UUZA 5HDGA 1HSJA 3NRGA 4HX4A 4QWQA 3BR2A 2M0CA 3I56I 3E7LA 1AHDP 2KT0A 2ZSHB 2X0LA 5K5OA 3AL0B 5EJCA 2DFHA 3V7RA 1I50J 2PN6A 1T0FC 3SZGA 1AA7A 1KZHA 1TBXA 3WGHA 2HVQA 3PASA 2L9VA 3K7AJ 1J0RA 1W36D 1B4AA 3OYIA 1MJAA 3QP5A 2ZO4A 3HTHA 2IA0A 1MBKA 2AXLA 2CG4A 3HOWJ 4G6TB 2V6EA 1AU7A 4RB2C 4HA8A 3SFZA 3T0YA 1R22A 2XDNA 3FXKA 4NBQA 1QGPA 1TNTA 5DAJA 3ULQB 3DPLC 1G3WA 3FMQA 3HKZA 3SFIA 1I3QJ 1ON1A 2OERA 4EQQA 2RQPA 2KHMA 3K9TA 2K9NA 2FU4A 1FYKA 3LL7A 3COLA 2DO7A 5FJ8J 3S1QJ 2E1MC 4XLCA 4Z2YA 4A0XA 4ZDLA 2HKOA 5C4YA 4BNCA 3KKCA 5E20A 4O5VA 5IYCJ 2A6HF 1FP1D 3GCMA 1D1BA 1V5EA 4KIGA 3O3KA 2M3AA 4GCKA 5LRSA 3BPXA 3A03A 4HF0A 2ZKZA 4A6DA 2Q0OA 1DU0A 5HSZA 2W82A 3HYIA 4XK4A 5JVGF 3PL8A 1TL8A 4XLHA 3LSGA 2M4GA 2E5ZA 5L3FA 1B6AA 3PO3J 1Q1HA 2M30A 4PJMA 3SXYA 4F52A 2L7ZA 2CH0A 1FY7A 3H3UA 4KA4A 1OKRA 4LK0F 5FD5A 2P0WA 2FUG2 2X6WA 2VT2A 3U9GA 3MQ0A 2CMPA 4N4OB 3L2UA 1I39A 3V4GA 3FXUA 4LK1F 2ETHA 2GIZA 3FWEA 2O8XA 1Z6TA 4Y15A 1YS7A 2FMYA 2ZXJA 4BE0A 2DT5A 4CXFA 2LVSA 3DF8A 4M9ZA 1JGGA 4GCLA 4E6KG 5F1JA 1KQ0A 5IT3A 2LSOA 3K0LA 5EEAA 3ZQCA 1XN7A 1FTTA 3A0BC 3AQSA 2NVTJ 4IX7A 1QHHD 1HW2A 3QAHA 2V9VA 3QPHA 2DW4A 2PMZN 1QZYA 3LWJA 5GAGJ 4XLPF 2EILH 4XMYA 2RQQA 2WB1A 3KIOA 4G7ZF 5HLTA 4AD9A 3MNLA 4MHGA 5K7HA 3BG3A 1R00A 2XUBA 3CDLA 3ABTA 3RPUD 1FP2A 3MZ8A 1I1GA 4ZTJA 5B5EC 2EFOA 2CUZA 2PMUA 1U0JA 3DEWA 4IQ4A 3JSPA 1PDNC 3W6VA 2ZCWA 3ABLH 4F91B 5B66C 3CJQB 2QGUA 3H1CA 1H8AC 2HVRA 2R7WA 1EH8A 2P81A 3BT9A 3RZDJ 5E1ZB 3TW7A 1C0WA 3BOQA 1OISA 1E2XA 3LFUA 4EJVA 3TO7A 4XSXF 4XKVA 2IS6A 1OYIA 5GADJ 4FE7A 3I4MJ 1OMIA 4WF2A 3KZZA 3FK6A 1NTCA 3GTPJ 3IUOA 5A2QK 3C2BA 4QPQA 1HOMA 5H2FC 2Q8KA 3HRSA 1TT0A 3WG7H 2WAFA 4WXHA 5LEKA 3WU1B 3WTYC 2E1NA 5GP9A 3A2KA 3H0DA 3LSHA 5C4JJ 4XBFA 1W1WE 1QA6A 2Q24A 3OYKA 4A3CJ 2I10A 1RNLA 2XAQA 1DGRM 2A6EF 4KJZA 2EV6A 2KIFA 2L3DA 1X3UA 5JHFA 2ZJQF 3IC7A 2LBFA 4BEHA 2GA1A 3NPIA 3O8HA 5EG0B 3PUBA 3RIRA 5J40A 2HS5A 1VQKI 5HNHA 3F6OA 3GBGA 2ECBA 1F5TA 3F8NA 4ASNA 4EEFG 4HZFA 1D5VA 2XASA 3HGGA 1MKMA 1LFUP 2DN0A 1D8KA 2XAJA 3LFKA 3V8LA 3G2BA 4HBLA 5IOYA 1H0MA 4CZCA 5LLQA 2STWA 2V26A 1F36A 3WTUC 3N05A 2BY1A 1JT6A 4BHCA 5K1YA 5F08A 2UXPA 1MJBA 3EYYA 1JT0A 3DPTA 2M87A 3FXMA 3MFKA 5K5QA 4FTHA 2W85A 4BXUA 2WTEA 4MO7A 3DBLB 1FT9A 1KU9A 1OCCH 2ME0A 4IHYA 3JW4A 2TCTA 5KCMA 3P9CA 4R1HA 3EUKL 1WQ2A 2HDCA 1F43A 4CCJA 3EPZA 3K1NA 5HS8A 5H6RA 1MD0A 2DFEA 2BEOA 2IVMA 1UHSA 3NAUA 2EK5A 2E2HJ 4XN0A 1WJDA 3PJRA 1VI0A 3VDXA 5C3EJ 2R92J 1HW5A 4V2FA 4UVBA 2B0LA 1TW2A 2K9QA 4BE2A 1UJ8A 2MD5A 5ED4A 4YRVA 2HDDA 3HTSB 3TOAA 2M0MA 3TKYA 2OF7A 1FBQA 1R6RA 2V4JC 3BG7A 3K1PA 2BHZA 1Z7UA 1MSFC 4M6XA 2JPCA 4DZPA 5BS6A 2RV8A 2XPUA 1FBUA 4EM2A 5IP7J 3ZMUA 4NHJA 1Z77A 1T0FA 2KZGA 4HLXA 5E3OA 4CUGA 1LNWA 1GXQA 4EV0A 4IHTA 3REOA 3CDHA 2K9LA 3E6BA 3DTKA 1LQ1A 3E5QA 1G3SA 4WXDA 5CQGA 3CJRB 4Q4ZF 2OC6A 5LGTA 1ZLKA 5IYBJ 2BY3A 2ZOZA 2JQ7A 2DYRH 3P9TA 2IA1A 2JMWA 2L7FP 4C2MJ 5IT9K 3GZ6A 4HG2A 3OIPA 4D1QA 1XTAA 3W6JB 3C07A 3VP5A 1Z7LA 2NVXJ 2IGNA 4AU7A 4HAMA 5DCMB 3AG2H 3MMYB 1U5TB 4G12A 3I53A 4JNNA 1WJCA 3QU6A 2VOPA 2DXIA 2JJ7A 2VJ4A 1H9GA 5KHDA 3EUPA 4YFNF 1P2FA 4HKUA 3ERMA 3VWBA 1TLHB 4I09A 2N8GA 2Q1ZB 2WAQA 4GCVA 1BOAA 3ZQIA 4A2UA 1YRNA 4Q5SF 3C3WA 3FKJA 3Q9VA 4HF1A 1SFKA 3AFHA 4JK1X 1X1CA 2BVLA 3EUAA 4W1UA 1MBGA 1GV5A 1WKMA 5B1BH 1KU2A 2XF7A 1X1BA 3BROA 3G1LA 3ML6A 3OWTA 4G94A 4BH9A 2REKA 3PSFA 3GTOJ 2UXUA 4PCQA 1STZA 1S29A 4DJAA 4PFPA 4RAGA 3CJTB 4BAYA 2VKEA 3DEEA 5GPCA 4LLGF 3W2VA 2P5LC 1H88C 3OYDA 2HTSA 1QVTA 3G1OA 1FIAA 2CUEA 3WODF 2M4KA 5D6EA 1YHQI 4KN7X 2WBMA 3QPTA 2YU3A 4TV7A 2L54A 5ICFA 4IHSA 3P9IA 3HOZJ 2GM4A 2GENA 1KONA 2M1BA 2X6XA 2PI0A 1QO0D 1Q1VA 2G9WA 2XGCA 2DMUA 1ERDA 1WVRA 3TMOA 1ENHA 4RMNA 1YW7A 2DLLA 3ZMDA 2ZSIB 2X6OA 1PVEA 2MC4A 4AUXA 3LQRA 4RAYA 4BUPA 2UXIA 1APLC 3MKYB 3JRBA 1N77A 1QHGA 2XAHA 1B9MA 2PMZA 3ZN0A 3OV8A 3ANGA 1XB4A 3S5RA 3NS4A 1T8IA 2WV1A 3R61A 3D0SA 4OOIA 2KFDA 4DQ2A 1ODDA 4CZZA 1I1SA 2Z2SB 3I59A 1XS9A 3NI7A 5TISC 4C9YA 1MMSA 2D45A 1RUNA 2DODA 2PJRB 4ENNA 2VKVA 2XSDC 1G3TA 2M7BA 3W6KB 4L5IA 2V9KA 1IN7A 3H9GA 1JGSA 1IN5A 3RCOA 2E1OA 4NUBA 3IRRA 2K02A 4RAFA 4Y13A 2KRHA 3K4BA 4KWAA 2FBKA 1VQMI 1HCRA 2PEXA 1FNNA 1R4NB 2OCEA 3LOCA 4HNVA 5DM7F 1ETKA 3WTVC 3IWFA 2V9PA 4F7ZA 2HQNA 2K9MA 3K4CA 5KVRA 4NC6A 4RB3C 2M8GX 2M45A 1D1AA 1YFHA 5D5WB 1FX7A 3PQKA 4QPOA 4DIQA 2PBIA 2JT1A 4Y7NJ 4MTDA 3JRCA 5CQEA 1FWZA 1ZR4A 5FKKA 2EBIA 2BW3B 4IVNA 3D5SC 1DQUA 1GDTA 2WY8Q 4E7JA 3WGIA 4OIRF 2DQLA 2RAEA 1Y1WJ 4UDSA 2BXYA 3ROUA 4P1WA 2FQ4A 5HAWA 5ERIA 1I6HJ 2ZMEB 2P6SA 2Z99A 1PUFA 5JLWA 3RQ4A 3ZMZA 3H0GJ 1VQPI 2XROA 1YIJI 5F0CA 3BG6A 3B81A 3HTUA 1O3TA 1ZRFA 2RKHA 1D5YA 2DJNA 1TQPA 1YOVB 3SEQA 2KP6A 3CRJA 5JLXA 2GWRA 3OYNA 4ZJZA 3LNQA 2STTA 2LNBA 5DDGA 1W36C 4A3GJ 2ELKA 3ONQA 2DDBA 3OIQA 3K1MA 4WX9A 5JHUA 1BR2A 4MEYF 2QIBA 2QSFX 1Z0XA 1LVAA 4RM2A 2MLGA 2H94A 4BQAA 1V3FA 5ICEA 1IAWA 3K4MA 1I5ZA 2RN7A 4PJJA 3F6VA 4GO1A 1ZRCA 4EATA 2A05A 2CQKA 4A69C 1BL0A 2B3WA 2FA5A 1P92A 2F5CA 3OYEA 3N4MA 1WPKA 1YW8A 4BY1J 3HPHA 2VASA 3MKLA 3CCVI 3GO5A 4ZYDA 1V55H 1EH6A 2PJRA 4PJLA 3ECHA 1HKTA 1S7AA 3C7JA 3CUQC 5E3NA 3J80Z 1G8XA 3A01B 4II3A 2UXXA 2G3BA 2WV0A 4OIQF 3PPBA 3J7AO 2G7GA 3KEYA 3HRMA 4KUMA 2O3FA 4NNJA 2UZKA 3BTLA 3V7SA 4IHXA 3VW0A 4CO8A 4XQFA 1R71A 3NRVA 3OS2A 1SMYF 4BQOA 3IKVA 3K2AA 2QQ9A 2F07A 4K2EA 2FBQA 2Y2ZA 3VOEA 2P7CB 3GTGJ 4L0ZB 3H9QA 5J4YA 3FK7A 3M1EA 3WE3A 1Y8QB 4LFUA 5FRMA 1FMVA 3CCYA 2OTLI 3KFWX 1DP3A 4LB5A 5CVVA 5BOXA 5IYDJ 5H9TA 1J2XA 5L3CA 4A3DJ 1WI9A 9ANTA 2QWWA 1N75A 1S6LA 4BXFA 4QTRA 3K6GA 4ESFA 1J7KA 1Z3XA 2HYTA 5ILSA 3GLLA 3KE2A 1FBSA 2ACJA 2VC1A 2WY7Q 3LA3A 3LA7A 4PJNA 4RLQA 3FISA 1K4TA 4OD5A 2YUSA 3WU2C 1ZTRA 2ELJA 2QOPA 5FKMA 4BHBA 2FXAA 3ZQGA 1T6SA 3F21A 3H9JA 5AIPA 2K85A 1U78A 4IF4A 1FC3A 2GIVA 4OWRB 1BBYA 3QPLA 2IS2A 5E8GA 4LG0B 1ONVA 1ZRDA 4KMFA 3E6CC 2HR3A 3HB9A 1XGNA 2DA6A 4YG2F 2ZBKA 1I6XA 4GRIA 2IW5A 1QNTA 3J7AY 2ID6A 1QVUA 3BRUA 1OR7C 1VF9A 3DFGA 3HEFA 1YQAA 1KU3A 2Y69H 5CYVA 3MZHA 1E17A 2VKHA 2WAEA 4QSHA 1DPRA 4KN4X 3T8TA 1SMTA 2L0KA 4I7HA 1BC7C 2XAFA 1R58A 4IHWA 4MQVA 4FETA 2NVYJ 4PK4A 4A3BJ 4XN3A 2QWTA 3LSJA 4XRFA 2DOFA 2I5UA 3CCMI 4AYBN 1KA8A 2DOEA 4RGRA 2Y9ZA 4JYKA 4UVCA 2LC2A 4AVPA 1K78A 2BBYA 3MEXA 4YFXF 3FHNA 1K4SA 2Y48A 3BTJA 1VNDA 2JUCA 5JVTA 2L4MA 4P55A 3LHQA 5KAFC 2H1LA 2CO5A 5AQCA 1OR7A 1ZELA 4ZDOA 4MLOA 1XCBA 3I55I 2FJI1 3A1YA 3ECOA 2X6YA 1L0OC 3FM3A 3CMYA 3CC7I 4CA0A 3HDDA 4LLNA 1F4KA 3OOUA 4PXIA 4LIUA 2KDZA 4A0ZA 3RH2A 2RREA 1IUYA 1IN8A 2VLAA 1R5GA 3H3ZA 4HYEA 3L9FA 4BYYA 2KJBA 3VOXA 1YI2I 2JRMA 4L9VA 5J47A 3CF5F 4D0PA 1FSHA 2GA2A 1OCRH 4Q48A 4NELA 4BJTA 3BPVA 3I0TA 4WWCA 3DPUA 5M3MJ 5F27A 1KYZA 5FLXK 2H27A 5K58A 1P4XA 2A69F 3OYHA 2VPRA 2JA7J 3WTSC 1YW9A 5FLMJ 2IBDA 4Y3OA 2DTZA 3KCCA 5CXGA 2D2WA 1LEBA 3FBNB 3C2HA 4IXAA 2J5PA 1K6YA 3JSOA 5HS9A 3DKYA 3VYTB 4HQMA 2NNYA 1P7JA 2HKXA 4BL0B 2IXSA 4XRSG 1RKTA 2EPFA 3H5NA 3DBHB 4M9XA 2XAUA 2XB5A 3HBLA 1K61A 1ZARA 3VVZA 2BXZA 3E5UA 1VQ4I 3HUGB 1RR7A 4XNFA 2O03A 2XAGA 1IXSB 2FMLA 3SZTA 2GLOA 1B72A 2EJRA 2HYFA 2V6CA 2VODA 1T95A 2FE3A 2LF8A 5FMPA 2EA4A 1ZGAA 3H3VK 3DPJA 1IG7A 2W84A 3DXJF 4OD4A 3HSFA 2H6BA 2K9SA 3U1KA 2YVXA 1DUXC 1B8IA 2CFOA 2YR2A 4HDUA 5EG0A 4HRIA 4EMSA 2LY9A 2WB1N 2QF7A 2XKPA 2L9NA 4HX7A 4ABZA 2G7SA 2XKOA 4JKZA 2O61A 5D4SA 3JSJA 3KP5A 3FZVA 4U0YA 4UUSA 3G3ZA 3CCLI 2R7TA 3J7YJ 2BVMA 4NC7A 3FBIB 2X1DA 4EJTA 2LD5A 4MGRA 3LQQA 4U7DA 3CC4I 2PX9A 2Y9YA 1ON2A 1W7PB 1XSXA 4FX0A 2NRAC 2CQ7A 2V1UA 3JCUC 1VQ9I 4BBRJ 1VQLI 4KYWA 1MMNA 4LJZF 5D5XB 1V5GA 4PGGA 1IRFA 1ETWA 3GZIA 1OLTA 3H35A 2ME6A 3T5XA 6PAXA 5L3GA 1WRJA 2VONA 4Y33A 2GOXB 3CMAI 4Z6YA 2EFPA 5D5UB 2FRHA 3SDBA 1Z1DA 5DM6F 5F64A 1SD5A 4A93J 2IS1A 4B3AA 2DT7B 2ELHA 4MXMA 2Z16A 3DEUA 2IP2A 2E5NA 5AONA 3GW2A 4CICA 4CSWA 2B1EA 3ISPA 4GCTA 2PMHA 5H6QA 4DBQA 3PQJA 3I4NJ 1MMAA 2ZMEC 4IKFA 4HSRA 2W00A 1J75A 2DG8A 3RYRA 2F2EA 1D1CA 5F0FA 1UI5A 2HQ5A 1U3EM 4H4KC 3EYIA 4E4HA 5LHIA 3ANPA 1JUSA 1ZAOA 1ITYA 3VOKA 2I8DA 4NC8A 2GOMA 1JKQC 4I0AA 1KGSA 1SVMA 3ZQLA 2NS7A 3W2AA 3A01A 3F9KA 2KIMA 1WWXA 4L0YB 3Q3SA 2RNGA 3W3CA 2F4IA 3PUFA 2Z1DA 4XLNF 2XC7A 4UB6C 3VFZA 1YITI 4ITVA 4A5MA 3G6EI 2A5YB 5CVRA 3M8FA 1BI1A 4AVZA 1GVJA 3FXOA 1SGMA 3F1BA 3BP8A 2DCEA 5CW8A 3QPSA 2BGCA 3O2PE 4B09A 4D5FA 5FRNA 3OYMA 4BQQA 3F22A 2HYJA 3T1BA 3RYPA 2M5WA 4A3KJ 2EV0A 2Y75A 4BY7J 3S1NJ 1UB9A 3CLOA 4X6AJ 2B63J 3CUQB 2QVOA 3HE0A 2W4SA 5EFYA 5D18A 4LOCA 1PUEE 4PUSA 2YX4A 1XX5A 5C44J 2WAQN 3L1PA 2XRLA 3EUHC 4NQWA 1MNEA 2ISYA 4L9TA 1FSEA 2BW3A 4LLLA 3VYSB 3LSPA 3LAPA 2HPIA 4BACA 2P5VA 3AG1H 3K70D 2IA2A 2QLZA 1SAUA 4G6DA 2ID3A 4WK8F 1MH3A 1Y8RB 3I58A 3PNYA 2DMPA 1K83J 4BJ6C 4M9SA 4EGZA 1GLNA 2UXOA 1R49A 2DJIA 4EM0B 3LA2A 3ESWB 2MW8A 1P4WA 2E35A 3KP2A 2NP5A 5D4RA 3U1DA 4DGWB 2EINH 3R6SA 4GGGA 3RSNA 2Y0SN 4ZYEA 2DPDA 4AM3A 1VQ6I 2KPMA 5M5WJ 3GZ5A 2JUGA 4UNOA 1ZN2A 2O6GE 4S0HB 3HOXJ 3VB2A 3BZKA 3CF2A 3IKTA 5E79C 2Y31A 1VTNC 5GTHC 1A6IA 1FYLA 1Y1VJ 3W2WA 3OY9A 3K4JA 2W1OA 4M3EA 4UB8C 5M5XJ 2E19A 2EB7A 1LJ9A 2CV2A 1W4MA 3GFIA 2VXZA 4ESJA 1YTYA 1D0YA 2FNAA 4U87A 1FPQA 1RIOH 2QKOA 2HOAA 4WIBA 4A5NA 3ASOH 2DPUA 3TP3A 4I0BA 3CP2A 1XGMA 2E7XA 2OAZA 1IJWC 4RA2A 1YX3A 1XGOA 1L3LA 2VOOA 1LB2A 5HDNA 4A12A 2JVHA 2CUFA 3J81K 1Z91A 1ZH5A 1YJWI 1R9TJ 1OJLA 2VQGA 2HOEA 2BYVE 2H6CA 3AL0C 1IZ1A 2EZHA 2BY2A 1G2HA 4B8XA 4HX8A 3VW2A 3JAMK 3VTIA 4P5OA 1IDYA 1PJRA 3HRTA 3IAS2 1XPXA 3TL4X 3KP4A 2CJJA 2G7HA 2ZCNA 1UHMA 2QSHX 2FOWA 5LD2C 1J5YA 3A0HC 1LVKA 3COAC 2VJIA 2ZCMA 1S3JA 5DV5A 2WUIA 2W57A 2X1CA 4XLAA 2XF5A 3CP8A 3BHQA 3BG9A 1CGPA 3F23A 2ZY9A 5J6XA 1MW7A 4PSXA 2NOGA 1WJBA 3BG5A 2VI6A 3FXLA 3HSRA 1VQOI 3ELKA 3WG9A 2E1MB 2VJ5A 3IP4B 1H9TA 4EJUA 3GTQJ 4ZC3A 3TP0A 2VN2A 4DOZA 1SD6A 1MH4A 5E1WA 2V1DA 1IO2A 2O9LA 2HU9A 1BI2A 5J3LA 1QBJA 2F6CA 2R5YB 2DU9A 1BOBA 4U7BA 2O8KA 4I2OA 2DA4A 4AC0A 3KZIC 3F8MA 3HKZN 1HLVA 2IJLA 3NEUA 1JI8A 3L7WA 5FHPA 3IAM2 3K69A 3QOPA 5E3LA 3CDIA 4ENJA 5HNFA 1EH7A 3CESA 2QZ8A 5K5RA 3KEOA 4F3QA 1U8RA 3LSIA 4WXCA 4PSWA 4E7IA 1XSVA 2CRGA 2W25A 1ZG3A 2ZNZA 1O7FA 2OQRA 2YX7A 5M3FJ 3S32A 3D5LA 4CGZA 5F6FA 4A3EJ 4CDGA 1DP7P 4GFBA 1X58A 1EV7A 2NAZA 4XRMA 2K4BA 3UNGC 3GWZA 4XLEA 3RJPA 3BJBA 1XD7A 2E2IJ 2LKPA 3ZRGA 2HQRA 3S3OA 3OS1A 3SEZA 3QKXA 1Y56A 2JVGA 2K4JA 1ETYA 1XC5A 4RM3A 2NNNA 5DCFA 4B1RA 1ZR2A 5CXIA 1G59A 4JL3A 2OZUA 3CUQA 2CQXA 2F5FA 1UZCA 3KX2A 1ZGJA 4IEJA 1I27A 2CV0A 3BR5A 3H36A 2Z33A 3OOPA 2ZNYA 1JTYA 2HZTA 3LAJA 1GHCA 5FGMA 4J19A 2A5WA 3AG4H 3HIMA 3FM5A 1O3SA 1IW7F 3BY6A 1BI3A 1EKEA 1W0UA 2HGCA 2Q2EA 3S2DJ 4V2GA 1YO5C 3V7CA 1F1ZA 1MMDA 3UKGA 5K7FA 2EFNA 2FBHA 4UV9A 2OU2A 5HS7A 2LFBA 2KRFA 1NK3P 1ORKA 4B4CA 4A3IJ 5HLGA 1OCZH 1YJNI 1LFBA 4GFLA 2X85A 1G6NA 2YVEA 3VODA 4FQGA 1CF7B 1X19A 3E6DA 3GEZA 1XGSA 2AQFA 3MCZA 2KRCA 2CW7A 5J4VA 3O60A 5EGOB 3B02A 4PZJA 2KLOA 1BJZA 1QQIA 2P4WA 4UV8A 3PIOF 1K79A 1J9IA 2PBXA 4BE1A 1TZLA 2GUHA 4OIPF 1R36A 2VQHA 3VIBA 5CKTA 2W7NA 2O0YA 2X9DA 1MIJA 4A0YA 1LEAA 4Y52J 1E0EA 2E2JJ 2ZJPF 1FTZA 3HGYA 2A6TA 3BC8A 2IGOA 1CQTA 2EH3A 3GFMA 2EZKA 3WTTC 2XIGA 2W53A 4YEJA 3EDPA 3OYLA 1K6OA 2HYGD 2Y30A 1A36A 3ZOBA 3CQZJ 3BTIA 1IRGA 3PNVA 5DS9A 2QQAA 1LFPA 2BE5F 4XM3A 2LREA 4YIRX 3V6GA 1XDUA 2DFIA 2EQRA 4KMUX 2ZFUA 5IP6A 3D5RC 3ZQQA 4DW6A 1TQIA 2L9SA 2QBYB 2OBPA 3RDIA 1G4DA 1UFMA 2CYYA 2LF7A 3F8CA 5BPDA 2X1EA 2M8EA 4DVYP 1HW1A 3ZCOA 3GFJA 5ICGA 2IGKA 1HBXG 2BV6A 1ZREA 2ICWG 3IV5A 3B73A 1OCPA 3C1DA 2VBYA 4PDKA 3L2QA 1X4PA 1P9QC 3C18A 1Z9CA 4P9UA 2BY0A 3WU0A 3J7ZI 4DYRA 3JRFA 4IRGA 4YIIA 4FT8A 4OMYA 3I64A 3K10A 4RS8A 2A3SA 3ZQHA 5LHHA 3MAJA 1EA3A 3BZCA 3JRDA 1V4RA 2DK5A 2TDXA 2XPVA 2YSRA 4JX5A 3ZGKA 1O57A 4XRSA 1LE8B 4DYCA 1SFUA 4IOCF 3ZN1A 4FX4A 4X0GA 5FLVA 3F8BA 1RESA 5DD4A 2QUFA 4YIFA 1XCVA 1FJLA 2IGMA 1RKWA 1MBJA 2F48A 3IH2A 3OS0A 1W7PD 2LH9A 2CW0F 3CCRI 2E71A 2VE9A 1TWAJ 3HOUJ 1BR4A 3BR6A 3NNRA 3HOYJ 2VQCA 4D5CA 3SYTA 4IRIA 2DBBA 1KQ9A 2HDWA 3S17J 4JX4A 4LMYA 4A3LJ 1OQYA 1ULYA 2JSCA 4MK6A 3CCSI 3P7NA 5LEJA 1FEXA 3HOVJ 2XVCA 5D8LB 3S3MA 4EJOA 2OV7A 2JK3A 1JKRC 2HXIA 4M6VA 1HDPA 1GUUA 3DV8A 1M1EB 1WCMJ 3K8PC 2LRDA 4CHUA 2NP3A 1ETVA 2E34A 3NXCA 2AQEA 4IOAF 3EUHA 1JHHA 1P7IA 4RAZA 4XKCA 3Q5FA 4IJAA 1IV6A 3S15J 4ENKA 4HQEA 1XG1A 2DAOA 2IT0A 2ESNA 4BBSJ 3G73A 2QTQA 2LR8A 1JJ8C 5FO5A 1T08B 2CFXA 3IRQA 2HOSA 2CGPA 1Y39A 5CLSA 1WJAA 4I6ZA 1BA5A 2VJJA 2O7TA 4QLCU 4XKBA 4E7LA 3S1RJ 1AWCA 3QOEA 3B6AA 3FF5A 3KP6A 2R7VA 3L00A 5KNLA 2EIMH 2EIJH 2R7OA 2V57A 4ICHA 2WC2A 2NXNB 2ZJRF 3DTEA 1K7AA 1Z67A 1IDZA 1YLFA 2HFHA 4RGXA 4HV6A 3RZOJ 2LBFB 3JRAA 1J59A 3OYGA 1RI7A 2L4AA 5HLIA 3BR3A 3FX3A 2IS4A 4EM1A 3AKZA 2EZIA 2D1HA 2QKLB 4HDVA 4UVAA 1WHUA 4IPAA 3Q9SA 3R0AA 2HTJA 3BCAA 3WE2A 3KEQA 1D0XA 3FDYA 5BMZA 4S05A 3M8EA 2M2EA 1W7PA 4E70A 3PO2J 3LJLA 4MTEA 4WCGA 3DKXA 2FBIA 2ZXHA 2MC3A 1EJ9A 1FLIA 2G0EA 3KLNA 3BJAA 4KT6A 3BJOA 5HOOA 1RRJA 3K4LA 2QQ8A 4GYIA 1YRNB 3CJDA 3HRUA 1LDKB 5B3SH 4AYBA 3CZ6A 2COMA 2JA2A 2XV4S 5E8IA 3QRFF 3VW1A 3VSKA 5HLHA 4MIMA 3DLAA 4U88A 1QZZA 3DLLF 3VSLA 3HTAA 2NVQJ 1OYWA 1R5ID 4M71A 2R93J 3K70C 2COBA 2GXBA 4KT5C 4IL6C 1T56A 2LYCA 1A04A 4XLFA 2HWVA 3BNIA 1XMXA 2FJ1A 1J09A 4KISA 1BC8C 3QYFA 1YS6A 1HA8A 1S7OA 3FKIJ 4PJ0C 2LY1A 1IF1A 2OCCH 2IEKA 3F3XA 1VFCA 1KU7A 4HEA2 1HC8A 2D1VA 1DU6A 3QP6A 3S16J 1DDNA 3S2HJ 1OFCX 2W24A 4L5EA 3SDGA 3OYAA 5EEGA 2Z5UA 3LSRA 1WZ2A 4OIOF 4CCNA 2KMUA 2L2OA 1LDJA 1ZHFA 1I3AA 1RUOA 2HZDA 5LRRA 3L2VA 1N25A 1SD7A 1S9HA 2KKOA 3HHGA 2QQBA 1WH7A 4PGHA 2HPMA 2PZ9A 4GFKA 2FF4A 4LD5A 3U21A 2F4OB 3BLYA 3VYRB 2KISA 5C4XJ 1BIBA 5EDNA 2EFWA 4O3MA 2KL4A 3OYBA 3S1MJ 3I59B 2K27A 5FFXA 3H5RA 1EF4A 3OSFA 1WH5A 1S5LC 5ICCA 4CGRA 1R23A 2R0QC 2XB0X 2XGXA 2V1XA 2MGQA 1WJEA 3L2WA 4V19K 4KDPA 2IAIA 3BQZA 2LLKA 2BOLA 3BTCA 4BDYA 4KNYA 2YVHA 4W97A 1FOKA 2AXTC 4OINF 2R3SA 1U5TA 3DWLE 4AIHA 1BIAA 2GZWA 4FASD 4EGYA 2XDVA 1D0ZA 3WTWC 2GXAA 2OPTA 3RKWA 1MDMA 3DU5A 3I54A 3H92A 3LSTA 4LITA 3UR3C 3H5AA 3OYFA 2Y0SA 4ANJA 3FIWA 3M4OJ 2MSYA 2K3FA 4XSZF 4NQWB 3BCGA 1IUFA 2VT3A 1Z6RA 2R7DA 2PFVA 1IXCA 1E3PA 2XPWA 5LGNA 2CS3A 3TO9A 4E7SA 2GQQA 1UHWA 4XICA 3GX4X 1SD4A 4D7NA 5FLXZ 2LKXA 3M1CA 3VVYA 4L62A 2HEOA 3M8JA 4BKXA 3RD3A 1RETA 4KITB 2CWEA 3RKYA 4UUVA 2M7AA 4G7HF 3ON4A 3E5XA 2DI3A 1R4MB 3GFLA 2NX4A 1T38A 2VIXA 2DA2A 2GAUA 3MD2A 2QEXI 2Z9OA 5L3BA 4S04A 1U8BA 3E7QA 3E3VA 4OMZA 2LP0A 3WGGA 3MWMA 3FRQA 3WTXC 2ZCXA 2DA3A 2M9HA 3TW6A 3CC2I 1ZLJA 4CCKA 2EV5A 2NOJB 1G3YA 2L01A 1S7EA 4FCYA 2ZXWH 4M3GA 1BI0A 1N78A 1JXSA 2CU7A 4HNUA 4KFCA 2R4GA 3GLXA 4M3BA 5EZGA 2C6YA 1B1BA 4CH7A 4F92B 3KP7A 1MBEA 1NK2P 2QENA 5FFZA 1A6QA 1E3HA 2LMDA 3DP7A 3G1MA 1TTYA 4AF5A 3GEUA 3WHCA 2MYSA 1YYVA 1VZ0A 2VUMJ 1SVOA 2MG4A 3FXQA 3J81Z 4I76A 4CCOA 2KDOA 3JRHA 5IY5H 2EZLA 1DPUA 4N9HA 4NDLA 2VBZA 3MN2A 3JRIA 3N97A 4U0VA 3HTIA 1USTA 3QU3A 4L9NA 4XL9A 3DTIA 5A2QZ 4KIBA 3CD6I 1PP7U 1FZPB 4G9YA 1U9NA 3AAFA 1IRXA 3KZYA 3WTZA 1GV2A 1X3ZB 5D19A 4ZZLA 4N9IA 1BJAA 2Y0MA 1QPMA 3E97A 3VYUB 3CJNA 1NG7A 3HOSA 3JREA 3OL3A 1XMAA 2FSWA 3GVAA 5LBQA 4B44A 4LGWA 3PSIA 1O7LA 5J1UA 2RVCA 5BPIA 4R79A 5D5VB 3G71I 2DOAA 3R0JA 1ZG1A 5E3MA 3ZP5A 2K86A 2B9SA 5DUIA 4C3HJ 3CMEI 3TQNA 3ZR8X 1ZK8A 1JTXA 3KP3A 2EWNA 5F04A 4HW0A 4JBAA 3OSGA 4C2UA 2KIUA 4LIVA 1YE9A 1BW6A 5GAHJ 2R5YA 4XOPA 3QWLA 2MBFA 5FKNA 3JAMZ 1B9NA 3QQAA 2K3PA 3S14J 1E3OC 2DA7A 1IN4A 4NN1A 5HDKA 2LKSA 3J80K 2K5CA 5ILVA 2RNJA 3QYBA 2NYXA 2VC0A 2CSOA 3TOBA 2FOKA 3JTGA 2H8WA 2JZYA 1HKQA 3ZMSA 2VQLA 3DCFA 3CCJI 1UCRA 3F8FA 1TWHJ 1O3RA 1Z21A 1FMWA 3P9KA 5DCMA 4I01A 2RHAA 1YG2A 1IN6A 4ME9A 1GT0C 2H1KA 4ZDPA 2ECCA 1TP4A 3OIOA 4DBRA 4P96A 1X1DA 3GTMJ 5GTIC 1RPWA 1LUJB 3V8KA 3I3LA 4XONA 2WGBA 3IH4A 2LTPA 3LSKA 2OZ6A 2RGVA 3ERED 3HPGA 3RI4A 5TRDA 4LG3A 2WADA 2R5ZA 4FHTA 2ZJ2A 1HF0A 5J8FA 3BDDA 1MGTA 3RTRA 1JJ6C 3CMMA 3NWTA 2K40A 3HM5A 2V7FA 2JA6J 2L9RA 3M7GA 2QCOA 2QBYA 2ZB9A 4E7HA 1FYMA 3G7RA 1QZEA 2ZXIA 4C3JJ 1YJ9I 2L7KA 4ETSA 3HIFA 1XSDA 1MDMB 2NS0A 1U5TC 4CYDA 1X3WB 4BS9A 4QIWN 2XGEA 3OL4A 1P6RA 3K4NA 1FOYA 1LDDA 2GBYA 3R4KA 4ZZDA 1XMKA 4UUSB 3V8JA 1Y6IA 3PNTA 5GPAA 2X48A 1HKSA 3MKZA 2P6TA 4A6EA 1OCOH 4U0WA 1SAXA 1IC8A 2PJPA 1ZKGA 2FD5A 4XR6A 1JKOC 4L5JA 3RKXA 1WJ5A 3S8PA 4MFDA 1T33A 1QPIA 1YX5A 4RGSA 3I5UA 4B47A 2E1CA 1F9NA 1UELB 1X1AA 3CUOA 2A68F 2E7WA 5LHGA 2V79A 3IHUA 1P4AA 4JP0A 5D6FA 4IO9F 3A02A 2KJCA 1HXDA 1GXPA 4II2A 4OAZA 1FIPA 3NARA 5EEHA 2DT6A 2R7UA 3ABKH 3VEPA 1V5FA 1CF7A 1JKPC 1SFEA 4N4NB 4UUTA 4U9LA 2EA2A 4I02A 5FKLA 4XKWA 1LE8A 3WHBA 2EFQA 5KK1A 1A31A 2DMTA 1ETOA 2JN6A 2PFBA 4HLYA 2FX0A 1R1UA 1A5JA 2CQNA 2X4HA 1V54H 5EYRA 5EGOA 3E0JB 4YZEA 3A4CA 4ZYGA 1LKXA 4JQFA 1IGNA 3BZ6A 2VBXA 3BR1A 4Y17A 3GZNB 3MZYA 4Q47A 1ZQ3P 3JRGA 3ASNH 2ADUA 1FOWA 3BJ6A 2IU5A 4ENMA 3F0CA 1R5HA 3OYCA 2MD0A 2LDUA 5LGUA 3VUQA 1TWCJ 3ZPLA 1SFXA 2Q2EB 3CO7C 5DEQA 5D1RA 2FNPA 1Z3YA 3TEDA 5DUKA 5E17F 2QKMB 3GYHX 3HZJA 1VQNI 3AQTA 3SQNA 2A07F 2DA5A 2F5DA 4R8HA 1PP8F 3CTAA 3S2WA 2J5OA 1JUPA 2JPBA 1RR8C 2HOTA 2VE8A 4ON0A 1TWFJ 2BHYA 2XGDA 3KYCB 1MBHA 1SC7A 1LPQA 5F0HA 4B3XA 4UXNA 5EZHA 4RB1A 3GUDA 5TJJA 4X1EA 2PLYA 3K2ZA 2GFNA 3RPQA 4M3DA 2DMNA 1SFOJ 2K7LA 1ETXA 1ZYRF 2NS8A 2VBWA 4C30A 1JE8A 4A3FJ 2DMQA 5K7ZA 3CO6C 3P5JA 1R1VA 4GXOA 4MEXF 3KKDA 2YPRA 2R7RA 3KYLA 2CV1A 1HQCA 3ABUA 4CYCA 1BW5A 4D9JA 5IT9Z 2UXHA 4HV5A 2P7VB 4AIJA 1D3YA 3HXLA 4L9JA 3GTJJ 3ZQ7A 4C2MA 2P5KA 3Q0UA 3LSMA 4J01A 2WWYA 2H09A 1WJFA 2FQ3A 2G7LA 4M73A 4CCLA 3I9V2 2R7FA 1W0TA 5IOZA 2E60A 3GMEA 1O3QA 5BNGA 1K78B 5J1RA 2MABA 4RDUA 5FKOA 2R7ZJ 3IL2A 2VKDA 4BHPA 3O6BB 1MNDA 2L5QA 3L09A 4E7ZA 4G7OF 1DGWY 3KZ9A 4B48A 4CYCB 3HJEA 3DKWA 2FEZA 2OA4A 3OYJA 1REPC 2MFZA 2A2FX 4XIDA 1IRZA 1RC9A 1TC3C 3G4SI 2HI3A 5DYMA 3S93A 3GTLJ 2B7EA 1S72I 4MFEA 3LMMA 1T98A 2JA5J 2IRFG 3Q0WA 2DYSH 5CJ9A 2ZC2A 4FISA 2R7XA 5EF6A 1ETQA 5CVUA 1IV8A 1T2KA 1S8NA 2DDAA 5FROA 3FXRA 1ZGWA 4M74A 2DA1A 3HL2A 3RKQA 1USSA 1WI3A 3EETA 4I99C 3DBRB 3QBMA 1TW3A 1OPCA 3KPHA 2UXNA 4ESBA 1VQ7I 3SJMA 1W5SA 4LG0A 5E1XA 3CCEI 3GTKJ 5HVQC 2DFFA 1AKHB 4C3IJ 3AG3H 1W5TA 1MBFA 3FMSA 4F55A 1VQ5I 2R7SA 5M5YJ 3S3NA 5IPAA 4IQJA 4XORA 2IPQX 2XF6A 1MSEC 1JHFA 2YS9A 4OAYA 3I4PA 1TNSA 1MJ9A 1X2NA 3LWFA 1TQMA 5CVJA 3M3YJ 3RQIA 4XOTA 3HTJA 2MH2A 4Y4RA 3BQYA 1T39A 2LY2A 1UI6A 2A61A 4HF2A 3M07A 3TBIA 1QU3A 3CWRA 2VB6A 4H0EA 4U9NA 5BQTA 3E1SA 3FXJA 2X51A 4N0BA 3L2RA 2LK2A 1B59A 1NG6A 2DQRA 1SVLA 3ON2A 4M3FA 2BZTA 5FD6A 1H89C 2RDPA 3IUVA 2VXDA 1U6GA 5ILUA 1U9OA 1AOYA 2HKUA 2HVSA 3V42A 3X2QH 4GDFA 3CCUI 1PUFB 3V78A 1Y0UA 2W48A 2AO9A 2AS5F 3F72A 4F93B 2H8RA 1KYWA 1Z05A 5FB2A 3OR1C 2ZFWA 2JA8J 3T6NA 3HHHA 2UV1A 5HBUA 5E18F 2F5EA 2PQ8A 1R1TA 3TDUC 1U2WA 1Y0NA 4DZJA 2DTRA 3M9AA 3QYEA 2WA0A 2R5ZB 4MQ9F 3FMRA 4BEHB 4EVIA 1TT5B 1W5CC 4A3MJ 2VL8A 2YU9J 2V1NA 4EJWA 4J00A 2L02A 2JRTA 4D7MA 1X4OA 2OJED 1NHAA 1UG0A 1UMQA 1RZ4A 2GXGA 3KYDB 1FOXA 2QSGX 5JI6A 3SWHA 2P8TA 4IZZA 2E36A 3O8GA 4BDZA 4NB5A 2XHKA 5JFRA 1SEUA 4ZYAA 2JTVA 4HSTA 3K4KA 2MH9A 2OD5A 5J8CA 5LFAA 4HOBA 4LB6B 3HG9A 4DNCA 3VVXA 3KLOA 4BQNA 1OYYA 4KIFA 4M6YA 3TO6A 5D8KB 1KQ8A 3QODA 3TGNA 4YELA 2DK8A 3HC7A 3VPRA 3ZMTA 4A3JJ 4BJ5C 1O4XA 1X2MA 2ZMEA 3MKWB 4G8XA 1SANA 2CUJA 1VQ8I 2OTJI 4JX6A 4BGDA 3C2GA 3DQVC 1MMGA 4AC6A 1PYVA 2JWTA 2R7QA 2AHQA 3L2CA 3HOTA 2UWMA 2CW8A 4OU0A 5KAIC 5H20A 4AWXB 3ZXSA 3OR2C 5AIQA 2LOOA 3PM1A 2OI8A 5L3EA 1WSUA 3ZQFA 3KETA 1HDDC 1POGA 1B8IB 4M72A 4YFKF 4E7KA 4RLFA 3SHFA 1WFXA 3T8RA 5F1RA 1BM9A 2KIQA 2CQQA 2LG4A 3ABMH 2QA4I 3TDZC 3Q0VA 1UG2A 3CCQI 4FE4A 3KNWA 5CVIA 5JR3A 4AIDA 4BU2A 5IP9J 4PFOA 2G7UA 1WGXA 2O5RA 4RB0A 2KZVA 2OQGA 5CPRB 1HSTA 1R7JA 1ZG5A 5DTDA 1D8JA 3B6CA 1OCTC 4KICA 4HPQA 2D5VA 1MZBA 3JR9A 3BCBA 4L18B 3G56A 2HQAA 5GAEJ 2TRTA 5FGLA 3EQLF 3GF2A 3IH3A 1ACIA 4UY8I 3PFYA 4DYQA 5HODA 1UAAA 3PIPF 4G6QA 3FHZA 2QYOA 2ZOYA 1TWGJ 3R60A 5DD8A 3HSEA 4MNUA 4ACIA 3I71A 2ISZA 2M34A 1GVDA 2D6YA 3CLQA 3NWSA 4UHTA 2HNHA 3JTHA 4ZYHA 1AKHA 3BR0A 1B72B 4BXXJ 2L7MP 1JUMA 4GYGA 3OMYA 4ZH4F 2RC4A 3IWZA 4B43A 2O7OA 3EGQA 2VPLA 2MA3A 3E6MA 4CCMA 4I98B 2F5VA 4IRHA 1XDSA 5J1YA 4C2TA 2QM3A 4HNTA 2F4MB 3RPUA 2MLKA 3GXOA 4RBOA 2XSJC 2NVUB 1BR1A 2JSPA 3BWGA 2PG4A 3NQOA 1IXRC 4O6JA 1X1PA 3SZPA 1YIOA 2DG7A 1A35A
chains in the Genus database with same CATH topology
3QQAA 3S14J 1E3OC 3D1NI 2E2IJ 2DA7A 4NN1A 4A69C 1BL0A 3QKXA 3MVPA 1QRYA 1WPKA 4BY1J 2HXOA 1ETYA 1XC5A 3DCFA 4B1RA 4JL3A 3MKLA 1ZR2A 5CXIA 2CQXA 1TWHJ 4IEJA 3BR5A 1MNMC 5E3NA 3A01B 2RHAA 4ME9A 1GT0C 2H1KA 1JTYA 2ECCA 4IHVA 2RASA 2G3BA 3OIOA 3NRGA 3PPBA 2G7GA 3GTMJ 4J19A 3HIMA 3BR2A 1RPWA 2M0CA 3BTLA 4IHXA 3VW0A 3E7LA 2WGBA 1AHDP 1W0UA 2KT0A 3S2DJ 3IH4A 2LTPA 4V2GA 1I50J 3K2AA 2F07A 2FBQA 3UKGA 2Y2ZA 5K7FA 2R5ZA 3GTGJ 1HF0A 3FK7A 3PASA 3K7AJ 2LFBA 1NK3P 1ORKA 3CCYA 4B4CA 4A3IJ 1JJ6C 1LFBA 5IYDJ 4GFLA 2K40A 3HM5A 3HTHA 5H9TA 2JA6J 1MBKA 4A3DJ 2L9RA 3HOWJ 9ANTA 2YVEA 2QCOA 1AU7A 2ZB9A 3O60A 4QTRA 4C3JJ 3G7RA 2XDNA 5EGOB 2HYTA 5DAJA 1BJZA 4QIWN 2XGEA 3FISA 3SFIA 1I3QJ 2GBYA 2OERA 2PBXA 2GUHA 2YUSA 4UUSB 3VIBA 1ZTRA 2QOPA 2K9NA 5GPAA 4Y52J 2X48A 2X9DA 5FKMA 3COLA 3ZQGA 5FJ8J 3S1QJ 2E2JJ 1FTZA 3HGYA 1IC8A 1CQTA 1U78A 5C4YA 2EH3A 1ZKGA 2FD5A 3KKCA 3QPLA 2EZKA 1JKOC 5IYCJ 2W53A 4MFDA 1T33A 1QPIA 2Y30A 3HB9A 2DA6A 4GCKA 3A03A 3ZOBA 3CQZJ 3BTIA 4JP0A 2ID6A 1QVUA 5DS9A 3A02A 3BRUA 1VF9A 1DU0A 3HEFA 5HSZA 4XK4A 1FIPA 3NARA 4QSHA 3V6GA 2L0KA 2EQRA 3LSGA 5IP6A 3PO3J 4DW6A 2L7ZA 4IHWA 1JKPC 2NVYJ 4A3BJ 4UUTA 2QWTA 3LSJA 4AYBN 5FKLA 1LE8A 3WHBA 2DMTA 3IV5A 1ETOA 1OCPA 2JN6A 2Y9ZA 2FX0A 4JYKA 1A5JA 3BTJA 1VNDA 5EYRA 5EGOA 4DYRA 3JRFA 3LHQA 5AQCA 4YZEA 2LVSA 4MLOA 1JGGA 4GCLA 1IGNA 3ZQHA 5F1JA 3BR1A 3CMYA 5EEAA 3ZQCA 3HDDA 1ZQ3P 1FTTA 3JRGA 3AQSA 4PXIA 3OOUA 3JRDA 2KDZA 2NVTJ 3RH2A 2PMZN 3LWJA 2IU5A 2XPVA 3F0CA 4JX5A 3MNLA 5K7HA 4XRSA 1LE8B 3BG3A 4DYCA 3VOXA 3VUQA 3CDLA 1TWCJ 5FLVA 4NELA 1RESA 5D1RA 3DEWA 1FJLA 1RKWA 1MBJA 3W6VA 5M3MJ 3TEDA 3IH2A 5F27A 1H8AC 5K58A 2VPRA 2JA7J 5FLMJ 1TWAJ 2IBDA 3HOUJ 3AQTA 2DTZA 2P81A 3BR6A 3NNRA 2DA5A 3BT9A 3RZDJ 3TW7A 3HOYJ 5CXGA 4D5CA 1JUPA 2HOTA 1TWFJ 2XGDA 1MBHA 1P7JA 3S17J 4JX4A 4FE7A 3I4MJ 5F0HA 3FK6A 1NTCA 4XRSG 1RKTA 5EZHA 3GTPJ 4A3LJ 1K61A 2XB5A 3HBLA 4MK6A 3VVZA 4X1EA 1RR7A 3C2BA 3HOVJ 1FEXA 1HOMA 4M3DA 2DMNA 2GFNA 1SFOJ 2GLOA 1B72A 5FMPA 2JK3A 1JKRC 2HXIA 4M6VA 1ETXA 2NS8A 3H3VK 3DPJA 1HDPA 1IG7A 1GUUA 1WCMJ 5GP9A 2K9SA 4A3FJ 2DMQA 5K7ZA 1ETVA 1B8IA 2NP3A 3NXCA 5C4JJ 5EG0A 1P7IA 1IV6A 2Q24A 2LY9A 2WB1N 2I10A 3S15J 4A3CJ 2QF7A 3KKDA 1XG1A 2G7SA 4ABZA 1BW5A 4CYCA 2UXHA 4JKZA 3NPIA 3O8HA 4BBSJ 5EG0B 2QTQA 3JSJA 2LR8A 3GTJJ 1JJ8C 4UUSA 3GBGA 2HOSA 2ECBA 2LD5A 3Q0UA 4EEFG 2Y9YA 1BA5A 3HGGA 4I6ZA 1LFUP 2DN0A 2O7TA 3S1RJ 2G7LA 5IOYA 1W0TA 3B6AA 5IOZA 1F36A 4BBRJ 5BNGA 1JT6A 2UXPA 2V57A 5F08A 5J1RA 4ICHA 4RDUA 5FKOA 2R7ZJ 1JT0A 1IDZA 4FTHA 3RZOJ 4MO7A 1ETWA 3GZIA 3KZ9A 3JRAA 2ME6A 4CYCB 2ME0A 4IHYA 3BR3A 2TCTA 4XIDA 1IRZA 1TC3C 2EZIA 2HI3A 1F43A 3GTLJ 4A93J 4B3AA 4MFEA 4MXMA 2JA5J 1UHSA 3NAUA 2E2HJ 3Q0WA 4GCTA 1VI0A 2M2EA 5C3EJ 4FISA 3PO2J 3I4NJ 5EF6A 1ETQA 4V2FA 2R92J 3LJLA 1ZGWA 2G0EA 2DG8A 2DA1A 2K9QA 3RKQA 1WI3A 2HDDA 5F0FA 1YRNB 3QBMA 3CJDA 1UI5A 3SJMA 2OF7A 2HQ5A 3GTKJ 3VW1A 3ANPA 1JUSA 1ITYA 1AKHB 3VOKA 4C3IJ 4MIMA 1MBFA 1JKQC 1MSFC 5M5YJ 4DZPA 5IPAA 3ZQLA 2NS7A 2XPUA 2NVQJ 1MSEC 3A01A 2YS9A 5IP7J 2R93J 3HTAA 1Z77A 2COBA 1T56A 3Q3SA 1X2NA 5E3OA 3BNIA 3M3YJ 3RQIA 2FJ1A 3HTJA 3BQYA 1UI6A 3FKIJ 3CWRA 1SGMA 2IEKA 1VFCA 1DU6A 3S16J 3F1BA 5IYBJ 3S2HJ 5CW8A 2ZOZA 1OFCX 3QPSA 4L5EA 3SDGA 2LK2A 4D5FA 3P9TA 3LSRA 2JMWA 2L7FP 4C2MJ 3ON2A 4M3FA 1H89C 3C07A 2HYJA 3VP5A 3IUVA 2NVXJ 4A3KJ 1U9OA 4G12A 4BY7J 3S1NJ 4JNNA 4X6AJ 2B63J 2HKUA 1WH7A 2JJ7A 3HE0A 5EFYA 1PUFB 3V78A 2W48A 3EUPA 2AO9A 2PZ9A 4GFKA 5D18A 4LOCA 4HKUA 2H8RA 5C44J 2WAQN 3L1PA 2XRLA 2JA8J 2N8GA 3T6NA 3ZQIA 5HBUA 1YRNA 5C4XJ 5EDNA 4W1UA 4DZJA 2R5ZB 3S1MJ 1MBGA 1GV5A 1EF4A 4A3MJ 3LSPA 3OSFA 1WH5A 3G1LA 4CGRA 2R0QC 2YU9J 2REKA 2XB0X 3GTOJ 2UXUA 2ID3A 2MGQA 1MH3A 4D7MA 2DMPA 2IAIA 1K83J 2LLKA 3BQZA 3BTCA 1UMQA 2UXOA 2VKEA 2YVHA 5GPCA 4W97A 1H88C 1QVTA 3G1OA 1FIAA 2CUEA 2MW8A 2NP5A 2OPTA 3O8GA 3HOZJ 3FIWA 3M4OJ 2MSYA 2Y0SN 2GM4A 2GENA 3BCGA 5M5WJ 1IUFA 1Q1VA 3VVXA 2XGCA 2DMUA 2XPWA 4S0HB 2LKXA 3HOXJ 4XICA 3VVYA 1ENHA 4D7NA 4L62A 2Y31A 1A6IA 4BKXA 3RD3A 1RETA 1Y1VJ 2X6OA 4AUXA 4M3EA 3VPRA 5M5XJ 2E19A 4A3JJ 2UXIA 3ON4A 1O4XA 1X2MA 1APLC 3JRBA 2NX4A 2DA2A 2QKOA 1SANA 2HOAA 1U8BA 3ANGA 3S5RA 3E7QA 4JX6A 2WV1A 3TP3A 4AC6A 2JWTA 2LP0A 2AHQA 3FRQA 1IJWC 1XS9A 2ZCXA 3NI7A 2DA3A 2M9HA 3TW6A 2CUFA 1R9TJ 1OJLA 2EZHA 1G2HA 3PM1A 2OI8A 3VW2A 1S7EA 2VKVA 2XSDC 4FCYA 3ZQFA 4M3GA 1HDDC 1POGA 1B8IB 1IDYA 2CU7A 2E1OA 4M3BA 5EZGA 2CQQA 4KWAA 2CJJA 2ZCNA 1HCRA 3Q0VA 1UG2A 3LOCA 4HNVA 1MBEA 1NK2P 4FE4A 1ETKA 3KNWA 3G1MA 5IP9J 2ZCMA 4AF5A 3GEUA 3WHCA 1WGXA 2VUMJ 2MG4A 2WUIA 2M8GX 4I76A 3BHQA 3BG9A 5DTDA 4Y7NJ 3B6CA 3JRHA 3JRCA 2EZLA 1ZR4A 5FKKA 1OCTC 2NOGA 3BG5A 2EBIA 2VI6A 2D5VA 4NDLA 3JR9A 3MN2A 3JRIA 1GDTA 3G56A 3HTIA 2TRTA 2RAEA 1Y1WJ 3GTQJ 4UDSA 3TP0A 5FGLA 3IH3A 1MH4A 4DYQA 2FQ4A 5HODA 5HAWA 2O9LA 5J3LA 1I6HJ 2ZOYA 1TWGJ 1U9NA 4ACIA 2M34A 1GVDA 2R5YB 2D6YA 1PUFA 1GV2A 5JLWA 2O8KA 5D19A 2DA4A 3H0GJ 4AC0A 3HKZN 1HLVA 1AKHA 3BR0A 1B72B 5F0CA 4BXXJ 2L7MP 1JUMA 3B81A 5FHPA 3JREA 1D5YA 3EGQA 2O7OA 2DJNA 5J1UA 5E3LA 3CRJA 5JLXA 5J1YA 3LNQA 5E3MA 4A3GJ 2ELKA 4C3HJ 2CRGA 4RBOA 1ZK8A 5M3FJ 4A3EJ 1JTXA 4GFBA 2QIBA 3OSGA 5F04A 1Z0XA 1X58A 4XRMA 1BW6A 2R5YA 2DG7A 3BJBA 5FKNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QQA A;  3S14 J;  1E3O C;  3D1N I;  2E2I J;  2DA7 A;  4NN1 A;  4A69 C;  1BL0 A;  3QKX A;  3MVP A;  1QRY A;  1WPK A;  4BY1 J;  2HXO A;  1ETY A;  1XC5 A;  3DCF A;  4B1R A;  4JL3 A;  3MKL A;  1ZR2 A;  5CXI A;  2CQX A;  1TWH J;  4IEJ A;  3BR5 A;  1MNM C;  5E3N A;  3A01 B;  2RHA A;  4ME9 A;  1GT0 C;  2H1K A;  1JTY A;  2ECC A;  4IHV A;  2RAS A;  2G3B A;  3OIO A;  3NRG A;  3PPB A;  2G7G A;  3GTM J;  4J19 A;  3HIM A;  3BR2 A;  1RPW A;  2M0C A;  3BTL A;  4IHX A;  3VW0 A;  3E7L A;  2WGB A;  1AHD P;  1W0U A;  2KT0 A;  3S2D J;  3IH4 A;  2LTP A;  4V2G A;  1I50 J;  3K2A A;  2F07 A;  2FBQ A;  3UKG A;  2Y2Z A;  5K7F A;  2R5Z A;  3GTG J;  1HF0 A;  3FK7 A;  3PAS A;  3K7A J;  2LFB A;  1NK3 P;  1ORK A;  3CCY A;  4B4C A;  4A3I J;  1JJ6 C;  1LFB A;  5IYD J;  4GFL A;  2K40 A;  3HM5 A;  3HTH A;  5H9T A;  2JA6 J;  1MBK A;  4A3D J;  2L9R A;  3HOW J;  9ANT A;  2YVE A;  2QCO A;  1AU7 A;  2ZB9 A;  3O60 A;  4QTR A;  4C3J J;  3G7R A;  2XDN A;  5EGO B;  2HYT A;  5DAJ A;  1BJZ A;  4QIW N;  2XGE A;  3FIS A;  3SFI A;  1I3Q J;  2GBY A;  2OER A;  2PBX A;  2GUH A;  2YUS A;  4UUS B;  3VIB A;  1ZTR A;  2QOP A;  2K9N A;  5GPA A;  4Y52 J;  2X48 A;  2X9D A;  5FKM A;  3COL A;  3ZQG A;  5FJ8 J;  3S1Q J;  2E2J J;  1FTZ A;  3HGY A;  1IC8 A;  1CQT A;  1U78 A;  5C4Y A;  2EH3 A;  1ZKG A;  2FD5 A;  3KKC A;  3QPL A;  2EZK A;  1JKO C;  5IYC J;  2W53 A;  4MFD A;  1T33 A;  1QPI A;  2Y30 A;  3HB9 A;  2DA6 A;  4GCK A;  3A03 A;  3ZOB A;  3CQZ J;  3BTI A;  4JP0 A;  2ID6 A;  1QVU A;  5DS9 A;  3A02 A;  3BRU A;  1VF9 A;  1DU0 A;  3HEF A;  5HSZ A;  4XK4 A;  1FIP A;  3NAR A;  4QSH A;  3V6G A;  2L0K A;  2EQR A;  3LSG A;  5IP6 A;  3PO3 J;  4DW6 A;  2L7Z A;  4IHW A;  1JKP C;  2NVY J;  4A3B J;  4UUT A;  2QWT A;  3LSJ A;  4AYB N;  5FKL A;  1LE8 A;  3WHB A;  2DMT A;  3IV5 A;  1ETO A;  1OCP A;  2JN6 A;  2Y9Z A;  2FX0 A;  4JYK A;  1A5J A;  3BTJ A;  1VND A;  5EYR A;  5EGO A;  4DYR A;  3JRF A;  3LHQ A;  5AQC A;  4YZE A;  2LVS A;  4MLO A;  1JGG A;  4GCL A;  1IGN A;  3ZQH A;  5F1J A;  3BR1 A;  3CMY A;  5EEA A;  3ZQC A;  3HDD A;  1ZQ3 P;  1FTT A;  3JRG A;  3AQS A;  4PXI A;  3OOU A;  3JRD A;  2KDZ A;  2NVT J;  3RH2 A;  2PMZ N;  3LWJ A;  2IU5 A;  2XPV A;  3F0C A;  4JX5 A;  3MNL A;  5K7H A;  4XRS A;  1LE8 B;  3BG3 A;  4DYC A;  3VOX A;  3VUQ A;  3CDL A;  1TWC J;  5FLV A;  4NEL A;  1RES A;  5D1R A;  3DEW A;  1FJL A;  1RKW A;  1MBJ A;  3W6V A;  5M3M J;  3TED A;  3IH2 A;  5F27 A;  1H8A C;  5K58 A;  2VPR A;  2JA7 J;  5FLM J;  1TWA J;  2IBD A;  3HOU J;  3AQT A;  2DTZ A;  2P81 A;  3BR6 A;  3NNR A;  2DA5 A;  3BT9 A;  3RZD J;  3TW7 A;  3HOY J;  5CXG A;  4D5C A;  1JUP A;  2HOT A;  1TWF J;  2XGD A;  1MBH A;  1P7J A;  3S17 J;  4JX4 A;  4FE7 A;  3I4M J;  5F0H A;  3FK6 A;  1NTC A;  4XRS G;  1RKT A;  5EZH A;  3GTP J;  4A3L J;  1K61 A;  2XB5 A;  3HBL A;  4MK6 A;  3VVZ A;  4X1E A;  1RR7 A;  3C2B A;  3HOV J;  1FEX A;  1HOM A;  4M3D A;  2DMN A;  2GFN A;  1SFO J;  2GLO A;  1B72 A;  5FMP A;  2JK3 A;  1JKR C;  2HXI A;  4M6V A;  1ETX A;  2NS8 A;  3H3V K;  3DPJ A;  1HDP A;  1IG7 A;  1GUU A;  1WCM J;  5GP9 A;  2K9S A;  4A3F J;  2DMQ A;  5K7Z A;  1ETV A;  1B8I A;  2NP3 A;  3NXC A;  5C4J J;  5EG0 A;  1P7I A;  1IV6 A;  2Q24 A;  2LY9 A;  2WB1 N;  2I10 A;  3S15 J;  4A3C J;  2QF7 A;  3KKD A;  1XG1 A;  2G7S A;  4ABZ A;  1BW5 A;  4CYC A;  2UXH A;  4JKZ A;  3NPI A;  3O8H A;  4BBS J;  5EG0 B;  2QTQ A;  3JSJ A;  2LR8 A;  3GTJ J;  1JJ8 C;  4UUS A;  3GBG A;  2HOS A;  2ECB A;  2LD5 A;  3Q0U A;  4EEF G;  2Y9Y A;  1BA5 A;  3HGG A;  4I6Z A;  1LFU P;  2DN0 A;  2O7T A;  3S1R J;  2G7L A;  5IOY A;  1W0T A;  3B6A A;  5IOZ A;  1F36 A;  4BBR J;  5BNG A;  1JT6 A;  2UXP A;  2V57 A;  5F08 A;  5J1R A;  4ICH A;  4RDU A;  5FKO A;  2R7Z J;  1JT0 A;  1IDZ A;  4FTH A;  3RZO J;  4MO7 A;  1ETW A;  3GZI A;  3KZ9 A;  3JRA A;  2ME6 A;  4CYC B;  2ME0 A;  4IHY A;  3BR3 A;  2TCT A;  4XID A;  1IRZ A;  1TC3 C;  2EZI A;  2HI3 A;  1F43 A;  3GTL J;  4A93 J;  4B3A A;  4MFE A;  4MXM A;  2JA5 J;  1UHS A;  3NAU A;  2E2H J;  3Q0W A;  4GCT A;  1VI0 A;  2M2E A;  5C3E J;  4FIS A;  3PO2 J;  3I4N J;  5EF6 A;  1ETQ A;  4V2F A;  2R92 J;  3LJL A;  1ZGW A;  2G0E A;  2DG8 A;  2DA1 A;  2K9Q A;  3RKQ A;  1WI3 A;  2HDD A;  5F0F A;  1YRN B;  3QBM A;  3CJD A;  1UI5 A;  3SJM A;  2OF7 A;  2HQ5 A;  3GTK J;  3VW1 A;  3ANP A;  1JUS A;  1ITY A;  1AKH B;  3VOK A;  4C3I J;  4MIM A;  1MBF A;  1JKQ C;  1MSF C;  5M5Y J;  4DZP A;  5IPA A;  3ZQL A;  2NS7 A;  2XPU A;  2NVQ J;  1MSE C;  3A01 A;  2YS9 A;  5IP7 J;  2R93 J;  3HTA A;  1Z77 A;  2COB A;  1T56 A;  3Q3S A;  1X2N A;  5E3O A;  3BNI A;  3M3Y J;  3RQI A;  2FJ1 A;  3HTJ A;  3BQY A;  1UI6 A;  3FKI J;  3CWR A;  1SGM A;  2IEK A;  1VFC A;  1DU6 A;  3S16 J;  3F1B A;  5IYB J;  3S2H J;  5CW8 A;  2ZOZ A;  1OFC X;  3QPS A;  4L5E A;  3SDG A;  2LK2 A;  4D5F A;  3P9T A;  3LSR A;  2JMW A;  2L7F P;  4C2M J;  3ON2 A;  4M3F A;  1H89 C;  3C07 A;  2HYJ A;  3VP5 A;  3IUV A;  2NVX J;  4A3K J;  1U9O A;  4G12 A;  4BY7 J;  3S1N J;  4JNN A;  4X6A J;  2B63 J;  2HKU A;  1WH7 A;  2JJ7 A;  3HE0 A;  5EFY A;  1PUF B;  3V78 A;  2W48 A;  3EUP A;  2AO9 A;  2PZ9 A;  4GFK A;  5D18 A;  4LOC A;  4HKU A;  2H8R A;  5C44 J;  2WAQ N;  3L1P A;  2XRL A;  2JA8 J;  2N8G A;  3T6N A;  3ZQI A;  5HBU A;  1YRN A;  5C4X J;  5EDN A;  4W1U A;  4DZJ A;  2R5Z B;  3S1M J;  1MBG A;  1GV5 A;  1EF4 A;  4A3M J;  3LSP A;  3OSF A;  1WH5 A;  3G1L A;  4CGR A;  2R0Q C;  2YU9 J;  2REK A;  2XB0 X;  3GTO J;  2UXU A;  2ID3 A;  2MGQ A;  1MH3 A;  4D7M A;  2DMP A;  2IAI A;  1K83 J;  2LLK A;  3BQZ A;  3BTC A;  1UMQ A;  2UXO A;  2VKE A;  2YVH A;  5GPC A;  4W97 A;  1H88 C;  1QVT A;  3G1O A;  1FIA A;  2CUE A;  2MW8 A;  2NP5 A;  2OPT A;  3O8G A;  3HOZ J;  3FIW A;  3M4O J;  2MSY A;  2Y0S N;  2GM4 A;  2GEN A;  3BCG A;  5M5W J;  1IUF A;  1Q1V A;  3VVX A;  2XGC A;  2DMU A;  2XPW A;  4S0H B;  2LKX A;  3HOX J;  4XIC A;  3VVY A;  1ENH A;  4D7N A;  4L62 A;  2Y31 A;  1A6I A;  4BKX A;  3RD3 A;  1RET A;  1Y1V J;  2X6O A;  4AUX A;  4M3E A;  3VPR A;  5M5X J;  2E19 A;  4A3J J;  2UXI A;  3ON4 A;  1O4X A;  1X2M A;  1APL C;  3JRB A;  2NX4 A;  2DA2 A;  2QKO A;  1SAN A;  2HOA A;  1U8B A;  3ANG A;  3S5R A;  3E7Q A;  4JX6 A;  2WV1 A;  3TP3 A;  4AC6 A;  2JWT A;  2LP0 A;  2AHQ A;  3FRQ A;  1IJW C;  1XS9 A;  2ZCX A;  3NI7 A;  2DA3 A;  2M9H A;  3TW6 A;  2CUF A;  1R9T J;  1OJL A;  2EZH A;  1G2H A;  3PM1 A;  2OI8 A;  3VW2 A;  1S7E A;  2VKV A;  2XSD C;  4FCY A;  3ZQF A;  4M3G A;  1HDD C;  1POG A;  1B8I B;  1IDY A;  2CU7 A;  2E1O A;  4M3B A;  5EZG A;  2CQQ A;  4KWA A;  2CJJ A;  2ZCN A;  1HCR A;  3Q0V A;  1UG2 A;  3LOC A;  4HNV A;  1MBE A;  1NK2 P;  4FE4 A;  1ETK A;  3KNW A;  3G1M A;  5IP9 J;  2ZCM A;  4AF5 A;  3GEU A;  3WHC A;  1WGX A;  2VUM J;  2MG4 A;  2WUI A;  2M8G X;  4I76 A;  3BHQ A;  3BG9 A;  5DTD A;  4Y7N J;  3B6C A;  3JRH A;  3JRC A;  2EZL A;  1ZR4 A;  5FKK A;  1OCT C;  2NOG A;  3BG5 A;  2EBI A;  2VI6 A;  2D5V A;  4NDL A;  3JR9 A;  3MN2 A;  3JRI A;  1GDT A;  3G56 A;  3HTI A;  2TRT A;  2RAE A;  1Y1W J;  3GTQ J;  4UDS A;  3TP0 A;  5FGL A;  3IH3 A;  1MH4 A;  4DYQ A;  2FQ4 A;  5HOD A;  5HAW A;  2O9L A;  5J3L A;  1I6H J;  2ZOY A;  1TWG J;  1U9N A;  4ACI A;  2M34 A;  1GVD A;  2R5Y B;  2D6Y A;  1PUF A;  1GV2 A;  5JLW A;  2O8K A;  5D19 A;  2DA4 A;  3H0G J;  4AC0 A;  3HKZ N;  1HLV A;  1AKH A;  3BR0 A;  1B72 B;  5F0C A;  4BXX J;  2L7M P;  1JUM A;  3B81 A;  5FHP A;  3JRE A;  1D5Y A;  3EGQ A;  2O7O A;  2DJN A;  5J1U A;  5E3L A;  3CRJ A;  5JLX A;  5J1Y A;  3LNQ A;  5E3M A;  4A3G J;  2ELK A;  4C3H J;  2CRG A;  4RBO A;  1ZK8 A;  5M3F J;  4A3E J;  1JTX A;  4GFB A;  2QIB A;  3OSG A;  5F04 A;  1Z0X A;  1X58 A;  4XRM A;  1BW6 A;  2R5Y A;  2DG7 A;  3BJB A;  5FKN A; 
#chains in the Genus database with same CATH topology
 1NH3 A;  3U2R A;  2OUM A;  3D1N I;  3HUG A;  1BN5 A;  5B1A H;  4JOM A;  5L3D A;  3MVP A;  1QRY A;  2Z3Y A;  2HXO A;  3PFI A;  2EIK H;  2XRN A;  5TGT A;  4IRV A;  4AIK A;  2ESH A;  3ZMV A;  2KQR A;  4RGU A;  1MNM C;  3DU6 A;  4P9F A;  4IHV A;  2RAS A;  4ZTF A;  2UUZ A;  5HDG A;  1HSJ A;  3NRG A;  4HX4 A;  4QWQ A;  3BR2 A;  2M0C A;  3I56 I;  3E7L A;  1AHD P;  2KT0 A;  2ZSH B;  2X0L A;  5K5O A;  3AL0 B;  5EJC A;  2DFH A;  3V7R A;  1I50 J;  2PN6 A;  1T0F C;  3SZG A;  1AA7 A;  1KZH A;  1TBX A;  3WGH A;  2HVQ A;  3PAS A;  2L9V A;  3K7A J;  1J0R A;  1W36 D;  1B4A A;  3OYI A;  1MJA A;  3QP5 A;  2ZO4 A;  3HTH A;  2IA0 A;  1MBK A;  2AXL A;  2CG4 A;  3HOW J;  4G6T B;  2V6E A;  1AU7 A;  4RB2 C;  4HA8 A;  3SFZ A;  3T0Y A;  1R22 A;  2XDN A;  3FXK A;  4NBQ A;  1QGP A;  1TNT A;  5DAJ A;  3ULQ B;  3DPL C;  1G3W A;  3FMQ A;  3HKZ A;  3SFI A;  1I3Q J;  1ON1 A;  2OER A;  4EQQ A;  2RQP A;  2KHM A;  3K9T A;  2K9N A;  2FU4 A;  1FYK A;  3LL7 A;  3COL A;  2DO7 A;  5FJ8 J;  3S1Q J;  2E1M C;  4XLC A;  4Z2Y A;  4A0X A;  4ZDL A;  2HKO A;  5C4Y A;  4BNC A;  3KKC A;  5E20 A;  4O5V A;  5IYC J;  2A6H F;  1FP1 D;  3GCM A;  1D1B A;  1V5E A;  4KIG A;  3O3K A;  2M3A A;  4GCK A;  5LRS A;  3BPX A;  3A03 A;  4HF0 A;  2ZKZ A;  4A6D A;  2Q0O A;  1DU0 A;  5HSZ A;  2W82 A;  3HYI A;  4XK4 A;  5JVG F;  3PL8 A;  1TL8 A;  4XLH A;  3LSG A;  2M4G A;  2E5Z A;  5L3F A;  1B6A A;  3PO3 J;  1Q1H A;  2M30 A;  4PJM A;  3SXY A;  4F52 A;  2L7Z A;  2CH0 A;  1FY7 A;  3H3U A;  4KA4 A;  1OKR A;  4LK0 F;  5FD5 A;  2P0W A;  2FUG 2;  2X6W A;  2VT2 A;  3U9G A;  3MQ0 A;  2CMP A;  4N4O B;  3L2U A;  1I39 A;  3V4G A;  3FXU A;  4LK1 F;  2ETH A;  2GIZ A;  3FWE A;  2O8X A;  1Z6T A;  4Y15 A;  1YS7 A;  2FMY A;  2ZXJ A;  4BE0 A;  2DT5 A;  4CXF A;  2LVS A;  3DF8 A;  4M9Z A;  1JGG A;  4GCL A;  4E6K G;  5F1J A;  1KQ0 A;  5IT3 A;  2LSO A;  3K0L A;  5EEA A;  3ZQC A;  1XN7 A;  1FTT A;  3A0B C;  3AQS A;  2NVT J;  4IX7 A;  1QHH D;  1HW2 A;  3QAH A;  2V9V A;  3QPH A;  2DW4 A;  2PMZ N;  1QZY A;  3LWJ A;  5GAG J;  4XLP F;  2EIL H;  4XMY A;  2RQQ A;  2WB1 A;  3KIO A;  4G7Z F;  5HLT A;  4AD9 A;  3MNL A;  4MHG A;  5K7H A;  3BG3 A;  1R00 A;  2XUB A;  3CDL A;  3ABT A;  3RPU D;  1FP2 A;  3MZ8 A;  1I1G A;  4ZTJ A;  5B5E C;  2EFO A;  2CUZ A;  2PMU A;  1U0J A;  3DEW A;  4IQ4 A;  3JSP A;  1PDN C;  3W6V A;  2ZCW A;  3ABL H;  4F91 B;  5B66 C;  3CJQ B;  2QGU A;  3H1C A;  1H8A C;  2HVR A;  2R7W A;  1EH8 A;  2P81 A;  3BT9 A;  3RZD J;  5E1Z B;  3TW7 A;  1C0W A;  3BOQ A;  1OIS A;  1E2X A;  3LFU A;  4EJV A;  3TO7 A;  4XSX F;  4XKV A;  2IS6 A;  1OYI A;  5GAD J;  4FE7 A;  3I4M J;  1OMI A;  4WF2 A;  3KZZ A;  3FK6 A;  1NTC A;  3GTP J;  3IUO A;  5A2Q K;  3C2B A;  4QPQ A;  1HOM A;  5H2F C;  2Q8K A;  3HRS A;  1TT0 A;  3WG7 H;  2WAF A;  4WXH A;  5LEK A;  3WU1 B;  3WTY C;  2E1N A;  5GP9 A;  3A2K A;  3H0D A;  3LSH A;  5C4J J;  4XBF A;  1W1W E;  1QA6 A;  2Q24 A;  3OYK A;  4A3C J;  2I10 A;  1RNL A;  2XAQ A;  1DGR M;  2A6E F;  4KJZ A;  2EV6 A;  2KIF A;  2L3D A;  1X3U A;  5JHF A;  2ZJQ F;  3IC7 A;  2LBF A;  4BEH A;  2GA1 A;  3NPI A;  3O8H A;  5EG0 B;  3PUB A;  3RIR A;  5J40 A;  2HS5 A;  1VQK I;  5HNH A;  3F6O A;  3GBG A;  2ECB A;  1F5T A;  3F8N A;  4ASN A;  4EEF G;  4HZF A;  1D5V A;  2XAS A;  3HGG A;  1MKM A;  1LFU P;  2DN0 A;  1D8K A;  2XAJ A;  3LFK A;  3V8L A;  3G2B A;  4HBL A;  5IOY A;  1H0M A;  4CZC A;  5LLQ A;  2STW A;  2V26 A;  1F36 A;  3WTU C;  3N05 A;  2BY1 A;  1JT6 A;  4BHC A;  5K1Y A;  5F08 A;  2UXP A;  1MJB A;  3EYY A;  1JT0 A;  3DPT A;  2M87 A;  3FXM A;  3MFK A;  5K5Q A;  4FTH A;  2W85 A;  4BXU A;  2WTE A;  4MO7 A;  3DBL B;  1FT9 A;  1KU9 A;  1OCC H;  2ME0 A;  4IHY A;  3JW4 A;  2TCT A;  5KCM A;  3P9C A;  4R1H A;  3EUK L;  1WQ2 A;  2HDC A;  1F43 A;  4CCJ A;  3EPZ A;  3K1N A;  5HS8 A;  5H6R A;  1MD0 A;  2DFE A;  2BEO A;  2IVM A;  1UHS A;  3NAU A;  2EK5 A;  2E2H J;  4XN0 A;  1WJD A;  3PJR A;  1VI0 A;  3VDX A;  5C3E J;  2R92 J;  1HW5 A;  4V2F A;  4UVB A;  2B0L A;  1TW2 A;  2K9Q A;  4BE2 A;  1UJ8 A;  2MD5 A;  5ED4 A;  4YRV A;  2HDD A;  3HTS B;  3TOA A;  2M0M A;  3TKY A;  2OF7 A;  1FBQ A;  1R6R A;  2V4J C;  3BG7 A;  3K1P A;  2BHZ A;  1Z7U A;  1MSF C;  4M6X A;  2JPC A;  4DZP A;  5BS6 A;  2RV8 A;  2XPU A;  1FBU A;  4EM2 A;  5IP7 J;  3ZMU A;  4NHJ A;  1Z77 A;  1T0F A;  2KZG A;  4HLX A;  5E3O A;  4CUG A;  1LNW A;  1GXQ A;  4EV0 A;  4IHT A;  3REO A;  3CDH A;  2K9L A;  3E6B A;  3DTK A;  1LQ1 A;  3E5Q A;  1G3S A;  4WXD A;  5CQG A;  3CJR B;  4Q4Z F;  2OC6 A;  5LGT A;  1ZLK A;  5IYB J;  2BY3 A;  2ZOZ A;  2JQ7 A;  2DYR H;  3P9T A;  2IA1 A;  2JMW A;  2L7F P;  4C2M J;  5IT9 K;  3GZ6 A;  4HG2 A;  3OIP A;  4D1Q A;  1XTA A;  3W6J B;  3C07 A;  3VP5 A;  1Z7L A;  2NVX J;  2IGN A;  4AU7 A;  4HAM A;  5DCM B;  3AG2 H;  3MMY B;  1U5T B;  4G12 A;  3I53 A;  4JNN A;  1WJC A;  3QU6 A;  2VOP A;  2DXI A;  2JJ7 A;  2VJ4 A;  1H9G A;  5KHD A;  3EUP A;  4YFN F;  1P2F A;  4HKU A;  3ERM A;  3VWB A;  1TLH B;  4I09 A;  2N8G A;  2Q1Z B;  2WAQ A;  4GCV A;  1BOA A;  3ZQI A;  4A2U A;  1YRN A;  4Q5S F;  3C3W A;  3FKJ A;  3Q9V A;  4HF1 A;  1SFK A;  3AFH A;  4JK1 X;  1X1C A;  2BVL A;  3EUA A;  4W1U A;  1MBG A;  1GV5 A;  1WKM A;  5B1B H;  1KU2 A;  2XF7 A;  1X1B A;  3BRO A;  3G1L A;  3ML6 A;  3OWT A;  4G94 A;  4BH9 A;  2REK A;  3PSF A;  3GTO J;  2UXU A;  4PCQ A;  1STZ A;  1S29 A;  4DJA A;  4PFP A;  4RAG A;  3CJT B;  4BAY A;  2VKE A;  3DEE A;  5GPC A;  4LLG F;  3W2V A;  2P5L C;  1H88 C;  3OYD A;  2HTS A;  1QVT A;  3G1O A;  1FIA A;  2CUE A;  3WOD F;  2M4K A;  5D6E A;  1YHQ I;  4KN7 X;  2WBM A;  3QPT A;  2YU3 A;  4TV7 A;  2L54 A;  5ICF A;  4IHS A;  3P9I A;  3HOZ J;  2GM4 A;  2GEN A;  1KON A;  2M1B A;  2X6X A;  2PI0 A;  1QO0 D;  1Q1V A;  2G9W A;  2XGC A;  2DMU A;  1ERD A;  1WVR A;  3TMO A;  1ENH A;  4RMN A;  1YW7 A;  2DLL A;  3ZMD A;  2ZSI B;  2X6O A;  1PVE A;  2MC4 A;  4AUX A;  3LQR A;  4RAY A;  4BUP A;  2UXI A;  1APL C;  3MKY B;  3JRB A;  1N77 A;  1QHG A;  2XAH A;  1B9M A;  2PMZ A;  3ZN0 A;  3OV8 A;  3ANG A;  1XB4 A;  3S5R A;  3NS4 A;  1T8I A;  2WV1 A;  3R61 A;  3D0S A;  4OOI A;  2KFD A;  4DQ2 A;  1ODD A;  4CZZ A;  1I1S A;  2Z2S B;  3I59 A;  1XS9 A;  3NI7 A;  5TIS C;  4C9Y A;  1MMS A;  2D45 A;  1RUN A;  2DOD A;  2PJR B;  4ENN A;  2VKV A;  2XSD C;  1G3T A;  2M7B A;  3W6K B;  4L5I A;  2V9K A;  1IN7 A;  3H9G A;  1JGS A;  1IN5 A;  3RCO A;  2E1O A;  4NUB A;  3IRR A;  2K02 A;  4RAF A;  4Y13 A;  2KRH A;  3K4B A;  4KWA A;  2FBK A;  1VQM I;  1HCR A;  2PEX A;  1FNN A;  1R4N B;  2OCE A;  3LOC A;  4HNV A;  5DM7 F;  1ETK A;  3WTV C;  3IWF A;  2V9P A;  4F7Z A;  2HQN A;  2K9M A;  3K4C A;  5KVR A;  4NC6 A;  4RB3 C;  2M8G X;  2M45 A;  1D1A A;  1YFH A;  5D5W B;  1FX7 A;  3PQK A;  4QPO A;  4DIQ A;  2PBI A;  2JT1 A;  4Y7N J;  4MTD A;  3JRC A;  5CQE A;  1FWZ A;  1ZR4 A;  5FKK A;  2EBI A;  2BW3 B;  4IVN A;  3D5S C;  1DQU A;  1GDT A;  2WY8 Q;  4E7J A;  3WGI A;  4OIR F;  2DQL A;  2RAE A;  1Y1W J;  4UDS A;  2BXY A;  3ROU A;  4P1W A;  2FQ4 A;  5HAW A;  5ERI A;  1I6H J;  2ZME B;  2P6S A;  2Z99 A;  1PUF A;  5JLW A;  3RQ4 A;  3ZMZ A;  3H0G J;  1VQP I;  2XRO A;  1YIJ I;  5F0C A;  3BG6 A;  3B81 A;  3HTU A;  1O3T A;  1ZRF A;  2RKH A;  1D5Y A;  2DJN A;  1TQP A;  1YOV B;  3SEQ A;  2KP6 A;  3CRJ A;  5JLX A;  2GWR A;  3OYN A;  4ZJZ A;  3LNQ A;  2STT A;  2LNB A;  5DDG A;  1W36 C;  4A3G J;  2ELK A;  3ONQ A;  2DDB A;  3OIQ A;  3K1M A;  4WX9 A;  5JHU A;  1BR2 A;  4MEY F;  2QIB A;  2QSF X;  1Z0X A;  1LVA A;  4RM2 A;  2MLG A;  2H94 A;  4BQA A;  1V3F A;  5ICE A;  1IAW A;  3K4M A;  1I5Z A;  2RN7 A;  4PJJ A;  3F6V A;  4GO1 A;  1ZRC A;  4EAT A;  2A05 A;  2CQK A;  4A69 C;  1BL0 A;  2B3W A;  2FA5 A;  1P92 A;  2F5C A;  3OYE A;  3N4M A;  1WPK A;  1YW8 A;  4BY1 J;  3HPH A;  2VAS A;  3MKL A;  3CCV I;  3GO5 A;  4ZYD A;  1V55 H;  1EH6 A;  2PJR A;  4PJL A;  3ECH A;  1HKT A;  1S7A A;  3C7J A;  3CUQ C;  5E3N A;  3J80 Z;  1G8X A;  3A01 B;  4II3 A;  2UXX A;  2G3B A;  2WV0 A;  4OIQ F;  3PPB A;  3J7A O;  2G7G A;  3KEY A;  3HRM A;  4KUM A;  2O3F A;  4NNJ A;  2UZK A;  3BTL A;  3V7S A;  4IHX A;  3VW0 A;  4CO8 A;  4XQF A;  1R71 A;  3NRV A;  3OS2 A;  1SMY F;  4BQO A;  3IKV A;  3K2A A;  2QQ9 A;  2F07 A;  4K2E A;  2FBQ A;  2Y2Z A;  3VOE A;  2P7C B;  3GTG J;  4L0Z B;  3H9Q A;  5J4Y A;  3FK7 A;  3M1E A;  3WE3 A;  1Y8Q B;  4LFU A;  5FRM A;  1FMV A;  3CCY A;  2OTL I;  3KFW X;  1DP3 A;  4LB5 A;  5CVV A;  5BOX A;  5IYD J;  5H9T A;  1J2X A;  5L3C A;  4A3D J;  1WI9 A;  9ANT A;  2QWW A;  1N75 A;  1S6L A;  4BXF A;  4QTR A;  3K6G A;  4ESF A;  1J7K A;  1Z3X A;  2HYT A;  5ILS A;  3GLL A;  3KE2 A;  1FBS A;  2ACJ A;  2VC1 A;  2WY7 Q;  3LA3 A;  3LA7 A;  4PJN A;  4RLQ A;  3FIS A;  1K4T A;  4OD5 A;  2YUS A;  3WU2 C;  1ZTR A;  2ELJ A;  2QOP A;  5FKM A;  4BHB A;  2FXA A;  3ZQG A;  1T6S A;  3F21 A;  3H9J A;  5AIP A;  2K85 A;  1U78 A;  4IF4 A;  1FC3 A;  2GIV A;  4OWR B;  1BBY A;  3QPL A;  2IS2 A;  5E8G A;  4LG0 B;  1ONV A;  1ZRD A;  4KMF A;  3E6C C;  2HR3 A;  3HB9 A;  1XGN A;  2DA6 A;  4YG2 F;  2ZBK A;  1I6X A;  4GRI A;  2IW5 A;  1QNT A;  3J7A Y;  2ID6 A;  1QVU A;  3BRU A;  1OR7 C;  1VF9 A;  3DFG A;  3HEF A;  1YQA A;  1KU3 A;  2Y69 H;  5CYV A;  3MZH A;  1E17 A;  2VKH A;  2WAE A;  4QSH A;  1DPR A;  4KN4 X;  3T8T A;  1SMT A;  2L0K A;  4I7H A;  1BC7 C;  2XAF A;  1R58 A;  4IHW A;  4MQV A;  4FET A;  2NVY J;  4PK4 A;  4A3B J;  4XN3 A;  2QWT A;  3LSJ A;  4XRF A;  2DOF A;  2I5U A;  3CCM I;  4AYB N;  1KA8 A;  2DOE A;  4RGR A;  2Y9Z A;  4JYK A;  4UVC A;  2LC2 A;  4AVP A;  1K78 A;  2BBY A;  3MEX A;  4YFX F;  3FHN A;  1K4S A;  2Y48 A;  3BTJ A;  1VND A;  2JUC A;  5JVT A;  2L4M A;  4P55 A;  3LHQ A;  5KAF C;  2H1L A;  2CO5 A;  5AQC A;  1OR7 A;  1ZEL A;  4ZDO A;  4MLO A;  1XCB A;  3I55 I;  2FJI 1;  3A1Y A;  3ECO A;  2X6Y A;  1L0O C;  3FM3 A;  3CMY A;  3CC7 I;  4CA0 A;  3HDD A;  4LLN A;  1F4K A;  3OOU A;  4PXI A;  4LIU A;  2KDZ A;  4A0Z A;  3RH2 A;  2RRE A;  1IUY A;  1IN8 A;  2VLA A;  1R5G A;  3H3Z A;  4HYE A;  3L9F A;  4BYY A;  2KJB A;  3VOX A;  1YI2 I;  2JRM A;  4L9V A;  5J47 A;  3CF5 F;  4D0P A;  1FSH A;  2GA2 A;  1OCR H;  4Q48 A;  4NEL A;  4BJT A;  3BPV A;  3I0T A;  4WWC A;  3DPU A;  5M3M J;  5F27 A;  1KYZ A;  5FLX K;  2H27 A;  5K58 A;  1P4X A;  2A69 F;  3OYH A;  2VPR A;  2JA7 J;  3WTS C;  1YW9 A;  5FLM J;  2IBD A;  4Y3O A;  2DTZ A;  3KCC A;  5CXG A;  2D2W A;  1LEB A;  3FBN B;  3C2H A;  4IXA A;  2J5P A;  1K6Y A;  3JSO A;  5HS9 A;  3DKY A;  3VYT B;  4HQM A;  2NNY A;  1P7J A;  2HKX A;  4BL0 B;  2IXS A;  4XRS G;  1RKT A;  2EPF A;  3H5N A;  3DBH B;  4M9X A;  2XAU A;  2XB5 A;  3HBL A;  1K61 A;  1ZAR A;  3VVZ A;  2BXZ A;  3E5U A;  1VQ4 I;  3HUG B;  1RR7 A;  4XNF A;  2O03 A;  2XAG A;  1IXS B;  2FML A;  3SZT A;  2GLO A;  1B72 A;  2EJR A;  2HYF A;  2V6C A;  2VOD A;  1T95 A;  2FE3 A;  2LF8 A;  5FMP A;  2EA4 A;  1ZGA A;  3H3V K;  3DPJ A;  1IG7 A;  2W84 A;  3DXJ F;  4OD4 A;  3HSF A;  2H6B A;  2K9S A;  3U1K A;  2YVX A;  1DUX C;  1B8I A;  2CFO A;  2YR2 A;  4HDU A;  5EG0 A;  4HRI A;  4EMS A;  2LY9 A;  2WB1 N;  2QF7 A;  2XKP A;  2L9N A;  4HX7 A;  4ABZ A;  2G7S A;  2XKO A;  4JKZ A;  2O61 A;  5D4S A;  3JSJ A;  3KP5 A;  3FZV A;  4U0Y A;  4UUS A;  3G3Z A;  3CCL I;  2R7T A;  3J7Y J;  2BVM A;  4NC7 A;  3FBI B;  2X1D A;  4EJT A;  2LD5 A;  4MGR A;  3LQQ A;  4U7D A;  3CC4 I;  2PX9 A;  2Y9Y A;  1ON2 A;  1W7P B;  1XSX A;  4FX0 A;  2NRA C;  2CQ7 A;  2V1U A;  3JCU C;  1VQ9 I;  4BBR J;  1VQL I;  4KYW A;  1MMN A;  4LJZ F;  5D5X B;  1V5G A;  4PGG A;  1IRF A;  1ETW A;  3GZI A;  1OLT A;  3H35 A;  2ME6 A;  3T5X A;  6PAX A;  5L3G A;  1WRJ A;  2VON A;  4Y33 A;  2GOX B;  3CMA I;  4Z6Y A;  2EFP A;  5D5U B;  2FRH A;  3SDB A;  1Z1D A;  5DM6 F;  5F64 A;  1SD5 A;  4A93 J;  2IS1 A;  4B3A A;  2DT7 B;  2ELH A;  4MXM A;  2Z16 A;  3DEU A;  2IP2 A;  2E5N A;  5AON A;  3GW2 A;  4CIC A;  4CSW A;  2B1E A;  3ISP A;  4GCT A;  2PMH A;  5H6Q A;  4DBQ A;  3PQJ A;  3I4N J;  1MMA A;  2ZME C;  4IKF A;  4HSR A;  2W00 A;  1J75 A;  2DG8 A;  3RYR A;  2F2E A;  1D1C A;  5F0F A;  1UI5 A;  2HQ5 A;  1U3E M;  4H4K C;  3EYI A;  4E4H A;  5LHI A;  3ANP A;  1JUS A;  1ZAO A;  1ITY A;  3VOK A;  2I8D A;  4NC8 A;  2GOM A;  1JKQ C;  4I0A A;  1KGS A;  1SVM A;  3ZQL A;  2NS7 A;  3W2A A;  3A01 A;  3F9K A;  2KIM A;  1WWX A;  4L0Y B;  3Q3S A;  2RNG A;  3W3C A;  2F4I A;  3PUF A;  2Z1D A;  4XLN F;  2XC7 A;  4UB6 C;  3VFZ A;  1YIT I;  4ITV A;  4A5M A;  3G6E I;  2A5Y B;  5CVR A;  3M8F A;  1BI1 A;  4AVZ A;  1GVJ A;  3FXO A;  1SGM A;  3F1B A;  3BP8 A;  2DCE A;  5CW8 A;  3QPS A;  2BGC A;  3O2P E;  4B09 A;  4D5F A;  5FRN A;  3OYM A;  4BQQ A;  3F22 A;  2HYJ A;  3T1B A;  3RYP A;  2M5W A;  4A3K J;  2EV0 A;  2Y75 A;  4BY7 J;  3S1N J;  1UB9 A;  3CLO A;  4X6A J;  2B63 J;  3CUQ B;  2QVO A;  3HE0 A;  2W4S A;  5EFY A;  5D18 A;  4LOC A;  1PUE E;  4PUS A;  2YX4 A;  1XX5 A;  5C44 J;  2WAQ N;  3L1P A;  2XRL A;  3EUH C;  4NQW A;  1MNE A;  2ISY A;  4L9T A;  1FSE A;  2BW3 A;  4LLL A;  3VYS B;  3LSP A;  3LAP A;  2HPI A;  4BAC A;  2P5V A;  3AG1 H;  3K70 D;  2IA2 A;  2QLZ A;  1SAU A;  4G6D A;  2ID3 A;  4WK8 F;  1MH3 A;  1Y8R B;  3I58 A;  3PNY A;  2DMP A;  1K83 J;  4BJ6 C;  4M9S A;  4EGZ A;  1GLN A;  2UXO A;  1R49 A;  2DJI A;  4EM0 B;  3LA2 A;  3ESW B;  2MW8 A;  1P4W A;  2E35 A;  3KP2 A;  2NP5 A;  5D4R A;  3U1D A;  4DGW B;  2EIN H;  3R6S A;  4GGG A;  3RSN A;  2Y0S N;  4ZYE A;  2DPD A;  4AM3 A;  1VQ6 I;  2KPM A;  5M5W J;  3GZ5 A;  2JUG A;  4UNO A;  1ZN2 A;  2O6G E;  4S0H B;  3HOX J;  3VB2 A;  3BZK A;  3CF2 A;  3IKT A;  5E79 C;  2Y31 A;  1VTN C;  5GTH C;  1A6I A;  1FYL A;  1Y1V J;  3W2W A;  3OY9 A;  3K4J A;  2W1O A;  4M3E A;  4UB8 C;  5M5X J;  2E19 A;  2EB7 A;  1LJ9 A;  2CV2 A;  1W4M A;  3GFI A;  2VXZ A;  4ESJ A;  1YTY A;  1D0Y A;  2FNA A;  4U87 A;  1FPQ A;  1RIO H;  2QKO A;  2HOA A;  4WIB A;  4A5N A;  3ASO H;  2DPU A;  3TP3 A;  4I0B A;  3CP2 A;  1XGM A;  2E7X A;  2OAZ A;  1IJW C;  4RA2 A;  1YX3 A;  1XGO A;  1L3L A;  2VOO A;  1LB2 A;  5HDN A;  4A12 A;  2JVH A;  2CUF A;  3J81 K;  1Z91 A;  1ZH5 A;  1YJW I;  1R9T J;  1OJL A;  2VQG A;  2HOE A;  2BYV E;  2H6C A;  3AL0 C;  1IZ1 A;  2EZH A;  2BY2 A;  1G2H A;  4B8X A;  4HX8 A;  3VW2 A;  3JAM K;  3VTI A;  4P5O A;  1IDY A;  1PJR A;  3HRT A;  3IAS 2;  1XPX A;  3TL4 X;  3KP4 A;  2CJJ A;  2G7H A;  2ZCN A;  1UHM A;  2QSH X;  2FOW A;  5LD2 C;  1J5Y A;  3A0H C;  1LVK A;  3COA C;  2VJI A;  2ZCM A;  1S3J A;  5DV5 A;  2WUI A;  2W57 A;  2X1C A;  4XLA A;  2XF5 A;  3CP8 A;  3BHQ A;  3BG9 A;  1CGP A;  3F23 A;  2ZY9 A;  5J6X A;  1MW7 A;  4PSX A;  2NOG A;  1WJB A;  3BG5 A;  2VI6 A;  3FXL A;  3HSR A;  1VQO I;  3ELK A;  3WG9 A;  2E1M B;  2VJ5 A;  3IP4 B;  1H9T A;  4EJU A;  3GTQ J;  4ZC3 A;  3TP0 A;  2VN2 A;  4DOZ A;  1SD6 A;  1MH4 A;  5E1W A;  2V1D A;  1IO2 A;  2O9L A;  2HU9 A;  1BI2 A;  5J3L A;  1QBJ A;  2F6C A;  2R5Y B;  2DU9 A;  1BOB A;  4U7B A;  2O8K A;  4I2O A;  2DA4 A;  4AC0 A;  3KZI C;  3F8M A;  3HKZ N;  1HLV A;  2IJL A;  3NEU A;  1JI8 A;  3L7W A;  5FHP A;  3IAM 2;  3K69 A;  3QOP A;  5E3L A;  3CDI A;  4ENJ A;  5HNF A;  1EH7 A;  3CES A;  2QZ8 A;  5K5R A;  3KEO A;  4F3Q A;  1U8R A;  3LSI A;  4WXC A;  4PSW A;  4E7I A;  1XSV A;  2CRG A;  2W25 A;  1ZG3 A;  2ZNZ A;  1O7F A;  2OQR A;  2YX7 A;  5M3F J;  3S32 A;  3D5L A;  4CGZ A;  5F6F A;  4A3E J;  4CDG A;  1DP7 P;  4GFB A;  1X58 A;  1EV7 A;  2NAZ A;  4XRM A;  2K4B A;  3UNG C;  3GWZ A;  4XLE A;  3RJP A;  3BJB A;  1XD7 A;  2E2I J;  2LKP A;  3ZRG A;  2HQR A;  3S3O A;  3OS1 A;  3SEZ A;  3QKX A;  1Y56 A;  2JVG A;  2K4J A;  1ETY A;  1XC5 A;  4RM3 A;  2NNN A;  5DCF A;  4B1R A;  1ZR2 A;  5CXI A;  1G59 A;  4JL3 A;  2OZU A;  3CUQ A;  2CQX A;  2F5F A;  1UZC A;  3KX2 A;  1ZGJ A;  4IEJ A;  1I27 A;  2CV0 A;  3BR5 A;  3H36 A;  2Z33 A;  3OOP A;  2ZNY A;  1JTY A;  2HZT A;  3LAJ A;  1GHC A;  5FGM A;  4J19 A;  2A5W A;  3AG4 H;  3HIM A;  3FM5 A;  1O3S A;  1IW7 F;  3BY6 A;  1BI3 A;  1EKE A;  1W0U A;  2HGC A;  2Q2E A;  3S2D J;  4V2G A;  1YO5 C;  3V7C A;  1F1Z A;  1MMD A;  3UKG A;  5K7F A;  2EFN A;  2FBH A;  4UV9 A;  2OU2 A;  5HS7 A;  2LFB A;  2KRF A;  1NK3 P;  1ORK A;  4B4C A;  4A3I J;  5HLG A;  1OCZ H;  1YJN I;  1LFB A;  4GFL A;  2X85 A;  1G6N A;  2YVE A;  3VOD A;  4FQG A;  1CF7 B;  1X19 A;  3E6D A;  3GEZ A;  1XGS A;  2AQF A;  3MCZ A;  2KRC A;  2CW7 A;  5J4V A;  3O60 A;  5EGO B;  3B02 A;  4PZJ A;  2KLO A;  1BJZ A;  1QQI A;  2P4W A;  4UV8 A;  3PIO F;  1K79 A;  1J9I A;  2PBX A;  4BE1 A;  1TZL A;  2GUH A;  4OIP F;  1R36 A;  2VQH A;  3VIB A;  5CKT A;  2W7N A;  2O0Y A;  2X9D A;  1MIJ A;  4A0Y A;  1LEA A;  4Y52 J;  1E0E A;  2E2J J;  2ZJP F;  1FTZ A;  3HGY A;  2A6T A;  3BC8 A;  2IGO A;  1CQT A;  2EH3 A;  3GFM A;  2EZK A;  3WTT C;  2XIG A;  2W53 A;  4YEJ A;  3EDP A;  3OYL A;  1K6O A;  2HYG D;  2Y30 A;  1A36 A;  3ZOB A;  3CQZ J;  3BTI A;  1IRG A;  3PNV A;  5DS9 A;  2QQA A;  1LFP A;  2BE5 F;  4XM3 A;  2LRE A;  4YIR X;  3V6G A;  1XDU A;  2DFI A;  2EQR A;  4KMU X;  2ZFU A;  5IP6 A;  3D5R C;  3ZQQ A;  4DW6 A;  1TQI A;  2L9S A;  2QBY B;  2OBP A;  3RDI A;  1G4D A;  1UFM A;  2CYY A;  2LF7 A;  3F8C A;  5BPD A;  2X1E A;  2M8E A;  4DVY P;  1HW1 A;  3ZCO A;  3GFJ A;  5ICG A;  2IGK A;  1HBX G;  2BV6 A;  1ZRE A;  2ICW G;  3IV5 A;  3B73 A;  1OCP A;  3C1D A;  2VBY A;  4PDK A;  3L2Q A;  1X4P A;  1P9Q C;  3C18 A;  1Z9C A;  4P9U A;  2BY0 A;  3WU0 A;  3J7Z I;  4DYR A;  3JRF A;  4IRG A;  4YII A;  4FT8 A;  4OMY A;  3I64 A;  3K10 A;  4RS8 A;  2A3S A;  3ZQH A;  5LHH A;  3MAJ A;  1EA3 A;  3BZC A;  3JRD A;  1V4R A;  2DK5 A;  2TDX A;  2XPV A;  2YSR A;  4JX5 A;  3ZGK A;  1O57 A;  4XRS A;  1LE8 B;  4DYC A;  1SFU A;  4IOC F;  3ZN1 A;  4FX4 A;  4X0G A;  5FLV A;  3F8B A;  1RES A;  5DD4 A;  2QUF A;  4YIF A;  1XCV A;  1FJL A;  2IGM A;  1RKW A;  1MBJ A;  2F48 A;  3IH2 A;  3OS0 A;  1W7P D;  2LH9 A;  2CW0 F;  3CCR I;  2E71 A;  2VE9 A;  1TWA J;  3HOU J;  1BR4 A;  3BR6 A;  3NNR A;  3HOY J;  2VQC A;  4D5C A;  3SYT A;  4IRI A;  2DBB A;  1KQ9 A;  2HDW A;  3S17 J;  4JX4 A;  4LMY A;  4A3L J;  1OQY A;  1ULY A;  2JSC A;  4MK6 A;  3CCS I;  3P7N A;  5LEJ A;  1FEX A;  3HOV J;  2XVC A;  5D8L B;  3S3M A;  4EJO A;  2OV7 A;  2JK3 A;  1JKR C;  2HXI A;  4M6V A;  1HDP A;  1GUU A;  3DV8 A;  1M1E B;  1WCM J;  3K8P C;  2LRD A;  4CHU A;  2NP3 A;  1ETV A;  2E34 A;  3NXC A;  2AQE A;  4IOA F;  3EUH A;  1JHH A;  1P7I A;  4RAZ A;  4XKC A;  3Q5F A;  4IJA A;  1IV6 A;  3S15 J;  4ENK A;  4HQE A;  1XG1 A;  2DAO A;  2IT0 A;  2ESN A;  4BBS J;  3G73 A;  2QTQ A;  2LR8 A;  1JJ8 C;  5FO5 A;  1T08 B;  2CFX A;  3IRQ A;  2HOS A;  2CGP A;  1Y39 A;  5CLS A;  1WJA A;  4I6Z A;  1BA5 A;  2VJJ A;  2O7T A;  4QLC U;  4XKB A;  4E7L A;  3S1R J;  1AWC A;  3QOE A;  3B6A A;  3FF5 A;  3KP6 A;  2R7V A;  3L00 A;  5KNL A;  2EIM H;  2EIJ H;  2R7O A;  2V57 A;  4ICH A;  2WC2 A;  2NXN B;  2ZJR F;  3DTE A;  1K7A A;  1Z67 A;  1IDZ A;  1YLF A;  2HFH A;  4RGX A;  4HV6 A;  3RZO J;  2LBF B;  3JRA A;  1J59 A;  3OYG A;  1RI7 A;  2L4A A;  5HLI A;  3BR3 A;  3FX3 A;  2IS4 A;  4EM1 A;  3AKZ A;  2EZI A;  2D1H A;  2QKL B;  4HDV A;  4UVA A;  1WHU A;  4IPA A;  3Q9S A;  3R0A A;  2HTJ A;  3BCA A;  3WE2 A;  3KEQ A;  1D0X A;  3FDY A;  5BMZ A;  4S05 A;  3M8E A;  2M2E A;  1W7P A;  4E70 A;  3PO2 J;  3LJL A;  4MTE A;  4WCG A;  3DKX A;  2FBI A;  2ZXH A;  2MC3 A;  1EJ9 A;  1FLI A;  2G0E A;  3KLN A;  3BJA A;  4KT6 A;  3BJO A;  5HOO A;  1RRJ A;  3K4L A;  2QQ8 A;  4GYI A;  1YRN B;  3CJD A;  3HRU A;  1LDK B;  5B3S H;  4AYB A;  3CZ6 A;  2COM A;  2JA2 A;  2XV4 S;  5E8I A;  3QRF F;  3VW1 A;  3VSK A;  5HLH A;  4MIM A;  3DLA A;  4U88 A;  1QZZ A;  3DLL F;  3VSL A;  3HTA A;  2NVQ J;  1OYW A;  1R5I D;  4M71 A;  2R93 J;  3K70 C;  2COB A;  2GXB A;  4KT5 C;  4IL6 C;  1T56 A;  2LYC A;  1A04 A;  4XLF A;  2HWV A;  3BNI A;  1XMX A;  2FJ1 A;  1J09 A;  4KIS A;  1BC8 C;  3QYF A;  1YS6 A;  1HA8 A;  1S7O A;  3FKI J;  4PJ0 C;  2LY1 A;  1IF1 A;  2OCC H;  2IEK A;  3F3X A;  1VFC A;  1KU7 A;  4HEA 2;  1HC8 A;  2D1V A;  1DU6 A;  3QP6 A;  3S16 J;  1DDN A;  3S2H J;  1OFC X;  2W24 A;  4L5E A;  3SDG A;  3OYA A;  5EEG A;  2Z5U A;  3LSR A;  1WZ2 A;  4OIO F;  4CCN A;  2KMU A;  2L2O A;  1LDJ A;  1ZHF A;  1I3A A;  1RUO A;  2HZD A;  5LRR A;  3L2V A;  1N25 A;  1SD7 A;  1S9H A;  2KKO A;  3HHG A;  2QQB A;  1WH7 A;  4PGH A;  2HPM A;  2PZ9 A;  4GFK A;  2FF4 A;  4LD5 A;  3U21 A;  2F4O B;  3BLY A;  3VYR B;  2KIS A;  5C4X J;  1BIB A;  5EDN A;  2EFW A;  4O3M A;  2KL4 A;  3OYB A;  3S1M J;  3I59 B;  2K27 A;  5FFX A;  3H5R A;  1EF4 A;  3OSF A;  1WH5 A;  1S5L C;  5ICC A;  4CGR A;  1R23 A;  2R0Q C;  2XB0 X;  2XGX A;  2V1X A;  2MGQ A;  1WJE A;  3L2W A;  4V19 K;  4KDP A;  2IAI A;  3BQZ A;  2LLK A;  2BOL A;  3BTC A;  4BDY A;  4KNY A;  2YVH A;  4W97 A;  1FOK A;  2AXT C;  4OIN F;  2R3S A;  1U5T A;  3DWL E;  4AIH A;  1BIA A;  2GZW A;  4FAS D;  4EGY A;  2XDV A;  1D0Z A;  3WTW C;  2GXA A;  2OPT A;  3RKW A;  1MDM A;  3DU5 A;  3I54 A;  3H92 A;  3LST A;  4LIT A;  3UR3 C;  3H5A A;  3OYF A;  2Y0S A;  4ANJ A;  3FIW A;  3M4O J;  2MSY A;  2K3F A;  4XSZ F;  4NQW B;  3BCG A;  1IUF A;  2VT3 A;  1Z6R A;  2R7D A;  2PFV A;  1IXC A;  1E3P A;  2XPW A;  5LGN A;  2CS3 A;  3TO9 A;  4E7S A;  2GQQ A;  1UHW A;  4XIC A;  3GX4 X;  1SD4 A;  4D7N A;  5FLX Z;  2LKX A;  3M1C A;  3VVY A;  4L62 A;  2HEO A;  3M8J A;  4BKX A;  3RD3 A;  1RET A;  4KIT B;  2CWE A;  3RKY A;  4UUV A;  2M7A A;  4G7H F;  3ON4 A;  3E5X A;  2DI3 A;  1R4M B;  3GFL A;  2NX4 A;  1T38 A;  2VIX A;  2DA2 A;  2GAU A;  3MD2 A;  2QEX I;  2Z9O A;  5L3B A;  4S04 A;  1U8B A;  3E7Q A;  3E3V A;  4OMZ A;  2LP0 A;  3WGG A;  3MWM A;  3FRQ A;  3WTX C;  2ZCX A;  2DA3 A;  2M9H A;  3TW6 A;  3CC2 I;  1ZLJ A;  4CCK A;  2EV5 A;  2NOJ B;  1G3Y A;  2L01 A;  1S7E A;  4FCY A;  2ZXW H;  4M3G A;  1BI0 A;  1N78 A;  1JXS A;  2CU7 A;  4HNU A;  4KFC A;  2R4G A;  3GLX A;  4M3B A;  5EZG A;  2C6Y A;  1B1B A;  4CH7 A;  4F92 B;  3KP7 A;  1MBE A;  1NK2 P;  2QEN A;  5FFZ A;  1A6Q A;  1E3H A;  2LMD A;  3DP7 A;  3G1M A;  1TTY A;  4AF5 A;  3GEU A;  3WHC A;  2MYS A;  1YYV A;  1VZ0 A;  2VUM J;  1SVO A;  2MG4 A;  3FXQ A;  3J81 Z;  4I76 A;  4CCO A;  2KDO A;  3JRH A;  5IY5 H;  2EZL A;  1DPU A;  4N9H A;  4NDL A;  2VBZ A;  3MN2 A;  3JRI A;  3N97 A;  4U0V A;  3HTI A;  1UST A;  3QU3 A;  4L9N A;  4XL9 A;  3DTI A;  5A2Q Z;  4KIB A;  3CD6 I;  1PP7 U;  1FZP B;  4G9Y A;  1U9N A;  3AAF A;  1IRX A;  3KZY A;  3WTZ A;  1GV2 A;  1X3Z B;  5D19 A;  4ZZL A;  4N9I A;  1BJA A;  2Y0M A;  1QPM A;  3E97 A;  3VYU B;  3CJN A;  1NG7 A;  3HOS A;  3JRE A;  3OL3 A;  1XMA A;  2FSW A;  3GVA A;  5LBQ A;  4B44 A;  4LGW A;  3PSI A;  1O7L A;  5J1U A;  2RVC A;  5BPI A;  4R79 A;  5D5V B;  3G71 I;  2DOA A;  3R0J A;  1ZG1 A;  5E3M A;  3ZP5 A;  2K86 A;  2B9S A;  5DUI A;  4C3H J;  3CME I;  3TQN A;  3ZR8 X;  1ZK8 A;  1JTX A;  3KP3 A;  2EWN A;  5F04 A;  4HW0 A;  4JBA A;  3OSG A;  4C2U A;  2KIU A;  4LIV A;  1YE9 A;  1BW6 A;  5GAH J;  2R5Y A;  4XOP A;  3QWL A;  2MBF A;  5FKN A;  3JAM Z;  1B9N A;  3QQA A;  2K3P A;  3S14 J;  1E3O C;  2DA7 A;  1IN4 A;  4NN1 A;  5HDK A;  2LKS A;  3J80 K;  2K5C A;  5ILV A;  2RNJ A;  3QYB A;  2NYX A;  2VC0 A;  2CSO A;  3TOB A;  2FOK A;  3JTG A;  2H8W A;  2JZY A;  1HKQ A;  3ZMS A;  2VQL A;  3DCF A;  3CCJ I;  1UCR A;  3F8F A;  1TWH J;  1O3R A;  1Z21 A;  1FMW A;  3P9K A;  5DCM A;  4I01 A;  2RHA A;  1YG2 A;  1IN6 A;  4ME9 A;  1GT0 C;  2H1K A;  4ZDP A;  2ECC A;  1TP4 A;  3OIO A;  4DBR A;  4P96 A;  1X1D A;  3GTM J;  5GTI C;  1RPW A;  1LUJ B;  3V8K A;  3I3L A;  4XON A;  2WGB A;  3IH4 A;  2LTP A;  3LSK A;  2OZ6 A;  2RGV A;  3ERE D;  3HPG A;  3RI4 A;  5TRD A;  4LG3 A;  2WAD A;  2R5Z A;  4FHT A;  2ZJ2 A;  1HF0 A;  5J8F A;  3BDD A;  1MGT A;  3RTR A;  1JJ6 C;  3CMM A;  3NWT A;  2K40 A;  3HM5 A;  2V7F A;  2JA6 J;  2L9R A;  3M7G A;  2QCO A;  2QBY A;  2ZB9 A;  4E7H A;  1FYM A;  3G7R A;  1QZE A;  2ZXI A;  4C3J J;  1YJ9 I;  2L7K A;  4ETS A;  3HIF A;  1XSD A;  1MDM B;  2NS0 A;  1U5T C;  4CYD A;  1X3W B;  4BS9 A;  4QIW N;  2XGE A;  3OL4 A;  1P6R A;  3K4N A;  1FOY A;  1LDD A;  2GBY A;  3R4K A;  4ZZD A;  1XMK A;  4UUS B;  3V8J A;  1Y6I A;  3PNT A;  5GPA A;  2X48 A;  1HKS A;  3MKZ A;  2P6T A;  4A6E A;  1OCO H;  4U0W A;  1SAX A;  1IC8 A;  2PJP A;  1ZKG A;  2FD5 A;  4XR6 A;  1JKO C;  4L5J A;  3RKX A;  1WJ5 A;  3S8P A;  4MFD A;  1T33 A;  1QPI A;  1YX5 A;  4RGS A;  3I5U A;  4B47 A;  2E1C A;  1F9N A;  1UEL B;  1X1A A;  3CUO A;  2A68 F;  2E7W A;  5LHG A;  2V79 A;  3IHU A;  1P4A A;  4JP0 A;  5D6F A;  4IO9 F;  3A02 A;  2KJC A;  1HXD A;  1GXP A;  4II2 A;  4OAZ A;  1FIP A;  3NAR A;  5EEH A;  2DT6 A;  2R7U A;  3ABK H;  3VEP A;  1V5F A;  1CF7 A;  1JKP C;  1SFE A;  4N4N B;  4UUT A;  4U9L A;  2EA2 A;  4I02 A;  5FKL A;  4XKW A;  1LE8 A;  3WHB A;  2EFQ A;  5KK1 A;  1A31 A;  2DMT A;  1ETO A;  2JN6 A;  2PFB A;  4HLY A;  2FX0 A;  1R1U A;  1A5J A;  2CQN A;  2X4H A;  1V54 H;  5EYR A;  5EGO A;  3E0J B;  4YZE A;  3A4C A;  4ZYG A;  1LKX A;  4JQF A;  1IGN A;  3BZ6 A;  2VBX A;  3BR1 A;  4Y17 A;  3GZN B;  3MZY A;  4Q47 A;  1ZQ3 P;  3JRG A;  3ASN H;  2ADU A;  1FOW A;  3BJ6 A;  2IU5 A;  4ENM A;  3F0C A;  1R5H A;  3OYC A;  2MD0 A;  2LDU A;  5LGU A;  3VUQ A;  1TWC J;  3ZPL A;  1SFX A;  2Q2E B;  3CO7 C;  5DEQ A;  5D1R A;  2FNP A;  1Z3Y A;  3TED A;  5DUK A;  5E17 F;  2QKM B;  3GYH X;  3HZJ A;  1VQN I;  3AQT A;  3SQN A;  2A07 F;  2DA5 A;  2F5D A;  4R8H A;  1PP8 F;  3CTA A;  3S2W A;  2J5O A;  1JUP A;  2JPB A;  1RR8 C;  2HOT A;  2VE8 A;  4ON0 A;  1TWF J;  2BHY A;  2XGD A;  3KYC B;  1MBH A;  1SC7 A;  1LPQ A;  5F0H A;  4B3X A;  4UXN A;  5EZH A;  4RB1 A;  3GUD A;  5TJJ A;  4X1E A;  2PLY A;  3K2Z A;  2GFN A;  3RPQ A;  4M3D A;  2DMN A;  1SFO J;  2K7L A;  1ETX A;  1ZYR F;  2NS8 A;  2VBW A;  4C30 A;  1JE8 A;  4A3F J;  2DMQ A;  5K7Z A;  3CO6 C;  3P5J A;  1R1V A;  4GXO A;  4MEX F;  3KKD A;  2YPR A;  2R7R A;  3KYL A;  2CV1 A;  1HQC A;  3ABU A;  4CYC A;  1BW5 A;  4D9J A;  5IT9 Z;  2UXH A;  4HV5 A;  2P7V B;  4AIJ A;  1D3Y A;  3HXL A;  4L9J A;  3GTJ J;  3ZQ7 A;  4C2M A;  2P5K A;  3Q0U A;  3LSM A;  4J01 A;  2WWY A;  2H09 A;  1WJF A;  2FQ3 A;  2G7L A;  4M73 A;  4CCL A;  3I9V 2;  2R7F A;  1W0T A;  5IOZ A;  2E60 A;  3GME A;  1O3Q A;  5BNG A;  1K78 B;  5J1R A;  2MAB A;  4RDU A;  5FKO A;  2R7Z J;  3IL2 A;  2VKD A;  4BHP A;  3O6B B;  1MND A;  2L5Q A;  3L09 A;  4E7Z A;  4G7O F;  1DGW Y;  3KZ9 A;  4B48 A;  4CYC B;  3HJE A;  3DKW A;  2FEZ A;  2OA4 A;  3OYJ A;  1REP C;  2MFZ A;  2A2F X;  4XID A;  1IRZ A;  1RC9 A;  1TC3 C;  3G4S I;  2HI3 A;  5DYM A;  3S93 A;  3GTL J;  2B7E A;  1S72 I;  4MFE A;  3LMM A;  1T98 A;  2JA5 J;  2IRF G;  3Q0W A;  2DYS H;  5CJ9 A;  2ZC2 A;  4FIS A;  2R7X A;  5EF6 A;  1ETQ A;  5CVU A;  1IV8 A;  1T2K A;  1S8N A;  2DDA A;  5FRO A;  3FXR A;  1ZGW A;  4M74 A;  2DA1 A;  3HL2 A;  3RKQ A;  1USS A;  1WI3 A;  3EET A;  4I99 C;  3DBR B;  3QBM A;  1TW3 A;  1OPC A;  3KPH A;  2UXN A;  4ESB A;  1VQ7 I;  3SJM A;  1W5S A;  4LG0 A;  5E1X A;  3CCE I;  3GTK J;  5HVQ C;  2DFF A;  1AKH B;  4C3I J;  3AG3 H;  1W5T A;  1MBF A;  3FMS A;  4F55 A;  1VQ5 I;  2R7S A;  5M5Y J;  3S3N A;  5IPA A;  4IQJ A;  4XOR A;  2IPQ X;  2XF6 A;  1MSE C;  1JHF A;  2YS9 A;  4OAY A;  3I4P A;  1TNS A;  1MJ9 A;  1X2N A;  3LWF A;  1TQM A;  5CVJ A;  3M3Y J;  3RQI A;  4XOT A;  3HTJ A;  2MH2 A;  4Y4R A;  3BQY A;  1T39 A;  2LY2 A;  1UI6 A;  2A61 A;  4HF2 A;  3M07 A;  3TBI A;  1QU3 A;  3CWR A;  2VB6 A;  4H0E A;  4U9N A;  5BQT A;  3E1S A;  3FXJ A;  2X51 A;  4N0B A;  3L2R A;  2LK2 A;  1B59 A;  1NG6 A;  2DQR A;  1SVL A;  3ON2 A;  4M3F A;  2BZT A;  5FD6 A;  1H89 C;  2RDP A;  3IUV A;  2VXD A;  1U6G A;  5ILU A;  1U9O A;  1AOY A;  2HKU A;  2HVS A;  3V42 A;  3X2Q H;  4GDF A;  3CCU I;  1PUF B;  3V78 A;  1Y0U A;  2W48 A;  2AO9 A;  2AS5 F;  3F72 A;  4F93 B;  2H8R A;  1KYW A;  1Z05 A;  5FB2 A;  3OR1 C;  2ZFW A;  2JA8 J;  3T6N A;  3HHH A;  2UV1 A;  5HBU A;  5E18 F;  2F5E A;  2PQ8 A;  1R1T A;  3TDU C;  1U2W A;  1Y0N A;  4DZJ A;  2DTR A;  3M9A A;  3QYE A;  2WA0 A;  2R5Z B;  4MQ9 F;  3FMR A;  4BEH B;  4EVI A;  1TT5 B;  1W5C C;  4A3M J;  2VL8 A;  2YU9 J;  2V1N A;  4EJW A;  4J00 A;  2L02 A;  2JRT A;  4D7M A;  1X4O A;  2OJE D;  1NHA A;  1UG0 A;  1UMQ A;  1RZ4 A;  2GXG A;  3KYD B;  1FOX A;  2QSG X;  5JI6 A;  3SWH A;  2P8T A;  4IZZ A;  2E36 A;  3O8G A;  4BDZ A;  4NB5 A;  2XHK A;  5JFR A;  1SEU A;  4ZYA A;  2JTV A;  4HST A;  3K4K A;  2MH9 A;  2OD5 A;  5J8C A;  5LFA A;  4HOB A;  4LB6 B;  3HG9 A;  4DNC A;  3VVX A;  3KLO A;  4BQN A;  1OYY A;  4KIF A;  4M6Y A;  3TO6 A;  5D8K B;  1KQ8 A;  3QOD A;  3TGN A;  4YEL A;  2DK8 A;  3HC7 A;  3VPR A;  3ZMT A;  4A3J J;  4BJ5 C;  1O4X A;  1X2M A;  2ZME A;  3MKW B;  4G8X A;  1SAN A;  2CUJ A;  1VQ8 I;  2OTJ I;  4JX6 A;  4BGD A;  3C2G A;  3DQV C;  1MMG A;  4AC6 A;  1PYV A;  2JWT A;  2R7Q A;  2AHQ A;  3L2C A;  3HOT A;  2UWM A;  2CW8 A;  4OU0 A;  5KAI C;  5H20 A;  4AWX B;  3ZXS A;  3OR2 C;  5AIQ A;  2LOO A;  3PM1 A;  2OI8 A;  5L3E A;  1WSU A;  3ZQF A;  3KET A;  1HDD C;  1POG A;  1B8I B;  4M72 A;  4YFK F;  4E7K A;  4RLF A;  3SHF A;  1WFX A;  3T8R A;  5F1R A;  1BM9 A;  2KIQ A;  2CQQ A;  2LG4 A;  3ABM H;  2QA4 I;  3TDZ C;  3Q0V A;  1UG2 A;  3CCQ I;  4FE4 A;  3KNW A;  5CVI A;  5JR3 A;  4AID A;  4BU2 A;  5IP9 J;  4PFO A;  2G7U A;  1WGX A;  2O5R A;  4RB0 A;  2KZV A;  2OQG A;  5CPR B;  1HST A;  1R7J A;  1ZG5 A;  5DTD A;  1D8J A;  3B6C A;  1OCT C;  4KIC A;  4HPQ A;  2D5V A;  1MZB A;  3JR9 A;  3BCB A;  4L18 B;  3G56 A;  2HQA A;  5GAE J;  2TRT A;  5FGL A;  3EQL F;  3GF2 A;  3IH3 A;  1ACI A;  4UY8 I;  3PFY A;  4DYQ A;  5HOD A;  1UAA A;  3PIP F;  4G6Q A;  3FHZ A;  2QYO A;  2ZOY A;  1TWG J;  3R60 A;  5DD8 A;  3HSE A;  4MNU A;  4ACI A;  3I71 A;  2ISZ A;  2M34 A;  1GVD A;  2D6Y A;  3CLQ A;  3NWS A;  4UHT A;  2HNH A;  3JTH A;  4ZYH A;  1AKH A;  3BR0 A;  1B72 B;  4BXX J;  2L7M P;  1JUM A;  4GYG A;  3OMY A;  4ZH4 F;  2RC4 A;  3IWZ A;  4B43 A;  2O7O A;  3EGQ A;  2VPL A;  2MA3 A;  3E6M A;  4CCM A;  4I98 B;  2F5V A;  4IRH A;  1XDS A;  5J1Y A;  4C2T A;  2QM3 A;  4HNT A;  2F4M B;  3RPU A;  2MLK A;  3GXO A;  4RBO A;  2XSJ C;  2NVU B;  1BR1 A;  2JSP A;  3BWG A;  2PG4 A;  3NQO A;  1IXR C;  4O6J A;  1X1P A;  3SZP A;  1YIO A;  2DG7 A;  1A35 A; 
#chains in the Genus database with same CATH homology
 3QQA A;  3S14 J;  1E3O C;  3D1N I;  2E2I J;  2DA7 A;  4NN1 A;  4A69 C;  1BL0 A;  3QKX A;  3MVP A;  1QRY A;  1WPK A;  4BY1 J;  2HXO A;  1ETY A;  1XC5 A;  3DCF A;  4B1R A;  4JL3 A;  3MKL A;  1ZR2 A;  5CXI A;  2CQX A;  1TWH J;  4IEJ A;  3BR5 A;  1MNM C;  5E3N A;  3A01 B;  2RHA A;  4ME9 A;  1GT0 C;  2H1K A;  1JTY A;  2ECC A;  4IHV A;  2RAS A;  2G3B A;  3OIO A;  3NRG A;  3PPB A;  2G7G A;  3GTM J;  4J19 A;  3HIM A;  3BR2 A;  1RPW A;  2M0C A;  3BTL A;  4IHX A;  3VW0 A;  3E7L A;  2WGB A;  1AHD P;  1W0U A;  2KT0 A;  3S2D J;  3IH4 A;  2LTP A;  4V2G A;  1I50 J;  3K2A A;  2F07 A;  2FBQ A;  3UKG A;  2Y2Z A;  5K7F A;  2R5Z A;  3GTG J;  1HF0 A;  3FK7 A;  3PAS A;  3K7A J;  2LFB A;  1NK3 P;  1ORK A;  3CCY A;  4B4C A;  4A3I J;  1JJ6 C;  1LFB A;  5IYD J;  4GFL A;  2K40 A;  3HM5 A;  3HTH A;  5H9T A;  2JA6 J;  1MBK A;  4A3D J;  2L9R A;  3HOW J;  9ANT A;  2YVE A;  2QCO A;  1AU7 A;  2ZB9 A;  3O60 A;  4QTR A;  4C3J J;  3G7R A;  2XDN A;  5EGO B;  2HYT A;  5DAJ A;  1BJZ A;  4QIW N;  2XGE A;  3FIS A;  3SFI A;  1I3Q J;  2GBY A;  2OER A;  2PBX A;  2GUH A;  2YUS A;  4UUS B;  3VIB A;  1ZTR A;  2QOP A;  2K9N A;  5GPA A;  4Y52 J;  2X48 A;  2X9D A;  5FKM A;  3COL A;  3ZQG A;  5FJ8 J;  3S1Q J;  2E2J J;  1FTZ A;  3HGY A;  1IC8 A;  1CQT A;  1U78 A;  5C4Y A;  2EH3 A;  1ZKG A;  2FD5 A;  3KKC A;  3QPL A;  2EZK A;  1JKO C;  5IYC J;  2W53 A;  4MFD A;  1T33 A;  1QPI A;  2Y30 A;  3HB9 A;  2DA6 A;  4GCK A;  3A03 A;  3ZOB A;  3CQZ J;  3BTI A;  4JP0 A;  2ID6 A;  1QVU A;  5DS9 A;  3A02 A;  3BRU A;  1VF9 A;  1DU0 A;  3HEF A;  5HSZ A;  4XK4 A;  1FIP A;  3NAR A;  4QSH A;  3V6G A;  2L0K A;  2EQR A;  3LSG A;  5IP6 A;  3PO3 J;  4DW6 A;  2L7Z A;  4IHW A;  1JKP C;  2NVY J;  4A3B J;  4UUT A;  2QWT A;  3LSJ A;  4AYB N;  5FKL A;  1LE8 A;  3WHB A;  2DMT A;  3IV5 A;  1ETO A;  1OCP A;  2JN6 A;  2Y9Z A;  2FX0 A;  4JYK A;  1A5J A;  3BTJ A;  1VND A;  5EYR A;  5EGO A;  4DYR A;  3JRF A;  3LHQ A;  5AQC A;  4YZE A;  2LVS A;  4MLO A;  1JGG A;  4GCL A;  1IGN A;  3ZQH A;  5F1J A;  3BR1 A;  3CMY A;  5EEA A;  3ZQC A;  3HDD A;  1ZQ3 P;  1FTT A;  3JRG A;  3AQS A;  4PXI A;  3OOU A;  3JRD A;  2KDZ A;  2NVT J;  3RH2 A;  2PMZ N;  3LWJ A;  2IU5 A;  2XPV A;  3F0C A;  4JX5 A;  3MNL A;  5K7H A;  4XRS A;  1LE8 B;  3BG3 A;  4DYC A;  3VOX A;  3VUQ A;  3CDL A;  1TWC J;  5FLV A;  4NEL A;  1RES A;  5D1R A;  3DEW A;  1FJL A;  1RKW A;  1MBJ A;  3W6V A;  5M3M J;  3TED A;  3IH2 A;  5F27 A;  1H8A C;  5K58 A;  2VPR A;  2JA7 J;  5FLM J;  1TWA J;  2IBD A;  3HOU J;  3AQT A;  2DTZ A;  2P81 A;  3BR6 A;  3NNR A;  2DA5 A;  3BT9 A;  3RZD J;  3TW7 A;  3HOY J;  5CXG A;  4D5C A;  1JUP A;  2HOT A;  1TWF J;  2XGD A;  1MBH A;  1P7J A;  3S17 J;  4JX4 A;  4FE7 A;  3I4M J;  5F0H A;  3FK6 A;  1NTC A;  4XRS G;  1RKT A;  5EZH A;  3GTP J;  4A3L J;  1K61 A;  2XB5 A;  3HBL A;  4MK6 A;  3VVZ A;  4X1E A;  1RR7 A;  3C2B A;  3HOV J;  1FEX A;  1HOM A;  4M3D A;  2DMN A;  2GFN A;  1SFO J;  2GLO A;  1B72 A;  5FMP A;  2JK3 A;  1JKR C;  2HXI A;  4M6V A;  1ETX A;  2NS8 A;  3H3V K;  3DPJ A;  1HDP A;  1IG7 A;  1GUU A;  1WCM J;  5GP9 A;  2K9S A;  4A3F J;  2DMQ A;  5K7Z A;  1ETV A;  1B8I A;  2NP3 A;  3NXC A;  5C4J J;  5EG0 A;  1P7I A;  1IV6 A;  2Q24 A;  2LY9 A;  2WB1 N;  2I10 A;  3S15 J;  4A3C J;  2QF7 A;  3KKD A;  1XG1 A;  2G7S A;  4ABZ A;  1BW5 A;  4CYC A;  2UXH A;  4JKZ A;  3NPI A;  3O8H A;  4BBS J;  5EG0 B;  2QTQ A;  3JSJ A;  2LR8 A;  3GTJ J;  1JJ8 C;  4UUS A;  3GBG A;  2HOS A;  2ECB A;  2LD5 A;  3Q0U A;  4EEF G;  2Y9Y A;  1BA5 A;  3HGG A;  4I6Z A;  1LFU P;  2DN0 A;  2O7T A;  3S1R J;  2G7L A;  5IOY A;  1W0T A;  3B6A A;  5IOZ A;  1F36 A;  4BBR J;  5BNG A;  1JT6 A;  2UXP A;  2V57 A;  5F08 A;  5J1R A;  4ICH A;  4RDU A;  5FKO A;  2R7Z J;  1JT0 A;  1IDZ A;  4FTH A;  3RZO J;  4MO7 A;  1ETW A;  3GZI A;  3KZ9 A;  3JRA A;  2ME6 A;  4CYC B;  2ME0 A;  4IHY A;  3BR3 A;  2TCT A;  4XID A;  1IRZ A;  1TC3 C;  2EZI A;  2HI3 A;  1F43 A;  3GTL J;  4A93 J;  4B3A A;  4MFE A;  4MXM A;  2JA5 J;  1UHS A;  3NAU A;  2E2H J;  3Q0W A;  4GCT A;  1VI0 A;  2M2E A;  5C3E J;  4FIS A;  3PO2 J;  3I4N J;  5EF6 A;  1ETQ A;  4V2F A;  2R92 J;  3LJL A;  1ZGW A;  2G0E A;  2DG8 A;  2DA1 A;  2K9Q A;  3RKQ A;  1WI3 A;  2HDD A;  5F0F A;  1YRN B;  3QBM A;  3CJD A;  1UI5 A;  3SJM A;  2OF7 A;  2HQ5 A;  3GTK J;  3VW1 A;  3ANP A;  1JUS A;  1ITY A;  1AKH B;  3VOK A;  4C3I J;  4MIM A;  1MBF A;  1JKQ C;  1MSF C;  5M5Y J;  4DZP A;  5IPA A;  3ZQL A;  2NS7 A;  2XPU A;  2NVQ J;  1MSE C;  3A01 A;  2YS9 A;  5IP7 J;  2R93 J;  3HTA A;  1Z77 A;  2COB A;  1T56 A;  3Q3S A;  1X2N A;  5E3O A;  3BNI A;  3M3Y J;  3RQI A;  2FJ1 A;  3HTJ A;  3BQY A;  1UI6 A;  3FKI J;  3CWR A;  1SGM A;  2IEK A;  1VFC A;  1DU6 A;  3S16 J;  3F1B A;  5IYB J;  3S2H J;  5CW8 A;  2ZOZ A;  1OFC X;  3QPS A;  4L5E A;  3SDG A;  2LK2 A;  4D5F A;  3P9T A;  3LSR A;  2JMW A;  2L7F P;  4C2M J;  3ON2 A;  4M3F A;  1H89 C;  3C07 A;  2HYJ A;  3VP5 A;  3IUV A;  2NVX J;  4A3K J;  1U9O A;  4G12 A;  4BY7 J;  3S1N J;  4JNN A;  4X6A J;  2B63 J;  2HKU A;  1WH7 A;  2JJ7 A;  3HE0 A;  5EFY A;  1PUF B;  3V78 A;  2W48 A;  3EUP A;  2AO9 A;  2PZ9 A;  4GFK A;  5D18 A;  4LOC A;  4HKU A;  2H8R A;  5C44 J;  2WAQ N;  3L1P A;  2XRL A;  2JA8 J;  2N8G A;  3T6N A;  3ZQI A;  5HBU A;  1YRN A;  5C4X J;  5EDN A;  4W1U A;  4DZJ A;  2R5Z B;  3S1M J;  1MBG A;  1GV5 A;  1EF4 A;  4A3M J;  3LSP A;  3OSF A;  1WH5 A;  3G1L A;  4CGR A;  2R0Q C;  2YU9 J;  2REK A;  2XB0 X;  3GTO J;  2UXU A;  2ID3 A;  2MGQ A;  1MH3 A;  4D7M A;  2DMP A;  2IAI A;  1K83 J;  2LLK A;  3BQZ A;  3BTC A;  1UMQ A;  2UXO A;  2VKE A;  2YVH A;  5GPC A;  4W97 A;  1H88 C;  1QVT A;  3G1O A;  1FIA A;  2CUE A;  2MW8 A;  2NP5 A;  2OPT A;  3O8G A;  3HOZ J;  3FIW A;  3M4O J;  2MSY A;  2Y0S N;  2GM4 A;  2GEN A;  3BCG A;  5M5W J;  1IUF A;  1Q1V A;  3VVX A;  2XGC A;  2DMU A;  2XPW A;  4S0H B;  2LKX A;  3HOX J;  4XIC A;  3VVY A;  1ENH A;  4D7N A;  4L62 A;  2Y31 A;  1A6I A;  4BKX A;  3RD3 A;  1RET A;  1Y1V J;  2X6O A;  4AUX A;  4M3E A;  3VPR A;  5M5X J;  2E19 A;  4A3J J;  2UXI A;  3ON4 A;  1O4X A;  1X2M A;  1APL C;  3JRB A;  2NX4 A;  2DA2 A;  2QKO A;  1SAN A;  2HOA A;  1U8B A;  3ANG A;  3S5R A;  3E7Q A;  4JX6 A;  2WV1 A;  3TP3 A;  4AC6 A;  2JWT A;  2LP0 A;  2AHQ A;  3FRQ A;  1IJW C;  1XS9 A;  2ZCX A;  3NI7 A;  2DA3 A;  2M9H A;  3TW6 A;  2CUF A;  1R9T J;  1OJL A;  2EZH A;  1G2H A;  3PM1 A;  2OI8 A;  3VW2 A;  1S7E A;  2VKV A;  2XSD C;  4FCY A;  3ZQF A;  4M3G A;  1HDD C;  1POG A;  1B8I B;  1IDY A;  2CU7 A;  2E1O A;  4M3B A;  5EZG A;  2CQQ A;  4KWA A;  2CJJ A;  2ZCN A;  1HCR A;  3Q0V A;  1UG2 A;  3LOC A;  4HNV A;  1MBE A;  1NK2 P;  4FE4 A;  1ETK A;  3KNW A;  3G1M A;  5IP9 J;  2ZCM A;  4AF5 A;  3GEU A;  3WHC A;  1WGX A;  2VUM J;  2MG4 A;  2WUI A;  2M8G X;  4I76 A;  3BHQ A;  3BG9 A;  5DTD A;  4Y7N J;  3B6C A;  3JRH A;  3JRC A;  2EZL A;  1ZR4 A;  5FKK A;  1OCT C;  2NOG A;  3BG5 A;  2EBI A;  2VI6 A;  2D5V A;  4NDL A;  3JR9 A;  3MN2 A;  3JRI A;  1GDT A;  3G56 A;  3HTI A;  2TRT A;  2RAE A;  1Y1W J;  3GTQ J;  4UDS A;  3TP0 A;  5FGL A;  3IH3 A;  1MH4 A;  4DYQ A;  2FQ4 A;  5HOD A;  5HAW A;  2O9L A;  5J3L A;  1I6H J;  2ZOY A;  1TWG J;  1U9N A;  4ACI A;  2M34 A;  1GVD A;  2R5Y B;  2D6Y A;  1PUF A;  1GV2 A;  5JLW A;  2O8K A;  5D19 A;  2DA4 A;  3H0G J;  4AC0 A;  3HKZ N;  1HLV A;  1AKH A;  3BR0 A;  1B72 B;  5F0C A;  4BXX J;  2L7M P;  1JUM A;  3B81 A;  5FHP A;  3JRE A;  1D5Y A;  3EGQ A;  2O7O A;  2DJN A;  5J1U A;  5E3L A;  3CRJ A;  5JLX A;  5J1Y A;  3LNQ A;  5E3M A;  4A3G J;  2ELK A;  4C3H J;  2CRG A;  4RBO A;  1ZK8 A;  5M3F J;  4A3E J;  1JTX A;  4GFB A;  2QIB A;  3OSG A;  5F04 A;  1Z0X A;  1X58 A;  4XRM A;  1BW6 A;  2R5Y A;  2DG7 A;  3BJB A;  5FKN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...