3QQAA

Crystal structures of cmer-bile acid complexes from campylobacter jejuni
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
200
structure length
200
Chain Sequence
TPSQKVLARQEKIKAVALELFLTKGYQETSLSDIIKLSGGSYSNIYDGFKSKEGLFFEILDDICKKHFHLIYSKTQEIKNGTLKEILTSFGLAFIEIFNQPEAVAFGKIIYSQVYDKDRHLANWIENNQQNFSYNILMGFFKQQNNSYMKKNAEKLAVLFCTMLKEPYHHLNVLINAPLKNKKEQKEHVEFVVNVFLNGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CmeR
publication title Crystal structures of CmeR-bile acid complexes from Campylobacter jejuni.
pubmed doi rcsb
source organism Campylobacter jejuni
molecule tags Transcription
total genus 76
structure length 200
sequence length 200
ec nomenclature
pdb deposition date 2011-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3qqaA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3qqaA02
1VNDA 2Y9ZA 1H89C 2Y0SN 3LOCA 3GTMJ 1GV5A 3S2HJ 5K7ZA 5C4YA 4M3EA 1JKQC 1BJZA 4HNVA 4MIMA 3A03A 2ZOZA 1MNMC 5DAJA 3MN2A 5GPCA 2OF7A 3HTJA 1IDZA 2M0CA 3GTQJ 3JRCA 4QSHA 1GVDA 4ME9A 4GCTA 1RKWA 5F04A 3GZIA 2FBQA 1HDPA 3SDGA 2Y30A 3LSJA 5GPAA 1I3QJ 1JJ6C 3HOWJ 5EZHA 3S1NJ 3BQZA 4A3DJ 3G56A 3QKXA 4GCLA 5C4JJ 3KNWA 2XPVA 5FKKA 4DZJA 3LWJA 2ID3A 1FTTA 3HB9A 3JRHA 3S2DJ 3BR1A 3PPBA 1JGGA 2DTZA 3IH2A 1IC8A 2GENA 4X6AJ 1FIAA 1MBJA 1EF4A 3T6NA 3PM1A 2NOGA 3JRIA 1UHSA 1WI3A 4XRSG 4UUTA 1HLVA 2DG7A 2DA1A 4RDUA 4JP0A 4A3KJ 4DW6A 3DCFA 4C3IJ 3EUPA 3FISA 3GTJJ 2M34A 1SGMA 3S1QJ 1POGA 4IHVA 5EYRA 3RQIA 5M5XJ 2YS9A 5FJ8J 3HOUJ 2JWTA 3PO2J 2L9RA 3ON4A 2EZKA 3CMYA 4A3FJ 2XGEA 5D19A 4DYRA 5FLVA 1H88C 1OFCX 3EGQA 2HYTA 2UXOA 1K61A 1ORKA 1X58A 3IH3A 4D7NA 1GUUA 4W1UA 3OSGA 4DYQA 5JLXA 3LJLA 2AHQA 2OI8A 3KZ9A 4BY7J 3TP0A 2R5ZA 4MLOA 2DMPA 3SFIA 4DYCA 3ZQLA 2ID6A 1T56A 1QRYA 3Q0UA 3QPSA 1LE8A 2VKVA 5M5WJ 2JA5J 4A3LJ 5C4XJ 2X48A 5C44J 2UXPA 3OIOA 2G0EA 4DZPA 4QIWN 3JRAA 1JKRC 2E2HJ 2HDDA 2XGCA 1B72A 4XRMA 1U78A 5JLWA 3HGYA 3LNQA 5DS9A 1UMQA 2CUFA 1X2MA 3D1NI 1D5YA 2L7FP 1YRNA 3HEFA 2FX0A 4ACIA 4AYBN 3JRFA 1P7IA 2EZIA 3HOZJ 3BG3A 1ENHA 1TWCJ 1ZR2A 2R5YA 2WV1A 2ZOYA 3BR5A 2XRLA 4A3JJ 2LD5A 1ETYA 3V78A 2AO9A 5J1YA 5CXGA 2NVQJ 2QWTA 4I76A 2Q24A 1WGXA 5EGOA 1TWGJ 4FISA 2K9QA 2G7GA 1BL0A 1WCMJ 2E2IJ 2EZHA 5EFYA 2HXIA 5HAWA 3V6GA 4IHYA 3Q3SA 2FQ4A 4Y7NJ 4FTHA 2PMZN 3K7AJ 1HCRA 4AC6A 4BY1J 2DA6A 2K9SA 3GBGA 4A3GJ 5D18A 3S1RJ 2XGDA 4UUSA 1JJ8C 2MG4A 1AKHA 2G7LA 1QVUA 3GTPJ 1HDDC 3CJDA 1ETOA 2KT0A 1Y1VJ 2QCOA 4CYCA 3ZQFA 1NTCA 2DMUA 4AC0A 5EDNA 2PBXA 4MK6A 4C3HJ 1I6HJ 4FE7A 4LOCA 4V2FA 2QIBA 2EZLA 1NK2P 3HDDA 3VP5A 1VI0A 1DU6A 3H0GJ 3I4MJ 2L7ZA 2REKA 2VKEA 5GP9A 3GEUA 1ZR4A 3GTGJ 1ZGWA 2WB1N 3JR9A 3G1LA 1FJLA 2Y9YA 4M3GA 1ETQA 1Q1VA 4QTRA 3UKGA 3PO3J 1K83J 1XG1A 5E3LA 3L1PA 4JYKA 2YUSA 2ECCA 1T33A 1MH3A 4I6ZA 5IYCJ 4PXIA 1ETXA 3JRDA 5CW8A 4BKXA 2DJNA 2B63J 3O60A 1RPWA 3VOXA 4M3FA 3RH2A 1MBEA 5E3MA 1NK3P 2G3BA 2DMQA 2HI3A 4NDLA 4S0HB 3ZQCA 2IU5A 1TWHJ 5IYBJ 1ETVA 2NVTJ 4M6VA 3B6CA 2W53A 4CGRA 3RZDJ 4YZEA 1A6IA 1IUFA 2R92J 3S16J 5F0HA 1UI5A 5IP6A 5IP9J 1BW5A 4HKUA 4KWAA 1U9NA 3HKZN 2CRGA 1F43A 2F07A 4JNNA 2NX4A 1RESA 3C07A 5EG0A 2E1OA 3OSFA 2ME6A 5EF6A 2EQRA 2IAIA 2RASA 1DU0A 1FTZA 2K40A 4JX5A 2R5ZB 2P81A 3HOYJ 2NP5A 2ME0A 5K7HA 3B81A 5DTDA 3F0CA 3BQYA 3VOKA 5E3OA 3A01A 1B8IB 4J19A 2JA6J 4A3BJ 3CRJA 2DA7A 1ZTRA 3VIBA 4NELA 2XPWA 3AQSA 4GFKA 3NI7A 1JTXA 4C3JJ 3CWRA 1HOMA 4L62A 2NVYJ 3BJBA 2ZCNA 1WPKA 4JL3A 4A69C 2X6OA 4AUXA 4Y52J 3COLA 4JX4A 2R7ZJ 1JT6A 3VW0A 1WH5A 1IGNA 1YRNB 2L7MP 3BTIA 5IPAA 3Q0WA 1PUFB 1QPIA 5C3EJ 5IOZA 2V57A 2UXIA 4AF5A 2MGQA 1BW6A 1ITYA 2R5YB 4D7MA 1Z0XA 1ETKA 3TW7A 2DG8A 3PASA 4G12A 3ON2A 9ANTA 2PZ9A 5K58A 1Z77A 3S17J 1GV2A 1UI6A 1TWFJ 2Y2ZA 1G2HA 4GFLA 3IH4A 2JK3A 3HTHA 1A5JA 3C2BA 4XRSA 1ZK8A 2CUEA 2R0QC 1VFCA 1IJWC 2G7SA 1VF9A 4W97A 2WUIA 3KKCA 1W0TA 2GUHA 4JX6A 4V2GA 1GDTA 2HQ5A 1BA5A 2CQXA 3BTJA 1HF0A 1OCTC 3BR2A 4UUSB 2HKUA 2I10A 1ETWA 2LY9A 3QPLA 5J1RA 1R9TJ 3NNRA 5H9TA 1IDYA 2LR8A 4FE4A 1MSFC 4M3BA 3BRUA 3A02A 3AQTA 2R93J 3IUVA 1RETA 3LSGA 2HOTA 3S1MJ 3ZOBA 3NPIA 1CQTA 5E3NA 2COBA 1OCPA 4C2MJ 1JKPC 5FMPA 2MW8A 1I50J 3QQAA 1MH4A 2LK2A 5M5YJ 3FRQA 1TC3C 3JREA 2RAEA 2NS7A 2GFNA 2FJ1A 2ZB9A 5M3FJ 3VW1A 4ICHA 3CDLA 1RKTA 1O4XA 1MBFA 1RR7A 2DA2A 3WHBA 1IG7A 3H3VK 4NN1A 1JT0A 3ZQGA 2IEKA 2IBDA 3FK7A 2HYJA 5FKNA 3M3YJ 4X1EA 3HIMA 2UXHA 5BNGA 5F08A 2DMNA 3I4NJ 3BR0A 3CCYA 4B4CA 1E3OC 3MVPA 1SFOJ 1IV6A 1UG2A 3FKIJ 4B3AA 5F1JA 4IHWA 1JTYA 1LFUP 2XSDC 2LVSA 1JUMA 1P7JA 2M8GX 3HM5A 5HBUA 3P9TA 4D5FA 2L0KA 3LSRA 2EBIA 3LSPA 1MBKA 5AQCA 2NVXJ 5F0CA 4XICA 2HOAA 3K2AA 3Q0VA 3MNLA 5IOYA 5IP7J 2LKXA 1ZKGA 1FIPA 2ZCMA 2DA5A 2N8GA 2NS8A 1AHDP 4D5CA 2D6YA 2O8KA 4UDSA 3WHCA 3FIWA 3ZQIA 1JUPA 3HOVJ 5EG0B 3JRGA 3NXCA 1MSEC 3GTKJ 3RKQA 3HBLA 2O7OA 5FLMJ 2JN6A 3G1MA 3RZOJ 2LP0A 2WAQN 3G1OA 3VVZA 2KDZA 3E7LA 3BR6A 1U8BA 2DA3A 5F0FA 4BBRJ 1H8AC 2Y31A 2H8RA 3BG5A 2TRTA 1ZQ3P 5F27A 2DN0A 2LFBA 3A01B 2GLOA 5HODA 2QTQA 4A93J 2CQQA 4RBOA 1LE8B 3ANGA 3HE0A 4BBSJ 2OERA 3DPJA 2VPRA 2VUMJ 1X2NA 5J3LA 4A3MJ 3W6VA 3DEWA 3M4OJ 3ZQHA 3MKLA 2GM4A 5FGLA 2EH3A 2ELKA 3ANPA 3BT9A 4MO7A 2D5VA 3GTOJ 2YVEA 4XIDA 3FK6A 3HTIA 3BCGA 2JJ7A 4MFEA 1MBHA 1B72B 2DA4A 3B6AA 2H1KA 2E19A 1Y1WJ 5D1RA 5K7FA 2XB5A 5EZGA 3G7RA 1TWAJ 2LLKA 1S7EA 1SANA 2TCTA 4MXMA 3CQZJ 1APLC 5HSZA 3S15J 3VUQA 2JA7J 2WGBA 2GBYA 4B1RA 2K9NA 1LFBA 1OJLA 3S14J 5FKMA 4ABZA 1B8IA 2O7TA 5M3MJ 2UXUA 1MBGA 3BHQA 2FD5A 2LTPA 3BTLA 2E2JJ 3HOXJ 3NARA 3LHQA 2DMTA 2M9HA 4GFBA 4A3IJ 5EGOB 2ECBA 3HGGA 4FCYA 3OOUA 2JA8J 5FHPA 3HTAA 3BR3A 5EEAA 1W0UA 3VW2A 1JKOC 4BXXJ 3BG9A 4A3CJ 2M2EA 4XK4A 3IV5A 1PUFA 1AKHB 2NP3A 3JRBA 5IYDJ 3JSJA 1WH7A 2O9LA 2OPTA 4IEJA 3NAUA 1GT0C 2XPUA 4L5EA 1QVTA 4CYCB 5FKLA 1XS9A 3QBMA 2MSYA 2CJJA 3O8GA 5J1UA 3GTLJ 2W48A 3O8HA 2CU7A 2RHAA 2YVHA 4A3EJ 1AU7A 3S5RA 3TW6A 2YU9J 2QKOA 5CXIA 1U9OA 2XB0X 3SJMA 3TEDA 4EEFG 1IRZA 2QOPA 3KKDA 3NRGA 4MFDA 3E7QA 3RD3A 2VI6A 2ZCXA 3F1BA 2X9DA 5FKOA 2JMWA 3TP3A 1F36A 2XDNA 4JKZA 2HOSA 1JUSA 4IHXA 3BNIA 3VVYA 4GCKA 4M3DA 3BTCA 2QF7A 3VVXA 2HXOA 1FEXA 3VPRA 1XC5A
chains in the Genus database with same CATH superfamily
1HQCA 3TDUC 4NBQA 1V5FA 3RPUA 3OYLA 3VTIA 4GDFA 4B47A 5K7ZA 4MIMA 3A03A 5AIQA 4WX9A 3K1PA 5KK1A 1IDZA 2F4MB 3OYAA 3CUQA 1D0XA 1GVDA 2DYSH 1RKWA 5F04A 2P7CB 5EEGA 4XR6A 3HSRA 5GPAA 1I3QJ 5E79C 5HLGA 5EZHA 2E1CA 3ONQA 1D1BA 3G56A 1BBYA 2D45A 4WK8F 2LOOA 2HKOA 5FKKA 1YOVB 4HQEA 3GF2A 3S2DJ 2QA4I 2DTZA 3KYLA 2DODA 2Q2EA 1B9NA 2BY2A 4XKBA 1ON2A 2LKSA 1UHSA 4Y17A 5H20A 4GYIA 2DG7A 2HDWA 4I99C 2R7TA 2HNHA 5DDGA 2WY8Q 4EGZA 4EM2A 2E35A 2M34A 1SGMA 1NG6A 2VQLA 2VXZA 1Z7LA 4AYBA 1VQ4I 5EYRA 5M5XJ 1Z3YA 2FOKA 4QPQA 1WQ2A 3LSTA 5FJ8J 3HOUJ 4Y13A 1TBXA 4UNOA 2L9RA 1Z6RA 2EZKA 1MDMB 4XMYA 2O8XA 2XVCA 2W25A 3CMYA 4ZDOA 2XAQA 4BYYA 1A31A 2IJLA 1T08B 2IXSA 5FLVA 4E7JA 1OFCX 4A0ZA 2HYTA 3CF5F 3IH3A 4IVNA 2BYVE 3L2CA 5E20A 1GUUA 3ESWB 3HC7A 2PMZA 2WY7Q 4A6EA 5JLXA 1FMVA 4DYQA 3LJLA 4EMSA 2HDCA 1X19A 3DPLC 3VFZA 1FC3A 2DMPA 4KT6A 3HL2A 1XTAA 2R5ZA 1SVLA 3N97A 2K3PA 1CF7A 2ID6A 1T56A 4A3LJ 3QPSA 4M73A 4C2MA 3V7RA 5C44J 2IS2A 2UXPA 4HF0A 2G0EA 2D1VA 4BQNA 5ED4A 1FOWA 1IXSB 1EV7A 4U7DA 1MMSA 1G3WA 2A6HF 1NH3A 1ZYRF 3LSKA 4KITB 2CH0A 1VQKI 4LFUA 3CJNA 3KCCA 2QKMB 2VT3A 3HGYA 5FROA 4M9XA 5JHUA 3LNQA 1LPQA 1K7AA 4MEXF 4G7HF 3V8KA 2XAHA 1LDDA 4C9YA 2CUFA 3N05A 5KAFC 3D1NI 1D5YA 3E6BA 3HJEA 1YRNA 1FYLA 4LGWA 4IHTA 3MZHA 1G6NA 2W7NA 1VQMI 4AYBN 3JRFA 2K3FA 2EZIA 3BPVA 5E1XA 3K70D 2UZKA 3WU1B 2LY2A 2XF5A 4BHCA 3SEQA 3MKWB 3K8PC 3GZNB 4AIHA 3M8JA 5KHDA 5ERIA 2HQAA 4U87A 1XMAA 4ZZDA 2ETHA 4A3JJ 5KNLA 4RLQA 2R7VA 2PLYA 1Q1HA 1R5HA 2QQ9A 1ON1A 1OKRA 1JHFA 2NVQJ 2OJED 2Q24A 1WGXA 2O0YA 1TWGJ 4FISA 1WCMJ 2ADUA 3H5NA 2EZHA 4CCLA 5HAWA 1LUJB 3JCUC 3OYCA 5GADJ 5LRSA 2PMZN 2R7DA 4G6TB 4IQ4A 3T8TA 4AC6A 1MKMA 2K9SA 4HDUA 3IKVA 2IW5A 2OTLI 1IXCA 2G7LA 1YO5C 1USTA 2CV0A 2STTA 2OCEA 4OINF 1QVUA 3GTPJ 3CDHA 2FMYA 1G59A 1HDDC 1Y1VJ 4OD4A 3TO9A 2GOXB 3S93A 4LLNA 4P1WA 2PBXA 3CUQB 3HIFA 1W5CC 3E6DA 5DD8A 4U0WA 3BCAA 3I54A 3K10A 3RTRA 2OD5A 3I4MJ 4CZCA 2VKEA 5GP9A 2EIMH 4U7BA 4XORA 3KE2A 1Q1VA 2WC2A 2M7BA 3OYHA 1K83J 4JYKA 2YUSA 2ECCA 1Z7UA 3P9CA 4B8XA 3CCUI 4PXIA 1IO2A 1X4PA 3LFUA 5FFZA 2DT7B 2VJIA 2B63J 1YG2A 3CTAA 2VKHA 1R49A 1RPWA 3D0SA 3RH2A 1MBEA 2ICWG 2G3BA 2PN6A 2ZXIA 1IRFA 1ETVA 1I39A 1T0FC 2V1NA 2R7OA 5TJJA 5IY5H 2ZJPF 1U8RA 5D6EA 4ZDPA 1I3AA 1TL8A 2F5FA 3KZZA 2JRTA 1SFUA 4IXAA 2X4HA 5CYVA 1DGRM 3RZDJ 2XKOA 1E3PA 3F72A 3WTTC 1J75A 3S16J 3CCRI 5BQTA 5L3GA 2JZYA 5LHIA 2KIUA 3F6VA 4BDYA 4DGWB 1IAWA 1U9NA 4I0BA 1QA6A 4G7OF 1F43A 1YI2I 2NX4A 5D4SA 1BR2A 5EG0A 2IAIA 2KRCA 2R5ZB 1WJBA 2BVMA 2NP5A 4K2EA 3F23A 4BEHA 1D1CA 4A3BJ 2ZMEA 3EQLF 4Z2YA 3CRJA 4LD5A 5HS7A 2F5CA 4KN4X 3S8PA 4ENMA 2RQPA 2LC2A 4HQMA 4OIQF 2MYSA 4C3JJ 3OYBA 3A2KA 3L7WA 3ZXSA 2L5QA 4L9JA 4YEJA 3ABUA 1WPKA 2EIKH 2YPRA 5FD5A 4Y52J 3F8MA 3FMRA 4CYDA 4IQJA 1IGNA 3ML6A 1YRNB 2STWA 2LBFA 4GGGA 1WJDA 2X6XA 1QPIA 4AM3A 3P9IA 3CCVI 1IRGA 4G94A 2UXIA 2MGQA 3PNYA 1MMNA 1FP2A 3W6JB 2G7HA 3TW7A 2WBMA 3SZPA 1WZ2A 3DU5A 1IN7A 1MW7A 9ANTA 3DFGA 4PZJA 3OL3A 5CPRB 1Z77A 3JW4A 3ABMH 1GV2A 1J09A 3ROUA 2Y2ZA 4EVIA 1YIJI 1XSXA 4XRSA 1R5GA 3DF8A 1ZK8A 2CUEA 2QSFX 2F5DA 1IJWC 4V19K 1XSVA 3FXQA 4E70A 2EIJH 1VF9A 4P5OA 1ZG1A 4C30A 3QOEA 2R7QA 4JX6A 1T38A 3HUGA 4V2GA 2KISA 2KJCA 3U2RA 3BR2A 1I27A 2FBHA 2I10A 2LY9A 5J1RA 2JPBA 4QWQA 3RIRA 4KDPA 3O3KA 2YU3A 1G4DA 2VOPA 1TTYA 4ZYAA 2FF4A 3FM3A 3F6OA 2W24A 3WODF 2PJRB 2COBA 3LA2A 1JKPC 2DOFA 2MW8A 5B1AH 4WWCA 5E1WA 2LK2A 2EFPA 3ECHA 2FJI1 3OIQA 4CXFA 1O3TA 1ZRFA 2NS7A 2VC0A 2GFNA 5M3FJ 5E8GA 1MBFA 3R0JA 4UVAA 1W7PD 4YIIA 1SVMA 3B73A 2UXHA 2DMNA 3CCMI 4M9ZA 3Q9SA 1E3OC 2CV1A 1Z1DA 4GYGA 3FZVA 1SFOJ 1R6RA 4WIBA 1BIAA 4RGSA 2K02A 2J5OA 3WG9A 1LFUP 3OS1A 2L7KA 3TBIA 2BHYA 2XSDC 4IRVA 1SAUA 3I71A 2OUMA 1F5TA 3R60A 2EBIA 3UR3C 3I64A 5H6QA 4HA8A 4XICA 3K2AA 3Q0VA 2KQRA 1GXPA 1LDKB 3SZTA 1OLTA 4KICA 1Z3XA 1ZN2A 3IP4B 3J81K 3JSPA 3ABLH 1FSEA 3KLNA 4XLPF 3BCBA 4UDSA 3ZQIA 1JUPA 2XAFA 2K4JA 3RQ4A 2KFDA 5EG0B 2QYOA 3NXCA 2BW3A 4OAZA 2VE8A 5FLMJ 3VEPA 2XUBA 1H9TA 1H8AC 2DA3A 2OAZA 5F0FA 5BMZA 2XRNA 2DJIA 3HRMA 2H8RA 4BEHB 2HVRA 2WAEA 1DP7P 2GLOA 2V9PA 5ILUA 3QRFF 2CQQA 2ZMEB 1QZEA 3ANGA 3HE0A 3W2WA 4C2TA 2FE3A 2FXAA 4E6KG 3WGIA 2Z9OA 2V7FA 3MZ8A 3CD6I 2FQ3A 2VN2A 4G6DA 2GM4A 3IAS2 1E0EA 3K4NA 3GTOJ 3BCGA 4EJUA 2H1KA 2VKDA 1MD0A 1Z05A 4FX4A 1T8IA 2XB5A 2DLLA 1W4MA 2ESNA 3D5SC 3F3XA 1S7EA 2DOAA 2LBFB 4BHPA 1APLC 1ODDA 2AS5F 3VUQA 2A69F 4U9NA 1JE8A 1HW5A 2DTRA 2OCCH 3PJRA 1OQYA 1ZH5A 4B1RA 3FXJA 3GZ5A 3PL8A 2R3SA 1ZARA 1LFBA 4ABZA 1B8IA 4LIVA 1MBGA 3DLLF 2LTPA 3BLYA 1CGPA 2HZDA 1RC9A 4P9UA 3SXYA 1TW3A 2LMDA 3COAC 4CCMA 2VC1A 3HUGB 1WSUA 3GLLA 3SZGA 4FCYA 3OOUA 1WKMA 2MD0A 2HEOA 4JBAA 5EEAA 4RS8A 1LQ1A 2H27A 3I56I 1J7KA 3K4CA 3K0LA 4A3CJ 1S6LA 1AKHB 3JRBA 1WH7A 1FOKA 2OPTA 4IEJA 4RAGA 2GXGA 3V7CA 4CYCB 2EK5A 5FKLA 4A2UA 2MSYA 3O8GA 2BBYA 1KU3A 2VJ5A 1YE9A 2W48A 3I5UA 3PSFA 4LK1F 3O8HA 3ZQQA 2RHAA 1TQPA 2XV4S 4A3EJ 4RB3C 3ZMTA 4J01A 3TW6A 3VWBA 4AD9A 5CXIA 3HRSA 4EQQA 1BI3A 2EILH 4KN7X 3V42A 1W36D 3E7QA 1VQPI 2QSGX 1MIJA 3QPTA 5ICEA 2EFOA 2Z2SB 2WWYA 1F36A 2BY1A 4RLFA 2XDNA 4JKZA 4IHXA 2Q1ZB 2X85A 2E5NA 1I6XA 2FNPA 3A1YA 1USSA 3BTCA 2ZSHB 3VB2A 1BI0A 1FEXA 1VNDA 4XLNF 2FMLA 4ASNA 3LOCA 5LEJA 2RKHA 5IT9Z 2L9NA 4M3EA 5LEKA 1JKQC 3EPZA 5ICFA 5JVTA 4P55A 2V1XA 2X1CA 3MN2A 3C18A 2CW7A 2R7WA 1MNEA 3GX4X 3GTQJ 4QSHA 1DGWY 4GCTA 5HDGA 3U9GA 4FHTA 3QYFA 3GZIA 1HDPA 3M7GA 2Y30A 1LFPA 3S1NJ 3RJPA 3QKXA 3LMMA 5DUIA 3KNWA 2XPVA 5CVJA 4DZJA 2ID3A 1B59A 3BR1A 2KZGA 3IH2A 3L2RA 2PMUA 1JHHA 3CMAI 1EF4A 2IPQX 3ELKA 4AIJA 4PSWA 3PIPF 4E7ZA 1LVAA 2M87A 4RDUA 1U5TA 4JP0A 4ZYEA 2QGUA 3OYDA 4KA4A 4A3KJ 3SEZA 2ZFUA 3FISA 3F9KA 3GTJJ 2HR3A 3S1QJ 1P2FA 1Y8QB 1QHGA 2XHKA 3LSHA 1BI1A 5D5UB 2JWTA 3PO2J 4JQFA 2E7WA 4LG0B 4NNJA 3ZMDA 5J40A 3GYHX 1MGTA 5FLXK 1A35A 4A3FJ 2FSWA 1PP8F 1XDUA 2EV0A 1H88C 1F1ZA 3RDIA 1X58A 2Y69H 2V6CA 3TGNA 4UV8A 3OSGA 2HVQA 1KYWA 3DV8A 4BY7J 2MH2A 3RYPA 1BC8C 4MLOA 3W2AA 1STZA 3SFIA 2W84A 1WRJA 1LE8A 3I4PA 2X48A 3PSIA 3DKWA 2UUZA 1QU3A 2HDDA 3HOTA 4DBQA 1IN5A 1B72A 4XRMA 3IRRA 1LJ9A 4UUVA 4D9JA 1K78B 2K27A 2VE9A 1OCCH 2E1MB 1FOYA 2UV1A 5D8KB 4LMYA 2O6GE 4P96A 3PFIA 2L2OA 4YELA 1FYMA 1MJAA 2CUZA 4EJWA 1OCRH 4ACIA 3RCOA 1PYVA 5J8FA 1TWCJ 4B48A 2AXLA 3FXRA 4RAFA 2R5YA 1S29A 4CZZA 4WXHA 4BQAA 2GXBA 1BJAA 3BR5A 4MQ9F 3UNGC 2G7UA 4F52A 3LAPA 3MKYB 2AO9A 6PAXA 3RI4A 5CXGA 4PGHA 1FBUA 4I76A 4CCNA 2IGOA 2L3DA 3K9TA 4XONA 4XLCA 4ESJA 2G7GA 2MBFA 3C1DA 3MMYB 2HXIA 5LHGA 3Q3SA 1R23A 1DQUA 2FQ4A 4XLAA 4FTHA 3CCEI 2L01A 2DA6A 5D18A 2XGDA 5LHHA 4BAYA 2R7FA 3HKZA 1IN4A 1DDNA 4RGRA 3CJDA 1ETOA 3ZQFA 4AC0A 5EDNA 3GMEA 3KEQA 4L9NA 5H6RA 2EZLA 2KPMA 2QUFA 3IWZA 1S72I 1QHHD 3HOSA 2OZUA 1PP7U 2NXNB 2Z1DA 3GEUA 3ZMUA 2EA4A 2ISZA 2CQNA 4A5NA 2IS1A 3G1LA 4M3GA 3FXKA 1QPMA 1H0MA 3OYJA 3WTXC 1FBQA 3PO3J 1XG1A 3L1PA 1XX5A 4BE1A 2NRAC 1UB9A 3GFLA 1X1DA 2RDPA 1MH3A 1LEBA 1NHAA 1IUYA 4L5JA 4M3FA 5A2QK 1NK3P 3L2UA 3LA7A 1ZRDA 3ZQCA 3C7JA 5IYBJ 3OL4A 2ZCWA 3LA3A 3B6CA 4M6VA 2V79A 1YX3A 3CC4I 2JVHA 3EUHA 2KRHA 4PDKA 1C0WA 4YZEA 1A6IA 1AWCA 5IT3A 1YIOA 1WFXA 5B5EC 4IF4A 2L4MA 2FEZA 1DPRA 5IP6A 4HBLA 5JFRA 4XSXF 1D3YA 3AFHA 3HKZN 2RNGA 1HXDA 2F07A 2VQCA 4JNNA 4U88A 1YLFA 2E1OA 4Q47A 3OSFA 2QBYB 1FTZA 4JX5A 2HS5A 2WADA 2P5KA 5K7HA 1ZGAA 4U0YA 3B81A 3F0CA 3BQYA 2M8EA 2DO7A 4R8HA 3OIPA 2B0LA 1X3ZB 2DA7A 3H92A 1YW7A 1ZG3A 2XAJA 4XM3A 4Y15A 3H9GA 2XF6A 1HC8A 1JTXA 1ERDA 3FXOA 3BJAA 3CWRA 1B9MA 2NVYJ 3FM5A 3EUAA 1FOXA 1Y8RB 2OQGA 3K2ZA 1KU9A 1T0FA 2W85A 4HNUA 2H1LA 2EFWA 1JT6A 2EJRA 3M1CA 3OOPA 3MCZA 1OR7A 3KEOA 1Z6TA 4XL9A 2VONA 3BTIA 2GOMA 2GIVA 4BDZA 1UJ8A 5C3EJ 5IOZA 3U1KA 4ENJA 1F9NA 4LLLA 5K1YA 4LB5A 3EYYA 4HV5A 2R5YB 4D7MA 1ETKA 2DG8A 2DOEA 3E3VA 2JQ7A 1AA7A 3LFKA 4IRHA 3Q5FA 4MGRA 4N9HA 4CCJA 4G8XA 3S17J 2XF7A 4HAMA 4CSWA 1UI6A 3AKZA 5CJ9A 2QQAA 1RR8C 4XN0A 1MJBA 3C2BA 4BACA 2A07F 1KQ8A 4ZH4F 2VASA 3KKCA 1W0TA 1FT9A 2O61A 1DP3A 1FMWA 2HQ5A 4F91B 1BA5A 2G9WA 1HF0A 3A0HC 3KFWX 1S7OA 1VQ8I 2IVMA 4ZC3A 2AQEA 2HKUA 2XIGA 3CUQC 4I09A 2X1EA 1R9TJ 4EM0B 2LR8A 1YS7A 1MSFC 3HHGA 4XQFA 3BRUA 3AQTA 1WJEA 3DQVC 2R93J 4ESFA 2LSOA 1RETA 3LSGA 2HOTA 3ZOBA 1CQTA 5E3NA 3CZ6A 1OCPA 1J59A 1IZ1A 3CJQB 5TGTA 1GLNA 1I50J 1MH4A 5M5YJ 3R61A 3TMOA 3ZMVA 4ZJZA 5CVIA 2RAEA 2FJ1A 2ZB9A 5ILSA 3HYIA 1FZPB 3VW1A 3CDLA 2PFBA 1O4XA 2BXZA 3ABTA 4OIRF 2DA2A 1L3LA 4F55A 1BR1A 4D0PA 1WJCA 2IBDA 3FK7A 4LLGF 2HYJA 2PG4A 4X1EA 3HIMA 2WTEA 4RGUA 3L00A 2Q2EB 5AONA 1IV6A 1KA8A 1ZLKA 3I9V2 2HU9A 2HQNA 2LVSA 3HM5A 4N9IA 2QEXI 1GHCA 4IRGA 1SVOA 2YX7A 3HTJA 4ITVA 3LSPA 5F0CA 2HOAA 3MNLA 1F4KA 2LKXA 1Z91A 1ZKGA 4EJTA 2V1UA 2N8GA 2NS8A 5FFXA 4D5CA 2PI0A 2NVUB 2HGCA 4Q48A 3QYEA 2KHMA 3DTIA 1P92A 3HOVJ 3PNTA 1JI8A 2VBYA 2QVOA 3O6BB 3RKQA 3HBLA 1FP1D 2JN6A 1QNTA 2LF7A 4FASD 4IKFA 2RC4A 4II2A 2HOEA 2XASA 4NQWA 2KDZA 2HPIA 3BR6A 2W00A 4PGGA 1N25A 2MD5A 4F7ZA 2M4GA 4RMNA 3BG5A 1TW2A 3J80K 5F27A 3H9JA 1CF7B 4RBOA 1HBXG 2OERA 2E71A 3G71I 2AQFA 4H0EA 1T95A 1MMAA 4A3MJ 5J3LA 1FYKA 3ZQHA 5FGLA 2QLZA 3K4LA 3J7AO 3FK6A 2JJ7A 4B43A 2ZXJA 2ELHA 4KUMA 4YFKF 5FRNA 3B6AA 5HOOA 2KIFA 5K7FA 2GXAA 5JI6A 4O3MA 4U9LA 4G7ZF 5EZGA 3OV8A 1BR4A 1TWAJ 3VDXA 3FBIB 1Z9CA 3ECOA 3CQZJ 1XD7A 3LL7A 5HSZA 4LB6B 2WAFA 5CLSA 3AG4H 2JA7J 4HX4A 2MLGA 2WGBA 4PJNA 1J5YA 2BEOA 3T0YA 5DCMA 2UXUA 5EJCA 2FD5A 5HDNA 2Y75A 3M1EA 3S2WA 2ZJRF 2E2JJ 1YYVA 2IGNA 4XRFA 3ULQB 2M9HA 3DBRB 4Q5SF 5LGUA 5E17F 5L3BA 4OIPF 2H8WA 4U0VA 4MNUA 5FHPA 2RVCA 2UWMA 1Y39A 2BHZA 3CO7C 4X0GA 1MMGA 5DEQA 3BG6A 3FX3A 1R4MB 4AVZA 3JSJA 1PUFA 3SFZA 5IYDJ 3CC2I 1U2WA 1QBJA 3E6CC 2XPUA 3LAJA 5E18F 4I0AA 2CJJA 3GTLJ 1G8XA 2P7VB 2DXIA 3DP7A 4PFPA 1AOYA 5GTIC 1XN7A 2VLAA 2NNYA 2QKOA 4G6QA 3GO5A 5DV5A 1U9OA 3MEXA 4EEFG 3EYIA 1IRZA 3S3MA 2JSCA 2CS3A 5CQGA 5HNFA 2DFFA 4M74A 3RD3A 2ZCXA 5FKOA 3ISPA 2JMWA 2HOSA 3FKJA 3D5LA 4MTDA 4OIOF 4ON0A 4A6DA 2QF7A 3E0JB 1O7LA 3P7NA 5KVRA 1TP4A 4IX7A 1KQ0A 3GTMJ 4LG3A 2M3AA 3S2HJ 2F4OB 3CLQA 5C4YA 3M8FA 1KONA 4KIBA 1BJZA 4HNVA 1I5ZA 4M71A 5JR3A 5DAJA 3IRQA 2PX9A 4P9FA 2OF7A 1Z21A 1EA3A 5GPCA 2PJPA 2M0CA 3H3ZA 3LSMA 4HSRA 4PJMA 3SDBA 4CCOA 5HDKA 3AAFA 2ZY9A 2KRFA 1MNDA 2HVSA 2JRMA 4ME9A 1E3HA 3KP2A 3NQOA 2FBQA 4IPAA 3LSJA 4XKWA 1JJ6C 1X1CA 3BQZA 1K4TA 2MFZA 2RREA 1FX7A 2DFIA 4IHSA 3LWJA 1N78A 3CLOA 4ETSA 3JRHA 2ZMEC 1T39A 3BG7A 1IC8A 4NQWB 3WG7H 2EINH 2JUGA 3U1DA 5DM7F 4X6AJ 2LREA 1MBJA 3GFMA 3T6NA 2NOGA 3JRIA 4XRSG 3HTUA 5LRRA 1XMXA 2CQKA 3SWHA 2ZNZA 3K4JA 4EV0A 3F8FA 4I7HA 2ELJA 1W7PA 5LD2C 3OS2A 3ASOH 2V4JC 1POGA 4BE0A 2IP2A 3RQIA 2P6TA 3IWFA 4UHTA 5GTHC 3PFYA 3RSNA 3KPHA 2EA2A 3ON4A 2GZWA 4GCVA 2V1DA 4IL6C 4FT8A 1R00A 4NB5A 2A68F 2P5VA 1YHQI 2OQRA 2XGEA 3CP8A 2M4KA 4DYRA 1J0RA 2H94A 1MMDA 3EGQA 2XSJC 2UXOA 3EDPA 1K61A 3QU3A 1Y56A 2A3SA 2DPUA 4G9YA 3G3ZA 3KZ9A 2E34A 3G4SI 3Q9VA 5DCMB 3I58A 2DK5A 1LEAA 4DYCA 2VT2A 3FHZA 1FPQA 2VKVA 4F92B 4DZPA 5H2FC 3NRVA 1JKRC 1ONVA 4ZYHA 1T6SA 2X51A 2E2HJ 2ZXHA 2YVXA 4UVCA 2CFXA 1RRJA 5D5XB 3VYSB 3VSLA 5FB2A 2OV7A 1I1GA 1XCBA 2FBIA 2LY1A 2NNNA 3WTSC 2RQQA 1ZGJA 5DD4A 4PK4A 4B44A 4DQ2A 1UMQA 1K79A 1X2MA 2WB1A 3E1SA 2IA1A 1GXQA 3TQNA 1SFEA 3BJ6A 3WTUC 1WJAA 3GW2A 3BG3A 1U3EM 1ENHA 3CC7I 1X1AA 1ZR2A 1B6AA 2WV1A 2CFOA 5LGTA 4YFXF 2VODA 2B3WA 2QENA 2ZFWA 2KKOA 4BJTA 3IAM2 4AIDA 2JPCA 2CW0F 1RUOA 3LSIA 5EGOA 2ZJ2A 2EPFA 2FUG2 3E5UA 3R6SA 2D1HA 4ZTJA 3RKXA 2E60A 1IN6A 5EFYA 4ANJA 4Y7NJ 2GA1A 3BJOA 1ZAOA 3K7AJ 3G6EI 4BY1J 1TNSA 3CJTB 3S1RJ 1JJ8C 1A6QA 4YIRX 1R22A 1OYIA 5FO5A 4DIQA 1L0OC 2R7XA 1Y6IA 1SFXA 3GCMA 4HNTA 2FOWA 5BS6A 5LLQA 5HLIA 1NTCA 3DKYA 1S7AA 2F6CA 5TRDA 3ZMSA 2FA5A 4C3HJ 1I6HJ 4V2FA 2QIBA 4HEA2 3RPQA 2OTJI 1RUNA 1R1UA 1TNTA 4HRIA 1SEUA 1NK2P 2CSOA 3S32A 4OWRB 1UHWA 1ZLJA 3VP5A 2KJBA 1IRXA 5DCFA 3DEUA 1VI0A 3H0GJ 2HQRA 4UY8I 2REKA 3QAHA 1ZR4A 3GTGJ 2P6SA 1ZGWA 1N75A 2WB1N 3BZ6A 4AIKA 2X0LA 1FJLA 1ETQA 1PVEA 2A6EF 2Z16A 4QTRA 1YJ9I 3UKGA 1Z67A 3QP6A 3R4KA 3FBNB 5K5RA 2BW3B 5E3LA 1KU7A 1REPC 2A05A 4OU0A 2UXXA 1SD6A 1T33A 4I6ZA 5IYCJ 1ETXA 4M6XA 3JRDA 4HPQA 4BKXA 2DJNA 2VBZA 5CW8A 2MABA 1I1SA 3O60A 3QODA 3GLXA 5FD6A 1W7PB 1BN5A 1D1AA 3H0DA 5E3MA 1LNWA 4MEYF 3ZMZA 3OYNA 3F22A 4NDLA 4S0HB 2IU5A 4KFCA 1TWHJ 2Q8KA 2EFNA 4HYEA 4XBFA 2NVTJ 3QOPA 3RKYA 1VQOI 2RV8A 2W57A 4RB1A 3CO6C 4CGRA 3O2PE 2KDOA 2X6WA 3H35A 1D5VA 2P8TA 5F1RA 4FQGA 4HLYA 2R92J 2E1NA 5F0HA 4E7IA 3TOAA 4A5MA 5J8CA 1UI5A 1V54H 5IP9J 4HKUA 5ICCA 1OCOH 2VJJA 3GZ6A 2YSRA 5D4RA 2LF8A 4L5IA 2AXTC 1HSJA 2M30A 2L02A 4C2UA 1D0ZA 1Y0NA 5EF6A 2RASA 4M72A 1DU0A 5GAGJ 2P81A 3HOYJ 2ME0A 4HX7A 4KMUX 1LVKA 3P9KA 2ZXWH 2GIZA 2NAZA 3VOKA 5E3OA 1FNNA 1ZHFA 4CDGA 2H6CA 1B8IB 4DJAA 2JA6J 4KMFA 3RYRA 1ZTRA 3VIBA 2K9LA 5AIPA 4NELA 1ZELA 2XPWA 3AQSA 3KP4A 2E1MC 3KLOA 3CCJI 3NI7A 3A0BC 1MDMA 3JAMK 2Z33A 2IT0A 3BJBA 1YX5A 4OMYA 2ZCNA 3H5AA 4A69C 3FMQA 5LBQA 3COLA 3QYBA 4JX4A 1K6YA 3VW0A 3CMMA 2L7MP 1O3RA 2A61A 2H6BA 2VBWA 3NS4A 1IW7F 3VOEA 4ZYGA 2V57A 3HZJA 3FXMA 3K4KA 1G3TA 4BL0B 2B7EA 2IGKA 3PASA 2Q0OA 3HRUA 5K58A 1RZ4A 1S8NA 3RPUD 1V55H 3IH4A 5BPDA 4XKVA 2FU4A 4BGDA 1A5JA 3HTHA 5HVQC 2L54A 1VFCA 3CCQI 3MFKA 1A04A 2ZNYA 3F21A 2O3FA 5TISC 3VODA 2CQXA 3BTJA 3C3WA 2E5ZA 1ZG5A 2GWRA 2VOOA 1OCTC 1HW1A 2HKXA 4EJVA 4ZYDA 5H9TA 1IDYA 5LGNA 5JHFA 1D8KA 1SD7A 3J81Z 4HG2A 3IUVA 2K7LA 1XGNA 5GAHJ 3TL4X 3NPIA 5CVUA 2PQ8A 2EFQA 4C2MJ 1O3QA 1XSDA 2CV2A 1BM9A 3DLAA 1Y0UA 3W2VA 2EWNA 1MJ9A 3JREA 3MZYA 4L9VA 4QLCU 1TQIA 5HLHA 2KMUA 3QPHA 4IRIA 1RR7A 1U5TC 4N4OB 3TKYA 3WHBA 3HSEA 1IG7A 4NN1A 3J7YJ 4S05A 2V9VA 1UHMA 3JTHA 4XKCA 4M9SA 3BZCA 5BNGA 2DU9A 3BR0A 4B4CA 3WU0A 5JVGF 3MVPA 2M45A 1S9HA 4B3AA 3FKIJ 1SMTA 4WXDA 1JTYA 4IOCF 2TDXA 3CCLI 1P7JA 2M8GX 4E7LA 1HKTA 2OU2A 1R1TA 1JXSA 2I8DA 5HBUA 3K4BA 1U5TB 2ZKZA 3P9TA 3QWLA 3AG1H 1GVJA 1G3YA 4KJZA 2IRFG 3LSRA 3I59A 3DKXA 3OYEA 2K85A 2COMA 3T5XA 1YS6A 3DXJF 4HOBA 5IOYA 1OYWA 2L9VA 1FIPA 3KEYA 1EH6A 2E36A 1VTNC 1AHDP 1G3SA 2D6YA 2CUJA 1KGSA 4JOMA 2O8KA 3R0AA 1SD4A 3FIWA 3BWGA 5E1ZB 3BROA 3EUKL 3M9AA 5DM6F 3OR2C 2R7SA 1MSEC 4L18B 3GTKJ 1EJ9A 3RZOJ 2BVLA 3G1MA 4CH7A 3G1OA 3V7SA 1U8BA 2DDAA 4BBRJ 4DOZA 2Y0MA 2Y31A 3CJRB 2TRTA 1ZQ3P 5HODA 3MWMA 4ZDLA 1BC7C 3KP7A 1LE8B 2QM3A 4BBSJ 2DQRA 2VPRA 1FY7A 1X2NA 3W6VA 1SD5A 3DEWA 3M4OJ 3I3LA 3DEEA 3MKLA 1XGSA 3ZR8X 3WTWC 3ANPA 3BT9A 1W5SA 1IN8A 3HTIA 1B72B 3IUOA 3KYCB 3X2QH 2QKLB 3ERED 2UXNA 4GXOA 1P4XA 3DTKA 2VXDA 4TV7A 1SANA 4CHUA 3FWEA 2DW4A 2O03A 4HW0A 3ZN1A 1RI7A 1VZ0A 3ZN0A 3PUBA 4BU2A 3S15J 2YX4A 4CGZA 3WE2A 2OZ6A 3FF5A 2W1OA 3VYTB 2FBKA 2KL4A 1E17A 4O6JA 1DUXC 1HW2A 1R58A 1OJLA 2F5EA 3S14J 2Y0SA 2O7TA 5CQEA 5M3MJ 2DFHA 3BTLA 2PMHA 3L9FA 4XLHA 2L9SA 1WHUA 3GXOA 1XB4A 3HOXJ 3LHQA 2DMTA 3T1BA 4GFBA 2ZC2A 4A0YA 4UB8C 4L0ZB 3HGGA 4Z6YA 2JA8J 3OYFA 3BR3A 2DK8A 1W0UA 3VW2A 2DT6A 2IS4A 4BXXJ 1KQ9A 2FNAA 3BG9A 3DBHB 2R7UA 3IV5A 1UFMA 3LQRA 2GQQA 2K86A 2O9LA 3GEZA 4L5EA 1VQLI 2DT5A 2BY3A 1QVTA 3N4MA 2ZO4A 1XS9A 3DBLB 1YFHA 2CU7A 2JA2A 1LDJA 3OR1C 2PEXA 3S5RA 4Y3OA 2DCEA 4DNCA 2YU9J 1V3FA 1IXRC 1LKXA 3SYTA 2XB0X 3F8NA 2MA3A 4EM1A 2QOPA 1OYYA 3K1MA 3VYRB 4N0BA 3NRGA 1UCRA 4MFDA 2QWWA 3KETA 3CP2A 3MAJA 4ZZLA 3TP3A 3BOQA 1ZRCA 3BNIA 4D1QA 4GCKA 2A2FX 1TQMA 4FETA 4E7KA 3VVXA 1WVRA 3VPRA 2ME6A 4BS9A 2Y9ZA 1XGOA 3BZKA 3EUHC 3H5RA 5D8LB 2BGCA 1H89C 2Y0SN 4CO8A 2KZVA 1GV5A 2BY0A 5FLXZ 3I59B 4I98B 2JVGA 2M0MA 3PQKA 4RM3A 4UV9A 1OMIA 2PJRA 2ZOZA 2HYFA 1MNMC 4BHBA 5ILVA 3JRCA 1UG0A 3QU6A 3J7AY 2NOJB 4UVBA 3SDGA 3GVAA 3HOWJ 1YJNI 4A3DJ 4GCLA 5C4JJ 1J9IA 4KIGA 3W3CA 3S3OA 1FTTA 1X1PA 3HB9A 4H4KC 4B3XA 3GFIA 3PPBA 1JGGA 2GENA 2VB6A 2M1BA 3JAMZ 1JGSA 1FIAA 1R36A 4BJ6C 3CESA 3PM1A 1P6RA 2A5WA 1WI3A 4HF2A 4UUTA 1HLVA 2HTJA 2WA0A 3REOA 2DA1A 5EEHA 2F2EA 2GA2A 3DCFA 4C3IJ 4DW6A 3EUPA 1V5EA 4NC6A 4KT5C 4IHVA 3KIOA 1OR7C 5CVRA 1OCZH 2YS9A 1XMKA 1VQ5I 1VQ9I 2Z3YA 1XDSA 2ACJA 2XC7A 3KP6A 3H9QA 3PQJA 4BXUA 3ZPLA 5IT9K 5D19A 2XGXA 4RB2C 4WCGA 4BE2A 2DYRH 1ORKA 1FBSA 4D7NA 3WGGA 2XKPA 4HDVA 3DPUA 4W1UA 2JTVA 1N77A 2AHQA 2OI8A 1HKSA 3TP0A 4AWXB 5BPIA 3M8EA 3ZQLA 5FGMA 3Q0UA 1QRYA 3ZP5A 3K6GA 1J2XA 4ESBA 4YIFA 5M5WJ 2JA5J 5C4XJ 2LKPA 2DDBA 3CUOA 3OIOA 3JRAA 4QIWN 2YR2A 3BP8A 4YRVA 3S3NA 4RAZA 2XGCA 1SMYF 4Y4RA 4KYWA 3AL0C 1X4OA 3BY6A 1U78A 2CWEA 5JLWA 4E7HA 3E5QA 1TT0A 2CYYA 1SC7A 3HSFA 1YJWI 4ENNA 1EKEA 5DS9A 1YW8A 1B4AA 3PIOF 3GUDA 3I0TA 2DBBA 2L7FP 3HEFA 3VSKA 1YQAA 2FX0A 3ZRGA 2CMPA 2MLKA 3HOZJ 1P7IA 3AL0B 3OYIA 5BOXA 3OYMA 2HFHA 3WTZA 3K70C 4KIFA 4XOTA 3ZCOA 1P4WA 2ZJQF 4EATA 4N4NB 1LB2A 2Y48A 3KZYA 2ZOYA 2XRLA 2OC6A 2LD5A 5KCMA 1ETYA 4HV6A 1TLHB 4HSTA 3HPGA 5HS8A 3V78A 2VIXA 1QGPA 2VL8A 5J1YA 3CMEI 1YTYA 1A36A 2QWTA 3J7ZI 3FHNA 2GAUA 5A2QZ 2K9QA 2ESHA 3ZGKA 1BL0A 2KIQA 2E2IJ 1M1EB 4I02A 4E4HA 3V6GA 4IHYA 2E7XA 1HCRA 4A3GJ 3GBGA 5HNHA 4UUSA 1QQIA 4J00A 2MG4A 4LITA 1AKHA 4XLEA 4I2OA 2KT0A 2QCOA 3LWFA 3OMYA 4CYCA 2DMUA 4L9TA 5L3FA 2BXYA 4MK6A 4FE7A 4LOCA 3F8CA 2M5WA 3ERMA 5J47A 4BJ5C 2HTSA 1VQ7I 3HDDA 2JUCA 5K5QA 1BOBA 3HRTA 3IL2A 4KNYA 1X3WB 4RB0A 1K6OA 1DU6A 5D5WB 2EV6A 2L7ZA 4RAYA 3GFJA 4CCKA 1WJ5A 3JR9A 2EV5A 2Y9YA 3MD2A 3KX2A 3ASNH 4XSZF 2MC4A 2LG4A 2DAOA 4PJJA 5D6FA 3OYKA 3DU6A 4M6YA 3V4GA 3I55I 4QPOA 4A0XA 4NHJA 2L4AA 1KYZA 1R5ID 2VQHA 3VOXA 2H09A 3IKTA 4CA0A 3V8JA 3K4MA 2DMQA 1O7FA 2HI3A 3KZIC 4NC7A 1DPUA 4PUSA 5KAIC 1TZLA 1XGMA 2R7RA 2W53A 2K9MA 1P9QC 2QQBA 3L2VA 4EGYA 5F64A 4R1HA 5L3CA 3B02A 1IUFA 1ZREA 4PJ0C 3W6KB 2K4BA 1BW5A 2P4WA 4KWAA 4O5VA 1BOAA 2CRGA 2ZSIB 5B66C 1RESA 3C07A 4FX0A 3WTYC 3NEUA 2EQRA 2K40A 2M7AA 4PJLA 4RGXA 4KISA 2RNJA 5DTDA 2IA0A 2W82A 2K5CA 3K1NA 3M07A 3E97A 3A01A 5J4VA 2BV6A 4J19A 3CCSI 3H36A 3HXLA 4S04A 3QP5A 1YITI 4NUBA 1R7JA 1W5TA 4LIUA 3FDYA 4MQVA 4BXFA 2WV0A 4LG0A 3EETA 4GFKA 3HG9A 3OWTA 1HOMA 4L62A 2P0WA 4Q4ZF 2I5UA 3E6MA 3TO6A 4GO1A 3HTSB 4JL3A 2XROA 2X6OA 4AUXA 2OA4A 2R7ZJ 4Y33A 1WH5A 3VYUB 2MC3A 1KZHA 1HA8A 5IPAA 1S5LC 3Q0WA 4PSXA 1PUFB 3AG2H 5J6XA 3K69A 3SQNA 4AF5A 1BW6A 1ITYA 2JT1A 2BE5F 3C2HA 1Z0XA 2JSPA 2XAUA 1XPXA 1E2XA 4G12A 2J5PA 4I01A 2NS0A 4OOIA 3ON2A 2X6YA 2PZ9A 3DWLE 1YW9A 4ENKA 2Z5UA 1VQ6I 3WU2C 1D0YA 1TWFJ 1G2HA 4GFLA 2JK3A 5CKTA 2R0QC 4UB6C 3MQ0A 2G7SA 4W97A 1ACIA 2WUIA 2IA2A 2EB7A 5L3EA 2GUHA 4JK1X 1GDTA 2Z99A 2LDUA 3TDZC 1K78A 3P5JA 4UUSB 4BUPA 1ETWA 3QPLA 1QZZA 3NNRA 2BOLA 1XCVA 2A6TA 3HHHA 4FE4A 1PJRA 3L2WA 4M3BA 4F93B 3A02A 3WTVC 2KP6A 3ZQ7A 3S1MJ 3L2QA 2WAQA 5DUKA 2CQ7A 1OISA 2X1DA 3AG3H 4WF2A 4E7SA 2CO5A 4AU7A 1P4AA 3LQQA 5F6FA 5FMPA 3QQAA 4YFNF 4BNCA 3DPTA 3FRQA 1PUEE 1TC3C 1V5GA 1U0JA 1QO0D 2RGVA 3OY9A 4IO9F 4ICHA 3J80Z 1OPCA 1RKTA 4MTEA 3H3VK 4HZFA 4RA2A 3ZQGA 1JT0A 2IEKA 1R71A 5FKNA 4R79A 1IF1A 2CGPA 1S3JA 3D5RC 3M3YJ 3FXUA 5F08A 3L09A 3I4NJ 3CCYA 1V4RA 1UG2A 3BPXA 2IGMA 5F1JA 1X3UA 3CF2A 3HPHA 4IHWA 2MH9A 4BH9A 1JUMA 2B9SA 5DYMA 1WJFA 1U6GA 2QZ8A 2RN7A 5HS9A 2NYXA 3OS0A 4HF1A 4D5FA 2L0KA 3H3UA 1MBKA 4XNFA 5AQCA 2NVXJ 2F5VA 3G2BA 1IV8A 1BI2A 2D2WA 1ULYA 2O5RA 3DTEA 4HLXA 5IP7J 3FXLA 2FRHA 2ZCMA 3RKWA 2DA5A 1QZYA 1NG7A 2CW8A 2KIMA 4F3QA 4UXNA 2F48A 4XOPA 1BIBA 3TOBA 4GRIA 4LJZF 3WHCA 1UELB 3IHUA 4OAYA 3NWTA 3JRGA 2C6YA 3FMSA 1FLIA 2V9KA 3SHFA 2O7OA 2LP0A 1TT5B 2WAQN 2VPLA 3VVZA 1O57A 2DFEA 3E7LA 4DBRA 2PFVA 2KLOA 3PNVA 2HPMA 5L3DA 2P5LC 1WI9A 5HLTA 5CVVA 3E5XA 2XDVA 4MHGA 2DN0A 2LFBA 4PCQA 2LNBA 3A01B 2QTQA 1H9GA 4A93J 3ABKH 4OMZA 4IJAA 3DPJA 4EJOA 3WGHA 2HZTA 2VUMJ 2CG4A 1D8JA 3C2GA 3NWSA 3BC8A 4B09A 4XLFA 1B1BA 5D5VB 2EH3A 1W1WE 2ELKA 1K4SA 2D5VA 4MO7A 2YVEA 1RIOH 4XIDA 4RM2A 2OBPA 2ZBKA 4MFEA 1MBHA 1T98A 1FSHA 2DA4A 1R1VA 1UZCA 1MZBA 3A4CA 2E19A 4NC8A 1Y1WJ 2QSHX 5D1RA 3WE3A 2VQGA 3G7RA 2LLKA 4II3A 3IC7A 1VQNI 1EH8A 1T2KA 1FWZA 2TCTA 2VJ4A 4MXMA 1R4NB 3TO7A 3G73A 5ICGA 2QBYA 4CICA 4ZTFA 4PFOA 1EH7A 3T8RA 2GBYA 4CUGA 3PUFA 1RNLA 4YG2F 2K9NA 1PDNC 2DPDA 2LYCA 5K5OA 3F8BA 4AVPA 2PBIA 5FKMA 3BHQA 5B1BH 3I53A 4LK0F 2HYGD 2LH9A 5GAEJ 3H1CA 1WWXA 3NARA 2V6EA 1HKQA 4A3IJ 3U21A 2QQ8A 5EGOB 4WXCA 1UAAA 3V8LA 2ECBA 4OD5A 3KP5A 5LFAA 3HTAA 4L0YB 1JKOC 5FRMA 2LRDA 5J4YA 3JSOA 4IOAF 2BZTA 2ISYA 3BDDA 2M2EA 4XK4A 1HSTA 2NP3A 3CDIA 2DQLA 3KYDB 3KP3A 3NAUA 4IZZA 1GT0C 4DVYP 2IS6A 2R4GA 3QBMA 3GWZA 5J1UA 4BQQA 4A12A 2YVHA 2XAGA 1X1BA 2F4IA 5B3SH 1SAXA 1AU7A 4HX8A 2A5YB 2V26A 1KU2A 4BQOA 3SJMA 3TEDA 3OYGA 3JTGA 2B1EA 3KKDA 1SFKA 2VI6A 2W4SA 5E8IA 3F1BA 2X9DA 1W36C 2DI3A 1O3SA 4XN3A 3MKZA 1JUSA 3VVYA 2VBXA 4M3DA 2HXOA 2HWVA 1XC5A
chains in the Genus database with same CATH topology
1VNDA 2Y9ZA 1H89C 2Y0SN 3LOCA 3GTMJ 1GV5A 3S2HJ 5K7ZA 5C4YA 4M3EA 1JKQC 1BJZA 4HNVA 4MIMA 3A03A 2ZOZA 1MNMC 5DAJA 3MN2A 5GPCA 2OF7A 3HTJA 1IDZA 2M0CA 3GTQJ 3JRCA 4QSHA 1GVDA 4ME9A 4GCTA 1RKWA 5F04A 3GZIA 2FBQA 1HDPA 3SDGA 2Y30A 3LSJA 5GPAA 1I3QJ 1JJ6C 3HOWJ 5EZHA 3S1NJ 3BQZA 4A3DJ 3G56A 3QKXA 4GCLA 5C4JJ 3KNWA 2XPVA 5FKKA 4DZJA 3LWJA 2ID3A 1FTTA 3HB9A 3JRHA 3S2DJ 3BR1A 3PPBA 1JGGA 2DTZA 3IH2A 1IC8A 2GENA 4X6AJ 1FIAA 1MBJA 1EF4A 3T6NA 3PM1A 2NOGA 3JRIA 1UHSA 1WI3A 4XRSG 4UUTA 1HLVA 2DG7A 2DA1A 4RDUA 4JP0A 4A3KJ 4DW6A 3DCFA 4C3IJ 3EUPA 3FISA 3GTJJ 2M34A 1SGMA 3S1QJ 1POGA 4IHVA 5EYRA 3RQIA 5M5XJ 2YS9A 5FJ8J 3HOUJ 2JWTA 3PO2J 2L9RA 3ON4A 2EZKA 3CMYA 4A3FJ 2XGEA 5D19A 4DYRA 5FLVA 1H88C 1OFCX 3EGQA 2HYTA 2UXOA 1K61A 1ORKA 1X58A 3IH3A 4D7NA 1GUUA 4W1UA 3OSGA 4DYQA 5JLXA 3LJLA 2AHQA 2OI8A 3KZ9A 4BY7J 3TP0A 2R5ZA 4MLOA 2DMPA 3SFIA 4DYCA 3ZQLA 2ID6A 1T56A 1QRYA 3Q0UA 3QPSA 1LE8A 2VKVA 5M5WJ 2JA5J 4A3LJ 5C4XJ 2X48A 5C44J 2UXPA 3OIOA 2G0EA 4DZPA 4QIWN 3JRAA 1JKRC 2E2HJ 2HDDA 2XGCA 1B72A 4XRMA 1U78A 5JLWA 3HGYA 3LNQA 5DS9A 1UMQA 2CUFA 1X2MA 3D1NI 1D5YA 2L7FP 1YRNA 3HEFA 2FX0A 4ACIA 4AYBN 3JRFA 1P7IA 2EZIA 3HOZJ 3BG3A 1ENHA 1TWCJ 1ZR2A 2R5YA 2WV1A 2ZOYA 3BR5A 2XRLA 4A3JJ 2LD5A 1ETYA 3V78A 2AO9A 5J1YA 5CXGA 2NVQJ 2QWTA 4I76A 2Q24A 1WGXA 5EGOA 1TWGJ 4FISA 2K9QA 2G7GA 1BL0A 1WCMJ 2E2IJ 2EZHA 5EFYA 2HXIA 5HAWA 3V6GA 4IHYA 3Q3SA 2FQ4A 4Y7NJ 4FTHA 2PMZN 3K7AJ 1HCRA 4AC6A 4BY1J 2DA6A 2K9SA 3GBGA 4A3GJ 5D18A 3S1RJ 2XGDA 4UUSA 1JJ8C 2MG4A 1AKHA 2G7LA 1QVUA 3GTPJ 1HDDC 3CJDA 1ETOA 2KT0A 1Y1VJ 2QCOA 4CYCA 3ZQFA 1NTCA 2DMUA 4AC0A 5EDNA 2PBXA 4MK6A 4C3HJ 1I6HJ 4FE7A 4LOCA 4V2FA 2QIBA 2EZLA 1NK2P 3HDDA 3VP5A 1VI0A 1DU6A 3H0GJ 3I4MJ 2L7ZA 2REKA 2VKEA 5GP9A 3GEUA 1ZR4A 3GTGJ 1ZGWA 2WB1N 3JR9A 3G1LA 1FJLA 2Y9YA 4M3GA 1ETQA 1Q1VA 4QTRA 3UKGA 3PO3J 1K83J 1XG1A 5E3LA 3L1PA 4JYKA 2YUSA 2ECCA 1T33A 1MH3A 4I6ZA 5IYCJ 4PXIA 1ETXA 3JRDA 5CW8A 4BKXA 2DJNA 2B63J 3O60A 1RPWA 3VOXA 4M3FA 3RH2A 1MBEA 5E3MA 1NK3P 2G3BA 2DMQA 2HI3A 4NDLA 4S0HB 3ZQCA 2IU5A 1TWHJ 5IYBJ 1ETVA 2NVTJ 4M6VA 3B6CA 2W53A 4CGRA 3RZDJ 4YZEA 1A6IA 1IUFA 2R92J 3S16J 5F0HA 1UI5A 5IP6A 5IP9J 1BW5A 4HKUA 4KWAA 1U9NA 3HKZN 2CRGA 1F43A 2F07A 4JNNA 2NX4A 1RESA 3C07A 5EG0A 2E1OA 3OSFA 2ME6A 5EF6A 2EQRA 2IAIA 2RASA 1DU0A 1FTZA 2K40A 4JX5A 2R5ZB 2P81A 3HOYJ 2NP5A 2ME0A 5K7HA 3B81A 5DTDA 3F0CA 3BQYA 3VOKA 5E3OA 3A01A 1B8IB 4J19A 2JA6J 4A3BJ 3CRJA 2DA7A 1ZTRA 3VIBA 4NELA 2XPWA 3AQSA 4GFKA 3NI7A 1JTXA 4C3JJ 3CWRA 1HOMA 4L62A 2NVYJ 3BJBA 2ZCNA 1WPKA 4JL3A 4A69C 2X6OA 4AUXA 4Y52J 3COLA 4JX4A 2R7ZJ 1JT6A 3VW0A 1WH5A 1IGNA 1YRNB 2L7MP 3BTIA 5IPAA 3Q0WA 1PUFB 1QPIA 5C3EJ 5IOZA 2V57A 2UXIA 4AF5A 2MGQA 1BW6A 1ITYA 2R5YB 4D7MA 1Z0XA 1ETKA 3TW7A 2DG8A 3PASA 4G12A 3ON2A 9ANTA 2PZ9A 5K58A 1Z77A 3S17J 1GV2A 1UI6A 1TWFJ 2Y2ZA 1G2HA 4GFLA 3IH4A 2JK3A 3HTHA 1A5JA 3C2BA 4XRSA 1ZK8A 2CUEA 2R0QC 1VFCA 1IJWC 2G7SA 1VF9A 4W97A 2WUIA 3KKCA 1W0TA 2GUHA 4JX6A 4V2GA 1GDTA 2HQ5A 1BA5A 2CQXA 3BTJA 1HF0A 1OCTC 3BR2A 4UUSB 2HKUA 2I10A 1ETWA 2LY9A 3QPLA 5J1RA 1R9TJ 3NNRA 5H9TA 1IDYA 2LR8A 4FE4A 1MSFC 4M3BA 3BRUA 3A02A 3AQTA 2R93J 3IUVA 1RETA 3LSGA 2HOTA 3S1MJ 3ZOBA 3NPIA 1CQTA 5E3NA 2COBA 1OCPA 4C2MJ 1JKPC 5FMPA 2MW8A 1I50J 3QQAA 1MH4A 2LK2A 5M5YJ 3FRQA 1TC3C 3JREA 2RAEA 2NS7A 2GFNA 2FJ1A 2ZB9A 5M3FJ 3VW1A 4ICHA 3CDLA 1RKTA 1O4XA 1MBFA 1RR7A 2DA2A 3WHBA 1IG7A 3H3VK 4NN1A 1JT0A 3ZQGA 2IEKA 2IBDA 3FK7A 2HYJA 5FKNA 3M3YJ 4X1EA 3HIMA 2UXHA 5BNGA 5F08A 2DMNA 3I4NJ 3BR0A 3CCYA 4B4CA 1E3OC 3MVPA 1SFOJ 1IV6A 1UG2A 3FKIJ 4B3AA 5F1JA 4IHWA 1JTYA 1LFUP 2XSDC 2LVSA 1JUMA 1P7JA 2M8GX 3HM5A 5HBUA 3P9TA 4D5FA 2L0KA 3LSRA 2EBIA 3LSPA 1MBKA 5AQCA 2NVXJ 5F0CA 4XICA 2HOAA 3K2AA 3Q0VA 3MNLA 5IOYA 5IP7J 2LKXA 1ZKGA 1FIPA 2ZCMA 2DA5A 2N8GA 2NS8A 1AHDP 4D5CA 2D6YA 2O8KA 4UDSA 3WHCA 3FIWA 3ZQIA 1JUPA 3HOVJ 5EG0B 3JRGA 3NXCA 1MSEC 3GTKJ 3RKQA 3HBLA 2O7OA 5FLMJ 2JN6A 3G1MA 3RZOJ 2LP0A 2WAQN 3G1OA 3VVZA 2KDZA 3E7LA 3BR6A 1U8BA 2DA3A 5F0FA 4BBRJ 1H8AC 2Y31A 2H8RA 3BG5A 2TRTA 1ZQ3P 5F27A 2DN0A 2LFBA 3A01B 2GLOA 5HODA 2QTQA 4A93J 2CQQA 4RBOA 1LE8B 3ANGA 3HE0A 4BBSJ 2OERA 3DPJA 2VPRA 2VUMJ 1X2NA 5J3LA 4A3MJ 3W6VA 3DEWA 3M4OJ 3ZQHA 3MKLA 2GM4A 5FGLA 2EH3A 2ELKA 3ANPA 3BT9A 4MO7A 2D5VA 3GTOJ 2YVEA 4XIDA 3FK6A 3HTIA 3BCGA 2JJ7A 4MFEA 1MBHA 1B72B 2DA4A 3B6AA 2H1KA 2E19A 1Y1WJ 5D1RA 5K7FA 2XB5A 5EZGA 3G7RA 1TWAJ 2LLKA 1S7EA 1SANA 2TCTA 4MXMA 3CQZJ 1APLC 5HSZA 3S15J 3VUQA 2JA7J 2WGBA 2GBYA 4B1RA 2K9NA 1LFBA 1OJLA 3S14J 5FKMA 4ABZA 1B8IA 2O7TA 5M3MJ 2UXUA 1MBGA 3BHQA 2FD5A 2LTPA 3BTLA 2E2JJ 3HOXJ 3NARA 3LHQA 2DMTA 2M9HA 4GFBA 4A3IJ 5EGOB 2ECBA 3HGGA 4FCYA 3OOUA 2JA8J 5FHPA 3HTAA 3BR3A 5EEAA 1W0UA 3VW2A 1JKOC 4BXXJ 3BG9A 4A3CJ 2M2EA 4XK4A 3IV5A 1PUFA 1AKHB 2NP3A 3JRBA 5IYDJ 3JSJA 1WH7A 2O9LA 2OPTA 4IEJA 3NAUA 1GT0C 2XPUA 4L5EA 1QVTA 4CYCB 5FKLA 1XS9A 3QBMA 2MSYA 2CJJA 3O8GA 5J1UA 3GTLJ 2W48A 3O8HA 2CU7A 2RHAA 2YVHA 4A3EJ 1AU7A 3S5RA 3TW6A 2YU9J 2QKOA 5CXIA 1U9OA 2XB0X 3SJMA 3TEDA 4EEFG 1IRZA 2QOPA 3KKDA 3NRGA 4MFDA 3E7QA 3RD3A 2VI6A 2ZCXA 3F1BA 2X9DA 5FKOA 2JMWA 3TP3A 1F36A 2XDNA 4JKZA 2HOSA 1JUSA 4IHXA 3BNIA 3VVYA 4GCKA 4M3DA 3BTCA 2QF7A 3VVXA 2HXOA 1FEXA 3VPRA 1XC5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VND A;  2Y9Z A;  1H89 C;  2Y0S N;  3LOC A;  3GTM J;  1GV5 A;  3S2H J;  5K7Z A;  5C4Y A;  4M3E A;  1JKQ C;  1BJZ A;  4HNV A;  4MIM A;  3A03 A;  2ZOZ A;  1MNM C;  5DAJ A;  3MN2 A;  5GPC A;  2OF7 A;  3HTJ A;  1IDZ A;  2M0C A;  3GTQ J;  3JRC A;  4QSH A;  1GVD A;  4ME9 A;  4GCT A;  1RKW A;  5F04 A;  3GZI A;  2FBQ A;  1HDP A;  3SDG A;  2Y30 A;  3LSJ A;  5GPA A;  1I3Q J;  1JJ6 C;  3HOW J;  5EZH A;  3S1N J;  3BQZ A;  4A3D J;  3G56 A;  3QKX A;  4GCL A;  5C4J J;  3KNW A;  2XPV A;  5FKK A;  4DZJ A;  3LWJ A;  2ID3 A;  1FTT A;  3HB9 A;  3JRH A;  3S2D J;  3BR1 A;  3PPB A;  1JGG A;  2DTZ A;  3IH2 A;  1IC8 A;  2GEN A;  4X6A J;  1FIA A;  1MBJ A;  1EF4 A;  3T6N A;  3PM1 A;  2NOG A;  3JRI A;  1UHS A;  1WI3 A;  4XRS G;  4UUT A;  1HLV A;  2DG7 A;  2DA1 A;  4RDU A;  4JP0 A;  4A3K J;  4DW6 A;  3DCF A;  4C3I J;  3EUP A;  3FIS A;  3GTJ J;  2M34 A;  1SGM A;  3S1Q J;  1POG A;  4IHV A;  5EYR A;  3RQI A;  5M5X J;  2YS9 A;  5FJ8 J;  3HOU J;  2JWT A;  3PO2 J;  2L9R A;  3ON4 A;  2EZK A;  3CMY A;  4A3F J;  2XGE A;  5D19 A;  4DYR A;  5FLV A;  1H88 C;  1OFC X;  3EGQ A;  2HYT A;  2UXO A;  1K61 A;  1ORK A;  1X58 A;  3IH3 A;  4D7N A;  1GUU A;  4W1U A;  3OSG A;  4DYQ A;  5JLX A;  3LJL A;  2AHQ A;  2OI8 A;  3KZ9 A;  4BY7 J;  3TP0 A;  2R5Z A;  4MLO A;  2DMP A;  3SFI A;  4DYC A;  3ZQL A;  2ID6 A;  1T56 A;  1QRY A;  3Q0U A;  3QPS A;  1LE8 A;  2VKV A;  5M5W J;  2JA5 J;  4A3L J;  5C4X J;  2X48 A;  5C44 J;  2UXP A;  3OIO A;  2G0E A;  4DZP A;  4QIW N;  3JRA A;  1JKR C;  2E2H J;  2HDD A;  2XGC A;  1B72 A;  4XRM A;  1U78 A;  5JLW A;  3HGY A;  3LNQ A;  5DS9 A;  1UMQ A;  2CUF A;  1X2M A;  3D1N I;  1D5Y A;  2L7F P;  1YRN A;  3HEF A;  2FX0 A;  4ACI A;  4AYB N;  3JRF A;  1P7I A;  2EZI A;  3HOZ J;  3BG3 A;  1ENH A;  1TWC J;  1ZR2 A;  2R5Y A;  2WV1 A;  2ZOY A;  3BR5 A;  2XRL A;  4A3J J;  2LD5 A;  1ETY A;  3V78 A;  2AO9 A;  5J1Y A;  5CXG A;  2NVQ J;  2QWT A;  4I76 A;  2Q24 A;  1WGX A;  5EGO A;  1TWG J;  4FIS A;  2K9Q A;  2G7G A;  1BL0 A;  1WCM J;  2E2I J;  2EZH A;  5EFY A;  2HXI A;  5HAW A;  3V6G A;  4IHY A;  3Q3S A;  2FQ4 A;  4Y7N J;  4FTH A;  2PMZ N;  3K7A J;  1HCR A;  4AC6 A;  4BY1 J;  2DA6 A;  2K9S A;  3GBG A;  4A3G J;  5D18 A;  3S1R J;  2XGD A;  4UUS A;  1JJ8 C;  2MG4 A;  1AKH A;  2G7L A;  1QVU A;  3GTP J;  1HDD C;  3CJD A;  1ETO A;  2KT0 A;  1Y1V J;  2QCO A;  4CYC A;  3ZQF A;  1NTC A;  2DMU A;  4AC0 A;  5EDN A;  2PBX A;  4MK6 A;  4C3H J;  1I6H J;  4FE7 A;  4LOC A;  4V2F A;  2QIB A;  2EZL A;  1NK2 P;  3HDD A;  3VP5 A;  1VI0 A;  1DU6 A;  3H0G J;  3I4M J;  2L7Z A;  2REK A;  2VKE A;  5GP9 A;  3GEU A;  1ZR4 A;  3GTG J;  1ZGW A;  2WB1 N;  3JR9 A;  3G1L A;  1FJL A;  2Y9Y A;  4M3G A;  1ETQ A;  1Q1V A;  4QTR A;  3UKG A;  3PO3 J;  1K83 J;  1XG1 A;  5E3L A;  3L1P A;  4JYK A;  2YUS A;  2ECC A;  1T33 A;  1MH3 A;  4I6Z A;  5IYC J;  4PXI A;  1ETX A;  3JRD A;  5CW8 A;  4BKX A;  2DJN A;  2B63 J;  3O60 A;  1RPW A;  3VOX A;  4M3F A;  3RH2 A;  1MBE A;  5E3M A;  1NK3 P;  2G3B A;  2DMQ A;  2HI3 A;  4NDL A;  4S0H B;  3ZQC A;  2IU5 A;  1TWH J;  5IYB J;  1ETV A;  2NVT J;  4M6V A;  3B6C A;  2W53 A;  4CGR A;  3RZD J;  4YZE A;  1A6I A;  1IUF A;  2R92 J;  3S16 J;  5F0H A;  1UI5 A;  5IP6 A;  5IP9 J;  1BW5 A;  4HKU A;  4KWA A;  1U9N A;  3HKZ N;  2CRG A;  1F43 A;  2F07 A;  4JNN A;  2NX4 A;  1RES A;  3C07 A;  5EG0 A;  2E1O A;  3OSF A;  2ME6 A;  5EF6 A;  2EQR A;  2IAI A;  2RAS A;  1DU0 A;  1FTZ A;  2K40 A;  4JX5 A;  2R5Z B;  2P81 A;  3HOY J;  2NP5 A;  2ME0 A;  5K7H A;  3B81 A;  5DTD A;  3F0C A;  3BQY A;  3VOK A;  5E3O A;  3A01 A;  1B8I B;  4J19 A;  2JA6 J;  4A3B J;  3CRJ A;  2DA7 A;  1ZTR A;  3VIB A;  4NEL A;  2XPW A;  3AQS A;  4GFK A;  3NI7 A;  1JTX A;  4C3J J;  3CWR A;  1HOM A;  4L62 A;  2NVY J;  3BJB A;  2ZCN A;  1WPK A;  4JL3 A;  4A69 C;  2X6O A;  4AUX A;  4Y52 J;  3COL A;  4JX4 A;  2R7Z J;  1JT6 A;  3VW0 A;  1WH5 A;  1IGN A;  1YRN B;  2L7M P;  3BTI A;  5IPA A;  3Q0W A;  1PUF B;  1QPI A;  5C3E J;  5IOZ A;  2V57 A;  2UXI A;  4AF5 A;  2MGQ A;  1BW6 A;  1ITY A;  2R5Y B;  4D7M A;  1Z0X A;  1ETK A;  3TW7 A;  2DG8 A;  3PAS A;  4G12 A;  3ON2 A;  9ANT A;  2PZ9 A;  5K58 A;  1Z77 A;  3S17 J;  1GV2 A;  1UI6 A;  1TWF J;  2Y2Z A;  1G2H A;  4GFL A;  3IH4 A;  2JK3 A;  3HTH A;  1A5J A;  3C2B A;  4XRS A;  1ZK8 A;  2CUE A;  2R0Q C;  1VFC A;  1IJW C;  2G7S A;  1VF9 A;  4W97 A;  2WUI A;  3KKC A;  1W0T A;  2GUH A;  4JX6 A;  4V2G A;  1GDT A;  2HQ5 A;  1BA5 A;  2CQX A;  3BTJ A;  1HF0 A;  1OCT C;  3BR2 A;  4UUS B;  2HKU A;  2I10 A;  1ETW A;  2LY9 A;  3QPL A;  5J1R A;  1R9T J;  3NNR A;  5H9T A;  1IDY A;  2LR8 A;  4FE4 A;  1MSF C;  4M3B A;  3BRU A;  3A02 A;  3AQT A;  2R93 J;  3IUV A;  1RET A;  3LSG A;  2HOT A;  3S1M J;  3ZOB A;  3NPI A;  1CQT A;  5E3N A;  2COB A;  1OCP A;  4C2M J;  1JKP C;  5FMP A;  2MW8 A;  1I50 J;  3QQA A;  1MH4 A;  2LK2 A;  5M5Y J;  3FRQ A;  1TC3 C;  3JRE A;  2RAE A;  2NS7 A;  2GFN A;  2FJ1 A;  2ZB9 A;  5M3F J;  3VW1 A;  4ICH A;  3CDL A;  1RKT A;  1O4X A;  1MBF A;  1RR7 A;  2DA2 A;  3WHB A;  1IG7 A;  3H3V K;  4NN1 A;  1JT0 A;  3ZQG A;  2IEK A;  2IBD A;  3FK7 A;  2HYJ A;  5FKN A;  3M3Y J;  4X1E A;  3HIM A;  2UXH A;  5BNG A;  5F08 A;  2DMN A;  3I4N J;  3BR0 A;  3CCY A;  4B4C A;  1E3O C;  3MVP A;  1SFO J;  1IV6 A;  1UG2 A;  3FKI J;  4B3A A;  5F1J A;  4IHW A;  1JTY A;  1LFU P;  2XSD C;  2LVS A;  1JUM A;  1P7J A;  2M8G X;  3HM5 A;  5HBU A;  3P9T A;  4D5F A;  2L0K A;  3LSR A;  2EBI A;  3LSP A;  1MBK A;  5AQC A;  2NVX J;  5F0C A;  4XIC A;  2HOA A;  3K2A A;  3Q0V A;  3MNL A;  5IOY A;  5IP7 J;  2LKX A;  1ZKG A;  1FIP A;  2ZCM A;  2DA5 A;  2N8G A;  2NS8 A;  1AHD P;  4D5C A;  2D6Y A;  2O8K A;  4UDS A;  3WHC A;  3FIW A;  3ZQI A;  1JUP A;  3HOV J;  5EG0 B;  3JRG A;  3NXC A;  1MSE C;  3GTK J;  3RKQ A;  3HBL A;  2O7O A;  5FLM J;  2JN6 A;  3G1M A;  3RZO J;  2LP0 A;  2WAQ N;  3G1O A;  3VVZ A;  2KDZ A;  3E7L A;  3BR6 A;  1U8B A;  2DA3 A;  5F0F A;  4BBR J;  1H8A C;  2Y31 A;  2H8R A;  3BG5 A;  2TRT A;  1ZQ3 P;  5F27 A;  2DN0 A;  2LFB A;  3A01 B;  2GLO A;  5HOD A;  2QTQ A;  4A93 J;  2CQQ A;  4RBO A;  1LE8 B;  3ANG A;  3HE0 A;  4BBS J;  2OER A;  3DPJ A;  2VPR A;  2VUM J;  1X2N A;  5J3L A;  4A3M J;  3W6V A;  3DEW A;  3M4O J;  3ZQH A;  3MKL A;  2GM4 A;  5FGL A;  2EH3 A;  2ELK A;  3ANP A;  3BT9 A;  4MO7 A;  2D5V A;  3GTO J;  2YVE A;  4XID A;  3FK6 A;  3HTI A;  3BCG A;  2JJ7 A;  4MFE A;  1MBH A;  1B72 B;  2DA4 A;  3B6A A;  2H1K A;  2E19 A;  1Y1W J;  5D1R A;  5K7F A;  2XB5 A;  5EZG A;  3G7R A;  1TWA J;  2LLK A;  1S7E A;  1SAN A;  2TCT A;  4MXM A;  3CQZ J;  1APL C;  5HSZ A;  3S15 J;  3VUQ A;  2JA7 J;  2WGB A;  2GBY A;  4B1R A;  2K9N A;  1LFB A;  1OJL A;  3S14 J;  5FKM A;  4ABZ A;  1B8I A;  2O7T A;  5M3M J;  2UXU A;  1MBG A;  3BHQ A;  2FD5 A;  2LTP A;  3BTL A;  2E2J J;  3HOX J;  3NAR A;  3LHQ A;  2DMT A;  2M9H A;  4GFB A;  4A3I J;  5EGO B;  2ECB A;  3HGG A;  4FCY A;  3OOU A;  2JA8 J;  5FHP A;  3HTA A;  3BR3 A;  5EEA A;  1W0U A;  3VW2 A;  1JKO C;  4BXX J;  3BG9 A;  4A3C J;  2M2E A;  4XK4 A;  3IV5 A;  1PUF A;  1AKH B;  2NP3 A;  3JRB A;  5IYD J;  3JSJ A;  1WH7 A;  2O9L A;  2OPT A;  4IEJ A;  3NAU A;  1GT0 C;  2XPU A;  4L5E A;  1QVT A;  4CYC B;  5FKL A;  1XS9 A;  3QBM A;  2MSY A;  2CJJ A;  3O8G A;  5J1U A;  3GTL J;  2W48 A;  3O8H A;  2CU7 A;  2RHA A;  2YVH A;  4A3E J;  1AU7 A;  3S5R A;  3TW6 A;  2YU9 J;  2QKO A;  5CXI A;  1U9O A;  2XB0 X;  3SJM A;  3TED A;  4EEF G;  1IRZ A;  2QOP A;  3KKD A;  3NRG A;  4MFD A;  3E7Q A;  3RD3 A;  2VI6 A;  2ZCX A;  3F1B A;  2X9D A;  5FKO A;  2JMW A;  3TP3 A;  1F36 A;  2XDN A;  4JKZ A;  2HOS A;  1JUS A;  4IHX A;  3BNI A;  3VVY A;  4GCK A;  4M3D A;  3BTC A;  2QF7 A;  3VVX A;  2HXO A;  1FEX A;  3VPR A;  1XC5 A; 
#chains in the Genus database with same CATH topology
 1HQC A;  3TDU C;  4NBQ A;  1V5F A;  3RPU A;  3OYL A;  3VTI A;  4GDF A;  4B47 A;  5K7Z A;  4MIM A;  3A03 A;  5AIQ A;  4WX9 A;  3K1P A;  5KK1 A;  1IDZ A;  2F4M B;  3OYA A;  3CUQ A;  1D0X A;  1GVD A;  2DYS H;  1RKW A;  5F04 A;  2P7C B;  5EEG A;  4XR6 A;  3HSR A;  5GPA A;  1I3Q J;  5E79 C;  5HLG A;  5EZH A;  2E1C A;  3ONQ A;  1D1B A;  3G56 A;  1BBY A;  2D45 A;  4WK8 F;  2LOO A;  2HKO A;  5FKK A;  1YOV B;  4HQE A;  3GF2 A;  3S2D J;  2QA4 I;  2DTZ A;  3KYL A;  2DOD A;  2Q2E A;  1B9N A;  2BY2 A;  4XKB A;  1ON2 A;  2LKS A;  1UHS A;  4Y17 A;  5H20 A;  4GYI A;  2DG7 A;  2HDW A;  4I99 C;  2R7T A;  2HNH A;  5DDG A;  2WY8 Q;  4EGZ A;  4EM2 A;  2E35 A;  2M34 A;  1SGM A;  1NG6 A;  2VQL A;  2VXZ A;  1Z7L A;  4AYB A;  1VQ4 I;  5EYR A;  5M5X J;  1Z3Y A;  2FOK A;  4QPQ A;  1WQ2 A;  3LST A;  5FJ8 J;  3HOU J;  4Y13 A;  1TBX A;  4UNO A;  2L9R A;  1Z6R A;  2EZK A;  1MDM B;  4XMY A;  2O8X A;  2XVC A;  2W25 A;  3CMY A;  4ZDO A;  2XAQ A;  4BYY A;  1A31 A;  2IJL A;  1T08 B;  2IXS A;  5FLV A;  4E7J A;  1OFC X;  4A0Z A;  2HYT A;  3CF5 F;  3IH3 A;  4IVN A;  2BYV E;  3L2C A;  5E20 A;  1GUU A;  3ESW B;  3HC7 A;  2PMZ A;  2WY7 Q;  4A6E A;  5JLX A;  1FMV A;  4DYQ A;  3LJL A;  4EMS A;  2HDC A;  1X19 A;  3DPL C;  3VFZ A;  1FC3 A;  2DMP A;  4KT6 A;  3HL2 A;  1XTA A;  2R5Z A;  1SVL A;  3N97 A;  2K3P A;  1CF7 A;  2ID6 A;  1T56 A;  4A3L J;  3QPS A;  4M73 A;  4C2M A;  3V7R A;  5C44 J;  2IS2 A;  2UXP A;  4HF0 A;  2G0E A;  2D1V A;  4BQN A;  5ED4 A;  1FOW A;  1IXS B;  1EV7 A;  4U7D A;  1MMS A;  1G3W A;  2A6H F;  1NH3 A;  1ZYR F;  3LSK A;  4KIT B;  2CH0 A;  1VQK I;  4LFU A;  3CJN A;  3KCC A;  2QKM B;  2VT3 A;  3HGY A;  5FRO A;  4M9X A;  5JHU A;  3LNQ A;  1LPQ A;  1K7A A;  4MEX F;  4G7H F;  3V8K A;  2XAH A;  1LDD A;  4C9Y A;  2CUF A;  3N05 A;  5KAF C;  3D1N I;  1D5Y A;  3E6B A;  3HJE A;  1YRN A;  1FYL A;  4LGW A;  4IHT A;  3MZH A;  1G6N A;  2W7N A;  1VQM I;  4AYB N;  3JRF A;  2K3F A;  2EZI A;  3BPV A;  5E1X A;  3K70 D;  2UZK A;  3WU1 B;  2LY2 A;  2XF5 A;  4BHC A;  3SEQ A;  3MKW B;  3K8P C;  3GZN B;  4AIH A;  3M8J A;  5KHD A;  5ERI A;  2HQA A;  4U87 A;  1XMA A;  4ZZD A;  2ETH A;  4A3J J;  5KNL A;  4RLQ A;  2R7V A;  2PLY A;  1Q1H A;  1R5H A;  2QQ9 A;  1ON1 A;  1OKR A;  1JHF A;  2NVQ J;  2OJE D;  2Q24 A;  1WGX A;  2O0Y A;  1TWG J;  4FIS A;  1WCM J;  2ADU A;  3H5N A;  2EZH A;  4CCL A;  5HAW A;  1LUJ B;  3JCU C;  3OYC A;  5GAD J;  5LRS A;  2PMZ N;  2R7D A;  4G6T B;  4IQ4 A;  3T8T A;  4AC6 A;  1MKM A;  2K9S A;  4HDU A;  3IKV A;  2IW5 A;  2OTL I;  1IXC A;  2G7L A;  1YO5 C;  1UST A;  2CV0 A;  2STT A;  2OCE A;  4OIN F;  1QVU A;  3GTP J;  3CDH A;  2FMY A;  1G59 A;  1HDD C;  1Y1V J;  4OD4 A;  3TO9 A;  2GOX B;  3S93 A;  4LLN A;  4P1W A;  2PBX A;  3CUQ B;  3HIF A;  1W5C C;  3E6D A;  5DD8 A;  4U0W A;  3BCA A;  3I54 A;  3K10 A;  3RTR A;  2OD5 A;  3I4M J;  4CZC A;  2VKE A;  5GP9 A;  2EIM H;  4U7B A;  4XOR A;  3KE2 A;  1Q1V A;  2WC2 A;  2M7B A;  3OYH A;  1K83 J;  4JYK A;  2YUS A;  2ECC A;  1Z7U A;  3P9C A;  4B8X A;  3CCU I;  4PXI A;  1IO2 A;  1X4P A;  3LFU A;  5FFZ A;  2DT7 B;  2VJI A;  2B63 J;  1YG2 A;  3CTA A;  2VKH A;  1R49 A;  1RPW A;  3D0S A;  3RH2 A;  1MBE A;  2ICW G;  2G3B A;  2PN6 A;  2ZXI A;  1IRF A;  1ETV A;  1I39 A;  1T0F C;  2V1N A;  2R7O A;  5TJJ A;  5IY5 H;  2ZJP F;  1U8R A;  5D6E A;  4ZDP A;  1I3A A;  1TL8 A;  2F5F A;  3KZZ A;  2JRT A;  1SFU A;  4IXA A;  2X4H A;  5CYV A;  1DGR M;  3RZD J;  2XKO A;  1E3P A;  3F72 A;  3WTT C;  1J75 A;  3S16 J;  3CCR I;  5BQT A;  5L3G A;  2JZY A;  5LHI A;  2KIU A;  3F6V A;  4BDY A;  4DGW B;  1IAW A;  1U9N A;  4I0B A;  1QA6 A;  4G7O F;  1F43 A;  1YI2 I;  2NX4 A;  5D4S A;  1BR2 A;  5EG0 A;  2IAI A;  2KRC A;  2R5Z B;  1WJB A;  2BVM A;  2NP5 A;  4K2E A;  3F23 A;  4BEH A;  1D1C A;  4A3B J;  2ZME A;  3EQL F;  4Z2Y A;  3CRJ A;  4LD5 A;  5HS7 A;  2F5C A;  4KN4 X;  3S8P A;  4ENM A;  2RQP A;  2LC2 A;  4HQM A;  4OIQ F;  2MYS A;  4C3J J;  3OYB A;  3A2K A;  3L7W A;  3ZXS A;  2L5Q A;  4L9J A;  4YEJ A;  3ABU A;  1WPK A;  2EIK H;  2YPR A;  5FD5 A;  4Y52 J;  3F8M A;  3FMR A;  4CYD A;  4IQJ A;  1IGN A;  3ML6 A;  1YRN B;  2STW A;  2LBF A;  4GGG A;  1WJD A;  2X6X A;  1QPI A;  4AM3 A;  3P9I A;  3CCV I;  1IRG A;  4G94 A;  2UXI A;  2MGQ A;  3PNY A;  1MMN A;  1FP2 A;  3W6J B;  2G7H A;  3TW7 A;  2WBM A;  3SZP A;  1WZ2 A;  3DU5 A;  1IN7 A;  1MW7 A;  9ANT A;  3DFG A;  4PZJ A;  3OL3 A;  5CPR B;  1Z77 A;  3JW4 A;  3ABM H;  1GV2 A;  1J09 A;  3ROU A;  2Y2Z A;  4EVI A;  1YIJ I;  1XSX A;  4XRS A;  1R5G A;  3DF8 A;  1ZK8 A;  2CUE A;  2QSF X;  2F5D A;  1IJW C;  4V19 K;  1XSV A;  3FXQ A;  4E70 A;  2EIJ H;  1VF9 A;  4P5O A;  1ZG1 A;  4C30 A;  3QOE A;  2R7Q A;  4JX6 A;  1T38 A;  3HUG A;  4V2G A;  2KIS A;  2KJC A;  3U2R A;  3BR2 A;  1I27 A;  2FBH A;  2I10 A;  2LY9 A;  5J1R A;  2JPB A;  4QWQ A;  3RIR A;  4KDP A;  3O3K A;  2YU3 A;  1G4D A;  2VOP A;  1TTY A;  4ZYA A;  2FF4 A;  3FM3 A;  3F6O A;  2W24 A;  3WOD F;  2PJR B;  2COB A;  3LA2 A;  1JKP C;  2DOF A;  2MW8 A;  5B1A H;  4WWC A;  5E1W A;  2LK2 A;  2EFP A;  3ECH A;  2FJI 1;  3OIQ A;  4CXF A;  1O3T A;  1ZRF A;  2NS7 A;  2VC0 A;  2GFN A;  5M3F J;  5E8G A;  1MBF A;  3R0J A;  4UVA A;  1W7P D;  4YII A;  1SVM A;  3B73 A;  2UXH A;  2DMN A;  3CCM I;  4M9Z A;  3Q9S A;  1E3O C;  2CV1 A;  1Z1D A;  4GYG A;  3FZV A;  1SFO J;  1R6R A;  4WIB A;  1BIA A;  4RGS A;  2K02 A;  2J5O A;  3WG9 A;  1LFU P;  3OS1 A;  2L7K A;  3TBI A;  2BHY A;  2XSD C;  4IRV A;  1SAU A;  3I71 A;  2OUM A;  1F5T A;  3R60 A;  2EBI A;  3UR3 C;  3I64 A;  5H6Q A;  4HA8 A;  4XIC A;  3K2A A;  3Q0V A;  2KQR A;  1GXP A;  1LDK B;  3SZT A;  1OLT A;  4KIC A;  1Z3X A;  1ZN2 A;  3IP4 B;  3J81 K;  3JSP A;  3ABL H;  1FSE A;  3KLN A;  4XLP F;  3BCB A;  4UDS A;  3ZQI A;  1JUP A;  2XAF A;  2K4J A;  3RQ4 A;  2KFD A;  5EG0 B;  2QYO A;  3NXC A;  2BW3 A;  4OAZ A;  2VE8 A;  5FLM J;  3VEP A;  2XUB A;  1H9T A;  1H8A C;  2DA3 A;  2OAZ A;  5F0F A;  5BMZ A;  2XRN A;  2DJI A;  3HRM A;  2H8R A;  4BEH B;  2HVR A;  2WAE A;  1DP7 P;  2GLO A;  2V9P A;  5ILU A;  3QRF F;  2CQQ A;  2ZME B;  1QZE A;  3ANG A;  3HE0 A;  3W2W A;  4C2T A;  2FE3 A;  2FXA A;  4E6K G;  3WGI A;  2Z9O A;  2V7F A;  3MZ8 A;  3CD6 I;  2FQ3 A;  2VN2 A;  4G6D A;  2GM4 A;  3IAS 2;  1E0E A;  3K4N A;  3GTO J;  3BCG A;  4EJU A;  2H1K A;  2VKD A;  1MD0 A;  1Z05 A;  4FX4 A;  1T8I A;  2XB5 A;  2DLL A;  1W4M A;  2ESN A;  3D5S C;  3F3X A;  1S7E A;  2DOA A;  2LBF B;  4BHP A;  1APL C;  1ODD A;  2AS5 F;  3VUQ A;  2A69 F;  4U9N A;  1JE8 A;  1HW5 A;  2DTR A;  2OCC H;  3PJR A;  1OQY A;  1ZH5 A;  4B1R A;  3FXJ A;  3GZ5 A;  3PL8 A;  2R3S A;  1ZAR A;  1LFB A;  4ABZ A;  1B8I A;  4LIV A;  1MBG A;  3DLL F;  2LTP A;  3BLY A;  1CGP A;  2HZD A;  1RC9 A;  4P9U A;  3SXY A;  1TW3 A;  2LMD A;  3COA C;  4CCM A;  2VC1 A;  3HUG B;  1WSU A;  3GLL A;  3SZG A;  4FCY A;  3OOU A;  1WKM A;  2MD0 A;  2HEO A;  4JBA A;  5EEA A;  4RS8 A;  1LQ1 A;  2H27 A;  3I56 I;  1J7K A;  3K4C A;  3K0L A;  4A3C J;  1S6L A;  1AKH B;  3JRB A;  1WH7 A;  1FOK A;  2OPT A;  4IEJ A;  4RAG A;  2GXG A;  3V7C A;  4CYC B;  2EK5 A;  5FKL A;  4A2U A;  2MSY A;  3O8G A;  2BBY A;  1KU3 A;  2VJ5 A;  1YE9 A;  2W48 A;  3I5U A;  3PSF A;  4LK1 F;  3O8H A;  3ZQQ A;  2RHA A;  1TQP A;  2XV4 S;  4A3E J;  4RB3 C;  3ZMT A;  4J01 A;  3TW6 A;  3VWB A;  4AD9 A;  5CXI A;  3HRS A;  4EQQ A;  1BI3 A;  2EIL H;  4KN7 X;  3V42 A;  1W36 D;  3E7Q A;  1VQP I;  2QSG X;  1MIJ A;  3QPT A;  5ICE A;  2EFO A;  2Z2S B;  2WWY A;  1F36 A;  2BY1 A;  4RLF A;  2XDN A;  4JKZ A;  4IHX A;  2Q1Z B;  2X85 A;  2E5N A;  1I6X A;  2FNP A;  3A1Y A;  1USS A;  3BTC A;  2ZSH B;  3VB2 A;  1BI0 A;  1FEX A;  1VND A;  4XLN F;  2FML A;  4ASN A;  3LOC A;  5LEJ A;  2RKH A;  5IT9 Z;  2L9N A;  4M3E A;  5LEK A;  1JKQ C;  3EPZ A;  5ICF A;  5JVT A;  4P55 A;  2V1X A;  2X1C A;  3MN2 A;  3C18 A;  2CW7 A;  2R7W A;  1MNE A;  3GX4 X;  3GTQ J;  4QSH A;  1DGW Y;  4GCT A;  5HDG A;  3U9G A;  4FHT A;  3QYF A;  3GZI A;  1HDP A;  3M7G A;  2Y30 A;  1LFP A;  3S1N J;  3RJP A;  3QKX A;  3LMM A;  5DUI A;  3KNW A;  2XPV A;  5CVJ A;  4DZJ A;  2ID3 A;  1B59 A;  3BR1 A;  2KZG A;  3IH2 A;  3L2R A;  2PMU A;  1JHH A;  3CMA I;  1EF4 A;  2IPQ X;  3ELK A;  4AIJ A;  4PSW A;  3PIP F;  4E7Z A;  1LVA A;  2M87 A;  4RDU A;  1U5T A;  4JP0 A;  4ZYE A;  2QGU A;  3OYD A;  4KA4 A;  4A3K J;  3SEZ A;  2ZFU A;  3FIS A;  3F9K A;  3GTJ J;  2HR3 A;  3S1Q J;  1P2F A;  1Y8Q B;  1QHG A;  2XHK A;  3LSH A;  1BI1 A;  5D5U B;  2JWT A;  3PO2 J;  4JQF A;  2E7W A;  4LG0 B;  4NNJ A;  3ZMD A;  5J40 A;  3GYH X;  1MGT A;  5FLX K;  1A35 A;  4A3F J;  2FSW A;  1PP8 F;  1XDU A;  2EV0 A;  1H88 C;  1F1Z A;  3RDI A;  1X58 A;  2Y69 H;  2V6C A;  3TGN A;  4UV8 A;  3OSG A;  2HVQ A;  1KYW A;  3DV8 A;  4BY7 J;  2MH2 A;  3RYP A;  1BC8 C;  4MLO A;  3W2A A;  1STZ A;  3SFI A;  2W84 A;  1WRJ A;  1LE8 A;  3I4P A;  2X48 A;  3PSI A;  3DKW A;  2UUZ A;  1QU3 A;  2HDD A;  3HOT A;  4DBQ A;  1IN5 A;  1B72 A;  4XRM A;  3IRR A;  1LJ9 A;  4UUV A;  4D9J A;  1K78 B;  2K27 A;  2VE9 A;  1OCC H;  2E1M B;  1FOY A;  2UV1 A;  5D8K B;  4LMY A;  2O6G E;  4P96 A;  3PFI A;  2L2O A;  4YEL A;  1FYM A;  1MJA A;  2CUZ A;  4EJW A;  1OCR H;  4ACI A;  3RCO A;  1PYV A;  5J8F A;  1TWC J;  4B48 A;  2AXL A;  3FXR A;  4RAF A;  2R5Y A;  1S29 A;  4CZZ A;  4WXH A;  4BQA A;  2GXB A;  1BJA A;  3BR5 A;  4MQ9 F;  3UNG C;  2G7U A;  4F52 A;  3LAP A;  3MKY B;  2AO9 A;  6PAX A;  3RI4 A;  5CXG A;  4PGH A;  1FBU A;  4I76 A;  4CCN A;  2IGO A;  2L3D A;  3K9T A;  4XON A;  4XLC A;  4ESJ A;  2G7G A;  2MBF A;  3C1D A;  3MMY B;  2HXI A;  5LHG A;  3Q3S A;  1R23 A;  1DQU A;  2FQ4 A;  4XLA A;  4FTH A;  3CCE I;  2L01 A;  2DA6 A;  5D18 A;  2XGD A;  5LHH A;  4BAY A;  2R7F A;  3HKZ A;  1IN4 A;  1DDN A;  4RGR A;  3CJD A;  1ETO A;  3ZQF A;  4AC0 A;  5EDN A;  3GME A;  3KEQ A;  4L9N A;  5H6R A;  2EZL A;  2KPM A;  2QUF A;  3IWZ A;  1S72 I;  1QHH D;  3HOS A;  2OZU A;  1PP7 U;  2NXN B;  2Z1D A;  3GEU A;  3ZMU A;  2EA4 A;  2ISZ A;  2CQN A;  4A5N A;  2IS1 A;  3G1L A;  4M3G A;  3FXK A;  1QPM A;  1H0M A;  3OYJ A;  3WTX C;  1FBQ A;  3PO3 J;  1XG1 A;  3L1P A;  1XX5 A;  4BE1 A;  2NRA C;  1UB9 A;  3GFL A;  1X1D A;  2RDP A;  1MH3 A;  1LEB A;  1NHA A;  1IUY A;  4L5J A;  4M3F A;  5A2Q K;  1NK3 P;  3L2U A;  3LA7 A;  1ZRD A;  3ZQC A;  3C7J A;  5IYB J;  3OL4 A;  2ZCW A;  3LA3 A;  3B6C A;  4M6V A;  2V79 A;  1YX3 A;  3CC4 I;  2JVH A;  3EUH A;  2KRH A;  4PDK A;  1C0W A;  4YZE A;  1A6I A;  1AWC A;  5IT3 A;  1YIO A;  1WFX A;  5B5E C;  4IF4 A;  2L4M A;  2FEZ A;  1DPR A;  5IP6 A;  4HBL A;  5JFR A;  4XSX F;  1D3Y A;  3AFH A;  3HKZ N;  2RNG A;  1HXD A;  2F07 A;  2VQC A;  4JNN A;  4U88 A;  1YLF A;  2E1O A;  4Q47 A;  3OSF A;  2QBY B;  1FTZ A;  4JX5 A;  2HS5 A;  2WAD A;  2P5K A;  5K7H A;  1ZGA A;  4U0Y A;  3B81 A;  3F0C A;  3BQY A;  2M8E A;  2DO7 A;  4R8H A;  3OIP A;  2B0L A;  1X3Z B;  2DA7 A;  3H92 A;  1YW7 A;  1ZG3 A;  2XAJ A;  4XM3 A;  4Y15 A;  3H9G A;  2XF6 A;  1HC8 A;  1JTX A;  1ERD A;  3FXO A;  3BJA A;  3CWR A;  1B9M A;  2NVY J;  3FM5 A;  3EUA A;  1FOX A;  1Y8R B;  2OQG A;  3K2Z A;  1KU9 A;  1T0F A;  2W85 A;  4HNU A;  2H1L A;  2EFW A;  1JT6 A;  2EJR A;  3M1C A;  3OOP A;  3MCZ A;  1OR7 A;  3KEO A;  1Z6T A;  4XL9 A;  2VON A;  3BTI A;  2GOM A;  2GIV A;  4BDZ A;  1UJ8 A;  5C3E J;  5IOZ A;  3U1K A;  4ENJ A;  1F9N A;  4LLL A;  5K1Y A;  4LB5 A;  3EYY A;  4HV5 A;  2R5Y B;  4D7M A;  1ETK A;  2DG8 A;  2DOE A;  3E3V A;  2JQ7 A;  1AA7 A;  3LFK A;  4IRH A;  3Q5F A;  4MGR A;  4N9H A;  4CCJ A;  4G8X A;  3S17 J;  2XF7 A;  4HAM A;  4CSW A;  1UI6 A;  3AKZ A;  5CJ9 A;  2QQA A;  1RR8 C;  4XN0 A;  1MJB A;  3C2B A;  4BAC A;  2A07 F;  1KQ8 A;  4ZH4 F;  2VAS A;  3KKC A;  1W0T A;  1FT9 A;  2O61 A;  1DP3 A;  1FMW A;  2HQ5 A;  4F91 B;  1BA5 A;  2G9W A;  1HF0 A;  3A0H C;  3KFW X;  1S7O A;  1VQ8 I;  2IVM A;  4ZC3 A;  2AQE A;  2HKU A;  2XIG A;  3CUQ C;  4I09 A;  2X1E A;  1R9T J;  4EM0 B;  2LR8 A;  1YS7 A;  1MSF C;  3HHG A;  4XQF A;  3BRU A;  3AQT A;  1WJE A;  3DQV C;  2R93 J;  4ESF A;  2LSO A;  1RET A;  3LSG A;  2HOT A;  3ZOB A;  1CQT A;  5E3N A;  3CZ6 A;  1OCP A;  1J59 A;  1IZ1 A;  3CJQ B;  5TGT A;  1GLN A;  1I50 J;  1MH4 A;  5M5Y J;  3R61 A;  3TMO A;  3ZMV A;  4ZJZ A;  5CVI A;  2RAE A;  2FJ1 A;  2ZB9 A;  5ILS A;  3HYI A;  1FZP B;  3VW1 A;  3CDL A;  2PFB A;  1O4X A;  2BXZ A;  3ABT A;  4OIR F;  2DA2 A;  1L3L A;  4F55 A;  1BR1 A;  4D0P A;  1WJC A;  2IBD A;  3FK7 A;  4LLG F;  2HYJ A;  2PG4 A;  4X1E A;  3HIM A;  2WTE A;  4RGU A;  3L00 A;  2Q2E B;  5AON A;  1IV6 A;  1KA8 A;  1ZLK A;  3I9V 2;  2HU9 A;  2HQN A;  2LVS A;  3HM5 A;  4N9I A;  2QEX I;  1GHC A;  4IRG A;  1SVO A;  2YX7 A;  3HTJ A;  4ITV A;  3LSP A;  5F0C A;  2HOA A;  3MNL A;  1F4K A;  2LKX A;  1Z91 A;  1ZKG A;  4EJT A;  2V1U A;  2N8G A;  2NS8 A;  5FFX A;  4D5C A;  2PI0 A;  2NVU B;  2HGC A;  4Q48 A;  3QYE A;  2KHM A;  3DTI A;  1P92 A;  3HOV J;  3PNT A;  1JI8 A;  2VBY A;  2QVO A;  3O6B B;  3RKQ A;  3HBL A;  1FP1 D;  2JN6 A;  1QNT A;  2LF7 A;  4FAS D;  4IKF A;  2RC4 A;  4II2 A;  2HOE A;  2XAS A;  4NQW A;  2KDZ A;  2HPI A;  3BR6 A;  2W00 A;  4PGG A;  1N25 A;  2MD5 A;  4F7Z A;  2M4G A;  4RMN A;  3BG5 A;  1TW2 A;  3J80 K;  5F27 A;  3H9J A;  1CF7 B;  4RBO A;  1HBX G;  2OER A;  2E71 A;  3G71 I;  2AQF A;  4H0E A;  1T95 A;  1MMA A;  4A3M J;  5J3L A;  1FYK A;  3ZQH A;  5FGL A;  2QLZ A;  3K4L A;  3J7A O;  3FK6 A;  2JJ7 A;  4B43 A;  2ZXJ A;  2ELH A;  4KUM A;  4YFK F;  5FRN A;  3B6A A;  5HOO A;  2KIF A;  5K7F A;  2GXA A;  5JI6 A;  4O3M A;  4U9L A;  4G7Z F;  5EZG A;  3OV8 A;  1BR4 A;  1TWA J;  3VDX A;  3FBI B;  1Z9C A;  3ECO A;  3CQZ J;  1XD7 A;  3LL7 A;  5HSZ A;  4LB6 B;  2WAF A;  5CLS A;  3AG4 H;  2JA7 J;  4HX4 A;  2MLG A;  2WGB A;  4PJN A;  1J5Y A;  2BEO A;  3T0Y A;  5DCM A;  2UXU A;  5EJC A;  2FD5 A;  5HDN A;  2Y75 A;  3M1E A;  3S2W A;  2ZJR F;  2E2J J;  1YYV A;  2IGN A;  4XRF A;  3ULQ B;  2M9H A;  3DBR B;  4Q5S F;  5LGU A;  5E17 F;  5L3B A;  4OIP F;  2H8W A;  4U0V A;  4MNU A;  5FHP A;  2RVC A;  2UWM A;  1Y39 A;  2BHZ A;  3CO7 C;  4X0G A;  1MMG A;  5DEQ A;  3BG6 A;  3FX3 A;  1R4M B;  4AVZ A;  3JSJ A;  1PUF A;  3SFZ A;  5IYD J;  3CC2 I;  1U2W A;  1QBJ A;  3E6C C;  2XPU A;  3LAJ A;  5E18 F;  4I0A A;  2CJJ A;  3GTL J;  1G8X A;  2P7V B;  2DXI A;  3DP7 A;  4PFP A;  1AOY A;  5GTI C;  1XN7 A;  2VLA A;  2NNY A;  2QKO A;  4G6Q A;  3GO5 A;  5DV5 A;  1U9O A;  3MEX A;  4EEF G;  3EYI A;  1IRZ A;  3S3M A;  2JSC A;  2CS3 A;  5CQG A;  5HNF A;  2DFF A;  4M74 A;  3RD3 A;  2ZCX A;  5FKO A;  3ISP A;  2JMW A;  2HOS A;  3FKJ A;  3D5L A;  4MTD A;  4OIO F;  4ON0 A;  4A6D A;  2QF7 A;  3E0J B;  1O7L A;  3P7N A;  5KVR A;  1TP4 A;  4IX7 A;  1KQ0 A;  3GTM J;  4LG3 A;  2M3A A;  3S2H J;  2F4O B;  3CLQ A;  5C4Y A;  3M8F A;  1KON A;  4KIB A;  1BJZ A;  4HNV A;  1I5Z A;  4M71 A;  5JR3 A;  5DAJ A;  3IRQ A;  2PX9 A;  4P9F A;  2OF7 A;  1Z21 A;  1EA3 A;  5GPC A;  2PJP A;  2M0C A;  3H3Z A;  3LSM A;  4HSR A;  4PJM A;  3SDB A;  4CCO A;  5HDK A;  3AAF A;  2ZY9 A;  2KRF A;  1MND A;  2HVS A;  2JRM A;  4ME9 A;  1E3H A;  3KP2 A;  3NQO A;  2FBQ A;  4IPA A;  3LSJ A;  4XKW A;  1JJ6 C;  1X1C A;  3BQZ A;  1K4T A;  2MFZ A;  2RRE A;  1FX7 A;  2DFI A;  4IHS A;  3LWJ A;  1N78 A;  3CLO A;  4ETS A;  3JRH A;  2ZME C;  1T39 A;  3BG7 A;  1IC8 A;  4NQW B;  3WG7 H;  2EIN H;  2JUG A;  3U1D A;  5DM7 F;  4X6A J;  2LRE A;  1MBJ A;  3GFM A;  3T6N A;  2NOG A;  3JRI A;  4XRS G;  3HTU A;  5LRR A;  1XMX A;  2CQK A;  3SWH A;  2ZNZ A;  3K4J A;  4EV0 A;  3F8F A;  4I7H A;  2ELJ A;  1W7P A;  5LD2 C;  3OS2 A;  3ASO H;  2V4J C;  1POG A;  4BE0 A;  2IP2 A;  3RQI A;  2P6T A;  3IWF A;  4UHT A;  5GTH C;  3PFY A;  3RSN A;  3KPH A;  2EA2 A;  3ON4 A;  2GZW A;  4GCV A;  2V1D A;  4IL6 C;  4FT8 A;  1R00 A;  4NB5 A;  2A68 F;  2P5V A;  1YHQ I;  2OQR A;  2XGE A;  3CP8 A;  2M4K A;  4DYR A;  1J0R A;  2H94 A;  1MMD A;  3EGQ A;  2XSJ C;  2UXO A;  3EDP A;  1K61 A;  3QU3 A;  1Y56 A;  2A3S A;  2DPU A;  4G9Y A;  3G3Z A;  3KZ9 A;  2E34 A;  3G4S I;  3Q9V A;  5DCM B;  3I58 A;  2DK5 A;  1LEA A;  4DYC A;  2VT2 A;  3FHZ A;  1FPQ A;  2VKV A;  4F92 B;  4DZP A;  5H2F C;  3NRV A;  1JKR C;  1ONV A;  4ZYH A;  1T6S A;  2X51 A;  2E2H J;  2ZXH A;  2YVX A;  4UVC A;  2CFX A;  1RRJ A;  5D5X B;  3VYS B;  3VSL A;  5FB2 A;  2OV7 A;  1I1G A;  1XCB A;  2FBI A;  2LY1 A;  2NNN A;  3WTS C;  2RQQ A;  1ZGJ A;  5DD4 A;  4PK4 A;  4B44 A;  4DQ2 A;  1UMQ A;  1K79 A;  1X2M A;  2WB1 A;  3E1S A;  2IA1 A;  1GXQ A;  3TQN A;  1SFE A;  3BJ6 A;  3WTU C;  1WJA A;  3GW2 A;  3BG3 A;  1U3E M;  1ENH A;  3CC7 I;  1X1A A;  1ZR2 A;  1B6A A;  2WV1 A;  2CFO A;  5LGT A;  4YFX F;  2VOD A;  2B3W A;  2QEN A;  2ZFW A;  2KKO A;  4BJT A;  3IAM 2;  4AID A;  2JPC A;  2CW0 F;  1RUO A;  3LSI A;  5EGO A;  2ZJ2 A;  2EPF A;  2FUG 2;  3E5U A;  3R6S A;  2D1H A;  4ZTJ A;  3RKX A;  2E60 A;  1IN6 A;  5EFY A;  4ANJ A;  4Y7N J;  2GA1 A;  3BJO A;  1ZAO A;  3K7A J;  3G6E I;  4BY1 J;  1TNS A;  3CJT B;  3S1R J;  1JJ8 C;  1A6Q A;  4YIR X;  1R22 A;  1OYI A;  5FO5 A;  4DIQ A;  1L0O C;  2R7X A;  1Y6I A;  1SFX A;  3GCM A;  4HNT A;  2FOW A;  5BS6 A;  5LLQ A;  5HLI A;  1NTC A;  3DKY A;  1S7A A;  2F6C A;  5TRD A;  3ZMS A;  2FA5 A;  4C3H J;  1I6H J;  4V2F A;  2QIB A;  4HEA 2;  3RPQ A;  2OTJ I;  1RUN A;  1R1U A;  1TNT A;  4HRI A;  1SEU A;  1NK2 P;  2CSO A;  3S32 A;  4OWR B;  1UHW A;  1ZLJ A;  3VP5 A;  2KJB A;  1IRX A;  5DCF A;  3DEU A;  1VI0 A;  3H0G J;  2HQR A;  4UY8 I;  2REK A;  3QAH A;  1ZR4 A;  3GTG J;  2P6S A;  1ZGW A;  1N75 A;  2WB1 N;  3BZ6 A;  4AIK A;  2X0L A;  1FJL A;  1ETQ A;  1PVE A;  2A6E F;  2Z16 A;  4QTR A;  1YJ9 I;  3UKG A;  1Z67 A;  3QP6 A;  3R4K A;  3FBN B;  5K5R A;  2BW3 B;  5E3L A;  1KU7 A;  1REP C;  2A05 A;  4OU0 A;  2UXX A;  1SD6 A;  1T33 A;  4I6Z A;  5IYC J;  1ETX A;  4M6X A;  3JRD A;  4HPQ A;  4BKX A;  2DJN A;  2VBZ A;  5CW8 A;  2MAB A;  1I1S A;  3O60 A;  3QOD A;  3GLX A;  5FD6 A;  1W7P B;  1BN5 A;  1D1A A;  3H0D A;  5E3M A;  1LNW A;  4MEY F;  3ZMZ A;  3OYN A;  3F22 A;  4NDL A;  4S0H B;  2IU5 A;  4KFC A;  1TWH J;  2Q8K A;  2EFN A;  4HYE A;  4XBF A;  2NVT J;  3QOP A;  3RKY A;  1VQO I;  2RV8 A;  2W57 A;  4RB1 A;  3CO6 C;  4CGR A;  3O2P E;  2KDO A;  2X6W A;  3H35 A;  1D5V A;  2P8T A;  5F1R A;  4FQG A;  4HLY A;  2R92 J;  2E1N A;  5F0H A;  4E7I A;  3TOA A;  4A5M A;  5J8C A;  1UI5 A;  1V54 H;  5IP9 J;  4HKU A;  5ICC A;  1OCO H;  2VJJ A;  3GZ6 A;  2YSR A;  5D4R A;  2LF8 A;  4L5I A;  2AXT C;  1HSJ A;  2M30 A;  2L02 A;  4C2U A;  1D0Z A;  1Y0N A;  5EF6 A;  2RAS A;  4M72 A;  1DU0 A;  5GAG J;  2P81 A;  3HOY J;  2ME0 A;  4HX7 A;  4KMU X;  1LVK A;  3P9K A;  2ZXW H;  2GIZ A;  2NAZ A;  3VOK A;  5E3O A;  1FNN A;  1ZHF A;  4CDG A;  2H6C A;  1B8I B;  4DJA A;  2JA6 J;  4KMF A;  3RYR A;  1ZTR A;  3VIB A;  2K9L A;  5AIP A;  4NEL A;  1ZEL A;  2XPW A;  3AQS A;  3KP4 A;  2E1M C;  3KLO A;  3CCJ I;  3NI7 A;  3A0B C;  1MDM A;  3JAM K;  2Z33 A;  2IT0 A;  3BJB A;  1YX5 A;  4OMY A;  2ZCN A;  3H5A A;  4A69 C;  3FMQ A;  5LBQ A;  3COL A;  3QYB A;  4JX4 A;  1K6Y A;  3VW0 A;  3CMM A;  2L7M P;  1O3R A;  2A61 A;  2H6B A;  2VBW A;  3NS4 A;  1IW7 F;  3VOE A;  4ZYG A;  2V57 A;  3HZJ A;  3FXM A;  3K4K A;  1G3T A;  4BL0 B;  2B7E A;  2IGK A;  3PAS A;  2Q0O A;  3HRU A;  5K58 A;  1RZ4 A;  1S8N A;  3RPU D;  1V55 H;  3IH4 A;  5BPD A;  4XKV A;  2FU4 A;  4BGD A;  1A5J A;  3HTH A;  5HVQ C;  2L54 A;  1VFC A;  3CCQ I;  3MFK A;  1A04 A;  2ZNY A;  3F21 A;  2O3F A;  5TIS C;  3VOD A;  2CQX A;  3BTJ A;  3C3W A;  2E5Z A;  1ZG5 A;  2GWR A;  2VOO A;  1OCT C;  1HW1 A;  2HKX A;  4EJV A;  4ZYD A;  5H9T A;  1IDY A;  5LGN A;  5JHF A;  1D8K A;  1SD7 A;  3J81 Z;  4HG2 A;  3IUV A;  2K7L A;  1XGN A;  5GAH J;  3TL4 X;  3NPI A;  5CVU A;  2PQ8 A;  2EFQ A;  4C2M J;  1O3Q A;  1XSD A;  2CV2 A;  1BM9 A;  3DLA A;  1Y0U A;  3W2V A;  2EWN A;  1MJ9 A;  3JRE A;  3MZY A;  4L9V A;  4QLC U;  1TQI A;  5HLH A;  2KMU A;  3QPH A;  4IRI A;  1RR7 A;  1U5T C;  4N4O B;  3TKY A;  3WHB A;  3HSE A;  1IG7 A;  4NN1 A;  3J7Y J;  4S05 A;  2V9V A;  1UHM A;  3JTH A;  4XKC A;  4M9S A;  3BZC A;  5BNG A;  2DU9 A;  3BR0 A;  4B4C A;  3WU0 A;  5JVG F;  3MVP A;  2M45 A;  1S9H A;  4B3A A;  3FKI J;  1SMT A;  4WXD A;  1JTY A;  4IOC F;  2TDX A;  3CCL I;  1P7J A;  2M8G X;  4E7L A;  1HKT A;  2OU2 A;  1R1T A;  1JXS A;  2I8D A;  5HBU A;  3K4B A;  1U5T B;  2ZKZ A;  3P9T A;  3QWL A;  3AG1 H;  1GVJ A;  1G3Y A;  4KJZ A;  2IRF G;  3LSR A;  3I59 A;  3DKX A;  3OYE A;  2K85 A;  2COM A;  3T5X A;  1YS6 A;  3DXJ F;  4HOB A;  5IOY A;  1OYW A;  2L9V A;  1FIP A;  3KEY A;  1EH6 A;  2E36 A;  1VTN C;  1AHD P;  1G3S A;  2D6Y A;  2CUJ A;  1KGS A;  4JOM A;  2O8K A;  3R0A A;  1SD4 A;  3FIW A;  3BWG A;  5E1Z B;  3BRO A;  3EUK L;  3M9A A;  5DM6 F;  3OR2 C;  2R7S A;  1MSE C;  4L18 B;  3GTK J;  1EJ9 A;  3RZO J;  2BVL A;  3G1M A;  4CH7 A;  3G1O A;  3V7S A;  1U8B A;  2DDA A;  4BBR J;  4DOZ A;  2Y0M A;  2Y31 A;  3CJR B;  2TRT A;  1ZQ3 P;  5HOD A;  3MWM A;  4ZDL A;  1BC7 C;  3KP7 A;  1LE8 B;  2QM3 A;  4BBS J;  2DQR A;  2VPR A;  1FY7 A;  1X2N A;  3W6V A;  1SD5 A;  3DEW A;  3M4O J;  3I3L A;  3DEE A;  3MKL A;  1XGS A;  3ZR8 X;  3WTW C;  3ANP A;  3BT9 A;  1W5S A;  1IN8 A;  3HTI A;  1B72 B;  3IUO A;  3KYC B;  3X2Q H;  2QKL B;  3ERE D;  2UXN A;  4GXO A;  1P4X A;  3DTK A;  2VXD A;  4TV7 A;  1SAN A;  4CHU A;  3FWE A;  2DW4 A;  2O03 A;  4HW0 A;  3ZN1 A;  1RI7 A;  1VZ0 A;  3ZN0 A;  3PUB A;  4BU2 A;  3S15 J;  2YX4 A;  4CGZ A;  3WE2 A;  2OZ6 A;  3FF5 A;  2W1O A;  3VYT B;  2FBK A;  2KL4 A;  1E17 A;  4O6J A;  1DUX C;  1HW2 A;  1R58 A;  1OJL A;  2F5E A;  3S14 J;  2Y0S A;  2O7T A;  5CQE A;  5M3M J;  2DFH A;  3BTL A;  2PMH A;  3L9F A;  4XLH A;  2L9S A;  1WHU A;  3GXO A;  1XB4 A;  3HOX J;  3LHQ A;  2DMT A;  3T1B A;  4GFB A;  2ZC2 A;  4A0Y A;  4UB8 C;  4L0Z B;  3HGG A;  4Z6Y A;  2JA8 J;  3OYF A;  3BR3 A;  2DK8 A;  1W0U A;  3VW2 A;  2DT6 A;  2IS4 A;  4BXX J;  1KQ9 A;  2FNA A;  3BG9 A;  3DBH B;  2R7U A;  3IV5 A;  1UFM A;  3LQR A;  2GQQ A;  2K86 A;  2O9L A;  3GEZ A;  4L5E A;  1VQL I;  2DT5 A;  2BY3 A;  1QVT A;  3N4M A;  2ZO4 A;  1XS9 A;  3DBL B;  1YFH A;  2CU7 A;  2JA2 A;  1LDJ A;  3OR1 C;  2PEX A;  3S5R A;  4Y3O A;  2DCE A;  4DNC A;  2YU9 J;  1V3F A;  1IXR C;  1LKX A;  3SYT A;  2XB0 X;  3F8N A;  2MA3 A;  4EM1 A;  2QOP A;  1OYY A;  3K1M A;  3VYR B;  4N0B A;  3NRG A;  1UCR A;  4MFD A;  2QWW A;  3KET A;  3CP2 A;  3MAJ A;  4ZZL A;  3TP3 A;  3BOQ A;  1ZRC A;  3BNI A;  4D1Q A;  4GCK A;  2A2F X;  1TQM A;  4FET A;  4E7K A;  3VVX A;  1WVR A;  3VPR A;  2ME6 A;  4BS9 A;  2Y9Z A;  1XGO A;  3BZK A;  3EUH C;  3H5R A;  5D8L B;  2BGC A;  1H89 C;  2Y0S N;  4CO8 A;  2KZV A;  1GV5 A;  2BY0 A;  5FLX Z;  3I59 B;  4I98 B;  2JVG A;  2M0M A;  3PQK A;  4RM3 A;  4UV9 A;  1OMI A;  2PJR A;  2ZOZ A;  2HYF A;  1MNM C;  4BHB A;  5ILV A;  3JRC A;  1UG0 A;  3QU6 A;  3J7A Y;  2NOJ B;  4UVB A;  3SDG A;  3GVA A;  3HOW J;  1YJN I;  4A3D J;  4GCL A;  5C4J J;  1J9I A;  4KIG A;  3W3C A;  3S3O A;  1FTT A;  1X1P A;  3HB9 A;  4H4K C;  4B3X A;  3GFI A;  3PPB A;  1JGG A;  2GEN A;  2VB6 A;  2M1B A;  3JAM Z;  1JGS A;  1FIA A;  1R36 A;  4BJ6 C;  3CES A;  3PM1 A;  1P6R A;  2A5W A;  1WI3 A;  4HF2 A;  4UUT A;  1HLV A;  2HTJ A;  2WA0 A;  3REO A;  2DA1 A;  5EEH A;  2F2E A;  2GA2 A;  3DCF A;  4C3I J;  4DW6 A;  3EUP A;  1V5E A;  4NC6 A;  4KT5 C;  4IHV A;  3KIO A;  1OR7 C;  5CVR A;  1OCZ H;  2YS9 A;  1XMK A;  1VQ5 I;  1VQ9 I;  2Z3Y A;  1XDS A;  2ACJ A;  2XC7 A;  3KP6 A;  3H9Q A;  3PQJ A;  4BXU A;  3ZPL A;  5IT9 K;  5D19 A;  2XGX A;  4RB2 C;  4WCG A;  4BE2 A;  2DYR H;  1ORK A;  1FBS A;  4D7N A;  3WGG A;  2XKP A;  4HDV A;  3DPU A;  4W1U A;  2JTV A;  1N77 A;  2AHQ A;  2OI8 A;  1HKS A;  3TP0 A;  4AWX B;  5BPI A;  3M8E A;  3ZQL A;  5FGM A;  3Q0U A;  1QRY A;  3ZP5 A;  3K6G A;  1J2X A;  4ESB A;  4YIF A;  5M5W J;  2JA5 J;  5C4X J;  2LKP A;  2DDB A;  3CUO A;  3OIO A;  3JRA A;  4QIW N;  2YR2 A;  3BP8 A;  4YRV A;  3S3N A;  4RAZ A;  2XGC A;  1SMY F;  4Y4R A;  4KYW A;  3AL0 C;  1X4O A;  3BY6 A;  1U78 A;  2CWE A;  5JLW A;  4E7H A;  3E5Q A;  1TT0 A;  2CYY A;  1SC7 A;  3HSF A;  1YJW I;  4ENN A;  1EKE A;  5DS9 A;  1YW8 A;  1B4A A;  3PIO F;  3GUD A;  3I0T A;  2DBB A;  2L7F P;  3HEF A;  3VSK A;  1YQA A;  2FX0 A;  3ZRG A;  2CMP A;  2MLK A;  3HOZ J;  1P7I A;  3AL0 B;  3OYI A;  5BOX A;  3OYM A;  2HFH A;  3WTZ A;  3K70 C;  4KIF A;  4XOT A;  3ZCO A;  1P4W A;  2ZJQ F;  4EAT A;  4N4N B;  1LB2 A;  2Y48 A;  3KZY A;  2ZOY A;  2XRL A;  2OC6 A;  2LD5 A;  5KCM A;  1ETY A;  4HV6 A;  1TLH B;  4HST A;  3HPG A;  5HS8 A;  3V78 A;  2VIX A;  1QGP A;  2VL8 A;  5J1Y A;  3CME I;  1YTY A;  1A36 A;  2QWT A;  3J7Z I;  3FHN A;  2GAU A;  5A2Q Z;  2K9Q A;  2ESH A;  3ZGK A;  1BL0 A;  2KIQ A;  2E2I J;  1M1E B;  4I02 A;  4E4H A;  3V6G A;  4IHY A;  2E7X A;  1HCR A;  4A3G J;  3GBG A;  5HNH A;  4UUS A;  1QQI A;  4J00 A;  2MG4 A;  4LIT A;  1AKH A;  4XLE A;  4I2O A;  2KT0 A;  2QCO A;  3LWF A;  3OMY A;  4CYC A;  2DMU A;  4L9T A;  5L3F A;  2BXY A;  4MK6 A;  4FE7 A;  4LOC A;  3F8C A;  2M5W A;  3ERM A;  5J47 A;  4BJ5 C;  2HTS A;  1VQ7 I;  3HDD A;  2JUC A;  5K5Q A;  1BOB A;  3HRT A;  3IL2 A;  4KNY A;  1X3W B;  4RB0 A;  1K6O A;  1DU6 A;  5D5W B;  2EV6 A;  2L7Z A;  4RAY A;  3GFJ A;  4CCK A;  1WJ5 A;  3JR9 A;  2EV5 A;  2Y9Y A;  3MD2 A;  3KX2 A;  3ASN H;  4XSZ F;  2MC4 A;  2LG4 A;  2DAO A;  4PJJ A;  5D6F A;  3OYK A;  3DU6 A;  4M6Y A;  3V4G A;  3I55 I;  4QPO A;  4A0X A;  4NHJ A;  2L4A A;  1KYZ A;  1R5I D;  2VQH A;  3VOX A;  2H09 A;  3IKT A;  4CA0 A;  3V8J A;  3K4M A;  2DMQ A;  1O7F A;  2HI3 A;  3KZI C;  4NC7 A;  1DPU A;  4PUS A;  5KAI C;  1TZL A;  1XGM A;  2R7R A;  2W53 A;  2K9M A;  1P9Q C;  2QQB A;  3L2V A;  4EGY A;  5F64 A;  4R1H A;  5L3C A;  3B02 A;  1IUF A;  1ZRE A;  4PJ0 C;  3W6K B;  2K4B A;  1BW5 A;  2P4W A;  4KWA A;  4O5V A;  1BOA A;  2CRG A;  2ZSI B;  5B66 C;  1RES A;  3C07 A;  4FX0 A;  3WTY C;  3NEU A;  2EQR A;  2K40 A;  2M7A A;  4PJL A;  4RGX A;  4KIS A;  2RNJ A;  5DTD A;  2IA0 A;  2W82 A;  2K5C A;  3K1N A;  3M07 A;  3E97 A;  3A01 A;  5J4V A;  2BV6 A;  4J19 A;  3CCS I;  3H36 A;  3HXL A;  4S04 A;  3QP5 A;  1YIT I;  4NUB A;  1R7J A;  1W5T A;  4LIU A;  3FDY A;  4MQV A;  4BXF A;  2WV0 A;  4LG0 A;  3EET A;  4GFK A;  3HG9 A;  3OWT A;  1HOM A;  4L62 A;  2P0W A;  4Q4Z F;  2I5U A;  3E6M A;  3TO6 A;  4GO1 A;  3HTS B;  4JL3 A;  2XRO A;  2X6O A;  4AUX A;  2OA4 A;  2R7Z J;  4Y33 A;  1WH5 A;  3VYU B;  2MC3 A;  1KZH A;  1HA8 A;  5IPA A;  1S5L C;  3Q0W A;  4PSX A;  1PUF B;  3AG2 H;  5J6X A;  3K69 A;  3SQN A;  4AF5 A;  1BW6 A;  1ITY A;  2JT1 A;  2BE5 F;  3C2H A;  1Z0X A;  2JSP A;  2XAU A;  1XPX A;  1E2X A;  4G12 A;  2J5P A;  4I01 A;  2NS0 A;  4OOI A;  3ON2 A;  2X6Y A;  2PZ9 A;  3DWL E;  1YW9 A;  4ENK A;  2Z5U A;  1VQ6 I;  3WU2 C;  1D0Y A;  1TWF J;  1G2H A;  4GFL A;  2JK3 A;  5CKT A;  2R0Q C;  4UB6 C;  3MQ0 A;  2G7S A;  4W97 A;  1ACI A;  2WUI A;  2IA2 A;  2EB7 A;  5L3E A;  2GUH A;  4JK1 X;  1GDT A;  2Z99 A;  2LDU A;  3TDZ C;  1K78 A;  3P5J A;  4UUS B;  4BUP A;  1ETW A;  3QPL A;  1QZZ A;  3NNR A;  2BOL A;  1XCV A;  2A6T A;  3HHH A;  4FE4 A;  1PJR A;  3L2W A;  4M3B A;  4F93 B;  3A02 A;  3WTV C;  2KP6 A;  3ZQ7 A;  3S1M J;  3L2Q A;  2WAQ A;  5DUK A;  2CQ7 A;  1OIS A;  2X1D A;  3AG3 H;  4WF2 A;  4E7S A;  2CO5 A;  4AU7 A;  1P4A A;  3LQQ A;  5F6F A;  5FMP A;  3QQA A;  4YFN F;  4BNC A;  3DPT A;  3FRQ A;  1PUE E;  1TC3 C;  1V5G A;  1U0J A;  1QO0 D;  2RGV A;  3OY9 A;  4IO9 F;  4ICH A;  3J80 Z;  1OPC A;  1RKT A;  4MTE A;  3H3V K;  4HZF A;  4RA2 A;  3ZQG A;  1JT0 A;  2IEK A;  1R71 A;  5FKN A;  4R79 A;  1IF1 A;  2CGP A;  1S3J A;  3D5R C;  3M3Y J;  3FXU A;  5F08 A;  3L09 A;  3I4N J;  3CCY A;  1V4R A;  1UG2 A;  3BPX A;  2IGM A;  5F1J A;  1X3U A;  3CF2 A;  3HPH A;  4IHW A;  2MH9 A;  4BH9 A;  1JUM A;  2B9S A;  5DYM A;  1WJF A;  1U6G A;  2QZ8 A;  2RN7 A;  5HS9 A;  2NYX A;  3OS0 A;  4HF1 A;  4D5F A;  2L0K A;  3H3U A;  1MBK A;  4XNF A;  5AQC A;  2NVX J;  2F5V A;  3G2B A;  1IV8 A;  1BI2 A;  2D2W A;  1ULY A;  2O5R A;  3DTE A;  4HLX A;  5IP7 J;  3FXL A;  2FRH A;  2ZCM A;  3RKW A;  2DA5 A;  1QZY A;  1NG7 A;  2CW8 A;  2KIM A;  4F3Q A;  4UXN A;  2F48 A;  4XOP A;  1BIB A;  3TOB A;  4GRI A;  4LJZ F;  3WHC A;  1UEL B;  3IHU A;  4OAY A;  3NWT A;  3JRG A;  2C6Y A;  3FMS A;  1FLI A;  2V9K A;  3SHF A;  2O7O A;  2LP0 A;  1TT5 B;  2WAQ N;  2VPL A;  3VVZ A;  1O57 A;  2DFE A;  3E7L A;  4DBR A;  2PFV A;  2KLO A;  3PNV A;  2HPM A;  5L3D A;  2P5L C;  1WI9 A;  5HLT A;  5CVV A;  3E5X A;  2XDV A;  4MHG A;  2DN0 A;  2LFB A;  4PCQ A;  2LNB A;  3A01 B;  2QTQ A;  1H9G A;  4A93 J;  3ABK H;  4OMZ A;  4IJA A;  3DPJ A;  4EJO A;  3WGH A;  2HZT A;  2VUM J;  2CG4 A;  1D8J A;  3C2G A;  3NWS A;  3BC8 A;  4B09 A;  4XLF A;  1B1B A;  5D5V B;  2EH3 A;  1W1W E;  2ELK A;  1K4S A;  2D5V A;  4MO7 A;  2YVE A;  1RIO H;  4XID A;  4RM2 A;  2OBP A;  2ZBK A;  4MFE A;  1MBH A;  1T98 A;  1FSH A;  2DA4 A;  1R1V A;  1UZC A;  1MZB A;  3A4C A;  2E19 A;  4NC8 A;  1Y1W J;  2QSH X;  5D1R A;  3WE3 A;  2VQG A;  3G7R A;  2LLK A;  4II3 A;  3IC7 A;  1VQN I;  1EH8 A;  1T2K A;  1FWZ A;  2TCT A;  2VJ4 A;  4MXM A;  1R4N B;  3TO7 A;  3G73 A;  5ICG A;  2QBY A;  4CIC A;  4ZTF A;  4PFO A;  1EH7 A;  3T8R A;  2GBY A;  4CUG A;  3PUF A;  1RNL A;  4YG2 F;  2K9N A;  1PDN C;  2DPD A;  2LYC A;  5K5O A;  3F8B A;  4AVP A;  2PBI A;  5FKM A;  3BHQ A;  5B1B H;  3I53 A;  4LK0 F;  2HYG D;  2LH9 A;  5GAE J;  3H1C A;  1WWX A;  3NAR A;  2V6E A;  1HKQ A;  4A3I J;  3U21 A;  2QQ8 A;  5EGO B;  4WXC A;  1UAA A;  3V8L A;  2ECB A;  4OD5 A;  3KP5 A;  5LFA A;  3HTA A;  4L0Y B;  1JKO C;  5FRM A;  2LRD A;  5J4Y A;  3JSO A;  4IOA F;  2BZT A;  2ISY A;  3BDD A;  2M2E A;  4XK4 A;  1HST A;  2NP3 A;  3CDI A;  2DQL A;  3KYD B;  3KP3 A;  3NAU A;  4IZZ A;  1GT0 C;  4DVY P;  2IS6 A;  2R4G A;  3QBM A;  3GWZ A;  5J1U A;  4BQQ A;  4A12 A;  2YVH A;  2XAG A;  1X1B A;  2F4I A;  5B3S H;  1SAX A;  1AU7 A;  4HX8 A;  2A5Y B;  2V26 A;  1KU2 A;  4BQO A;  3SJM A;  3TED A;  3OYG A;  3JTG A;  2B1E A;  3KKD A;  1SFK A;  2VI6 A;  2W4S A;  5E8I A;  3F1B A;  2X9D A;  1W36 C;  2DI3 A;  1O3S A;  4XN3 A;  3MKZ A;  1JUS A;  3VVY A;  2VBX A;  4M3D A;  2HXO A;  2HWV A;  1XC5 A; 
#chains in the Genus database with same CATH homology
 1VND A;  2Y9Z A;  1H89 C;  2Y0S N;  3LOC A;  3GTM J;  1GV5 A;  3S2H J;  5K7Z A;  5C4Y A;  4M3E A;  1JKQ C;  1BJZ A;  4HNV A;  4MIM A;  3A03 A;  2ZOZ A;  1MNM C;  5DAJ A;  3MN2 A;  5GPC A;  2OF7 A;  3HTJ A;  1IDZ A;  2M0C A;  3GTQ J;  3JRC A;  4QSH A;  1GVD A;  4ME9 A;  4GCT A;  1RKW A;  5F04 A;  3GZI A;  2FBQ A;  1HDP A;  3SDG A;  2Y30 A;  3LSJ A;  5GPA A;  1I3Q J;  1JJ6 C;  3HOW J;  5EZH A;  3S1N J;  3BQZ A;  4A3D J;  3G56 A;  3QKX A;  4GCL A;  5C4J J;  3KNW A;  2XPV A;  5FKK A;  4DZJ A;  3LWJ A;  2ID3 A;  1FTT A;  3HB9 A;  3JRH A;  3S2D J;  3BR1 A;  3PPB A;  1JGG A;  2DTZ A;  3IH2 A;  1IC8 A;  2GEN A;  4X6A J;  1FIA A;  1MBJ A;  1EF4 A;  3T6N A;  3PM1 A;  2NOG A;  3JRI A;  1UHS A;  1WI3 A;  4XRS G;  4UUT A;  1HLV A;  2DG7 A;  2DA1 A;  4RDU A;  4JP0 A;  4A3K J;  4DW6 A;  3DCF A;  4C3I J;  3EUP A;  3FIS A;  3GTJ J;  2M34 A;  1SGM A;  3S1Q J;  1POG A;  4IHV A;  5EYR A;  3RQI A;  5M5X J;  2YS9 A;  5FJ8 J;  3HOU J;  2JWT A;  3PO2 J;  2L9R A;  3ON4 A;  2EZK A;  3CMY A;  4A3F J;  2XGE A;  5D19 A;  4DYR A;  5FLV A;  1H88 C;  1OFC X;  3EGQ A;  2HYT A;  2UXO A;  1K61 A;  1ORK A;  1X58 A;  3IH3 A;  4D7N A;  1GUU A;  4W1U A;  3OSG A;  4DYQ A;  5JLX A;  3LJL A;  2AHQ A;  2OI8 A;  3KZ9 A;  4BY7 J;  3TP0 A;  2R5Z A;  4MLO A;  2DMP A;  3SFI A;  4DYC A;  3ZQL A;  2ID6 A;  1T56 A;  1QRY A;  3Q0U A;  3QPS A;  1LE8 A;  2VKV A;  5M5W J;  2JA5 J;  4A3L J;  5C4X J;  2X48 A;  5C44 J;  2UXP A;  3OIO A;  2G0E A;  4DZP A;  4QIW N;  3JRA A;  1JKR C;  2E2H J;  2HDD A;  2XGC A;  1B72 A;  4XRM A;  1U78 A;  5JLW A;  3HGY A;  3LNQ A;  5DS9 A;  1UMQ A;  2CUF A;  1X2M A;  3D1N I;  1D5Y A;  2L7F P;  1YRN A;  3HEF A;  2FX0 A;  4ACI A;  4AYB N;  3JRF A;  1P7I A;  2EZI A;  3HOZ J;  3BG3 A;  1ENH A;  1TWC J;  1ZR2 A;  2R5Y A;  2WV1 A;  2ZOY A;  3BR5 A;  2XRL A;  4A3J J;  2LD5 A;  1ETY A;  3V78 A;  2AO9 A;  5J1Y A;  5CXG A;  2NVQ J;  2QWT A;  4I76 A;  2Q24 A;  1WGX A;  5EGO A;  1TWG J;  4FIS A;  2K9Q A;  2G7G A;  1BL0 A;  1WCM J;  2E2I J;  2EZH A;  5EFY A;  2HXI A;  5HAW A;  3V6G A;  4IHY A;  3Q3S A;  2FQ4 A;  4Y7N J;  4FTH A;  2PMZ N;  3K7A J;  1HCR A;  4AC6 A;  4BY1 J;  2DA6 A;  2K9S A;  3GBG A;  4A3G J;  5D18 A;  3S1R J;  2XGD A;  4UUS A;  1JJ8 C;  2MG4 A;  1AKH A;  2G7L A;  1QVU A;  3GTP J;  1HDD C;  3CJD A;  1ETO A;  2KT0 A;  1Y1V J;  2QCO A;  4CYC A;  3ZQF A;  1NTC A;  2DMU A;  4AC0 A;  5EDN A;  2PBX A;  4MK6 A;  4C3H J;  1I6H J;  4FE7 A;  4LOC A;  4V2F A;  2QIB A;  2EZL A;  1NK2 P;  3HDD A;  3VP5 A;  1VI0 A;  1DU6 A;  3H0G J;  3I4M J;  2L7Z A;  2REK A;  2VKE A;  5GP9 A;  3GEU A;  1ZR4 A;  3GTG J;  1ZGW A;  2WB1 N;  3JR9 A;  3G1L A;  1FJL A;  2Y9Y A;  4M3G A;  1ETQ A;  1Q1V A;  4QTR A;  3UKG A;  3PO3 J;  1K83 J;  1XG1 A;  5E3L A;  3L1P A;  4JYK A;  2YUS A;  2ECC A;  1T33 A;  1MH3 A;  4I6Z A;  5IYC J;  4PXI A;  1ETX A;  3JRD A;  5CW8 A;  4BKX A;  2DJN A;  2B63 J;  3O60 A;  1RPW A;  3VOX A;  4M3F A;  3RH2 A;  1MBE A;  5E3M A;  1NK3 P;  2G3B A;  2DMQ A;  2HI3 A;  4NDL A;  4S0H B;  3ZQC A;  2IU5 A;  1TWH J;  5IYB J;  1ETV A;  2NVT J;  4M6V A;  3B6C A;  2W53 A;  4CGR A;  3RZD J;  4YZE A;  1A6I A;  1IUF A;  2R92 J;  3S16 J;  5F0H A;  1UI5 A;  5IP6 A;  5IP9 J;  1BW5 A;  4HKU A;  4KWA A;  1U9N A;  3HKZ N;  2CRG A;  1F43 A;  2F07 A;  4JNN A;  2NX4 A;  1RES A;  3C07 A;  5EG0 A;  2E1O A;  3OSF A;  2ME6 A;  5EF6 A;  2EQR A;  2IAI A;  2RAS A;  1DU0 A;  1FTZ A;  2K40 A;  4JX5 A;  2R5Z B;  2P81 A;  3HOY J;  2NP5 A;  2ME0 A;  5K7H A;  3B81 A;  5DTD A;  3F0C A;  3BQY A;  3VOK A;  5E3O A;  3A01 A;  1B8I B;  4J19 A;  2JA6 J;  4A3B J;  3CRJ A;  2DA7 A;  1ZTR A;  3VIB A;  4NEL A;  2XPW A;  3AQS A;  4GFK A;  3NI7 A;  1JTX A;  4C3J J;  3CWR A;  1HOM A;  4L62 A;  2NVY J;  3BJB A;  2ZCN A;  1WPK A;  4JL3 A;  4A69 C;  2X6O A;  4AUX A;  4Y52 J;  3COL A;  4JX4 A;  2R7Z J;  1JT6 A;  3VW0 A;  1WH5 A;  1IGN A;  1YRN B;  2L7M P;  3BTI A;  5IPA A;  3Q0W A;  1PUF B;  1QPI A;  5C3E J;  5IOZ A;  2V57 A;  2UXI A;  4AF5 A;  2MGQ A;  1BW6 A;  1ITY A;  2R5Y B;  4D7M A;  1Z0X A;  1ETK A;  3TW7 A;  2DG8 A;  3PAS A;  4G12 A;  3ON2 A;  9ANT A;  2PZ9 A;  5K58 A;  1Z77 A;  3S17 J;  1GV2 A;  1UI6 A;  1TWF J;  2Y2Z A;  1G2H A;  4GFL A;  3IH4 A;  2JK3 A;  3HTH A;  1A5J A;  3C2B A;  4XRS A;  1ZK8 A;  2CUE A;  2R0Q C;  1VFC A;  1IJW C;  2G7S A;  1VF9 A;  4W97 A;  2WUI A;  3KKC A;  1W0T A;  2GUH A;  4JX6 A;  4V2G A;  1GDT A;  2HQ5 A;  1BA5 A;  2CQX A;  3BTJ A;  1HF0 A;  1OCT C;  3BR2 A;  4UUS B;  2HKU A;  2I10 A;  1ETW A;  2LY9 A;  3QPL A;  5J1R A;  1R9T J;  3NNR A;  5H9T A;  1IDY A;  2LR8 A;  4FE4 A;  1MSF C;  4M3B A;  3BRU A;  3A02 A;  3AQT A;  2R93 J;  3IUV A;  1RET A;  3LSG A;  2HOT A;  3S1M J;  3ZOB A;  3NPI A;  1CQT A;  5E3N A;  2COB A;  1OCP A;  4C2M J;  1JKP C;  5FMP A;  2MW8 A;  1I50 J;  3QQA A;  1MH4 A;  2LK2 A;  5M5Y J;  3FRQ A;  1TC3 C;  3JRE A;  2RAE A;  2NS7 A;  2GFN A;  2FJ1 A;  2ZB9 A;  5M3F J;  3VW1 A;  4ICH A;  3CDL A;  1RKT A;  1O4X A;  1MBF A;  1RR7 A;  2DA2 A;  3WHB A;  1IG7 A;  3H3V K;  4NN1 A;  1JT0 A;  3ZQG A;  2IEK A;  2IBD A;  3FK7 A;  2HYJ A;  5FKN A;  3M3Y J;  4X1E A;  3HIM A;  2UXH A;  5BNG A;  5F08 A;  2DMN A;  3I4N J;  3BR0 A;  3CCY A;  4B4C A;  1E3O C;  3MVP A;  1SFO J;  1IV6 A;  1UG2 A;  3FKI J;  4B3A A;  5F1J A;  4IHW A;  1JTY A;  1LFU P;  2XSD C;  2LVS A;  1JUM A;  1P7J A;  2M8G X;  3HM5 A;  5HBU A;  3P9T A;  4D5F A;  2L0K A;  3LSR A;  2EBI A;  3LSP A;  1MBK A;  5AQC A;  2NVX J;  5F0C A;  4XIC A;  2HOA A;  3K2A A;  3Q0V A;  3MNL A;  5IOY A;  5IP7 J;  2LKX A;  1ZKG A;  1FIP A;  2ZCM A;  2DA5 A;  2N8G A;  2NS8 A;  1AHD P;  4D5C A;  2D6Y A;  2O8K A;  4UDS A;  3WHC A;  3FIW A;  3ZQI A;  1JUP A;  3HOV J;  5EG0 B;  3JRG A;  3NXC A;  1MSE C;  3GTK J;  3RKQ A;  3HBL A;  2O7O A;  5FLM J;  2JN6 A;  3G1M A;  3RZO J;  2LP0 A;  2WAQ N;  3G1O A;  3VVZ A;  2KDZ A;  3E7L A;  3BR6 A;  1U8B A;  2DA3 A;  5F0F A;  4BBR J;  1H8A C;  2Y31 A;  2H8R A;  3BG5 A;  2TRT A;  1ZQ3 P;  5F27 A;  2DN0 A;  2LFB A;  3A01 B;  2GLO A;  5HOD A;  2QTQ A;  4A93 J;  2CQQ A;  4RBO A;  1LE8 B;  3ANG A;  3HE0 A;  4BBS J;  2OER A;  3DPJ A;  2VPR A;  2VUM J;  1X2N A;  5J3L A;  4A3M J;  3W6V A;  3DEW A;  3M4O J;  3ZQH A;  3MKL A;  2GM4 A;  5FGL A;  2EH3 A;  2ELK A;  3ANP A;  3BT9 A;  4MO7 A;  2D5V A;  3GTO J;  2YVE A;  4XID A;  3FK6 A;  3HTI A;  3BCG A;  2JJ7 A;  4MFE A;  1MBH A;  1B72 B;  2DA4 A;  3B6A A;  2H1K A;  2E19 A;  1Y1W J;  5D1R A;  5K7F A;  2XB5 A;  5EZG A;  3G7R A;  1TWA J;  2LLK A;  1S7E A;  1SAN A;  2TCT A;  4MXM A;  3CQZ J;  1APL C;  5HSZ A;  3S15 J;  3VUQ A;  2JA7 J;  2WGB A;  2GBY A;  4B1R A;  2K9N A;  1LFB A;  1OJL A;  3S14 J;  5FKM A;  4ABZ A;  1B8I A;  2O7T A;  5M3M J;  2UXU A;  1MBG A;  3BHQ A;  2FD5 A;  2LTP A;  3BTL A;  2E2J J;  3HOX J;  3NAR A;  3LHQ A;  2DMT A;  2M9H A;  4GFB A;  4A3I J;  5EGO B;  2ECB A;  3HGG A;  4FCY A;  3OOU A;  2JA8 J;  5FHP A;  3HTA A;  3BR3 A;  5EEA A;  1W0U A;  3VW2 A;  1JKO C;  4BXX J;  3BG9 A;  4A3C J;  2M2E A;  4XK4 A;  3IV5 A;  1PUF A;  1AKH B;  2NP3 A;  3JRB A;  5IYD J;  3JSJ A;  1WH7 A;  2O9L A;  2OPT A;  4IEJ A;  3NAU A;  1GT0 C;  2XPU A;  4L5E A;  1QVT A;  4CYC B;  5FKL A;  1XS9 A;  3QBM A;  2MSY A;  2CJJ A;  3O8G A;  5J1U A;  3GTL J;  2W48 A;  3O8H A;  2CU7 A;  2RHA A;  2YVH A;  4A3E J;  1AU7 A;  3S5R A;  3TW6 A;  2YU9 J;  2QKO A;  5CXI A;  1U9O A;  2XB0 X;  3SJM A;  3TED A;  4EEF G;  1IRZ A;  2QOP A;  3KKD A;  3NRG A;  4MFD A;  3E7Q A;  3RD3 A;  2VI6 A;  2ZCX A;  3F1B A;  2X9D A;  5FKO A;  2JMW A;  3TP3 A;  1F36 A;  2XDN A;  4JKZ A;  2HOS A;  1JUS A;  4IHX A;  3BNI A;  3VVY A;  4GCK A;  4M3D A;  3BTC A;  2QF7 A;  3VVX A;  2HXO A;  1FEX A;  3VPR A;  1XC5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...