3QQCD

Crystal structure of archaeal spt4/5 bound to the rnap clamp domain
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
82
structure length
82
Chain Sequence
KIFAVRVTHGQEETTAKLIYSKVRTYNLPIYAILAPSRVKGYIFVEAPNKGVVDEAIRGIRHARGVLPGEVPFKEIEHFLEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase subunit b, DNA-directed RNA poly
publication title Architecture of the RNA polymerase-Spt4/5 complex and basis of universal transcription processivity.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Transcription
total genus 15
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2011-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00467 KOW KOW motif
D PF03439 Spt5-NGN Early transcription elongation factor of RNA pol II, NGN section
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.940 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits NusG, N-terminal domain 3qqcD00
1NZ8A 1M1GA 2K06A 1NPRA 2LQ8A 3QQCD 1NPPA 3EWGA 4ZN1A 3H7HB 4ZN3A 3LPEA 3P8BB 2OUGA 2EXUA 1M1HA 2XHCA
chains in the Genus database with same CATH superfamily
2CADA 4I4BA 2XMUA 3TEHB 1FDDA 1RCXB 1SKUB 3BV8A 1OMSA 5C25A 4CLUA 4DBQA 3UDVA 4KGKA 1V5VA 5C25B 3DFEA 3ENQA 5C2GA 4ZJQA 5HATA 1VQYA 1UA1A 3P6YC 2J0XA 2ZBIA 3J7A1 4ES3A 4CLKA 1WC6A 3QFWA 1MWQA 2IRUA 3W9JA 4ELTA 1N5SA 5IWAJ 4ANDA 2KYZA 5A8WA 3T9NA 4DR6J 3D7SB 5A8WB 4OV1A 1RAOA 4MK7A 3IN5A 1RT1A 5L38A 4TQSA 3B8HA 2G2YA 1TAQA 3IBWA 1FDNA 4HACB 1WHYA 1Y00A 1QVGR 1DY3A 3IG1A 5J2NB 1N56A 5KFZA 1X5TA 3FQKA 3CCLS 3AD8C 4P71A 2ZKUA 4IFVB 3NAIA 1DRZA 4X4SA 1ELOA 1DFDA 1JKHA 3TJAA 1XNQJ 1NK8A 4JOUA 3GCXP 3K17A 4RPFA 2W2QP 2K1RA 3HHNB 3MMJA 2XC9A 1U49A 2D1CA 4P74A 3TQEA 1QUVA 4UF4A 3MUVP 4W92B 1NJIT 2OPPA 1Q79A 4DV6F 1QY7A 1VISA 2E44A 2ADBA 3EGZA 1XMOJ 4DFJA 3UCGA 2LEBA 5KFTA 3OFGA 3I9ZA 3R6LB 4NASA 1FRLA 4U7UD 1VLOA 5KFUA 3PXGa 3D68A 4DU7A 1JLAA 3PCOB 3MTKA 5DRKA 1G2EA 1JLGA 1FFWB 2IJRA 2W2MP 5LMUJ 2VONA 9RUBA 3JSMA 3EXCX 1T0TV 3JSMB 3UN2A 3C16A 1RTDA 4DS5A 1WF2A 4CH0S 4XDDA 3GIIA 1RTDB 5A2QY 1XJWB 4NL5A 4ZPWR 1VI7A 2VL1A 2LU1A 3BPDA 2HKEA 4U67Q 1CULB 4DV2F 1YJTA 2L9DA 2JC0A 4JUZA 2OEKA 3OT9A 1KFDA 3I87A 1E6YB 1DARA 3BJYA 2MKSA 2B7CB 4DZDA 4GMKA 4IOCQ 2DEJA 4WZMA 1WNEA 3GJTB 3HD1A 2M8DB 2WCXA 2ZH9A 3I55S 1VMBA 3RAMA 3SI8A 3RB3A 4NLUA 1N33F 4O4RA 4I68A 3RBDA 3VVTA 5IT9Y 2FUG9 4XTTA 2IIHA 1R0AA 5T41A 3CDBA 2NLWA 4ALZA 3FCWA 4RO0A 4O3QA 3LA0A 4FPIA 2FGCA 4WP8A 2WVEA 2EG1A 5JJBA 2MSSA 5KFRA 4DV0F 2E5HA 1G6BA 2QA4S 3R2DJ 3E2EA 1H0HB 5HANA 1AROP 1VJWA 4ZVSB 1QSSA 1CS4A 5E3CA 2ZM6J 2XEXA 1C0TB 5CD4A 4R8UB 1DBDA 2ZE2A 5GMDA 1VQ7S 3CVKA 1SL1A 4UY8T 1C1CA 4KV8B 5ADZA 1C1CB 3MDFA 4I64A 2BANA 1VBYA 1OYEA 3HVTA 3GONA 2BKOA 1FF2A 4HR2A 2PA8D 3TQ1A 1Q5VA 3PHTA 4CZCA 5KFCA 2WBMA 3QJPA 2Y8YA 5KFBA 1JLEA 4DF4A 3BPSP 3LP0B 4DV4J 3L7PA 4ZIVA 1LWEB 1RQ0A 2XSJA 1D8YA 5D15A 3HD2A 2CG8A 2GJ2A 3QRQA 4USVA 4KIAA 1HMVA 5DM7Q 1RBOB 4NLOA 1LWCA 1NHVA 1IKXA 2XSFA 4L75A 1NKEA 2LXUA 4HKQA 1QJHA 4WXWA 3AOAA 4TLQA 1HNXJ 1AUDA 1P6TA 3M30A 3MMAB 3M4XA 2QYCA 1U2CA 2W7AA 1RT3B 2V68A 3DI6B 1NHUA 3UDLA 3W66A 1VHFA 2L9WA 5KOXA 2XMWA 4RNHA 1FXRA 2PMHA 4WJBA 2OFHX 4QIGA 5D3GB 1S6QA 3ZZYA 2ZOFA 1U1KA 4ID5A 4L3KA 2IVFB 4ID5B 4YHHJ 1RBAA 4Q43A 2QX0A 3MAQA 1WTFA 2UU9J 1XERA 3PX4A 2UVVA 3EUNA 1S99A 2EC2A 1KC8T 3HHEA 2Y3YA 1IKVA 4QR2A 1IKVB 1UFKA 1UVJA 2EK1A 2HNZA 4ZCMA 2YPZA 4JV1A 3N79A 4DX6A 1KNZA 3H20A 4UOFA 3MUTP 1Q78A 2AGOA 5J2MB 3I5AA 3MF5A 1FE4A 1DQ9A 2BW2A 4F0MA 1QVFR 3HFKA 2MQLA 5GAHU 3LALA 1HA1A 2KZMA 3SSRA 1MN9A 4FN5A 3Q8RB 4LF5F 1HNIB 1RT5A 2WZ1A 5IT9U 1RT5B 1UVIA 2CWXA 3JQJA 4N5SA 4LQ3A 2AYEA 4QOTA 4NCGB 1BXNA 2FHMA 2W9CA 4MT1A 1VQMS 3TVZA 3W64A 1X4CA 2KDOA 2ZZMA 5BJRA 3AA8A 1F9EB 3CXCR 4LF7F 5J1PA 3GZ7A 1LK5A 2MZQA 3BH7B 3UR3C 1NH7A 4YB5A 5KFXA 3J80Y 3NS5A 1R6VA 4O3PA 2B9EA 2KI2A 5F8HA 3DRRA 3IR5B 4AQYF 5I42B 3E01B 4DUTA 1LW2A 1YVFA 5IZHA 2HIQA 1TV6B 2ASLA 2DGWA 5DDRC 4K4ZA 3EM1A 1K8AT 1IKWA 7FD1A 4URQU 5E5NA 1IKWB 4G3IA 3C14A 3BS9A 1HNWF 1WKJA 1Q53A 2OHDA 2EFGA 2ATCB 4CRJA 2XMMA 4LR9A 4LFCF 1W7WA 2EXUA 1EX8A 2ZVIA 2HGLA 2FC9A 1IR1A 4PQAA 2JFKA 3J81j 2OLWA 4EMDA 3KLFA 5HBMA 1OSDA 3KLFB 4EK2A 5U47A 1NZAA 5LL6d 3NCQA 2F4FA 3DXSX 4DUZJ 4IYQA 1FXDA 1LV5A 3PW5A 4KT0C 3MM5A 1HWIA 5KFVA 4TU9A 2V94A 3P96A 4BC9A 1T9VA 4C97A 4B02A 2ASYA 1HW9A 1T9YA 2HNDA 3OXGA 2HNDB 2QMWA 3BQ1A 2HFSA 2MZRA 4LF9F 2YKMA 3HK2A 5E3PA 2YKMB 4B3SF 4ZPDA 1JLBA 1RWKB 1FO1A 5L9NA 2CQHA 1S1UA 4KB7A 2PIIA 3GIRA 1I94J 2XMAA 1HI1A 4QIWD 1TFWA 4JI2J 2V9WA 5ETOA 1VRQC 2E9TA 4NLWA 2CJXB 1PYOB 5F0WA 1EKSA 1BWEA 3LGMA 4OZNA 4TNOA 3EZ5A 1QAYA 5ETSA 1LW0A 2Y1IA 1SJ1A 1X4GA 2Z30B 5CCLA 4TLRA 4NA3A 3DGPB 4X65J 1JLCA 3I0RB 2CZ9A 5CYMA 4JI8J 3CCQS 4ILMA 2F5GA 5BR8J 2CPXA 3MUMP 5C24A 3J7Z5 4U8YA 2LA4A 3V81A 3CUNA 1RWXB 3FZBA 1M5KC 3UD4P 2GIRA 3V6KA 5AE1A 4ECRA 3RBZA 1TR0A 4DR4F 2ZHOA 5DQIA 3UCZP 1U1LA 1ICEB 1KHVA 1ZZNA 1FJGF 1K0TA 1UEVA 4Q8EA 2BDPA 2LCWA 3ETOA 3EVOA 3DDNA 3TR5A 1RAAB 1X5SA 3CIZA 5D6GA 4DJBA 2WVBA 1CPZA 2CQ3A 1Z1ZA 1QM9A 4IRCA 2E1CA 1PC5A 1Q4RA 5IT0A 4OYIA 4GO7X 3LGHA 3NOCA 1N36J 1VQPS 3RW6A 1ZM4A 1ZBTA 2LQ5A 1FVSA 2BOAA 1CJTA 3DHXA 3AOCA 4ZVTB 2R7UA 3J80U 1RWWB 4Q2LA 2F63A 2M8HA 1PBUA 3PV8A 2MDAA 4DX7A 4KO0A 4KJIA 4XAKA 3D6HB 1EP4A 2VA2A 1S1WA 4RNMA 1S1WB 3IS9B 3D6TB 3K2YA 5KFQA 2HMIB 2ATLA 3DLJA 2DKOB 1X31C 4PYDA 2MB0B 4QYZJ 3MECB 1N34J 3QMQA 4J91A 2GA7A 2IM2A 3R5BA 2RT3A 5DG8A 3HDSA 2H48B 3D28A 1WOOA 3TJ8A 2HZAA 1GMWA 3DYAA 2R7QA 2CVEA 1PJ7A 4F0HA 3HSGA 1S7HA 2QYGA 5KFEA 2DGVA 1KOOA 4IO9Q 4FYYB 1R31A 2IYGA 3CC4S 2VG7A 3GILA 1FFGB 2AF6A 1IBLF 1RP5A 3GFXA 1S0MA 1DJ0A 4I0WA 4P72A 2AD9A 3PACA 1YHQS 1IR2A 3L3CA 4EGLA 3BM7A 1BE4A 5H9EJ 3P3DA 4TVAB 2WRMA 4PUOA 2DGQA 5DDPC 5RUBA 3PW4A 3T1HF 3QBCA 1HWUA 2VPWB 3K8WA 1NDLA 2JH3A 2V67A 2C2OB 3MEGA 1FT8A 1TVRB 4Y6IA 1HNZF 3L7UA 1RT6A 3TUPA 2ASJA 2ZZNA 3Q2TC 4C48A 2VJUA 1MWYA 3T1YF 3MEDA 1TKTA 3MEDB 3KUEA 3MXHP 2UV8A 2CFXA 4WZQA 3CULA 1T03A 1JXEA 5F8MA 4OLPA 3PKYA 1T05A 1TKXB 2IRYA 3AODA 1T05B 3OBIA 2FHJA 5L1JA 4OJHA 3KJVA 2DHAA 2PO4A 4ECXA 2ILYA 1RHRB 2ZWPA 4DL0C 1BHNA 1I5OB 3ZTRA 2G1DA 3UW1A 1RJJA 4CI0B 5F9LA 4IRDA 2OPRB 2R4FA 1DTQB 1H2TZ 1X9MA 4WF9Q 3CCTA 2JL9A 3CCWA 1N5QA 2HHHF 3ILLA 1RI7A 4M5KA 2EFPA 2AGPA 3BH6B 2VQEJ 1PC4A 1EQ0A 2LVWA 2XLKA 2KO1A 1Y5NB 3FUYA 2NXJA 4Y2CA 3OV7A 1VC6A 1CJUB 2DH8A 4Z2XA 1ITPA 3UNGC 2KB2A 2OP5A 4Y00A 4D3HA 4KGZB 3D4JA 4WU2A 2MQ8A 5IT4A 2ZVSA 4ED8A 1Z4UA 2GX8A 3QT7A 3R5CA 2HVEA 4GKKF 3DRSB 4IH5A 1VQNS 5HJXA 4DV1F 2HFOA 4LF2A 2Q43A 2K2PA 4A8XA 2G13A 2R8KA 2H3EB 1ZH5A 1BQMA 1BQMB 1WC1A 3HSDA 2VF3A 3BO2A 3E8OA 3HF5A 4O44A 1HPZA 1Q1KA 1WC4A 4IDKA 5GAGI 3C8YA 2CJAA 3Q8VA 2NCKL 1TL3A 3F73A 1TL3B 1N4LA 2ZH3A 3QAEA 2E5LJ 5LSRA 4NXMF 3HT0A 3I5CA 5FDLB 4LUBA 3UVJA 2DNYA 3M6VA 1OYDA 4W4MA 4P2SA 3G8TA 2RS8A 1SVDA 2FC8A 2BV3A 2FZKB 3BF4A 2AYBA 2VBWA 1BWVA 1LNQA 3T1AA 3ITHA 2EVZA 4IG0A 3R1HA 5CHCB 4IG0B 5E2QA 2R2SA 5D4PA 4EI2A 4DL7A 3M05A 4H4MA 4PXDA 1S77D 4H4MB 2MLZA 4J9VA 2DXFA 2MJNA 1RTIB 2GMLA 3PRBA 1RHKB 1D9AA 4NEYA 4Q7AA 3AA9A 3VHQA 2PFDA 2BJ3A 1NEEA 4LF8J 3KG4A 3NNAA 4UZBA 4RNFA 3IRXA 3EYZA 4Y0FA 3J7YU 2I2YA 4YR3A 4OZ3A 1X4AA 1PKUA 2B6AB 2QLBB 3E3XA 2PN6A 4ECVA 4C8LA 4OYWA 3N4WA 3CSKA 2U1AA 1MMDA 4KBIA 1HWLA 1BLUA 4HTIA 4ZP9A 5I3UA 3VAIA 2BVZA 4X4RA 3HSJA 4IR1A 4DN0A 4BCAA 3K59A 2VQFF 2J8SA 2MSTA 4KQZA 3SBMA 1ULRA 4K2JA 2MKYA 1G7CB 3PTWA 5KFKA 2XY5A 3SV4A 3Q22A 5KFAA 1NH8A 3G82A 1RWPB 3KHHA 5HJYA 2A1BA 3I9V9 4MTPA 3QLHA 2BW7A 4QQBA 4DU8A 1L3TA 1FK9B 1Q8BA 4DX8H 4QYZK 3NGTA 2GAGC 3FMWA 1F5BA 5T7LA 4YQWA 2HPUA 3W9IA 4B3OB 9ATCB 2UXBF 3FSIA 4V19X 1TK0A 2OD6A 2QG9B 3KK1B 4RW7B 2BM0A 2B3TB 3MEEA 2K8GA 1S0OA 2BACA 3U1MA 4QZVB 2EFVA 1YDLA 4M5JA 2ZH8A 1JX4A 2DIVA 4C0BA 1IQTA 1PBAA 4WCEQ 1UP1A 3CWJA 2XI2A 2G0CA 1ZM9A 2GGPB 1M90T 4IOBA 4CTAB 3VAJA 3K5NA 1KLNA 3Q2SC 4HH0A 4E8UA 5B7WA 4UTGA 1NJWA 4DSIA 4XO0A 5D78A 2ROGA 2VPXB 3W8PA 1Y7PA 3KLHB 1KQKA 4LSNA 1RWVB 1QE1A 4HDHA 3P5TL 1F3VA 4ED7A 2B4VA 1OO0B 2RDIA 4UY85 2WVCA 1NHKL 5HI7A 4QU6A 4PYAA 5EUHA 2E1MC 1SQFA 4G1QA 4G1QB 2FY1A 3T5JA 3JXOA 4B9UA 1H98A 3TWZA 5D8HB 1H3DA 2RQMA 3ISZA 5LJ3Y 2VPZB 1PGZA 2UP1A 5F8LA 3JQKA 1J2VA 2BMBA 4PCQA 4X4OA 2GW8A 5F8JA 3TO8A 3OTEA 2CQ0A 3OUYA 1SH0A 3I31A 4FS1A 5KG2A 5K5MA 3GFHA 4RUCA 2AYMA 4OZ1A 5KG3A 3M2UB 3BKTA 1D3WA 3B54A 2CQDA 3NXZA 2WW4A 2OEMA 1JNZB 2VG6B 2BBEA 2DGXA 2RIJA 5EX3A 1CC8A 4J9LA 2AJ2A 4G1IA 2BE7D 1GTEA 4BLGA 4ZPVR 1SJRA 4ZHRA 4TY8A 3MEKA 1U48A 1SIWB 1UZHA 1NRKA 2WVDA 2I38A 2M88A 1XC9A 3D1OA 2AJFE 4RUBA 2E5IA 4DR2J 3CPWR 3K5LA 5CZXA 2M0GB 1TZ0A 2B8QA 4BS2A 3ADAC 1M5HA 2QV6A 1URNA 4QIEA 2B5JA 2QL7B 1ZAWA 3CCUS 2BM1A 4HI1A 3MR5A 3KLGA 1X7VA 3UR0A 4PEOA 2AHOB 1VQ9S 4JI5F 4F02A 4MMOA 4JI0F 2ZOGA 4MKAA 4YEAA 1S72S 2IY5B 2GMJA 4F2RA 2VD3A 2I9SA 1VS3A 3FC9A 3ILOA 4OI6A 3LPYA 1NK6A 1KS2A 3TARA 1WSVA 2I5JA 3QQCD 2YH0A 1HW8A 4AL6A 5F3TA 2WTFA 3BQ0A 2NYHA 5EWFA 4NLTA 5E33A 3WQPA 2MQPA 3NLCA 1IJFB 4Q2MA 3ICLA 2O01C 1KVIA 1FVQA 4DFKA 2IAJB 1UL3A 4O0NA 2DGOA 5IM0A 3EX7B 2P9GA 5K14A 4DF8A 4GKJJ 2BJ9A 3LUYA 1R8PA 3CMQA 4DXLA 3PFEA 3GJSB 4YB6A 1YJUA 5CZVA 2J76E 4NLYA 5B0AA 3DRYA 3KHGA 5KFNA 1SB6A 4FNIA 5FD1A 4ZITA 5E3RA 2HZCA 3IWXA 3NWGA 3MR2A 1M1GA 1SUQB 2LYVA 1S48A 2DY9A 1VQSA 1N32F 4Q5VA 2FJDB 2HQIA 2RJZA 1LXJA 2XGQA 2LECA 2CQ1A 2KKHA 1F2HA 3M32A 1WOSA 2MXYA 5FJ4A 2G0IA 3M32B 2IMOA 3DLBA 2D69A 3R5DA 3JSYA 2QE5A 3HFVA 2W25A 3OL9A 3FGVA 1KFSA 3HVRA 1SIZA 1KR4A 1YBAA 5D0HA 4P9SA 1CJVA 1R8CA 3HZEA 3OXFA 1J5EF 1PAUB 1OIAA 2CPFA 1HARA 2VODA 2HVIA 3MURP 1U8SA 1KQSR 1MROA 1HBUA 2VDIA 2CNOB 1MG7A 3G8QA 4MK8A 2IFXA 3FQLA 3FJ2A 1ZTWA 3H5YA 1FKPA 4ZVFA 1FKPB 1PIEA 1AA1B 4HLBA 4FYXB 2M9KA 2XCPA 5AJ3F 3JTOA 4WWSA 3KUHA 2FY8A 2IA0A 2Q3PA 1NM2A 4CLTA 3PW7A 4DL5A 4RNOA 1RAJA 3LW5C 1IJEB 2IJNA 3J81Y 1FX4A 1HBMA 4MYTA 3CJQA 1HBMB 3PFOA 2HAFA 5L1KA 4DL3A 2VH7A 2Y0SD 3BKUA 2EPIA 3ILIA 1VK8A 3S01A 3PYGA 2XLIA 3RB0A 2OIHA 2D3UA 3AXMA 4ED2A 2MQNA 1AZSB 3DOLB 2G1HA 2LXIA 3O3LA 2GS8A 1QSLA 4H4OB 2RF2A 1AXQA 1RAFB 5HQ8A 2Y9HA 3DRXA 2RQ4A 3HX9A 2ZBQA 4ECQA 3TW0A 5CYJA 4F36A 1R0BG 3I0SA 1HBNA 3IM9A 3WDOA 1Q86T 4IUFA 3CJ4A 1FNXH 1DHMA 1UWBA 4JI4F 1GMWD 2F8MA 2P8IA 5DGAA 4YR0A 1S5ZA 1WEZA 4KHPF 3OTCA 3PYDA 4QWCA 2EK6A 4HHJA 2FLPA 1C4CA 2JLFA 2AEFA 4LBHA 5GAGU 2R7OA 3D0IE 2V9KA 2M4MA 4HYKA 1NMEB 4RW8B 3TAMA 4A8WA 2V2QA 1NDPA 2J8AA 1GX5A 4Q0BA 3GSDA 4LIWA 3GU0A 2B9YA 2QA4G 3HO1A 2BKNA 2XTJP 2Q79A 4WYLA 2BQRA 4ZPTR 2NXEA 4WE1B 3MM6A 1UTAA 2IVMA 2IYIA 2BE2A 2PC6A 5KT2A 5F8NA 1XR6A 2AX1A 2VUGA 1NU4A 3OL6A 3F56A 3BREA 3KWMA 3W9HA 1YJRA 4X62J 5JMNA 5EX0A 1QD1A 1DQAA 1J27A 2YBVA 2RH3A 4LF1A 2R8JA 3CJRA 3KUGA 3Q8QB 4RZRA 1T3OA 4A8OA 3CC7S 3CMES 3HJFA 2DGUA 4A8MP 1S6PB 4OHXA 1VRTB 3PW0A 2FHJD 2DXDA 3D9BA 2VFSA 1L3UA 1QAIA 2RU9A 4F67A 3ETMA 4RBUA 3TNVA 2Z58B 2ZHBA 2IPOB 1WDTA 4UUXA 2R8IA 4F3MA 3QYYA 4CP5A 3FDSA 2VFVA 2WW8A 3NGRA 2AEJA 5FLXY 2H4YB 2XI3A 1FNMA 3DDIA 3OPKA 5LXYA 2A6OA 1IBKF 4CYUA 4OZ2A 3EPGA 4AXJA 2UXCJ 3UN5A 1CQMA 1HBOB 2MTLA 4USHA 2YPYA 2C2NA 1FRKA 1Z2ZA 2UXDJ 2C28A 3ZO7A 4I2PA 3R7NB 2BABA 2GHWA 1LWFB 4R0JA 4YR2A 3J81U 3SFGA 2DNOA 3ZZPA 1F60B 3PG9A 3H4BA 3N6MA 3GIKA 3OLAA 2UV8G 2CPHA 2FPHX 1ZPVA 2HQDA 1EKRA 2K06A 4C3LA 4ZN3A 1TU0B 1JMTA 1D9FA 2V50A 1YK9A 3PY8A 2CYYA 2A6MA 4C4WA 2LQBA 1UCNA 4RUAA 5HVGA 2ZJQQ 1Q5YA 2CJQA 1HR0F 4Y3CA 2IM1A 2M7SA 2FJXA 1NXIA 4M5HA 3QZ7A 1SH3A 3KDOA 3EVWA 4DR7F 5CD4H 2B9XA 1VQ5S 4X64F 3KK2B 2H54B 5DDQC 3BDEA 3DLKB 3R9LA 3RB6A 2V6AA 2WAQD 3VQSA 3VQTA 3VTIA 1N52B 3PJWA 3W2VB 4JI6F 4IR9A 4TQRA 3QGGA 2KN4A 1RWNB 1YRUA 3MMCA 4LSLB 5LJ5Y 2W4CA 2DR9A 4ZPBA 2DD8S 3DOKA 2J7UA 5M2RA 5F9NA 1VLYA 2B0GA 2V0NA 1B3TA 2AU0A 4AQYJ 4DQRA 5D0GA 2VDHA 1YX2A 4O4GA 2C2MB 2YX4A 2YKNA 7AT1B 3BSOA 4IQMA 4ED3A 5ETQA 2YKNB 2MLXA 2MZSA 3NL0A 1DLOA 3W2WB 1MSWD 3ZNJ1 5T14A 3T5HA 3BB5A 8RUCA 1IM6A 4WKYA 1CQNA 4LFCJ 3CJ0A 3BGRB 1U6FA 3D2WA 1Y3JA 4K4YA 3SDEA 3SDEB 4DCOB 1EIYB 1VYAA 4M5NA 5IWAF 2N4DA 4JB8B 3T9ZA 2FZGB 3MR7A 2YX1A 4DR6F 2DCUB 4U8VA 2GZOA 2EBGA 1YJ9S 4H54A 1T9UA 3AJ2A 1C0UB 3V4IA 1NPRA 4BC7A 1F5CA 1OSCA 1FX2A 2BYCA 3VGSA 4ICLB 4XIUA 2KL8A 3W3SA 4ANEA 2V8HA 1Q0NA 4M63A 2GVDB 1TL7A 2ROEA 4IH7A 4C8ZA 4DZ6A 3SEOA 4LR7A 2B7BB 5ETKA 5AT1B 3PM9A 2OFGX 2BQUA 4J9NA 2BEFA 4RNNA 1SC1B 2GVZB 3CCES 1XNQF 2GIFA 5DLGA 3JAMU 2Y1JA 2A18A 2QTWA 4KGMA 1U0HA 3MMBA 4NLXA 4LBPA 5KFGA 5A0YB 2FLNA 2E7XA 3H7HB 4I67A 2QRRA 3S8SA 3CO0P 2W4DA 2ZH7A 3US5A 2DISA 4RX6A 4N41A 2R42A 1OJ4A 3TUIC 2EWHA 2DB1A 1N5YA 4A8FA 2HFZA 1EETB 2F65A 3IA0A 2HS3A 4ZJOA 5IV3A 3H42A 3GV5B 1QSYA 1UETA 3AD7C 5LMUF 4YS2A 2ERRA 4HHUA 2LQ9A 3EXYA 3AAWB 3CJKB 5HLFB 3RRKA 3CDAA 2WOMB 3NMAA 5I3PA 3BGOP 5HVFA 3NWRA 3MOJB 2H51B 2W2NP 4FBTA 1YTYA 5JUMA 2IC3B 3K5PA 1VC5A 3CTRA 2F40A 3BSNA 2COLA 3QSIA 4JYAJ 2YNHB 1OQ6A 4O23A 1OY9A 3I5BA 2J7KA 3D0GE 1U1QA 1VQ6S 2F4VJ 4PAAA 1U47A 1YZ7A 2W8KA 1NK9A 2PFFB 1HLWA 4F0KA 2XNQA 3Q8UA 2IM0A 1N0VC 2DYAA 3W60A 2AZ1A 2OPSB 2AGQA 5CXTA 1FDAA 4IG3B 5K20B 1F9FA 2UVRA 1RYSA 4EBEA 3QRPA 2J9DA 4J9MA 5HVHA 2RB7A 2RE1A 1FRHA 2APOA 3QO9A 2DNMA 3A8IA 3QO9B 3ISNC 2DBBA 8ATCB 3IM8A 3I4HX 4MJKA 2DTJA 4B3RJ 4MKYA 4J9OA 3IAM9 3GWCA 4ZOSA 4AL7A 5L1LA 2C3PA 1WC5A 2XO7A 4F4ZA 4K2XA 3KXDA 2UUBJ 2D3OR 4NOHA 2ZM6F 1S9EB 4X4PA 4K0KJ 2JLEA 3CCMS 4Q44A 1GX6A 2CPYA 2CJKA 2GQQA 3FFIA 3CDUA 1H7XA 5GAHI 3OTBA 1RAIB 1TKZB 4RW4B 2E1AA 3RYLA 3MZIA 2M2BA 4I7FB 3BZQA 3I32A 4DQSA 2VU5A 4EZ9A 1S1XB 3THVA 4OI0A 1F5AA 2J6TA 4ZPCA 4FF1A 3UFCX 4ZP7A 3DOMA 2DHSA 5H9FJ 4DV4F 4WFBQ 1B0VA 4QW9A 2CQ4A 4NA1A 4ZP6A 3RB4A 4NLRA 3CCVS 2MGZB 3QT8A 2B51A 1RU2A 2N3OA 4QWDA 4KSEB 3WC0A 1P9YA 1LFWA 1WORA 1X5PA 2RUSA 1IUJA 3FCHA 1HNXF 1S4EA 2NYIA 4AUKA 3T1YJ 1RT7A 3MPVA 3EJMA 1RT7B 2NQPA 5FIIA 2CPZA 4OL8A 4ITSA 3M8QA 1Y10A 2N82B 2XULA 4DV3J 4JI3J 5B0CA 2JHEA 1S1VB 5HMXA 3QGHA 2PE8A 4I2QA 2HQCA 2DNLA 5C42B 4YHHF 4OI3A 3ELHA 4RWXA 1YLXA 5E3AA 3VGTA 2W2OP 2UU9F 1KVKA 1C1BA 1FXLA 1SKWA 3CJ5A 4ELUA 3BBFA 4NRUA 2AJQA 3U1LA 4C0HA 3T5LA 4DG1B 1RHUB 1YRTA 4OHZA 1UVLA 3M1VA 2OMLA 1LEOA 3JSRA 1IBCB 1FEHA 2XG8A 5HROA 1VHIA 5HROB 1GXUA 3WIUA 2WVFA 2HHWA 4FYWB 5KG4A 1Q8KA 3N5BA 5IOLA 3JYTB 4PXCA 2IVYA 3FBEA 2ZBPA 2Z2MA 4B9MA 1Q81T 1NK7A 1EQMA 1LXNA 4NRTA 1ZS6A 3MAAB 3K58A 3AH6A 4C3MA 3OVAA 4ZKAA 2OMOA 3DLEA 4R5PA 2AMCB 3QRRA 4NI2B 1NSPA 2D9PA 2FYXA 3KNAA 5I3QA 1VQOS 1OPIA 1H2UX 4Y2AA 2CUYA 1SJ4P 4P7VA 4DSEA 2CWKA 5LT5A 2MLYA 4LQ9A 1FHTA 4EBCA 2FJVA 1T95A 4F4YA 3KMSA 3BN7A 1L3VA 1ZAXA 2WONB 5BYRA 3CC2S 1GFWB 4LBIA 2OELA 5K8OA 4CO5A 3T19A 4Y65A 3ZZUA 3SXLA 4OZJA 4HACA 2QA2A 3H98A 4LREA 3GG0A 5KT3A 2CRLA 2NPFA 3GYNA 1N5VA 4BBYA 4BHQA 5J2NA 2HK3A 4NLDA 2R7VA 4IFVA 3NY0A 2JX2A 3IWNC 4ID8A 3KJFB 3DCAA 4ECSA 3KHRA 2V8VA 2OGUA 3HPOA 1HWKA 3RBXA 2RQCA 4J9SA 1H2VZ 4NXNF 3CJ8A 2ALZA 3RGIA 4NZ0A 1BQNB 4DUZF 3QT5A 4GVBB 1O0PA 2JC1A 2HLTA 2UUCJ 3H8YA 2J6UA 3CDWA 3L95X 1XEZA 4KFBA 2Q6BA 4KFBB 3NNCA 4PG8A 1NKBA 4JI7J 1CLFA 3OTDA 2C3YA 4C9DA 3DGVA 5J1NA 1UWAA 4WBFA 3DMJB 2L08A 4ZVHA 4OQJA 4D3GA 1K9MT 3A13A 2RKIB 4LJMA 2ZHAA 3Q23A 1VQ4S 3FVYA 4CLWA 2VQFJ 1MLAA 4Y34A 3LPEA 1I94F 1ZTTA 1WSRA 4DFMA 2E66A 1NCLA 1B7YB 4LVOP 5ETPA 3KYLA 2FQQB 1ACMB 1IWGA 4IFYB 3HKZD 1CULA 1WWHA 4J9UE 3OQ2A 4ZVUB 3EGWB 4ZVPB 4EO8A 2U2FA 1WF1A 3EDRB 1E6YA 3DM2B 4ES1A 3CW2C 2DR7A 1M0SA 2E1RA 1CBKA 5CH7B 4X65F 4TN2A 2ZWOA 2RILA 2HRYA 1EJ7L 2W9AA 3VR1A 3EGNA 5BR8F 3I82A 3W5XA 2DY1A 2O67A 1R0CB 2KG1A 4B9VA 3R5JB 3O44A 1NAQA 4EYHB 2DNPA 3W61A 2ZOMA 4W98A 2W2PP 2W7OA 3WIVA 1H72C 4L73A 1F0XA 3N9UC 1REVB 2KXNB 4DV7F 4U96A 3HHKA 2WK4A 1U1NA 1RTJB 4PABA 2DRDA 1YRXA 1FWKA 1K44A 5H9FK 4ED5A 2C3MA 3A12A 2VZ9A 1C0TA 3K89A 1N36F 4R8UA 4RUHA 2CKWA 5B0BA 3NGSA 1UW4A 4USJC 3VAHA 4KV8A 4B9TA 1NZ8A 3GB0A 3AY0A 3SZ2A 3DRPB 1SV5B 4MAKA 2CQIA 2QMUB 4J7CA 3FEXB 1RDRA 1SXLA 2AX0A 1G1XA 4B3TJ 2CQBA 2KFZA 3SV3A 2ZH4A 3AOBA 3IP0A 2ACMA 4QIVA 4JBCA 5B0EA 3T5KA 4C98A 4PQUA 3SQGB 1UZDA 1R7IA 4PQUB 5KFSA 5J2QB 4YMEA 1N34F 1NDCA 3LP0A 2CZ4A 2XB2D 1LWEA 1XQIA 1RABB 2LLZA 4NYZA 2KT2A 3SCIE 2V5HG 2JSXA 3KLIB 1S49A 4RU2A 1WEYA 2YWKA 3ENVA 5AXLA 3ILJA 2V4QA 5EDWA 3OFFA 2X3DA 1RWOB 4CCHA 3MPWA 5KFWA 3LP1A 2HS0A 1RAHB 3LP1B 1URRA 1NJXA 3ZTPA 5HSPA 1KBRA 2DH9A 5L9XA 1OPZA 3BR9A 1FA0A 5HO4A 5HMYA 3EPIA 3WHIA 3MMAA 3R97A 1SBRA 2ZJRQ 3CD7A 1N6QB 3PJXA 1RT3A 4WU3A 2WHOA 3DI6A 2XS5A 4N7TA 2CG4A 2DR5A 5DJBA 3TJ9A 4PWWA 4URSA 2QMXA 4KGVB 1YI2S 2MPUA 2R3VA 5D3GA 3FEYB 4FNHA 4JI5J 1UW9A 3THTA 2OSQA 3PEHA 3H2UB 5D0RA 3JQMA 2B4PA 2O5DA 3M2VB 2IA6A 1RAGB 5IFMA 4P2FA 5ETTA 3C19A 4FPRA 1S6UA 1NJZA 2Y0BB 2W9BB 4ATNA 5ITHA 5KFOA 3L09A 4X4QA 1SQEA 5KG7A 2DEIA 4ZA1A 4TKTA 3QATA 1V6HA 4XPCA 2KT5A 1JNRB 2CIMA 4UW2A 1L3KA 5I4MA 3ZFVA 2IDLA 5J2MA 2XBPA 3AQOA 3X1LB 4NWBA 5HP1B 5H1SV 1BY9A 1HQUB 4ZLJA 2V63A 2IJFA 1HHSA 2HFNA 1HNIA 1WOPA 5DS7A 2G4BA 3J7YI 2VKRA 4W90B 3ISND 4BDPA 4NCGA 5KT6A 3N01A 2VQEF 2OKQA 2K3KA 3DU6A 4ETZA 3RR7A 1YBUA 2HVZA 3IXQA 2G2OA 4M5DA 3M9OB 4M5DB 2AJ4A 2E9ZA 2XYHB 2MKKA 5J2PB 1YIJS 3NRBA 1VBZA 2MHEA 4CT9A 3BO3A 4XDCA 3UPFA 3UWTA 5HN0A 1JJCB 3GR1A 5I42A 3E01A 3GLJA 4X4TA 1R8BA 1TV6A 5CYQB 2AKWB 1Q8LA 3D0HE 2YWHA 3I6PA 1JLQB 2CQGA 4C0OC 5M2UA 1A6LA 3PRVA 2RNEA 1K47A 3AHPA 3Q8SB 1R43A 3RUBL 3G8SA 3G6VA 1MMNA 3HHLB 4WTYA 4V19J 4TXSA 1N8RT 2DR6A 1QTMA 2CNLB 2LXFA 5KFIA 4DQQA 2L41A 4CLZA 5D4OA 2MJUA 1SKSA 5D0EA 3H2VE 4U7CA 4PG6A 3MFIA 1LKZA 2CPEA 5DO2A 2E5LF 2KFNA 5ETNA 3V6DA 1ZYQA 4PKDB 3V6DB 3POTB 2PGCA 1T02A 2Z57B 3C66A 1TKDA 4ANCA 2XY7A 3CEDA 2FVCA 4G6VB 4K5RA 5KT4A 4LF4F 3A4TA 2AZ3A 3G6ES 3H4DA 1RYRA 4IH6A 2AV5A 1BD6A 4ER8A 5DZ7A 4DL4A 3GR0A 5IQQA 2G0JA 4ES2A 4F4AA 5THWA 2A0FB 2ZH6A 3O6QA 4ED4A 1S79A 4USTA 1HQEB 1RT4A 1FE0A 1RT4B 2Y8WA 4LF8F 1I1GA 3NBPA 1UPMB 2MYFA 3NBPB 4BWJA 1YJWS 2V4RA 2ILZA 3BGFA 1S1TB 2DGTA 3P5BP 4QWBA 5GMEA 2O3DA 3DGPA 3M6WA 2ABYA 3I0RA 2XGPA 1KSPA 1X5OA 3G2XA 4HH1A 4B9NA 2KXFA 2YNGB 2LEAA 4PG4A 4DX5A 2RDDA 3RR8A 4WFAQ 4F8RA 2CXEA 2P6TA 2PI5A 1PJ6A 4CT8A 4WIIA 2CJYB 2C3UA 3W65A 2GC8A 1N54B 3IR6B 2BRKA 2YXLA 4ECWA 3P4UB 2FVSA 1IM4A 1FTRA 1JIHA 2DVIA 1HD1A 3K8VA 1RKJA 4WFNQ 4WFZA 1WG1A 2EFOA 3EE3A 3IBCB 4U9RA 5D4NA 3HHLC 4C8OA 4KPCA 2W24A 2YNFA 3PYEA 2BE9B 2YNFB 1Y3KA 3BEGB 3T3FA 1GMVA 2AQ4A 2N4CA 4WFYA 4C8YA 3VVUA 2NPIA 5CAAA 1HKAA 1HI0P 2NUHA 3HM9A 3M6XA 3ZC4A 2HBYB 4N8OA 1LWXA 4WK3A 2OSRA 3VWSA 2BQ3A 4CLPA 2R7TA 2VA3A 3QGPA 2ZBRA 1TL4A 1GXLA 3AB2B 1F6TA 3OTOJ 2ROPA 3DNCA 2BJDA 3H59A 2EEYA 4OX7A 3IS9A 3KNGA 2HMIA 4C8MA 4OIXA 5CA5A 4Z7CA 3MECA 3IBFB 2V8PA 2Z0GA 4O3OA 2MQQA 3FK4A 1DQ8A 2HHTA 2XYPB 2Z8QA 3W8GA 1RT2A 2R2TA 1RT2B 1NUEA 1JQGA 1HD0A 4DSJA 1KTVA 4OYMA 2VBYA 3MR6A 4HL9A 4DR1J 4ZVGA 1LK7A 4KHMA 1GNKA 3PX0A 4TYBA 4OI4A 1WDDA 4ZLLA 4AD6A 4CO4A 3B78A 2XS7A 2MEWA 3H90A 2MZ1A 3OR2B 1Y4ZB 1V3RA 4OYXA 2LKZA 2NZCA 3W5YA 2UUAJ 1KEKA 2MKIA 1L3SA 4ZPAA 2ZH5A 3CD6S 3QIPB 3BO4A 3Q86A 1X9WA 3LGNA 1N0UA 2GHPA 2DNQA 5IXUA 1M5PC 1KWMA 1X4EA 1BC6A 3B6BA 4A8QA 2HAIA 1KQFB 1XN9A 1UVKA 4UQTA 2LP4A 1TVRA 4ZVOB 3S6EA 1U0SA 2CVIA 4GC6A 2FJEB 2JEIA 5GAEU 1SC4B 3ZZOA 2YWGA 3DN9A 2YQ0A 3TX0A 1RKIA 2ACYA 2PMWA 1B99A 4DR7J 2HWTA 4DR2F 3GYGA 4USKA 3BBBA 3OSPA 4B3MJ 2OPQB 3NCPA 3M8WA 1TKXA 5EHHA 2NR0A 3VF0B 5E41A 1ZAVA 2D74B 4UT4A 1VOMA 1H73A 1EARA 5JXSA 2XWYA 1XNRJ 4PXEA 2M5YA 4JI6J 4U6PA 4LFAF 2OPRA 1DTQA 4DV5J 3V4MA 5A8KB 4OYAA 5SUHA 4R0EA 3NS6A 1F9HA 2FJBB 1NSAA 3T41A 3CNQP 3C15B 3VAGA 4F3OA 1S6OA 4RW9B 5G0RB 1CJUA 3CB4A 4QBUA 1RACB 1O5JA 4ZP8A 4KHRA 1H38A 3O8WA 4X4NA 4OJGA 6AT1B 1YJNS 3HXMA 4YUDA 1NJYA 4DPTA 1CSJA 3V6JA 2GQ2A 3ONQA 1T8EA 4LF6J 1UJ4A 1W26A 4NLQA 1V3SA 2B4OA 5KOWA 5LMNF 3DRSA 3LP2A 4GKJF 2B8PA 1FI4A 3LP2B 5F8GA 3DLLQ 2C1EB 4M5MA 1RT1B 2EFNA 3C6UA 4OX9J 5AXKA 4AE5A 3C6UB 4LFBJ 1NDKA 1D09B 2CDQA 2EKNA 3A3PB 5D4LA 4F2SA 1AFJA 4DSFA 1L5UA 3IG1B 3TZXA 5L1IA 3JTPA 5EWGA 2QFIA 1WG5A 4DR3F 2X1GA 1PO6A 1D8ZA 2AW0A 2LA6A 1UJ5A 5FDLA 1JKHB 2RRAA 1WHVA 2K1RB 1Q7YT 2I0XA 4L76A 5KG5A 3PEJA 1EB0A 2VFRA 2P9EA 2J6SA 2OPPB 3G4SS 2RHQB 1RU1A 1XR5A 4DSLA 2NS1B 4X66J 3DKDA 1GMUA 2BJ8A 2DT9A 4ILRA 4MIAA 4FXVA 4ZCIA 4OX6A 1RTIA 1T94A 1OS5A 4FVMA 2XZWA 1SJFA 1JLAB 3PDNA 4CO3A 2HIYA 4O0IA 2W8LA 2HHXA 3TA2A 3GIJA 1JLGB 4P7TA 2DRAA 5KG0A 3C16B 2VJVA 1IQZA 2DCLA 1I3OB 3DDKA 2B6AA 3UD5A 1JJ4A 2RRNA 1TUWA 4USWA 1P8GA 1HQ2A 4NEZA 2YWWA 1BGXT 4B9SA 5DG7A 2Y1LB 4I1TA 1SC6A 3H5SA 4DPWA 5HQMA 4G1PA 1M5VC 1SL0A 2MQMA 3HZGA 1TUVA 3MCNA 2HSEB 2ZBCA 4YY3J 3VAFA 4IOAQ 4N56A 5KFJA 1YG0A 5G4DA 4A46A 2YQ1A 2DJWA 4FZVA 2XMTA 2GV1A 3N5FA 3SCKE 1FK9A 5HAOA 1NPKA 2BOPA 2AIRB 4HEA9 1FKAF 1R0AB 4F3QA 2JLGA 1ZM2A 2BZ2A 3S7RA 3D3BJ 4B3OA 1AT1B 4JI1J 2CPJA 3KK1A 4RW7A 3TZYA 4CLYA 3GCWP 3QWPA 1B64A 4QJVA 4ECUA 4JV5J 1Q95G 2NUUG 1IBMJ 1CS4B 4PXBA 5DQHA 1X4HA 5BXIA 2DK2A 3GTYX 4J9QA 3K5OA 4WFXA 4UOHA 5A6PA 2HHUA 1EHWA 2GGPA 2FLOA 2ZE2B 2DNRA 4CTAA 4O3SA 2XY6A 4LRFA 3JSBA 4BWMA 1W2BR 2BANB 3FKBA 1XK8A 3IAS9 3KKFA 4YB1P 3HVTB 1C2PA 2HRUA 4PPZA 4QU7A 4CM2A 4DPXA 3KLHA 4ELVA 1AUSL 4E2FB 1Y5LB 2G9OA 4FYVB 4WK1A 3NKYA 3B82A 2OTLS 4KGXB 2VKZG 3M7VA 1E6VA 1B0PA 1JLEB 2YWFA 1AFIA 3K7RA 1M1KT 1E6VB 3RJMB 4X62F 2J9EA 3H5XA 1ZPWX 1FRIA 4YDXA 3QJLA 3HP6A 4DR5J 2XO6A 1HI8A 1S10A 3MGJA 4AL5A 3KHLA 2XSJB 5F0UA 1VQ8S 3NCRA 3OHBA 3TYTA 4TU8A 2RU3A 1HMVB 2FHKA 1LWCB 5GADU 1FRXA 1IKXB 5B09A 3SYZA 1R8HA 2LEPA 3H40A 3G6YA 3NGDA 2E29A 3DXBA 2OH2A 2AWZA 1ZM3A 2C22A 1XMQJ 2MKJA 3M2UA 3EWGA 2XZTB 2JJ4D 1Y11A 2VG6A 3M30B 4ED0A 4LVNP 4ENOA 1UA0A 4F04B 3CT9A 1R27B 2WBRA 2KT3A 1VIOA 4KPYA 3PX6A 4ED6A 1G4CA 2UXCF 1H7WA 4DUYJ 2F8EX 3G86A 2CA9A 4LSZB 3TA0A 3V6HA 4ETXA 1S6QB 2UXDF 4PG7A 5K8MA 4DLEA 1T9WA 3HLUA 2RRBA 1FJEB 5A2QU 3LTOA 2NREA 3M8YA 1SJ3P 2GIQA 3AB4B 4P73A 4N8NA 2B43A 2OO4A 1U1OA 1GT8A 4EZ6A 4FYDA 2QZ8A 3R2CJ 3KK3A 3TZWA 3KK3B 2ZEJA 4DHVA 1WEXA 1SCJB 2HNZB 3TUJC 4EYIB 5KT7A 4K4XA 3X3UA 2QJ3A 4I6YA 3CJSA 3HHLD 2QA1A 4EUVA 3PIPQ 3UI3A 4HDGA 4MYUA 4NE9C 1U24A 4MK9A 2KVIA 5DZ6A 3CGIA 2ZD1A 4UZCA 2ZD1B 1PILA 3SIPB 2XMVA 2MMYA 8AT1B 1I51B 1UVNA 3R3TA 4Y2MA 5KFHA 1D9DA 3KTQA 2RD5C 4KE5A 2HHQA 2QT7A 2W9CB 2JVRA 2HQ3A 1VBKA 3HMJG 1NO8A 5L46A 2QLWA 3VV2B 1WHXA 2DHXA 2XCAA 2IAJA 4LRCA 1TK8A 1D0EA 3AQPA 1X60A 2RSQA 5BYQA 2HFUA 3D6FB 2F9JA 5B0DA 1K73T 5LOQA 2IBOA 3DRRB 3R5AA 3LWMA 3JB9k 1CJKA 4IKAA 1CJKB 3A1YG 1LW2B 4P2MA 3TUZC 2UUWA 4UOCA 3MD1A 3L4BC 2R8HA 3C14B 1SUQA 3T6JA 1BUXA 1FD8A 3TRGA 3MI7X 2HRTA 4HHHA 2AEMA 4DWIA 4L74A 5HK4A 3U27A 4OFZA 2XWXA 4XK8C 3D66A 4RU9A 1VIXA 1RHQB 3HVWA 4A47A 2N3LA 3PNIA 1JXVA 3GYXB 5HBMB 3GFYA 3RAQA 3TANA 4OHWA 4NXNJ 2HVHA 1P1LA 2K7JA 3BSAA 4R25A 4DV6J 1VC0A 4ECYA 3MM5B 2LDYA 3F44A 2VASA 4ECTA 1OQ3A 1FJCA 3EICA 2P9CA 4OI2A 1RB0A 1QAXA 1YKWA 4Y2IA 3CCRS 2R9LA 2FDNA 3HSZA 3A8EA 5DETA 1JLBB 1S1UB 1VR6A 1VK3A 3GV7B 4M1KA 4DQIA 3PJ9A 4RJVA 2ZJPQ 1SL2A 4M5IA 4ZJLA 1X0PA 4FS2A 2KHDA 3KDNA 2B56A 5KFDA 1I6JA 4RBTA 5AXMA 1RA7A 3H2LA 4DV2J 4GVLA 3LAMA 3OD2A 4OYOA 3GJQB 1GQEA 1REGX 1TQLA 1LW0B 4ECZA 4CH7A 2JFDA 4FDFA 1AZSA 1JLCB 3DOLA 1RTZA 4K4SA 4H4OA 1JK9B 1S12A 1M1HA 3QZ8A 5CYMB 2VV5A 5A76A 3PYFA 3QIDA 1S7IA 3OSNA 3RW7A 5C24B 5F8IA 4J9KA 3D67A 4HT7A 4ZDNA 5C7PA 3HI9A 3V81B 5AE2A 1VGYA 2QO3A 1N33J 4TYAA 4EFAC 5EGYA 2E7VA 2RQKA 4DV7J 1HYSA 2RMLA 3PIOQ 1U8WA 1HYSB 2JRSA 1T7PA 1B0TA 3QNWB 2W1BA 4CNZA 2KM8B 3F0NA 1F2GA 4JYAF 1WC0A 1XR7A 4DV0J 1X4BA 2YQ3A 2F4VF 1FTCA 4C11A 3LOUA 4C11B 4RW8A 1CEZA 3EDQB 5CABA 1SH2A 5L39A 2J5AA 5K8PA 2HEKA 2YKPA 4NZ6A 4XPEA 3OL8A 2MZTA 3NS7B 3RRGA 5KFYA 4UUWA 1CJTB 4QWAA 2RDJA 2KZZA 1KRPA 2KXHA 3FCVA 4CLSA 2ZITA 1R8AA 1VJQA 3Q0AA 4QPXA 4CO2A 1FRMA 2VIHA 2AJ1A 4PRFA 4WE1A 2HGNA 3C2PA 4KO0B 1EP4B 4EBDA 3F41A 3Q83A 1U26A 2G2ZA 1WACA 4NMXA 2HGMA 3M8PA 3HULA 3M8PB 1KD1T 3ENAA 4B3RF 3FEZA 5LXRA 4C8NA 4J37A 2UUBF 3MFHA 3HFZB 4RLEA 4K0KF 1UMJA 2JWNA 1UEUA 4J5OA 2OTJS 4A8SA 4HT5A 3DYAB 1S6PA 2DIUA 1NPPA 2ZC3A 1UFLA 1S0NA 1VRTA 1YGYA 2PEHA 1S9GA 3DC2A 2JZ5A 1S9GB 3MM7A 4CO0A 3MM7B 3GIMA 1QUPA 3BN4A 2GO9A 5KG1A 3OVSA 4FKYA 5BYSA 4EWTA 1DAXA 3QPIA 2VG7B 3FZ2A 4GC7A 4O3RA 4WKRA 5DLFA 1FESA 2JNJA 1YBTA 5MAOA 3JAMY 2KTQA 1Y5IB 3EVMA 4PUOB 1HBOA 1U2FA 1HIYA 5KFLA 3W7BA 3N28A 3HKWA 3IR7B 4JV0A 2NSBA 2BR0A 1RK8A 4OZLA 2KM8C 1CC7A 3MEGB 4YB7A 5JVHQ 2ZKTA 1LWFA 4QCLA 4NLPA 1KP6A 1RT6B 1YSJA 2HBZB 4X2BA 2OEJA 4NPOA 2FB0A 4K4VA 3GPAA 1TKTB 1TL5A 2C2DA 1PYSB 1T03B 4DV3F 1AYEA 2O1PA 4JI3F 4IQXA 3A3OB 4MKBA 2GCFA 3KJVB 2ADCA 2D7SA 2V2ZA 1X4FA 3RG6A 3ZNUA 2VHGA 1PJ5A 2QC3A 1Q8IA 5DQGA 4LF5J 2KYXA 2QFJA 3KK2A 1HNVA 1HWJA 1F3FA 1HNVB 4H4KA 1S9FA 4CLFA 3C46A 2QL9B 3DLKA 4YN3B 4DLGA 3UCUP 5KFPA 3BYRA 4KR0B 1T9TA 1YWXA 3PR5B 1WD6A 4KC5A 3W2VA 1GTHA 4LF7J 4OYBA 2E9RX 1U25A 1P1TA 2L3MA 2CNNB 5B08A 4QR0A 4LSLA 4ZK7M 2AT1B 2YNIA 2HNYA 2YNIB 5C5JA 2QSWA 2HNYB 4MIBA 2YVSA 3IC1A 2QN6B 2Q66A 4DEZA 1U4BA 2RHSB 3H0PA 3AJDA 4USMA 2DXEA 2FLLA 3HVAA 1X4DA 3W2WA 1JWWA 1HNWJ 5DGBA 1MNEA 1DURA 1B70B 2NXNA 1YJ7A 4F7VA 1WJ9A 1MN7A 1RLDA 3BGRA 4O44B 2ZH2A 5J1EA 1HPZB 5J1EB 2ZUAA 2XHCA 1TMMA 3MM8A 1GXTA 3MM8B 4IDKB 5M2PA 4USUA 2JEFA 1UEKA 2D3O1 2PD1A 4I6WA 3T6BA 3HJVA 3R5GA 2VC0A 1C0UA 4JV2A 3UVJB 1FDBA 3VALA 2M70A 2I1RA 4ICLA 5ETRA 2C2KB 1FERA 2GVDA 4PG5A 4LF4J 2YX7A 1S57A 3ITHB 3LWLA 2W7PA 2YKAA 2HBRB 4J9RA 2UVUA 4LRAA 1U09A 4LF9J 3VAKA 3HHDA 3OLBA 4B3SJ 2ZDOA 5E7OB 2GVZA 2BJEA 4I6AA 1RISA 3FRZA 1B7FA 4P2XA 2X1FA 4H4KC 1NK0A 3GSIA 1V3ZA 3QWUA 1ROFA 2ZZTA 3IRXB 3OHAA 3CD5A 5A0YA 2FGOA 2RUGA 3QAUA 2UUCF 4P6QA 1XMOF 1O51A 2CAJA 2DPJA 1FCAA 2X1BA 2N7CA 1HHTP 2PEBA 1RLCL 2LQJA 2V69A 5GVQA 1EETA 3V2UC 4JI7F 4DSKA 1U45A 2X51A 5I3UB 4KY3A 5SZTA 2R7XA 1TAUA 3MR3A 3J7AN 1WUUA 2UZAA 2XZDB 3MM9A 3MM9B 1ZETA 2F9DA 2RAQA 3CJKA 5HLFA 2FHOB 4KH0B 2WOMA 3BDPA 4DR4J 1ZZFA 3TVYA 3W1YC 3G71S 3G82B 4NLSA 4Q45A 2R7SA 1FJGJ 3SCJE 2WSEC 2IC3A 5LSLA 4X4VA 3VZIA 3MCOA 1VFJA 3QLHB 2FZCB 2YWEA 2YNHA 2HS4A 2LFVA 5T7LB 3EMTA 4OJ1A 4ZLNA 3FMBA 5ETVA 3CMAS 1R6YA 1ZA2B 3MEEB 1ZA1B 2BA9A 2OPSA 3HCXA 4IG3A 3TX8A 3U02A 3MCMA 4F50A 2DNNA 3LF0A 1WELA 1MMLA 1QAJA 3KMQA 2HWIA 2ZFHA 4B9LA 1KN6A 2BRLA 3RRHA 1VCTA 3BR8A 2QIFA 4LRDA 2DNHA 3ZTOA 2H5JB 1S97A 5H9EK 4JP8A 4LSNB 1S9EA 1TK5A 1KTQA 1QE1B 1FEEA 2GFFA 3BYPA 3GG1A 2Z2LA 5MLCV 4K8RA 3PO4A 4F26A 2LMIA 2DH7A 3RAXA 2ALYB 1NBEB 4YDDB 5IQ6A 3GQCA 2FD2A 5F41A 3UN3A 3K0JA 2VPYB 1TKZA 1LQ9A 4RW4A 2DGSA 1NNDA 5F3ZA 1TTHB 2A2DA 4I7FA 3W63A 2KJVA 1VDHA 4KRWA 4B3TF 2XMJA 2DO0A 2EFQA 1U1PA 3O5TB 3CJ3A 4DS4A 1S1XA 1IBLJ 3OUYB 1XWLA 2C3OA 1A0OB 2IRXA 1U6ZA 2JOQA 3B4DA 4TU7A 1PG5B 1LFPA 3OR1A 1BMQB 3OR1B 2OJ3A 3ZXWA 3IWLA 4OMFG 4U95A 3T1HJ 4F25A 1ZOTA 4QPTA 4K59A 3SSSA 4DPUA 1U2RA 2MGZA 2CQCA 2VFUA 3MPUB 2IDEA 1O6XA 5EN1A 3DU5A 1M5SA 2DPIA 2GHVC 3R6GB 4ZHRB 3QT6A 2ZNZA 3DHWC 4TY8B 1HNZJ 2MKCA 1FNOA 3RU0A 2KRBA 5JVGQ 1KVJA 1UKUA 1VQKS 2DNKA 3TOQA 2HQFA 4O3NA 1LOUA 5C2CA 4M5GA 3ZZZA 1J5OA 3KG1A 1J5OB 5ETLA 3GFZA 4DFPA 2HYIB 4DCPB 2F8HA 1RCOB 3CDEA 2J7WA 3B4MA 3R7BB 2B5JB 1EAYC 2F7VA 2HBQB 1S1VA 4N47A 4PWUA 3LO3A 2NZ4A 2MQOA 3KLGB 1SC3B 5C42A 1KKHA 4LFAJ 3M2RA 2RS2A 3M2RB 1Q7LB 2E5GA 3V5RA 2W01A 4LMZA 3BGLA 2DNGA 2HHHJ 4NA2A 3UO0A 2IHR1 2C42A 2PI4A 1IXKA 4WYWA 2D9OA 3EGVA 6FDRA 4C2MA 4KTQA 1IR0A 4DG1A 1N48A 1RHJB 3QGIA 3CF5Q 3BKFA 1SPBP 1NKCA 2IMWP 2CDRB 4L72B 2I5JB 2FVPA 2POKA 2E5JA 3JYTA 2BJ1A 2H9ZA 1WF0A 5IC4B 3CCJS 3U1NA 1HL6A 3MAAA 3JS9A 1K1SA 4F4WA 3Q89A 3TAQA 2X1AA 5IM0B 1WI6A 2AJ0A 5LMNJ 3KJQB 1FWPA 4GKKJ 4NI2A 3C6TA 2V8GA 4OI1A 5K14B 3VZHA 2EC0A 3C6TB 1UPPA 4DV1J 1RWMB 4ZCKA 1RZMA 1OWXA 2M3DA 2LU2A 4NLVA 2J0SD 2GAHC 4PZVA 2D41A 3KJNB 2R8GA 2V34A 2DHGA 4LRBA 3CIMA 2V8DA 2NXCA 4DR3J 3GV8B 1XBWA 2K7KA 2KU7A 4P75A 2WONA 2J0QD 1MW7A 1Q82T 2R2UA 3M8RA 1QLNA 4RBVA 3CO9A 4NXMJ 1KONA 3VCDA 5CCMA 4X4UA 5GMKa 3MPDA 1GH8A 2KG0A 4ZVEA 3K57A 3P8BB 3C3LA 1CJVB 2XNRA 4DI6A 2HQGA 2VBXA 4DCJB 4CNYA 3MTJA 2VC1A 3L9ZA 4FP9A 3ZZ0A 1MROB 1HBUB 1UAWA 3NOGA 2IBKA 2HG4A 3K5MA 1T3NA 1GK8A 4DQPA 2VG5A 2VG5B 1GAOA 3IO1A 1FRJA 2WB1D 4CM0A 2RVJA 1BQNA 4WTOB 2BJ7A 2Z56B 4GVBA 3AXKA 3TZZA 4QWEA 4FKXA 4QIFA 1M5OC 2A2CA 3M8SA 2VICA 3D5MA 4USIA 3BSCA 2AYGA 4P52A 1NSQA 4YFUA 1K0VA 3A3NB 2Z4PA 3DMJA 4DMZA 1PAEX 4AXIA 4I56A 1WHWA 3ULHA 5B0GA 2RKIA 1HFEL 4ZIWA 4WXOA 2W4PA 1BQXA 3M8ZA 3I96A 2YTCA 3JTNA 4K4WA 2RF2B 3OJUA 4JI2F 1WKLA 2KVQE 2J9CA 3AJ1A 3CCZA 1FJ7A 4IFYA 2R2RA 3NNHA 3IMQJ 4ED1A 4NCBA 3IGNA 1YJVA 3I0SB 1HBNB 1OY8A 2E1PA 4HTJA 3DM2A 3SFUA 2QL5B 3O2IA 4IO1A 2FIUA 3D54A 1UWBB 2X3GA 5B0FA 4NCAA 1NSKL 2B9WA 1RTHA 4K5SA 4FF3A 1RTHB 1A7GE 2NXUA 3PW2A 4RW6A 4JI8F 1IKYA 4C3KA 2CPDA 2GJIA 4RW6B 1IKYB 4N77A 2UXBJ 3DLGA 3DLGB 1MU2A 5AE3A 1B4SA 6FD1A 1MU2B 3TVKA 4ZVQB 5ETMA 1KDNA 3PHEA 3FBCA 3ZTSA 3TAMB 3PRDA 5D77A 1REVA 2ZC4A 4ILLA 4Q0BB 5GAEI 2XS2A 1RTJA 4ZCLA 1SQGA 3BQ2A 3TP2A 2Y1RI 1XMBA 4S0MA 3G6XA 3W62A 1P9QC 4TY9A 1C4AA 5A6WA 2XMKA 2PT0A 1Y0HA 1O8BA 3S1TA 1PYTA 2VFTA 3MM6B 2VOPA 2BE2B 2XQCA 3LH2S 1WC3A 1Z2LA 4QYRA 4KKOA 2JEJA 4FXDA 4K4TA 4KKOB 4OV6A 4K7QA 3DRPA 1SV5A 1XIQA 2HVDA 1U02A 4J90A 1CG2A 1GEHA 1PSDA 4OZ0A 1G3OA 3I4PA 1FWLA 2SXLA 4RWWA 3SQOP 4OX8A 1TMJA 4WPAA 3OTOF 1K1QA 2H65B 3OVBA 1WTBA 3ZZRA 1FKOA 3SQGA 3RZAA 4F4KA 1FKOB 5J2QA 2V2VA 3FBBA 1WKKA 3UNYA 2H5EA 2K3IA 3EZOA 3EZUA 4GO5X 2Q1LA 4I69A 2DO4A 2C2EA 4OJ3A 4A8KA 3KLIA 3D6MB 3OL7A 3TI0A 3MOZA 3FSXA 4CYUB 3L7OA 4AFFA 2XLJA 4DR1F 4AYBD 3KFWX 2XYGB 3KLEA 3I56S 4DPYA 1TP7A 2PSZA 3KLEB 3SSQA 3G87A 3IGVA 5E3QA 2HLUA 2LDIA 3MPYA 4I2PB 4ERDA 2UUAF 5K9FA 3ENWA 1Q16B 1N6QA 4C7QA 2EG2A 5AXNA 2IM3A 2WB4A 5EWEA 1AB8A 2KHCA 4WIQA 2R7RA 2DRBA 1RSCA 3IFEA 1S4FA 4V1Ak 2WSCC 2MY7A 2OUGA 4F4XA 4EU0A 4OYZA 3LAKA 2DHHA 3M2VA 4JI0J 2PMZD 1W2IA 1TFYA 4G65A 1NB7A 1S59A 2CQPA 2W9BA 4ZMMA 1TL1A 4CDIA 3KOAA 1TL1B 4B08A 1NLKL 2HW3A 2EBEA 3N6NA 4B3MF 4PWDA 4OZ5A 4PWDB 2BX6A 4ZVRB 3ET6A 4RL1A 3ET6B 3H5UA 2H4WB 3UQSA 1XNRF 2CNKB 5HP1A 1HQUA 4P10A 5HQLA 2MZJA 1U1MA 4KH1B 4DV5F 3PKMA 3D1HA 3MMCB 2KFYA 3CE8A 4CQ1A 2L48A 4RKUC 4UOGA 3DOKB 5IV4A 3VGUA 3NEKA 2E7WA 2DNZA 4O4GB 1CVJA 2AP6A 1SJQA 4N76A 3NGKA 3FNNA 3AT1B 3ZZTA 3A8JA 3E51A 1X0FA 2X7IA 4MFBA 3IRWP 3NG8A 1DLOB 4MFBB 5J2PA 2ZNYA 3N0VA 1DZ5A 4A8YA 1N32J 1QDUB 2PA3A 4NMLA 5LSOA 1WI8A 2OD4A 3P45B 4HVZA 4A4JA 3BBCA 4U7UK 4K4UA 2YY3A 3WBZA 4LF6F 5CYQA 3MD3A 3M6UA 4A48A 2QLJB 4QR1A 1JLQA 4M94A 1RADB 5CQGA 1R3NA 1A9NB 4HI2A 2I6WA 1VQLS 2I8EA 1H74A 1J5EJ 1DTTA 5KAKA 1DTTB 3AD9C 4OX9F 3V4IB 1QTNB 3HHLA 5IS2A 2B4UA 4LFBF 2CQ2A 1VBXA 1JXLA 3VGVA 2HWHA 2CJ9A 1TL7B 4M8LA 3R27A 4Y2KA 3CCSS 4PR6A 2R7WA 1IWAA 5AJ3J 4YP3A 5FLXU 2N7YA 3R1LA 3TEGA 4FBUA 3MCSA 2J0WA 3SCLE 3MAHA 2QLXA 4KAIA 1IN0A 2ZUGA 3POTA 4WP9A 2EW9A 5DM6Q 2GO8A 1H6KX 4C6AA 2M52A 4URGA 4M95A 1PCAA 3D1QA 5KT5A 2BKPA 3OXLA 1U0HB 7FDRA 1KLMA 1T11A 3R7SB 3MMBB 1KLMB 2EI5A 2KJWA 2J9DE 4X66F 4EEYA 5DG9A 2QLFB 4C8KA 3MWBA 4DDFA 3PVXA 2C2ZB 2GQCA 1X9SA 3BGUA 2F1FA 1N5YB 1YITS 4QW8A 1Y9OA 4DOZA 2KH9A 4Q8FA 2MKHA 3FBFA 1HQEA 3LANA 1MWZA 1WG4A 4CLLA 5L8RC 3TA1A 3WC2A 3J7ZT 1V5IB 2DR8A 4OLOA 2JVOA 2Q6CA 4X84A 1SI9A 1U1RA 1SKRA 3PO5A 4FVCA 2P6SA 4Y28C 1S1TA 5GADI 1KHWA 2BXJA 4JI4J 2QSFA 3GE9A 5E0OA 3U7JA 2CZVC 4KHPJ 3UD3P 5KTQA 2OAUA 5IC6B 3NP5A 2YNGA 1FD2A 2HFVA 1S76D 2P5VA 3G9CA 1UFWA 2GMHA 4RR5A 2L9NA 3NAHA 1V9OA 2UUTA 4L3NA 2HHSA 4YY3F 2FJWA 3SMZA 1N5TA 3QSYB 1AW0A 3A8KA 2JDJA 2MY8A 4ZLPA 3O1LA 3FRYA 3PR4A 3R8YA 3DLHA 4OYPA 4FF2A 5HL7Q 3AFGA 4OHYA 5KFFA 1HHQA 4WP3A 1RA6A 4NX9A 4FF4A 4L6V3 3GJRB 3THPA 1S0VA 1OY6A 4CH1A 3OFEA 2GNKA 1RXOB 3N6LA 4JI1F 4E98A 3WX8A 3WX4A 4J9PA 4UQGA 4JV5F 1IBMF 4KYZA 2WSFC 4K50A 2P2CB 4MKVA 4LR8A 3PZPA 4NZ7A 1R89A 4NYOA 4LIRA 4NLGA 3W5ZA 2ZDPA 5KG6A 5KFMA 2F3JA 2EKYA 1U7LA 3FFIB 3QFHA 2H1YA 3CJTA 1P27B 1NB2A 2YKOA 3HT3A 3LQVA 4GRSA 4CIOA 5A8RA 1NK5A 4ZS6A 3P49B 5A8RB 2DITA 3Q8YA 1RWUA 1W25A 2VOOA 1VRUA 1VRUB 2A10A 4DL6A 2ZH1A 3WZ0A 1D1UA 1XTZA 2HZVA 2Z2ZA 1IBKJ 1JJHA 2XHWA 4Z37A 3DOMB 4AT1B 2V4JA 4NYPA 2Z2YB 2V4JB 4DR5F 1TELA 2FJAB 2V2KA 2CJBA 4LT6A 3NMRA 4CWBA 3NGUA 1RGVA 3D3CJ 3GP9A 3OR2A 2QGFB 1APSA 2UVWA 2PDAA 2FTRA 1RBLA 3RBEA 4PPDA 3Q24A 2D3ZA 5HMZA 3QIPA 4FXWA 1XMQF 1YZ6A 4M5LA 1F1BB 3UDCA 2CPIA 3QJJA 4ZN1A 3TAPA 4B17A 2VBZA 4E0DA 3M8QB 1N88A 2HURA 3H25A 1NK4A 1KOHA 1JB0C 3VAMA 4DUYF 2YH1A 3MHYA 5LM7E 3UDEA 1HR0J 3Q8PB 3OW2R 4I2QB 2NSCA 1KQGB 2JEGA 2O66A 1T9XA 2QEXS 2YKQA 2KRRA 3KLVA 1JLFA 1JLFB 2C2RA 4X64J 1UVMA 2MHNA 2OPQA 1C1BB 5K8NA 3FSYA 1RAEB 4OHVA 2GJFA 2HK2A 2LQ8A 3CD0A 4DN9A 3G96A 3RTVA 5HMWA 3M9MB 2HHVA 3M1VB 1FFSB 5DDOC 1RHMB 1U6BA 2H5IB 3UE2A 4MH8A 4Z7YA 1UJ6A 3ZTQA 3OFHA 4CO1A 5A8KA 3GMGA 2VB6A 3CJ2A 4MIWA 4DL2A 3OJSA 1JJ2R 1YQHA 2A3JA 2XM3A 3C15A 2BUNA 1TUGB 3M9NB 3DLEB 2FVRA 1RE1B 2HHPA 4R5PB 4YOEA 1RUSA 4RW9A 4DPOA 2OI2A 4EO6A 2FVQA 5G0RA 1IVZA 1EZZB 3KG0A 2ASDA 4IRKA 1X8DA
chains in the Genus database with same CATH topology
1NZ8A 1M1GA 2K06A 1NPRA 2LQ8A 3QQCD 1NPPA 3EWGA 4ZN1A 3H7HB 4ZN3A 3LPEA 3P8BB 2OUGA 2EXUA 1M1HA 2XHCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NZ8 A;  1M1G A;  2K06 A;  1NPR A;  2LQ8 A;  3QQC D;  1NPP A;  3EWG A;  4ZN1 A;  3H7H B;  4ZN3 A;  3LPE A;  3P8B B;  2OUG A;  2EXU A;  1M1H A;  2XHC A; 
#chains in the Genus database with same CATH topology
 2CAD A;  4I4B A;  2XMU A;  3TEH B;  1FDD A;  1RCX B;  1SKU B;  3BV8 A;  1OMS A;  5C25 A;  4CLU A;  4DBQ A;  3UDV A;  4KGK A;  1V5V A;  5C25 B;  3DFE A;  3ENQ A;  5C2G A;  4ZJQ A;  5HAT A;  1VQY A;  1UA1 A;  3P6Y C;  2J0X A;  2ZBI A;  3J7A 1;  4ES3 A;  4CLK A;  1WC6 A;  3QFW A;  1MWQ A;  2IRU A;  3W9J A;  4ELT A;  1N5S A;  5IWA J;  4AND A;  2KYZ A;  5A8W A;  3T9N A;  4DR6 J;  3D7S B;  5A8W B;  4OV1 A;  1RAO A;  4MK7 A;  3IN5 A;  1RT1 A;  5L38 A;  4TQS A;  3B8H A;  2G2Y A;  1TAQ A;  3IBW A;  1FDN A;  4HAC B;  1WHY A;  1Y00 A;  1QVG R;  1DY3 A;  3IG1 A;  5J2N B;  1N56 A;  5KFZ A;  1X5T A;  3FQK A;  3CCL S;  3AD8 C;  4P71 A;  2ZKU A;  4IFV B;  3NAI A;  1DRZ A;  4X4S A;  1ELO A;  1DFD A;  1JKH A;  3TJA A;  1XNQ J;  1NK8 A;  4JOU A;  3GCX P;  3K17 A;  4RPF A;  2W2Q P;  2K1R A;  3HHN B;  3MMJ A;  2XC9 A;  1U49 A;  2D1C A;  4P74 A;  3TQE A;  1QUV A;  4UF4 A;  3MUV P;  4W92 B;  1NJI T;  2OPP A;  1Q79 A;  4DV6 F;  1QY7 A;  1VIS A;  2E44 A;  2ADB A;  3EGZ A;  1XMO J;  4DFJ A;  3UCG A;  2LEB A;  5KFT A;  3OFG A;  3I9Z A;  3R6L B;  4NAS A;  1FRL A;  4U7U D;  1VLO A;  5KFU A;  3PXG a;  3D68 A;  4DU7 A;  1JLA A;  3PCO B;  3MTK A;  5DRK A;  1G2E A;  1JLG A;  1FFW B;  2IJR A;  2W2M P;  5LMU J;  2VON A;  9RUB A;  3JSM A;  3EXC X;  1T0T V;  3JSM B;  3UN2 A;  3C16 A;  1RTD A;  4DS5 A;  1WF2 A;  4CH0 S;  4XDD A;  3GII A;  1RTD B;  5A2Q Y;  1XJW B;  4NL5 A;  4ZPW R;  1VI7 A;  2VL1 A;  2LU1 A;  3BPD A;  2HKE A;  4U67 Q;  1CUL B;  4DV2 F;  1YJT A;  2L9D A;  2JC0 A;  4JUZ A;  2OEK A;  3OT9 A;  1KFD A;  3I87 A;  1E6Y B;  1DAR A;  3BJY A;  2MKS A;  2B7C B;  4DZD A;  4GMK A;  4IOC Q;  2DEJ A;  4WZM A;  1WNE A;  3GJT B;  3HD1 A;  2M8D B;  2WCX A;  2ZH9 A;  3I55 S;  1VMB A;  3RAM A;  3SI8 A;  3RB3 A;  4NLU A;  1N33 F;  4O4R A;  4I68 A;  3RBD A;  3VVT A;  5IT9 Y;  2FUG 9;  4XTT A;  2IIH A;  1R0A A;  5T41 A;  3CDB A;  2NLW A;  4ALZ A;  3FCW A;  4RO0 A;  4O3Q A;  3LA0 A;  4FPI A;  2FGC A;  4WP8 A;  2WVE A;  2EG1 A;  5JJB A;  2MSS A;  5KFR A;  4DV0 F;  2E5H A;  1G6B A;  2QA4 S;  3R2D J;  3E2E A;  1H0H B;  5HAN A;  1ARO P;  1VJW A;  4ZVS B;  1QSS A;  1CS4 A;  5E3C A;  2ZM6 J;  2XEX A;  1C0T B;  5CD4 A;  4R8U B;  1DBD A;  2ZE2 A;  5GMD A;  1VQ7 S;  3CVK A;  1SL1 A;  4UY8 T;  1C1C A;  4KV8 B;  5ADZ A;  1C1C B;  3MDF A;  4I64 A;  2BAN A;  1VBY A;  1OYE A;  3HVT A;  3GON A;  2BKO A;  1FF2 A;  4HR2 A;  2PA8 D;  3TQ1 A;  1Q5V A;  3PHT A;  4CZC A;  5KFC A;  2WBM A;  3QJP A;  2Y8Y A;  5KFB A;  1JLE A;  4DF4 A;  3BPS P;  3LP0 B;  4DV4 J;  3L7P A;  4ZIV A;  1LWE B;  1RQ0 A;  2XSJ A;  1D8Y A;  5D15 A;  3HD2 A;  2CG8 A;  2GJ2 A;  3QRQ A;  4USV A;  4KIA A;  1HMV A;  5DM7 Q;  1RBO B;  4NLO A;  1LWC A;  1NHV A;  1IKX A;  2XSF A;  4L75 A;  1NKE A;  2LXU A;  4HKQ A;  1QJH A;  4WXW A;  3AOA A;  4TLQ A;  1HNX J;  1AUD A;  1P6T A;  3M30 A;  3MMA B;  3M4X A;  2QYC A;  1U2C A;  2W7A A;  1RT3 B;  2V68 A;  3DI6 B;  1NHU A;  3UDL A;  3W66 A;  1VHF A;  2L9W A;  5KOX A;  2XMW A;  4RNH A;  1FXR A;  2PMH A;  4WJB A;  2OFH X;  4QIG A;  5D3G B;  1S6Q A;  3ZZY A;  2ZOF A;  1U1K A;  4ID5 A;  4L3K A;  2IVF B;  4ID5 B;  4YHH J;  1RBA A;  4Q43 A;  2QX0 A;  3MAQ A;  1WTF A;  2UU9 J;  1XER A;  3PX4 A;  2UVV A;  3EUN A;  1S99 A;  2EC2 A;  1KC8 T;  3HHE A;  2Y3Y A;  1IKV A;  4QR2 A;  1IKV B;  1UFK A;  1UVJ A;  2EK1 A;  2HNZ A;  4ZCM A;  2YPZ A;  4JV1 A;  3N79 A;  4DX6 A;  1KNZ A;  3H20 A;  4UOF A;  3MUT P;  1Q78 A;  2AGO A;  5J2M B;  3I5A A;  3MF5 A;  1FE4 A;  1DQ9 A;  2BW2 A;  4F0M A;  1QVF R;  3HFK A;  2MQL A;  5GAH U;  3LAL A;  1HA1 A;  2KZM A;  3SSR A;  1MN9 A;  4FN5 A;  3Q8R B;  4LF5 F;  1HNI B;  1RT5 A;  2WZ1 A;  5IT9 U;  1RT5 B;  1UVI A;  2CWX A;  3JQJ A;  4N5S A;  4LQ3 A;  2AYE A;  4QOT A;  4NCG B;  1BXN A;  2FHM A;  2W9C A;  4MT1 A;  1VQM S;  3TVZ A;  3W64 A;  1X4C A;  2KDO A;  2ZZM A;  5BJR A;  3AA8 A;  1F9E B;  3CXC R;  4LF7 F;  5J1P A;  3GZ7 A;  1LK5 A;  2MZQ A;  3BH7 B;  3UR3 C;  1NH7 A;  4YB5 A;  5KFX A;  3J80 Y;  3NS5 A;  1R6V A;  4O3P A;  2B9E A;  2KI2 A;  5F8H A;  3DRR A;  3IR5 B;  4AQY F;  5I42 B;  3E01 B;  4DUT A;  1LW2 A;  1YVF A;  5IZH A;  2HIQ A;  1TV6 B;  2ASL A;  2DGW A;  5DDR C;  4K4Z A;  3EM1 A;  1K8A T;  1IKW A;  7FD1 A;  4URQ U;  5E5N A;  1IKW B;  4G3I A;  3C14 A;  3BS9 A;  1HNW F;  1WKJ A;  1Q53 A;  2OHD A;  2EFG A;  2ATC B;  4CRJ A;  2XMM A;  4LR9 A;  4LFC F;  1W7W A;  2EXU A;  1EX8 A;  2ZVI A;  2HGL A;  2FC9 A;  1IR1 A;  4PQA A;  2JFK A;  3J81 j;  2OLW A;  4EMD A;  3KLF A;  5HBM A;  1OSD A;  3KLF B;  4EK2 A;  5U47 A;  1NZA A;  5LL6 d;  3NCQ A;  2F4F A;  3DXS X;  4DUZ J;  4IYQ A;  1FXD A;  1LV5 A;  3PW5 A;  4KT0 C;  3MM5 A;  1HWI A;  5KFV A;  4TU9 A;  2V94 A;  3P96 A;  4BC9 A;  1T9V A;  4C97 A;  4B02 A;  2ASY A;  1HW9 A;  1T9Y A;  2HND A;  3OXG A;  2HND B;  2QMW A;  3BQ1 A;  2HFS A;  2MZR A;  4LF9 F;  2YKM A;  3HK2 A;  5E3P A;  2YKM B;  4B3S F;  4ZPD A;  1JLB A;  1RWK B;  1FO1 A;  5L9N A;  2CQH A;  1S1U A;  4KB7 A;  2PII A;  3GIR A;  1I94 J;  2XMA A;  1HI1 A;  4QIW D;  1TFW A;  4JI2 J;  2V9W A;  5ETO A;  1VRQ C;  2E9T A;  4NLW A;  2CJX B;  1PYO B;  5F0W A;  1EKS A;  1BWE A;  3LGM A;  4OZN A;  4TNO A;  3EZ5 A;  1QAY A;  5ETS A;  1LW0 A;  2Y1I A;  1SJ1 A;  1X4G A;  2Z30 B;  5CCL A;  4TLR A;  4NA3 A;  3DGP B;  4X65 J;  1JLC A;  3I0R B;  2CZ9 A;  5CYM A;  4JI8 J;  3CCQ S;  4ILM A;  2F5G A;  5BR8 J;  2CPX A;  3MUM P;  5C24 A;  3J7Z 5;  4U8Y A;  2LA4 A;  3V81 A;  3CUN A;  1RWX B;  3FZB A;  1M5K C;  3UD4 P;  2GIR A;  3V6K A;  5AE1 A;  4ECR A;  3RBZ A;  1TR0 A;  4DR4 F;  2ZHO A;  5DQI A;  3UCZ P;  1U1L A;  1ICE B;  1KHV A;  1ZZN A;  1FJG F;  1K0T A;  1UEV A;  4Q8E A;  2BDP A;  2LCW A;  3ETO A;  3EVO A;  3DDN A;  3TR5 A;  1RAA B;  1X5S A;  3CIZ A;  5D6G A;  4DJB A;  2WVB A;  1CPZ A;  2CQ3 A;  1Z1Z A;  1QM9 A;  4IRC A;  2E1C A;  1PC5 A;  1Q4R A;  5IT0 A;  4OYI A;  4GO7 X;  3LGH A;  3NOC A;  1N36 J;  1VQP S;  3RW6 A;  1ZM4 A;  1ZBT A;  2LQ5 A;  1FVS A;  2BOA A;  1CJT A;  3DHX A;  3AOC A;  4ZVT B;  2R7U A;  3J80 U;  1RWW B;  4Q2L A;  2F63 A;  2M8H A;  1PBU A;  3PV8 A;  2MDA A;  4DX7 A;  4KO0 A;  4KJI A;  4XAK A;  3D6H B;  1EP4 A;  2VA2 A;  1S1W A;  4RNM A;  1S1W B;  3IS9 B;  3D6T B;  3K2Y A;  5KFQ A;  2HMI B;  2ATL A;  3DLJ A;  2DKO B;  1X31 C;  4PYD A;  2MB0 B;  4QYZ J;  3MEC B;  1N34 J;  3QMQ A;  4J91 A;  2GA7 A;  2IM2 A;  3R5B A;  2RT3 A;  5DG8 A;  3HDS A;  2H48 B;  3D28 A;  1WOO A;  3TJ8 A;  2HZA A;  1GMW A;  3DYA A;  2R7Q A;  2CVE A;  1PJ7 A;  4F0H A;  3HSG A;  1S7H A;  2QYG A;  5KFE A;  2DGV A;  1KOO A;  4IO9 Q;  4FYY B;  1R31 A;  2IYG A;  3CC4 S;  2VG7 A;  3GIL A;  1FFG B;  2AF6 A;  1IBL F;  1RP5 A;  3GFX A;  1S0M A;  1DJ0 A;  4I0W A;  4P72 A;  2AD9 A;  3PAC A;  1YHQ S;  1IR2 A;  3L3C A;  4EGL A;  3BM7 A;  1BE4 A;  5H9E J;  3P3D A;  4TVA B;  2WRM A;  4PUO A;  2DGQ A;  5DDP C;  5RUB A;  3PW4 A;  3T1H F;  3QBC A;  1HWU A;  2VPW B;  3K8W A;  1NDL A;  2JH3 A;  2V67 A;  2C2O B;  3MEG A;  1FT8 A;  1TVR B;  4Y6I A;  1HNZ F;  3L7U A;  1RT6 A;  3TUP A;  2ASJ A;  2ZZN A;  3Q2T C;  4C48 A;  2VJU A;  1MWY A;  3T1Y F;  3MED A;  1TKT A;  3MED B;  3KUE A;  3MXH P;  2UV8 A;  2CFX A;  4WZQ A;  3CUL A;  1T03 A;  1JXE A;  5F8M A;  4OLP A;  3PKY A;  1T05 A;  1TKX B;  2IRY A;  3AOD A;  1T05 B;  3OBI A;  2FHJ A;  5L1J A;  4OJH A;  3KJV A;  2DHA A;  2PO4 A;  4ECX A;  2ILY A;  1RHR B;  2ZWP A;  4DL0 C;  1BHN A;  1I5O B;  3ZTR A;  2G1D A;  3UW1 A;  1RJJ A;  4CI0 B;  5F9L A;  4IRD A;  2OPR B;  2R4F A;  1DTQ B;  1H2T Z;  1X9M A;  4WF9 Q;  3CCT A;  2JL9 A;  3CCW A;  1N5Q A;  2HHH F;  3ILL A;  1RI7 A;  4M5K A;  2EFP A;  2AGP A;  3BH6 B;  2VQE J;  1PC4 A;  1EQ0 A;  2LVW A;  2XLK A;  2KO1 A;  1Y5N B;  3FUY A;  2NXJ A;  4Y2C A;  3OV7 A;  1VC6 A;  1CJU B;  2DH8 A;  4Z2X A;  1ITP A;  3UNG C;  2KB2 A;  2OP5 A;  4Y00 A;  4D3H A;  4KGZ B;  3D4J A;  4WU2 A;  2MQ8 A;  5IT4 A;  2ZVS A;  4ED8 A;  1Z4U A;  2GX8 A;  3QT7 A;  3R5C A;  2HVE A;  4GKK F;  3DRS B;  4IH5 A;  1VQN S;  5HJX A;  4DV1 F;  2HFO A;  4LF2 A;  2Q43 A;  2K2P A;  4A8X A;  2G13 A;  2R8K A;  2H3E B;  1ZH5 A;  1BQM A;  1BQM B;  1WC1 A;  3HSD A;  2VF3 A;  3BO2 A;  3E8O A;  3HF5 A;  4O44 A;  1HPZ A;  1Q1K A;  1WC4 A;  4IDK A;  5GAG I;  3C8Y A;  2CJA A;  3Q8V A;  2NCK L;  1TL3 A;  3F73 A;  1TL3 B;  1N4L A;  2ZH3 A;  3QAE A;  2E5L J;  5LSR A;  4NXM F;  3HT0 A;  3I5C A;  5FDL B;  4LUB A;  3UVJ A;  2DNY A;  3M6V A;  1OYD A;  4W4M A;  4P2S A;  3G8T A;  2RS8 A;  1SVD A;  2FC8 A;  2BV3 A;  2FZK B;  3BF4 A;  2AYB A;  2VBW A;  1BWV A;  1LNQ A;  3T1A A;  3ITH A;  2EVZ A;  4IG0 A;  3R1H A;  5CHC B;  4IG0 B;  5E2Q A;  2R2S A;  5D4P A;  4EI2 A;  4DL7 A;  3M05 A;  4H4M A;  4PXD A;  1S77 D;  4H4M B;  2MLZ A;  4J9V A;  2DXF A;  2MJN A;  1RTI B;  2GML A;  3PRB A;  1RHK B;  1D9A A;  4NEY A;  4Q7A A;  3AA9 A;  3VHQ A;  2PFD A;  2BJ3 A;  1NEE A;  4LF8 J;  3KG4 A;  3NNA A;  4UZB A;  4RNF A;  3IRX A;  3EYZ A;  4Y0F A;  3J7Y U;  2I2Y A;  4YR3 A;  4OZ3 A;  1X4A A;  1PKU A;  2B6A B;  2QLB B;  3E3X A;  2PN6 A;  4ECV A;  4C8L A;  4OYW A;  3N4W A;  3CSK A;  2U1A A;  1MMD A;  4KBI A;  1HWL A;  1BLU A;  4HTI A;  4ZP9 A;  5I3U A;  3VAI A;  2BVZ A;  4X4R A;  3HSJ A;  4IR1 A;  4DN0 A;  4BCA A;  3K59 A;  2VQF F;  2J8S A;  2MST A;  4KQZ A;  3SBM A;  1ULR A;  4K2J A;  2MKY A;  1G7C B;  3PTW A;  5KFK A;  2XY5 A;  3SV4 A;  3Q22 A;  5KFA A;  1NH8 A;  3G82 A;  1RWP B;  3KHH A;  5HJY A;  2A1B A;  3I9V 9;  4MTP A;  3QLH A;  2BW7 A;  4QQB A;  4DU8 A;  1L3T A;  1FK9 B;  1Q8B A;  4DX8 H;  4QYZ K;  3NGT A;  2GAG C;  3FMW A;  1F5B A;  5T7L A;  4YQW A;  2HPU A;  3W9I A;  4B3O B;  9ATC B;  2UXB F;  3FSI A;  4V19 X;  1TK0 A;  2OD6 A;  2QG9 B;  3KK1 B;  4RW7 B;  2BM0 A;  2B3T B;  3MEE A;  2K8G A;  1S0O A;  2BAC A;  3U1M A;  4QZV B;  2EFV A;  1YDL A;  4M5J A;  2ZH8 A;  1JX4 A;  2DIV A;  4C0B A;  1IQT A;  1PBA A;  4WCE Q;  1UP1 A;  3CWJ A;  2XI2 A;  2G0C A;  1ZM9 A;  2GGP B;  1M90 T;  4IOB A;  4CTA B;  3VAJ A;  3K5N A;  1KLN A;  3Q2S C;  4HH0 A;  4E8U A;  5B7W A;  4UTG A;  1NJW A;  4DSI A;  4XO0 A;  5D78 A;  2ROG A;  2VPX B;  3W8P A;  1Y7P A;  3KLH B;  1KQK A;  4LSN A;  1RWV B;  1QE1 A;  4HDH A;  3P5T L;  1F3V A;  4ED7 A;  2B4V A;  1OO0 B;  2RDI A;  4UY8 5;  2WVC A;  1NHK L;  5HI7 A;  4QU6 A;  4PYA A;  5EUH A;  2E1M C;  1SQF A;  4G1Q A;  4G1Q B;  2FY1 A;  3T5J A;  3JXO A;  4B9U A;  1H98 A;  3TWZ A;  5D8H B;  1H3D A;  2RQM A;  3ISZ A;  5LJ3 Y;  2VPZ B;  1PGZ A;  2UP1 A;  5F8L A;  3JQK A;  1J2V A;  2BMB A;  4PCQ A;  4X4O A;  2GW8 A;  5F8J A;  3TO8 A;  3OTE A;  2CQ0 A;  3OUY A;  1SH0 A;  3I31 A;  4FS1 A;  5KG2 A;  5K5M A;  3GFH A;  4RUC A;  2AYM A;  4OZ1 A;  5KG3 A;  3M2U B;  3BKT A;  1D3W A;  3B54 A;  2CQD A;  3NXZ A;  2WW4 A;  2OEM A;  1JNZ B;  2VG6 B;  2BBE A;  2DGX A;  2RIJ A;  5EX3 A;  1CC8 A;  4J9L A;  2AJ2 A;  4G1I A;  2BE7 D;  1GTE A;  4BLG A;  4ZPV R;  1SJR A;  4ZHR A;  4TY8 A;  3MEK A;  1U48 A;  1SIW B;  1UZH A;  1NRK A;  2WVD A;  2I38 A;  2M88 A;  1XC9 A;  3D1O A;  2AJF E;  4RUB A;  2E5I A;  4DR2 J;  3CPW R;  3K5L A;  5CZX A;  2M0G B;  1TZ0 A;  2B8Q A;  4BS2 A;  3ADA C;  1M5H A;  2QV6 A;  1URN A;  4QIE A;  2B5J A;  2QL7 B;  1ZAW A;  3CCU S;  2BM1 A;  4HI1 A;  3MR5 A;  3KLG A;  1X7V A;  3UR0 A;  4PEO A;  2AHO B;  1VQ9 S;  4JI5 F;  4F02 A;  4MMO A;  4JI0 F;  2ZOG A;  4MKA A;  4YEA A;  1S72 S;  2IY5 B;  2GMJ A;  4F2R A;  2VD3 A;  2I9S A;  1VS3 A;  3FC9 A;  3ILO A;  4OI6 A;  3LPY A;  1NK6 A;  1KS2 A;  3TAR A;  1WSV A;  2I5J A;  3QQC D;  2YH0 A;  1HW8 A;  4AL6 A;  5F3T A;  2WTF A;  3BQ0 A;  2NYH A;  5EWF A;  4NLT A;  5E33 A;  3WQP A;  2MQP A;  3NLC A;  1IJF B;  4Q2M A;  3ICL A;  2O01 C;  1KVI A;  1FVQ A;  4DFK A;  2IAJ B;  1UL3 A;  4O0N A;  2DGO A;  5IM0 A;  3EX7 B;  2P9G A;  5K14 A;  4DF8 A;  4GKJ J;  2BJ9 A;  3LUY A;  1R8P A;  3CMQ A;  4DXL A;  3PFE A;  3GJS B;  4YB6 A;  1YJU A;  5CZV A;  2J76 E;  4NLY A;  5B0A A;  3DRY A;  3KHG A;  5KFN A;  1SB6 A;  4FNI A;  5FD1 A;  4ZIT A;  5E3R A;  2HZC A;  3IWX A;  3NWG A;  3MR2 A;  1M1G A;  1SUQ B;  2LYV A;  1S48 A;  2DY9 A;  1VQS A;  1N32 F;  4Q5V A;  2FJD B;  2HQI A;  2RJZ A;  1LXJ A;  2XGQ A;  2LEC A;  2CQ1 A;  2KKH A;  1F2H A;  3M32 A;  1WOS A;  2MXY A;  5FJ4 A;  2G0I A;  3M32 B;  2IMO A;  3DLB A;  2D69 A;  3R5D A;  3JSY A;  2QE5 A;  3HFV A;  2W25 A;  3OL9 A;  3FGV A;  1KFS A;  3HVR A;  1SIZ A;  1KR4 A;  1YBA A;  5D0H A;  4P9S A;  1CJV A;  1R8C A;  3HZE A;  3OXF A;  1J5E F;  1PAU B;  1OIA A;  2CPF A;  1HAR A;  2VOD A;  2HVI A;  3MUR P;  1U8S A;  1KQS R;  1MRO A;  1HBU A;  2VDI A;  2CNO B;  1MG7 A;  3G8Q A;  4MK8 A;  2IFX A;  3FQL A;  3FJ2 A;  1ZTW A;  3H5Y A;  1FKP A;  4ZVF A;  1FKP B;  1PIE A;  1AA1 B;  4HLB A;  4FYX B;  2M9K A;  2XCP A;  5AJ3 F;  3JTO A;  4WWS A;  3KUH A;  2FY8 A;  2IA0 A;  2Q3P A;  1NM2 A;  4CLT A;  3PW7 A;  4DL5 A;  4RNO A;  1RAJ A;  3LW5 C;  1IJE B;  2IJN A;  3J81 Y;  1FX4 A;  1HBM A;  4MYT A;  3CJQ A;  1HBM B;  3PFO A;  2HAF A;  5L1K A;  4DL3 A;  2VH7 A;  2Y0S D;  3BKU A;  2EPI A;  3ILI A;  1VK8 A;  3S01 A;  3PYG A;  2XLI A;  3RB0 A;  2OIH A;  2D3U A;  3AXM A;  4ED2 A;  2MQN A;  1AZS B;  3DOL B;  2G1H A;  2LXI A;  3O3L A;  2GS8 A;  1QSL A;  4H4O B;  2RF2 A;  1AXQ A;  1RAF B;  5HQ8 A;  2Y9H A;  3DRX A;  2RQ4 A;  3HX9 A;  2ZBQ A;  4ECQ A;  3TW0 A;  5CYJ A;  4F36 A;  1R0B G;  3I0S A;  1HBN A;  3IM9 A;  3WDO A;  1Q86 T;  4IUF A;  3CJ4 A;  1FNX H;  1DHM A;  1UWB A;  4JI4 F;  1GMW D;  2F8M A;  2P8I A;  5DGA A;  4YR0 A;  1S5Z A;  1WEZ A;  4KHP F;  3OTC A;  3PYD A;  4QWC A;  2EK6 A;  4HHJ A;  2FLP A;  1C4C A;  2JLF A;  2AEF A;  4LBH A;  5GAG U;  2R7O A;  3D0I E;  2V9K A;  2M4M A;  4HYK A;  1NME B;  4RW8 B;  3TAM A;  4A8W A;  2V2Q A;  1NDP A;  2J8A A;  1GX5 A;  4Q0B A;  3GSD A;  4LIW A;  3GU0 A;  2B9Y A;  2QA4 G;  3HO1 A;  2BKN A;  2XTJ P;  2Q79 A;  4WYL A;  2BQR A;  4ZPT R;  2NXE A;  4WE1 B;  3MM6 A;  1UTA A;  2IVM A;  2IYI A;  2BE2 A;  2PC6 A;  5KT2 A;  5F8N A;  1XR6 A;  2AX1 A;  2VUG A;  1NU4 A;  3OL6 A;  3F56 A;  3BRE A;  3KWM A;  3W9H A;  1YJR A;  4X62 J;  5JMN A;  5EX0 A;  1QD1 A;  1DQA A;  1J27 A;  2YBV A;  2RH3 A;  4LF1 A;  2R8J A;  3CJR A;  3KUG A;  3Q8Q B;  4RZR A;  1T3O A;  4A8O A;  3CC7 S;  3CME S;  3HJF A;  2DGU A;  4A8M P;  1S6P B;  4OHX A;  1VRT B;  3PW0 A;  2FHJ D;  2DXD A;  3D9B A;  2VFS A;  1L3U A;  1QAI A;  2RU9 A;  4F67 A;  3ETM A;  4RBU A;  3TNV A;  2Z58 B;  2ZHB A;  2IPO B;  1WDT A;  4UUX A;  2R8I A;  4F3M A;  3QYY A;  4CP5 A;  3FDS A;  2VFV A;  2WW8 A;  3NGR A;  2AEJ A;  5FLX Y;  2H4Y B;  2XI3 A;  1FNM A;  3DDI A;  3OPK A;  5LXY A;  2A6O A;  1IBK F;  4CYU A;  4OZ2 A;  3EPG A;  4AXJ A;  2UXC J;  3UN5 A;  1CQM A;  1HBO B;  2MTL A;  4USH A;  2YPY A;  2C2N A;  1FRK A;  1Z2Z A;  2UXD J;  2C28 A;  3ZO7 A;  4I2P A;  3R7N B;  2BAB A;  2GHW A;  1LWF B;  4R0J A;  4YR2 A;  3J81 U;  3SFG A;  2DNO A;  3ZZP A;  1F60 B;  3PG9 A;  3H4B A;  3N6M A;  3GIK A;  3OLA A;  2UV8 G;  2CPH A;  2FPH X;  1ZPV A;  2HQD A;  1EKR A;  2K06 A;  4C3L A;  4ZN3 A;  1TU0 B;  1JMT A;  1D9F A;  2V50 A;  1YK9 A;  3PY8 A;  2CYY A;  2A6M A;  4C4W A;  2LQB A;  1UCN A;  4RUA A;  5HVG A;  2ZJQ Q;  1Q5Y A;  2CJQ A;  1HR0 F;  4Y3C A;  2IM1 A;  2M7S A;  2FJX A;  1NXI A;  4M5H A;  3QZ7 A;  1SH3 A;  3KDO A;  3EVW A;  4DR7 F;  5CD4 H;  2B9X A;  1VQ5 S;  4X64 F;  3KK2 B;  2H54 B;  5DDQ C;  3BDE A;  3DLK B;  3R9L A;  3RB6 A;  2V6A A;  2WAQ D;  3VQS A;  3VQT A;  3VTI A;  1N52 B;  3PJW A;  3W2V B;  4JI6 F;  4IR9 A;  4TQR A;  3QGG A;  2KN4 A;  1RWN B;  1YRU A;  3MMC A;  4LSL B;  5LJ5 Y;  2W4C A;  2DR9 A;  4ZPB A;  2DD8 S;  3DOK A;  2J7U A;  5M2R A;  5F9N A;  1VLY A;  2B0G A;  2V0N A;  1B3T A;  2AU0 A;  4AQY J;  4DQR A;  5D0G A;  2VDH A;  1YX2 A;  4O4G A;  2C2M B;  2YX4 A;  2YKN A;  7AT1 B;  3BSO A;  4IQM A;  4ED3 A;  5ETQ A;  2YKN B;  2MLX A;  2MZS A;  3NL0 A;  1DLO A;  3W2W B;  1MSW D;  3ZNJ 1;  5T14 A;  3T5H A;  3BB5 A;  8RUC A;  1IM6 A;  4WKY A;  1CQN A;  4LFC J;  3CJ0 A;  3BGR B;  1U6F A;  3D2W A;  1Y3J A;  4K4Y A;  3SDE A;  3SDE B;  4DCO B;  1EIY B;  1VYA A;  4M5N A;  5IWA F;  2N4D A;  4JB8 B;  3T9Z A;  2FZG B;  3MR7 A;  2YX1 A;  4DR6 F;  2DCU B;  4U8V A;  2GZO A;  2EBG A;  1YJ9 S;  4H54 A;  1T9U A;  3AJ2 A;  1C0U B;  3V4I A;  1NPR A;  4BC7 A;  1F5C A;  1OSC A;  1FX2 A;  2BYC A;  3VGS A;  4ICL B;  4XIU A;  2KL8 A;  3W3S A;  4ANE A;  2V8H A;  1Q0N A;  4M63 A;  2GVD B;  1TL7 A;  2ROE A;  4IH7 A;  4C8Z A;  4DZ6 A;  3SEO A;  4LR7 A;  2B7B B;  5ETK A;  5AT1 B;  3PM9 A;  2OFG X;  2BQU A;  4J9N A;  2BEF A;  4RNN A;  1SC1 B;  2GVZ B;  3CCE S;  1XNQ F;  2GIF A;  5DLG A;  3JAM U;  2Y1J A;  2A18 A;  2QTW A;  4KGM A;  1U0H A;  3MMB A;  4NLX A;  4LBP A;  5KFG A;  5A0Y B;  2FLN A;  2E7X A;  3H7H B;  4I67 A;  2QRR A;  3S8S A;  3CO0 P;  2W4D A;  2ZH7 A;  3US5 A;  2DIS A;  4RX6 A;  4N41 A;  2R42 A;  1OJ4 A;  3TUI C;  2EWH A;  2DB1 A;  1N5Y A;  4A8F A;  2HFZ A;  1EET B;  2F65 A;  3IA0 A;  2HS3 A;  4ZJO A;  5IV3 A;  3H42 A;  3GV5 B;  1QSY A;  1UET A;  3AD7 C;  5LMU F;  4YS2 A;  2ERR A;  4HHU A;  2LQ9 A;  3EXY A;  3AAW B;  3CJK B;  5HLF B;  3RRK A;  3CDA A;  2WOM B;  3NMA A;  5I3P A;  3BGO P;  5HVF A;  3NWR A;  3MOJ B;  2H51 B;  2W2N P;  4FBT A;  1YTY A;  5JUM A;  2IC3 B;  3K5P A;  1VC5 A;  3CTR A;  2F40 A;  3BSN A;  2COL A;  3QSI A;  4JYA J;  2YNH B;  1OQ6 A;  4O23 A;  1OY9 A;  3I5B A;  2J7K A;  3D0G E;  1U1Q A;  1VQ6 S;  2F4V J;  4PAA A;  1U47 A;  1YZ7 A;  2W8K A;  1NK9 A;  2PFF B;  1HLW A;  4F0K A;  2XNQ A;  3Q8U A;  2IM0 A;  1N0V C;  2DYA A;  3W60 A;  2AZ1 A;  2OPS B;  2AGQ A;  5CXT A;  1FDA A;  4IG3 B;  5K20 B;  1F9F A;  2UVR A;  1RYS A;  4EBE A;  3QRP A;  2J9D A;  4J9M A;  5HVH A;  2RB7 A;  2RE1 A;  1FRH A;  2APO A;  3QO9 A;  2DNM A;  3A8I A;  3QO9 B;  3ISN C;  2DBB A;  8ATC B;  3IM8 A;  3I4H X;  4MJK A;  2DTJ A;  4B3R J;  4MKY A;  4J9O A;  3IAM 9;  3GWC A;  4ZOS A;  4AL7 A;  5L1L A;  2C3P A;  1WC5 A;  2XO7 A;  4F4Z A;  4K2X A;  3KXD A;  2UUB J;  2D3O R;  4NOH A;  2ZM6 F;  1S9E B;  4X4P A;  4K0K J;  2JLE A;  3CCM S;  4Q44 A;  1GX6 A;  2CPY A;  2CJK A;  2GQQ A;  3FFI A;  3CDU A;  1H7X A;  5GAH I;  3OTB A;  1RAI B;  1TKZ B;  4RW4 B;  2E1A A;  3RYL A;  3MZI A;  2M2B A;  4I7F B;  3BZQ A;  3I32 A;  4DQS A;  2VU5 A;  4EZ9 A;  1S1X B;  3THV A;  4OI0 A;  1F5A A;  2J6T A;  4ZPC A;  4FF1 A;  3UFC X;  4ZP7 A;  3DOM A;  2DHS A;  5H9F J;  4DV4 F;  4WFB Q;  1B0V A;  4QW9 A;  2CQ4 A;  4NA1 A;  4ZP6 A;  3RB4 A;  4NLR A;  3CCV S;  2MGZ B;  3QT8 A;  2B51 A;  1RU2 A;  2N3O A;  4QWD A;  4KSE B;  3WC0 A;  1P9Y A;  1LFW A;  1WOR A;  1X5P A;  2RUS A;  1IUJ A;  3FCH A;  1HNX F;  1S4E A;  2NYI A;  4AUK A;  3T1Y J;  1RT7 A;  3MPV A;  3EJM A;  1RT7 B;  2NQP A;  5FII A;  2CPZ A;  4OL8 A;  4ITS A;  3M8Q A;  1Y10 A;  2N82 B;  2XUL A;  4DV3 J;  4JI3 J;  5B0C A;  2JHE A;  1S1V B;  5HMX A;  3QGH A;  2PE8 A;  4I2Q A;  2HQC A;  2DNL A;  5C42 B;  4YHH F;  4OI3 A;  3ELH A;  4RWX A;  1YLX A;  5E3A A;  3VGT A;  2W2O P;  2UU9 F;  1KVK A;  1C1B A;  1FXL A;  1SKW A;  3CJ5 A;  4ELU A;  3BBF A;  4NRU A;  2AJQ A;  3U1L A;  4C0H A;  3T5L A;  4DG1 B;  1RHU B;  1YRT A;  4OHZ A;  1UVL A;  3M1V A;  2OML A;  1LEO A;  3JSR A;  1IBC B;  1FEH A;  2XG8 A;  5HRO A;  1VHI A;  5HRO B;  1GXU A;  3WIU A;  2WVF A;  2HHW A;  4FYW B;  5KG4 A;  1Q8K A;  3N5B A;  5IOL A;  3JYT B;  4PXC A;  2IVY A;  3FBE A;  2ZBP A;  2Z2M A;  4B9M A;  1Q81 T;  1NK7 A;  1EQM A;  1LXN A;  4NRT A;  1ZS6 A;  3MAA B;  3K58 A;  3AH6 A;  4C3M A;  3OVA A;  4ZKA A;  2OMO A;  3DLE A;  4R5P A;  2AMC B;  3QRR A;  4NI2 B;  1NSP A;  2D9P A;  2FYX A;  3KNA A;  5I3Q A;  1VQO S;  1OPI A;  1H2U X;  4Y2A A;  2CUY A;  1SJ4 P;  4P7V A;  4DSE A;  2CWK A;  5LT5 A;  2MLY A;  4LQ9 A;  1FHT A;  4EBC A;  2FJV A;  1T95 A;  4F4Y A;  3KMS A;  3BN7 A;  1L3V A;  1ZAX A;  2WON B;  5BYR A;  3CC2 S;  1GFW B;  4LBI A;  2OEL A;  5K8O A;  4CO5 A;  3T19 A;  4Y65 A;  3ZZU A;  3SXL A;  4OZJ A;  4HAC A;  2QA2 A;  3H98 A;  4LRE A;  3GG0 A;  5KT3 A;  2CRL A;  2NPF A;  3GYN A;  1N5V A;  4BBY A;  4BHQ A;  5J2N A;  2HK3 A;  4NLD A;  2R7V A;  4IFV A;  3NY0 A;  2JX2 A;  3IWN C;  4ID8 A;  3KJF B;  3DCA A;  4ECS A;  3KHR A;  2V8V A;  2OGU A;  3HPO A;  1HWK A;  3RBX A;  2RQC A;  4J9S A;  1H2V Z;  4NXN F;  3CJ8 A;  2ALZ A;  3RGI A;  4NZ0 A;  1BQN B;  4DUZ F;  3QT5 A;  4GVB B;  1O0P A;  2JC1 A;  2HLT A;  2UUC J;  3H8Y A;  2J6U A;  3CDW A;  3L95 X;  1XEZ A;  4KFB A;  2Q6B A;  4KFB B;  3NNC A;  4PG8 A;  1NKB A;  4JI7 J;  1CLF A;  3OTD A;  2C3Y A;  4C9D A;  3DGV A;  5J1N A;  1UWA A;  4WBF A;  3DMJ B;  2L08 A;  4ZVH A;  4OQJ A;  4D3G A;  1K9M T;  3A13 A;  2RKI B;  4LJM A;  2ZHA A;  3Q23 A;  1VQ4 S;  3FVY A;  4CLW A;  2VQF J;  1MLA A;  4Y34 A;  3LPE A;  1I94 F;  1ZTT A;  1WSR A;  4DFM A;  2E66 A;  1NCL A;  1B7Y B;  4LVO P;  5ETP A;  3KYL A;  2FQQ B;  1ACM B;  1IWG A;  4IFY B;  3HKZ D;  1CUL A;  1WWH A;  4J9U E;  3OQ2 A;  4ZVU B;  3EGW B;  4ZVP B;  4EO8 A;  2U2F A;  1WF1 A;  3EDR B;  1E6Y A;  3DM2 B;  4ES1 A;  3CW2 C;  2DR7 A;  1M0S A;  2E1R A;  1CBK A;  5CH7 B;  4X65 F;  4TN2 A;  2ZWO A;  2RIL A;  2HRY A;  1EJ7 L;  2W9A A;  3VR1 A;  3EGN A;  5BR8 F;  3I82 A;  3W5X A;  2DY1 A;  2O67 A;  1R0C B;  2KG1 A;  4B9V A;  3R5J B;  3O44 A;  1NAQ A;  4EYH B;  2DNP A;  3W61 A;  2ZOM A;  4W98 A;  2W2P P;  2W7O A;  3WIV A;  1H72 C;  4L73 A;  1F0X A;  3N9U C;  1REV B;  2KXN B;  4DV7 F;  4U96 A;  3HHK A;  2WK4 A;  1U1N A;  1RTJ B;  4PAB A;  2DRD A;  1YRX A;  1FWK A;  1K44 A;  5H9F K;  4ED5 A;  2C3M A;  3A12 A;  2VZ9 A;  1C0T A;  3K89 A;  1N36 F;  4R8U A;  4RUH A;  2CKW A;  5B0B A;  3NGS A;  1UW4 A;  4USJ C;  3VAH A;  4KV8 A;  4B9T A;  1NZ8 A;  3GB0 A;  3AY0 A;  3SZ2 A;  3DRP B;  1SV5 B;  4MAK A;  2CQI A;  2QMU B;  4J7C A;  3FEX B;  1RDR A;  1SXL A;  2AX0 A;  1G1X A;  4B3T J;  2CQB A;  2KFZ A;  3SV3 A;  2ZH4 A;  3AOB A;  3IP0 A;  2ACM A;  4QIV A;  4JBC A;  5B0E A;  3T5K A;  4C98 A;  4PQU A;  3SQG B;  1UZD A;  1R7I A;  4PQU B;  5KFS A;  5J2Q B;  4YME A;  1N34 F;  1NDC A;  3LP0 A;  2CZ4 A;  2XB2 D;  1LWE A;  1XQI A;  1RAB B;  2LLZ A;  4NYZ A;  2KT2 A;  3SCI E;  2V5H G;  2JSX A;  3KLI B;  1S49 A;  4RU2 A;  1WEY A;  2YWK A;  3ENV A;  5AXL A;  3ILJ A;  2V4Q A;  5EDW A;  3OFF A;  2X3D A;  1RWO B;  4CCH A;  3MPW A;  5KFW A;  3LP1 A;  2HS0 A;  1RAH B;  3LP1 B;  1URR A;  1NJX A;  3ZTP A;  5HSP A;  1KBR A;  2DH9 A;  5L9X A;  1OPZ A;  3BR9 A;  1FA0 A;  5HO4 A;  5HMY A;  3EPI A;  3WHI A;  3MMA A;  3R97 A;  1SBR A;  2ZJR Q;  3CD7 A;  1N6Q B;  3PJX A;  1RT3 A;  4WU3 A;  2WHO A;  3DI6 A;  2XS5 A;  4N7T A;  2CG4 A;  2DR5 A;  5DJB A;  3TJ9 A;  4PWW A;  4URS A;  2QMX A;  4KGV B;  1YI2 S;  2MPU A;  2R3V A;  5D3G A;  3FEY B;  4FNH A;  4JI5 J;  1UW9 A;  3THT A;  2OSQ A;  3PEH A;  3H2U B;  5D0R A;  3JQM A;  2B4P A;  2O5D A;  3M2V B;  2IA6 A;  1RAG B;  5IFM A;  4P2F A;  5ETT A;  3C19 A;  4FPR A;  1S6U A;  1NJZ A;  2Y0B B;  2W9B B;  4ATN A;  5ITH A;  5KFO A;  3L09 A;  4X4Q A;  1SQE A;  5KG7 A;  2DEI A;  4ZA1 A;  4TKT A;  3QAT A;  1V6H A;  4XPC A;  2KT5 A;  1JNR B;  2CIM A;  4UW2 A;  1L3K A;  5I4M A;  3ZFV A;  2IDL A;  5J2M A;  2XBP A;  3AQO A;  3X1L B;  4NWB A;  5HP1 B;  5H1S V;  1BY9 A;  1HQU B;  4ZLJ A;  2V63 A;  2IJF A;  1HHS A;  2HFN A;  1HNI A;  1WOP A;  5DS7 A;  2G4B A;  3J7Y I;  2VKR A;  4W90 B;  3ISN D;  4BDP A;  4NCG A;  5KT6 A;  3N01 A;  2VQE F;  2OKQ A;  2K3K A;  3DU6 A;  4ETZ A;  3RR7 A;  1YBU A;  2HVZ A;  3IXQ A;  2G2O A;  4M5D A;  3M9O B;  4M5D B;  2AJ4 A;  2E9Z A;  2XYH B;  2MKK A;  5J2P B;  1YIJ S;  3NRB A;  1VBZ A;  2MHE A;  4CT9 A;  3BO3 A;  4XDC A;  3UPF A;  3UWT A;  5HN0 A;  1JJC B;  3GR1 A;  5I42 A;  3E01 A;  3GLJ A;  4X4T A;  1R8B A;  1TV6 A;  5CYQ B;  2AKW B;  1Q8L A;  3D0H E;  2YWH A;  3I6P A;  1JLQ B;  2CQG A;  4C0O C;  5M2U A;  1A6L A;  3PRV A;  2RNE A;  1K47 A;  3AHP A;  3Q8S B;  1R43 A;  3RUB L;  3G8S A;  3G6V A;  1MMN A;  3HHL B;  4WTY A;  4V19 J;  4TXS A;  1N8R T;  2DR6 A;  1QTM A;  2CNL B;  2LXF A;  5KFI A;  4DQQ A;  2L41 A;  4CLZ A;  5D4O A;  2MJU A;  1SKS A;  5D0E A;  3H2V E;  4U7C A;  4PG6 A;  3MFI A;  1LKZ A;  2CPE A;  5DO2 A;  2E5L F;  2KFN A;  5ETN A;  3V6D A;  1ZYQ A;  4PKD B;  3V6D B;  3POT B;  2PGC A;  1T02 A;  2Z57 B;  3C66 A;  1TKD A;  4ANC A;  2XY7 A;  3CED A;  2FVC A;  4G6V B;  4K5R A;  5KT4 A;  4LF4 F;  3A4T A;  2AZ3 A;  3G6E S;  3H4D A;  1RYR A;  4IH6 A;  2AV5 A;  1BD6 A;  4ER8 A;  5DZ7 A;  4DL4 A;  3GR0 A;  5IQQ A;  2G0J A;  4ES2 A;  4F4A A;  5THW A;  2A0F B;  2ZH6 A;  3O6Q A;  4ED4 A;  1S79 A;  4UST A;  1HQE B;  1RT4 A;  1FE0 A;  1RT4 B;  2Y8W A;  4LF8 F;  1I1G A;  3NBP A;  1UPM B;  2MYF A;  3NBP B;  4BWJ A;  1YJW S;  2V4R A;  2ILZ A;  3BGF A;  1S1T B;  2DGT A;  3P5B P;  4QWB A;  5GME A;  2O3D A;  3DGP A;  3M6W A;  2ABY A;  3I0R A;  2XGP A;  1KSP A;  1X5O A;  3G2X A;  4HH1 A;  4B9N A;  2KXF A;  2YNG B;  2LEA A;  4PG4 A;  4DX5 A;  2RDD A;  3RR8 A;  4WFA Q;  4F8R A;  2CXE A;  2P6T A;  2PI5 A;  1PJ6 A;  4CT8 A;  4WII A;  2CJY B;  2C3U A;  3W65 A;  2GC8 A;  1N54 B;  3IR6 B;  2BRK A;  2YXL A;  4ECW A;  3P4U B;  2FVS A;  1IM4 A;  1FTR A;  1JIH A;  2DVI A;  1HD1 A;  3K8V A;  1RKJ A;  4WFN Q;  4WFZ A;  1WG1 A;  2EFO A;  3EE3 A;  3IBC B;  4U9R A;  5D4N A;  3HHL C;  4C8O A;  4KPC A;  2W24 A;  2YNF A;  3PYE A;  2BE9 B;  2YNF B;  1Y3K A;  3BEG B;  3T3F A;  1GMV A;  2AQ4 A;  2N4C A;  4WFY A;  4C8Y A;  3VVU A;  2NPI A;  5CAA A;  1HKA A;  1HI0 P;  2NUH A;  3HM9 A;  3M6X A;  3ZC4 A;  2HBY B;  4N8O A;  1LWX A;  4WK3 A;  2OSR A;  3VWS A;  2BQ3 A;  4CLP A;  2R7T A;  2VA3 A;  3QGP A;  2ZBR A;  1TL4 A;  1GXL A;  3AB2 B;  1F6T A;  3OTO J;  2ROP A;  3DNC A;  2BJD A;  3H59 A;  2EEY A;  4OX7 A;  3IS9 A;  3KNG A;  2HMI A;  4C8M A;  4OIX A;  5CA5 A;  4Z7C A;  3MEC A;  3IBF B;  2V8P A;  2Z0G A;  4O3O A;  2MQQ A;  3FK4 A;  1DQ8 A;  2HHT A;  2XYP B;  2Z8Q A;  3W8G A;  1RT2 A;  2R2T A;  1RT2 B;  1NUE A;  1JQG A;  1HD0 A;  4DSJ A;  1KTV A;  4OYM A;  2VBY A;  3MR6 A;  4HL9 A;  4DR1 J;  4ZVG A;  1LK7 A;  4KHM A;  1GNK A;  3PX0 A;  4TYB A;  4OI4 A;  1WDD A;  4ZLL A;  4AD6 A;  4CO4 A;  3B78 A;  2XS7 A;  2MEW A;  3H90 A;  2MZ1 A;  3OR2 B;  1Y4Z B;  1V3R A;  4OYX A;  2LKZ A;  2NZC A;  3W5Y A;  2UUA J;  1KEK A;  2MKI A;  1L3S A;  4ZPA A;  2ZH5 A;  3CD6 S;  3QIP B;  3BO4 A;  3Q86 A;  1X9W A;  3LGN A;  1N0U A;  2GHP A;  2DNQ A;  5IXU A;  1M5P C;  1KWM A;  1X4E A;  1BC6 A;  3B6B A;  4A8Q A;  2HAI A;  1KQF B;  1XN9 A;  1UVK A;  4UQT A;  2LP4 A;  1TVR A;  4ZVO B;  3S6E A;  1U0S A;  2CVI A;  4GC6 A;  2FJE B;  2JEI A;  5GAE U;  1SC4 B;  3ZZO A;  2YWG A;  3DN9 A;  2YQ0 A;  3TX0 A;  1RKI A;  2ACY A;  2PMW A;  1B99 A;  4DR7 J;  2HWT A;  4DR2 F;  3GYG A;  4USK A;  3BBB A;  3OSP A;  4B3M J;  2OPQ B;  3NCP A;  3M8W A;  1TKX A;  5EHH A;  2NR0 A;  3VF0 B;  5E41 A;  1ZAV A;  2D74 B;  4UT4 A;  1VOM A;  1H73 A;  1EAR A;  5JXS A;  2XWY A;  1XNR J;  4PXE A;  2M5Y A;  4JI6 J;  4U6P A;  4LFA F;  2OPR A;  1DTQ A;  4DV5 J;  3V4M A;  5A8K B;  4OYA A;  5SUH A;  4R0E A;  3NS6 A;  1F9H A;  2FJB B;  1NSA A;  3T41 A;  3CNQ P;  3C15 B;  3VAG A;  4F3O A;  1S6O A;  4RW9 B;  5G0R B;  1CJU A;  3CB4 A;  4QBU A;  1RAC B;  1O5J A;  4ZP8 A;  4KHR A;  1H38 A;  3O8W A;  4X4N A;  4OJG A;  6AT1 B;  1YJN S;  3HXM A;  4YUD A;  1NJY A;  4DPT A;  1CSJ A;  3V6J A;  2GQ2 A;  3ONQ A;  1T8E A;  4LF6 J;  1UJ4 A;  1W26 A;  4NLQ A;  1V3S A;  2B4O A;  5KOW A;  5LMN F;  3DRS A;  3LP2 A;  4GKJ F;  2B8P A;  1FI4 A;  3LP2 B;  5F8G A;  3DLL Q;  2C1E B;  4M5M A;  1RT1 B;  2EFN A;  3C6U A;  4OX9 J;  5AXK A;  4AE5 A;  3C6U B;  4LFB J;  1NDK A;  1D09 B;  2CDQ A;  2EKN A;  3A3P B;  5D4L A;  4F2S A;  1AFJ A;  4DSF A;  1L5U A;  3IG1 B;  3TZX A;  5L1I A;  3JTP A;  5EWG A;  2QFI A;  1WG5 A;  4DR3 F;  2X1G A;  1PO6 A;  1D8Z A;  2AW0 A;  2LA6 A;  1UJ5 A;  5FDL A;  1JKH B;  2RRA A;  1WHV A;  2K1R B;  1Q7Y T;  2I0X A;  4L76 A;  5KG5 A;  3PEJ A;  1EB0 A;  2VFR A;  2P9E A;  2J6S A;  2OPP B;  3G4S S;  2RHQ B;  1RU1 A;  1XR5 A;  4DSL A;  2NS1 B;  4X66 J;  3DKD A;  1GMU A;  2BJ8 A;  2DT9 A;  4ILR A;  4MIA A;  4FXV A;  4ZCI A;  4OX6 A;  1RTI A;  1T94 A;  1OS5 A;  4FVM A;  2XZW A;  1SJF A;  1JLA B;  3PDN A;  4CO3 A;  2HIY A;  4O0I A;  2W8L A;  2HHX A;  3TA2 A;  3GIJ A;  1JLG B;  4P7T A;  2DRA A;  5KG0 A;  3C16 B;  2VJV A;  1IQZ A;  2DCL A;  1I3O B;  3DDK A;  2B6A A;  3UD5 A;  1JJ4 A;  2RRN A;  1TUW A;  4USW A;  1P8G A;  1HQ2 A;  4NEZ A;  2YWW A;  1BGX T;  4B9S A;  5DG7 A;  2Y1L B;  4I1T A;  1SC6 A;  3H5S A;  4DPW A;  5HQM A;  4G1P A;  1M5V C;  1SL0 A;  2MQM A;  3HZG A;  1TUV A;  3MCN A;  2HSE B;  2ZBC A;  4YY3 J;  3VAF A;  4IOA Q;  4N56 A;  5KFJ A;  1YG0 A;  5G4D A;  4A46 A;  2YQ1 A;  2DJW A;  4FZV A;  2XMT A;  2GV1 A;  3N5F A;  3SCK E;  1FK9 A;  5HAO A;  1NPK A;  2BOP A;  2AIR B;  4HEA 9;  1FKA F;  1R0A B;  4F3Q A;  2JLG A;  1ZM2 A;  2BZ2 A;  3S7R A;  3D3B J;  4B3O A;  1AT1 B;  4JI1 J;  2CPJ A;  3KK1 A;  4RW7 A;  3TZY A;  4CLY A;  3GCW P;  3QWP A;  1B64 A;  4QJV A;  4ECU A;  4JV5 J;  1Q95 G;  2NUU G;  1IBM J;  1CS4 B;  4PXB A;  5DQH A;  1X4H A;  5BXI A;  2DK2 A;  3GTY X;  4J9Q A;  3K5O A;  4WFX A;  4UOH A;  5A6P A;  2HHU A;  1EHW A;  2GGP A;  2FLO A;  2ZE2 B;  2DNR A;  4CTA A;  4O3S A;  2XY6 A;  4LRF A;  3JSB A;  4BWM A;  1W2B R;  2BAN B;  3FKB A;  1XK8 A;  3IAS 9;  3KKF A;  4YB1 P;  3HVT B;  1C2P A;  2HRU A;  4PPZ A;  4QU7 A;  4CM2 A;  4DPX A;  3KLH A;  4ELV A;  1AUS L;  4E2F B;  1Y5L B;  2G9O A;  4FYV B;  4WK1 A;  3NKY A;  3B82 A;  2OTL S;  4KGX B;  2VKZ G;  3M7V A;  1E6V A;  1B0P A;  1JLE B;  2YWF A;  1AFI A;  3K7R A;  1M1K T;  1E6V B;  3RJM B;  4X62 F;  2J9E A;  3H5X A;  1ZPW X;  1FRI A;  4YDX A;  3QJL A;  3HP6 A;  4DR5 J;  2XO6 A;  1HI8 A;  1S10 A;  3MGJ A;  4AL5 A;  3KHL A;  2XSJ B;  5F0U A;  1VQ8 S;  3NCR A;  3OHB A;  3TYT A;  4TU8 A;  2RU3 A;  1HMV B;  2FHK A;  1LWC B;  5GAD U;  1FRX A;  1IKX B;  5B09 A;  3SYZ A;  1R8H A;  2LEP A;  3H40 A;  3G6Y A;  3NGD A;  2E29 A;  3DXB A;  2OH2 A;  2AWZ A;  1ZM3 A;  2C22 A;  1XMQ J;  2MKJ A;  3M2U A;  3EWG A;  2XZT B;  2JJ4 D;  1Y11 A;  2VG6 A;  3M30 B;  4ED0 A;  4LVN P;  4ENO A;  1UA0 A;  4F04 B;  3CT9 A;  1R27 B;  2WBR A;  2KT3 A;  1VIO A;  4KPY A;  3PX6 A;  4ED6 A;  1G4C A;  2UXC F;  1H7W A;  4DUY J;  2F8E X;  3G86 A;  2CA9 A;  4LSZ B;  3TA0 A;  3V6H A;  4ETX A;  1S6Q B;  2UXD F;  4PG7 A;  5K8M A;  4DLE A;  1T9W A;  3HLU A;  2RRB A;  1FJE B;  5A2Q U;  3LTO A;  2NRE A;  3M8Y A;  1SJ3 P;  2GIQ A;  3AB4 B;  4P73 A;  4N8N A;  2B43 A;  2OO4 A;  1U1O A;  1GT8 A;  4EZ6 A;  4FYD A;  2QZ8 A;  3R2C J;  3KK3 A;  3TZW A;  3KK3 B;  2ZEJ A;  4DHV A;  1WEX A;  1SCJ B;  2HNZ B;  3TUJ C;  4EYI B;  5KT7 A;  4K4X A;  3X3U A;  2QJ3 A;  4I6Y A;  3CJS A;  3HHL D;  2QA1 A;  4EUV A;  3PIP Q;  3UI3 A;  4HDG A;  4MYU A;  4NE9 C;  1U24 A;  4MK9 A;  2KVI A;  5DZ6 A;  3CGI A;  2ZD1 A;  4UZC A;  2ZD1 B;  1PIL A;  3SIP B;  2XMV A;  2MMY A;  8AT1 B;  1I51 B;  1UVN A;  3R3T A;  4Y2M A;  5KFH A;  1D9D A;  3KTQ A;  2RD5 C;  4KE5 A;  2HHQ A;  2QT7 A;  2W9C B;  2JVR A;  2HQ3 A;  1VBK A;  3HMJ G;  1NO8 A;  5L46 A;  2QLW A;  3VV2 B;  1WHX A;  2DHX A;  2XCA A;  2IAJ A;  4LRC A;  1TK8 A;  1D0E A;  3AQP A;  1X60 A;  2RSQ A;  5BYQ A;  2HFU A;  3D6F B;  2F9J A;  5B0D A;  1K73 T;  5LOQ A;  2IBO A;  3DRR B;  3R5A A;  3LWM A;  3JB9 k;  1CJK A;  4IKA A;  1CJK B;  3A1Y G;  1LW2 B;  4P2M A;  3TUZ C;  2UUW A;  4UOC A;  3MD1 A;  3L4B C;  2R8H A;  3C14 B;  1SUQ A;  3T6J A;  1BUX A;  1FD8 A;  3TRG A;  3MI7 X;  2HRT A;  4HHH A;  2AEM A;  4DWI A;  4L74 A;  5HK4 A;  3U27 A;  4OFZ A;  2XWX A;  4XK8 C;  3D66 A;  4RU9 A;  1VIX A;  1RHQ B;  3HVW A;  4A47 A;  2N3L A;  3PNI A;  1JXV A;  3GYX B;  5HBM B;  3GFY A;  3RAQ A;  3TAN A;  4OHW A;  4NXN J;  2HVH A;  1P1L A;  2K7J A;  3BSA A;  4R25 A;  4DV6 J;  1VC0 A;  4ECY A;  3MM5 B;  2LDY A;  3F44 A;  2VAS A;  4ECT A;  1OQ3 A;  1FJC A;  3EIC A;  2P9C A;  4OI2 A;  1RB0 A;  1QAX A;  1YKW A;  4Y2I A;  3CCR S;  2R9L A;  2FDN A;  3HSZ A;  3A8E A;  5DET A;  1JLB B;  1S1U B;  1VR6 A;  1VK3 A;  3GV7 B;  4M1K A;  4DQI A;  3PJ9 A;  4RJV A;  2ZJP Q;  1SL2 A;  4M5I A;  4ZJL A;  1X0P A;  4FS2 A;  2KHD A;  3KDN A;  2B56 A;  5KFD A;  1I6J A;  4RBT A;  5AXM A;  1RA7 A;  3H2L A;  4DV2 J;  4GVL A;  3LAM A;  3OD2 A;  4OYO A;  3GJQ B;  1GQE A;  1REG X;  1TQL A;  1LW0 B;  4ECZ A;  4CH7 A;  2JFD A;  4FDF A;  1AZS A;  1JLC B;  3DOL A;  1RTZ A;  4K4S A;  4H4O A;  1JK9 B;  1S12 A;  1M1H A;  3QZ8 A;  5CYM B;  2VV5 A;  5A76 A;  3PYF A;  3QID A;  1S7I A;  3OSN A;  3RW7 A;  5C24 B;  5F8I A;  4J9K A;  3D67 A;  4HT7 A;  4ZDN A;  5C7P A;  3HI9 A;  3V81 B;  5AE2 A;  1VGY A;  2QO3 A;  1N33 J;  4TYA A;  4EFA C;  5EGY A;  2E7V A;  2RQK A;  4DV7 J;  1HYS A;  2RML A;  3PIO Q;  1U8W A;  1HYS B;  2JRS A;  1T7P A;  1B0T A;  3QNW B;  2W1B A;  4CNZ A;  2KM8 B;  3F0N A;  1F2G A;  4JYA F;  1WC0 A;  1XR7 A;  4DV0 J;  1X4B A;  2YQ3 A;  2F4V F;  1FTC A;  4C11 A;  3LOU A;  4C11 B;  4RW8 A;  1CEZ A;  3EDQ B;  5CAB A;  1SH2 A;  5L39 A;  2J5A A;  5K8P A;  2HEK A;  2YKP A;  4NZ6 A;  4XPE A;  3OL8 A;  2MZT A;  3NS7 B;  3RRG A;  5KFY A;  4UUW A;  1CJT B;  4QWA A;  2RDJ A;  2KZZ A;  1KRP A;  2KXH A;  3FCV A;  4CLS A;  2ZIT A;  1R8A A;  1VJQ A;  3Q0A A;  4QPX A;  4CO2 A;  1FRM A;  2VIH A;  2AJ1 A;  4PRF A;  4WE1 A;  2HGN A;  3C2P A;  4KO0 B;  1EP4 B;  4EBD A;  3F41 A;  3Q83 A;  1U26 A;  2G2Z A;  1WAC A;  4NMX A;  2HGM A;  3M8P A;  3HUL A;  3M8P B;  1KD1 T;  3ENA A;  4B3R F;  3FEZ A;  5LXR A;  4C8N A;  4J37 A;  2UUB F;  3MFH A;  3HFZ B;  4RLE A;  4K0K F;  1UMJ A;  2JWN A;  1UEU A;  4J5O A;  2OTJ S;  4A8S A;  4HT5 A;  3DYA B;  1S6P A;  2DIU A;  1NPP A;  2ZC3 A;  1UFL A;  1S0N A;  1VRT A;  1YGY A;  2PEH A;  1S9G A;  3DC2 A;  2JZ5 A;  1S9G B;  3MM7 A;  4CO0 A;  3MM7 B;  3GIM A;  1QUP A;  3BN4 A;  2GO9 A;  5KG1 A;  3OVS A;  4FKY A;  5BYS A;  4EWT A;  1DAX A;  3QPI A;  2VG7 B;  3FZ2 A;  4GC7 A;  4O3R A;  4WKR A;  5DLF A;  1FES A;  2JNJ A;  1YBT A;  5MAO A;  3JAM Y;  2KTQ A;  1Y5I B;  3EVM A;  4PUO B;  1HBO A;  1U2F A;  1HIY A;  5KFL A;  3W7B A;  3N28 A;  3HKW A;  3IR7 B;  4JV0 A;  2NSB A;  2BR0 A;  1RK8 A;  4OZL A;  2KM8 C;  1CC7 A;  3MEG B;  4YB7 A;  5JVH Q;  2ZKT A;  1LWF A;  4QCL A;  4NLP A;  1KP6 A;  1RT6 B;  1YSJ A;  2HBZ B;  4X2B A;  2OEJ A;  4NPO A;  2FB0 A;  4K4V A;  3GPA A;  1TKT B;  1TL5 A;  2C2D A;  1PYS B;  1T03 B;  4DV3 F;  1AYE A;  2O1P A;  4JI3 F;  4IQX A;  3A3O B;  4MKB A;  2GCF A;  3KJV B;  2ADC A;  2D7S A;  2V2Z A;  1X4F A;  3RG6 A;  3ZNU A;  2VHG A;  1PJ5 A;  2QC3 A;  1Q8I A;  5DQG A;  4LF5 J;  2KYX A;  2QFJ A;  3KK2 A;  1HNV A;  1HWJ A;  1F3F A;  1HNV B;  4H4K A;  1S9F A;  4CLF A;  3C46 A;  2QL9 B;  3DLK A;  4YN3 B;  4DLG A;  3UCU P;  5KFP A;  3BYR A;  4KR0 B;  1T9T A;  1YWX A;  3PR5 B;  1WD6 A;  4KC5 A;  3W2V A;  1GTH A;  4LF7 J;  4OYB A;  2E9R X;  1U25 A;  1P1T A;  2L3M A;  2CNN B;  5B08 A;  4QR0 A;  4LSL A;  4ZK7 M;  2AT1 B;  2YNI A;  2HNY A;  2YNI B;  5C5J A;  2QSW A;  2HNY B;  4MIB A;  2YVS A;  3IC1 A;  2QN6 B;  2Q66 A;  4DEZ A;  1U4B A;  2RHS B;  3H0P A;  3AJD A;  4USM A;  2DXE A;  2FLL A;  3HVA A;  1X4D A;  3W2W A;  1JWW A;  1HNW J;  5DGB A;  1MNE A;  1DUR A;  1B70 B;  2NXN A;  1YJ7 A;  4F7V A;  1WJ9 A;  1MN7 A;  1RLD A;  3BGR A;  4O44 B;  2ZH2 A;  5J1E A;  1HPZ B;  5J1E B;  2ZUA A;  2XHC A;  1TMM A;  3MM8 A;  1GXT A;  3MM8 B;  4IDK B;  5M2P A;  4USU A;  2JEF A;  1UEK A;  2D3O 1;  2PD1 A;  4I6W A;  3T6B A;  3HJV A;  3R5G A;  2VC0 A;  1C0U A;  4JV2 A;  3UVJ B;  1FDB A;  3VAL A;  2M70 A;  2I1R A;  4ICL A;  5ETR A;  2C2K B;  1FER A;  2GVD A;  4PG5 A;  4LF4 J;  2YX7 A;  1S57 A;  3ITH B;  3LWL A;  2W7P A;  2YKA A;  2HBR B;  4J9R A;  2UVU A;  4LRA A;  1U09 A;  4LF9 J;  3VAK A;  3HHD A;  3OLB A;  4B3S J;  2ZDO A;  5E7O B;  2GVZ A;  2BJE A;  4I6A A;  1RIS A;  3FRZ A;  1B7F A;  4P2X A;  2X1F A;  4H4K C;  1NK0 A;  3GSI A;  1V3Z A;  3QWU A;  1ROF A;  2ZZT A;  3IRX B;  3OHA A;  3CD5 A;  5A0Y A;  2FGO A;  2RUG A;  3QAU A;  2UUC F;  4P6Q A;  1XMO F;  1O51 A;  2CAJ A;  2DPJ A;  1FCA A;  2X1B A;  2N7C A;  1HHT P;  2PEB A;  1RLC L;  2LQJ A;  2V69 A;  5GVQ A;  1EET A;  3V2U C;  4JI7 F;  4DSK A;  1U45 A;  2X51 A;  5I3U B;  4KY3 A;  5SZT A;  2R7X A;  1TAU A;  3MR3 A;  3J7A N;  1WUU A;  2UZA A;  2XZD B;  3MM9 A;  3MM9 B;  1ZET A;  2F9D A;  2RAQ A;  3CJK A;  5HLF A;  2FHO B;  4KH0 B;  2WOM A;  3BDP A;  4DR4 J;  1ZZF A;  3TVY A;  3W1Y C;  3G71 S;  3G82 B;  4NLS A;  4Q45 A;  2R7S A;  1FJG J;  3SCJ E;  2WSE C;  2IC3 A;  5LSL A;  4X4V A;  3VZI A;  3MCO A;  1VFJ A;  3QLH B;  2FZC B;  2YWE A;  2YNH A;  2HS4 A;  2LFV A;  5T7L B;  3EMT A;  4OJ1 A;  4ZLN A;  3FMB A;  5ETV A;  3CMA S;  1R6Y A;  1ZA2 B;  3MEE B;  1ZA1 B;  2BA9 A;  2OPS A;  3HCX A;  4IG3 A;  3TX8 A;  3U02 A;  3MCM A;  4F50 A;  2DNN A;  3LF0 A;  1WEL A;  1MML A;  1QAJ A;  3KMQ A;  2HWI A;  2ZFH A;  4B9L A;  1KN6 A;  2BRL A;  3RRH A;  1VCT A;  3BR8 A;  2QIF A;  4LRD A;  2DNH A;  3ZTO A;  2H5J B;  1S97 A;  5H9E K;  4JP8 A;  4LSN B;  1S9E A;  1TK5 A;  1KTQ A;  1QE1 B;  1FEE A;  2GFF A;  3BYP A;  3GG1 A;  2Z2L A;  5MLC V;  4K8R A;  3PO4 A;  4F26 A;  2LMI A;  2DH7 A;  3RAX A;  2ALY B;  1NBE B;  4YDD B;  5IQ6 A;  3GQC A;  2FD2 A;  5F41 A;  3UN3 A;  3K0J A;  2VPY B;  1TKZ A;  1LQ9 A;  4RW4 A;  2DGS A;  1NND A;  5F3Z A;  1TTH B;  2A2D A;  4I7F A;  3W63 A;  2KJV A;  1VDH A;  4KRW A;  4B3T F;  2XMJ A;  2DO0 A;  2EFQ A;  1U1P A;  3O5T B;  3CJ3 A;  4DS4 A;  1S1X A;  1IBL J;  3OUY B;  1XWL A;  2C3O A;  1A0O B;  2IRX A;  1U6Z A;  2JOQ A;  3B4D A;  4TU7 A;  1PG5 B;  1LFP A;  3OR1 A;  1BMQ B;  3OR1 B;  2OJ3 A;  3ZXW A;  3IWL A;  4OMF G;  4U95 A;  3T1H J;  4F25 A;  1ZOT A;  4QPT A;  4K59 A;  3SSS A;  4DPU A;  1U2R A;  2MGZ A;  2CQC A;  2VFU A;  3MPU B;  2IDE A;  1O6X A;  5EN1 A;  3DU5 A;  1M5S A;  2DPI A;  2GHV C;  3R6G B;  4ZHR B;  3QT6 A;  2ZNZ A;  3DHW C;  4TY8 B;  1HNZ J;  2MKC A;  1FNO A;  3RU0 A;  2KRB A;  5JVG Q;  1KVJ A;  1UKU A;  1VQK S;  2DNK A;  3TOQ A;  2HQF A;  4O3N A;  1LOU A;  5C2C A;  4M5G A;  3ZZZ A;  1J5O A;  3KG1 A;  1J5O B;  5ETL A;  3GFZ A;  4DFP A;  2HYI B;  4DCP B;  2F8H A;  1RCO B;  3CDE A;  2J7W A;  3B4M A;  3R7B B;  2B5J B;  1EAY C;  2F7V A;  2HBQ B;  1S1V A;  4N47 A;  4PWU A;  3LO3 A;  2NZ4 A;  2MQO A;  3KLG B;  1SC3 B;  5C42 A;  1KKH A;  4LFA J;  3M2R A;  2RS2 A;  3M2R B;  1Q7L B;  2E5G A;  3V5R A;  2W01 A;  4LMZ A;  3BGL A;  2DNG A;  2HHH J;  4NA2 A;  3UO0 A;  2IHR 1;  2C42 A;  2PI4 A;  1IXK A;  4WYW A;  2D9O A;  3EGV A;  6FDR A;  4C2M A;  4KTQ A;  1IR0 A;  4DG1 A;  1N48 A;  1RHJ B;  3QGI A;  3CF5 Q;  3BKF A;  1SPB P;  1NKC A;  2IMW P;  2CDR B;  4L72 B;  2I5J B;  2FVP A;  2POK A;  2E5J A;  3JYT A;  2BJ1 A;  2H9Z A;  1WF0 A;  5IC4 B;  3CCJ S;  3U1N A;  1HL6 A;  3MAA A;  3JS9 A;  1K1S A;  4F4W A;  3Q89 A;  3TAQ A;  2X1A A;  5IM0 B;  1WI6 A;  2AJ0 A;  5LMN J;  3KJQ B;  1FWP A;  4GKK J;  4NI2 A;  3C6T A;  2V8G A;  4OI1 A;  5K14 B;  3VZH A;  2EC0 A;  3C6T B;  1UPP A;  4DV1 J;  1RWM B;  4ZCK A;  1RZM A;  1OWX A;  2M3D A;  2LU2 A;  4NLV A;  2J0S D;  2GAH C;  4PZV A;  2D41 A;  3KJN B;  2R8G A;  2V34 A;  2DHG A;  4LRB A;  3CIM A;  2V8D A;  2NXC A;  4DR3 J;  3GV8 B;  1XBW A;  2K7K A;  2KU7 A;  4P75 A;  2WON A;  2J0Q D;  1MW7 A;  1Q82 T;  2R2U A;  3M8R A;  1QLN A;  4RBV A;  3CO9 A;  4NXM J;  1KON A;  3VCD A;  5CCM A;  4X4U A;  5GMK a;  3MPD A;  1GH8 A;  2KG0 A;  4ZVE A;  3K57 A;  3P8B B;  3C3L A;  1CJV B;  2XNR A;  4DI6 A;  2HQG A;  2VBX A;  4DCJ B;  4CNY A;  3MTJ A;  2VC1 A;  3L9Z A;  4FP9 A;  3ZZ0 A;  1MRO B;  1HBU B;  1UAW A;  3NOG A;  2IBK A;  2HG4 A;  3K5M A;  1T3N A;  1GK8 A;  4DQP A;  2VG5 A;  2VG5 B;  1GAO A;  3IO1 A;  1FRJ A;  2WB1 D;  4CM0 A;  2RVJ A;  1BQN A;  4WTO B;  2BJ7 A;  2Z56 B;  4GVB A;  3AXK A;  3TZZ A;  4QWE A;  4FKX A;  4QIF A;  1M5O C;  2A2C A;  3M8S A;  2VIC A;  3D5M A;  4USI A;  3BSC A;  2AYG A;  4P52 A;  1NSQ A;  4YFU A;  1K0V A;  3A3N B;  2Z4P A;  3DMJ A;  4DMZ A;  1PAE X;  4AXI A;  4I56 A;  1WHW A;  3ULH A;  5B0G A;  2RKI A;  1HFE L;  4ZIW A;  4WXO A;  2W4P A;  1BQX A;  3M8Z A;  3I96 A;  2YTC A;  3JTN A;  4K4W A;  2RF2 B;  3OJU A;  4JI2 F;  1WKL A;  2KVQ E;  2J9C A;  3AJ1 A;  3CCZ A;  1FJ7 A;  4IFY A;  2R2R A;  3NNH A;  3IMQ J;  4ED1 A;  4NCB A;  3IGN A;  1YJV A;  3I0S B;  1HBN B;  1OY8 A;  2E1P A;  4HTJ A;  3DM2 A;  3SFU A;  2QL5 B;  3O2I A;  4IO1 A;  2FIU A;  3D54 A;  1UWB B;  2X3G A;  5B0F A;  4NCA A;  1NSK L;  2B9W A;  1RTH A;  4K5S A;  4FF3 A;  1RTH B;  1A7G E;  2NXU A;  3PW2 A;  4RW6 A;  4JI8 F;  1IKY A;  4C3K A;  2CPD A;  2GJI A;  4RW6 B;  1IKY B;  4N77 A;  2UXB J;  3DLG A;  3DLG B;  1MU2 A;  5AE3 A;  1B4S A;  6FD1 A;  1MU2 B;  3TVK A;  4ZVQ B;  5ETM A;  1KDN A;  3PHE A;  3FBC A;  3ZTS A;  3TAM B;  3PRD A;  5D77 A;  1REV A;  2ZC4 A;  4ILL A;  4Q0B B;  5GAE I;  2XS2 A;  1RTJ A;  4ZCL A;  1SQG A;  3BQ2 A;  3TP2 A;  2Y1R I;  1XMB A;  4S0M A;  3G6X A;  3W62 A;  1P9Q C;  4TY9 A;  1C4A A;  5A6W A;  2XMK A;  2PT0 A;  1Y0H A;  1O8B A;  3S1T A;  1PYT A;  2VFT A;  3MM6 B;  2VOP A;  2BE2 B;  2XQC A;  3LH2 S;  1WC3 A;  1Z2L A;  4QYR A;  4KKO A;  2JEJ A;  4FXD A;  4K4T A;  4KKO B;  4OV6 A;  4K7Q A;  3DRP A;  1SV5 A;  1XIQ A;  2HVD A;  1U02 A;  4J90 A;  1CG2 A;  1GEH A;  1PSD A;  4OZ0 A;  1G3O A;  3I4P A;  1FWL A;  2SXL A;  4RWW A;  3SQO P;  4OX8 A;  1TMJ A;  4WPA A;  3OTO F;  1K1Q A;  2H65 B;  3OVB A;  1WTB A;  3ZZR A;  1FKO A;  3SQG A;  3RZA A;  4F4K A;  1FKO B;  5J2Q A;  2V2V A;  3FBB A;  1WKK A;  3UNY A;  2H5E A;  2K3I A;  3EZO A;  3EZU A;  4GO5 X;  2Q1L A;  4I69 A;  2DO4 A;  2C2E A;  4OJ3 A;  4A8K A;  3KLI A;  3D6M B;  3OL7 A;  3TI0 A;  3MOZ A;  3FSX A;  4CYU B;  3L7O A;  4AFF A;  2XLJ A;  4DR1 F;  4AYB D;  3KFW X;  2XYG B;  3KLE A;  3I56 S;  4DPY A;  1TP7 A;  2PSZ A;  3KLE B;  3SSQ A;  3G87 A;  3IGV A;  5E3Q A;  2HLU A;  2LDI A;  3MPY A;  4I2P B;  4ERD A;  2UUA F;  5K9F A;  3ENW A;  1Q16 B;  1N6Q A;  4C7Q A;  2EG2 A;  5AXN A;  2IM3 A;  2WB4 A;  5EWE A;  1AB8 A;  2KHC A;  4WIQ A;  2R7R A;  2DRB A;  1RSC A;  3IFE A;  1S4F A;  4V1A k;  2WSC C;  2MY7 A;  2OUG A;  4F4X A;  4EU0 A;  4OYZ A;  3LAK A;  2DHH A;  3M2V A;  4JI0 J;  2PMZ D;  1W2I A;  1TFY A;  4G65 A;  1NB7 A;  1S59 A;  2CQP A;  2W9B A;  4ZMM A;  1TL1 A;  4CDI A;  3KOA A;  1TL1 B;  4B08 A;  1NLK L;  2HW3 A;  2EBE A;  3N6N A;  4B3M F;  4PWD A;  4OZ5 A;  4PWD B;  2BX6 A;  4ZVR B;  3ET6 A;  4RL1 A;  3ET6 B;  3H5U A;  2H4W B;  3UQS A;  1XNR F;  2CNK B;  5HP1 A;  1HQU A;  4P10 A;  5HQL A;  2MZJ A;  1U1M A;  4KH1 B;  4DV5 F;  3PKM A;  3D1H A;  3MMC B;  2KFY A;  3CE8 A;  4CQ1 A;  2L48 A;  4RKU C;  4UOG A;  3DOK B;  5IV4 A;  3VGU A;  3NEK A;  2E7W A;  2DNZ A;  4O4G B;  1CVJ A;  2AP6 A;  1SJQ A;  4N76 A;  3NGK A;  3FNN A;  3AT1 B;  3ZZT A;  3A8J A;  3E51 A;  1X0F A;  2X7I A;  4MFB A;  3IRW P;  3NG8 A;  1DLO B;  4MFB B;  5J2P A;  2ZNY A;  3N0V A;  1DZ5 A;  4A8Y A;  1N32 J;  1QDU B;  2PA3 A;  4NML A;  5LSO A;  1WI8 A;  2OD4 A;  3P45 B;  4HVZ A;  4A4J A;  3BBC A;  4U7U K;  4K4U A;  2YY3 A;  3WBZ A;  4LF6 F;  5CYQ A;  3MD3 A;  3M6U A;  4A48 A;  2QLJ B;  4QR1 A;  1JLQ A;  4M94 A;  1RAD B;  5CQG A;  1R3N A;  1A9N B;  4HI2 A;  2I6W A;  1VQL S;  2I8E A;  1H74 A;  1J5E J;  1DTT A;  5KAK A;  1DTT B;  3AD9 C;  4OX9 F;  3V4I B;  1QTN B;  3HHL A;  5IS2 A;  2B4U A;  4LFB F;  2CQ2 A;  1VBX A;  1JXL A;  3VGV A;  2HWH A;  2CJ9 A;  1TL7 B;  4M8L A;  3R27 A;  4Y2K A;  3CCS S;  4PR6 A;  2R7W A;  1IWA A;  5AJ3 J;  4YP3 A;  5FLX U;  2N7Y A;  3R1L A;  3TEG A;  4FBU A;  3MCS A;  2J0W A;  3SCL E;  3MAH A;  2QLX A;  4KAI A;  1IN0 A;  2ZUG A;  3POT A;  4WP9 A;  2EW9 A;  5DM6 Q;  2GO8 A;  1H6K X;  4C6A A;  2M52 A;  4URG A;  4M95 A;  1PCA A;  3D1Q A;  5KT5 A;  2BKP A;  3OXL A;  1U0H B;  7FDR A;  1KLM A;  1T11 A;  3R7S B;  3MMB B;  1KLM B;  2EI5 A;  2KJW A;  2J9D E;  4X66 F;  4EEY A;  5DG9 A;  2QLF B;  4C8K A;  3MWB A;  4DDF A;  3PVX A;  2C2Z B;  2GQC A;  1X9S A;  3BGU A;  2F1F A;  1N5Y B;  1YIT S;  4QW8 A;  1Y9O A;  4DOZ A;  2KH9 A;  4Q8F A;  2MKH A;  3FBF A;  1HQE A;  3LAN A;  1MWZ A;  1WG4 A;  4CLL A;  5L8R C;  3TA1 A;  3WC2 A;  3J7Z T;  1V5I B;  2DR8 A;  4OLO A;  2JVO A;  2Q6C A;  4X84 A;  1SI9 A;  1U1R A;  1SKR A;  3PO5 A;  4FVC A;  2P6S A;  4Y28 C;  1S1T A;  5GAD I;  1KHW A;  2BXJ A;  4JI4 J;  2QSF A;  3GE9 A;  5E0O A;  3U7J A;  2CZV C;  4KHP J;  3UD3 P;  5KTQ A;  2OAU A;  5IC6 B;  3NP5 A;  2YNG A;  1FD2 A;  2HFV A;  1S76 D;  2P5V A;  3G9C A;  1UFW A;  2GMH A;  4RR5 A;  2L9N A;  3NAH A;  1V9O A;  2UUT A;  4L3N A;  2HHS A;  4YY3 F;  2FJW A;  3SMZ A;  1N5T A;  3QSY B;  1AW0 A;  3A8K A;  2JDJ A;  2MY8 A;  4ZLP A;  3O1L A;  3FRY A;  3PR4 A;  3R8Y A;  3DLH A;  4OYP A;  4FF2 A;  5HL7 Q;  3AFG A;  4OHY A;  5KFF A;  1HHQ A;  4WP3 A;  1RA6 A;  4NX9 A;  4FF4 A;  4L6V 3;  3GJR B;  3THP A;  1S0V A;  1OY6 A;  4CH1 A;  3OFE A;  2GNK A;  1RXO B;  3N6L A;  4JI1 F;  4E98 A;  3WX8 A;  3WX4 A;  4J9P A;  4UQG A;  4JV5 F;  1IBM F;  4KYZ A;  2WSF C;  4K50 A;  2P2C B;  4MKV A;  4LR8 A;  3PZP A;  4NZ7 A;  1R89 A;  4NYO A;  4LIR A;  4NLG A;  3W5Z A;  2ZDP A;  5KG6 A;  5KFM A;  2F3J A;  2EKY A;  1U7L A;  3FFI B;  3QFH A;  2H1Y A;  3CJT A;  1P27 B;  1NB2 A;  2YKO A;  3HT3 A;  3LQV A;  4GRS A;  4CIO A;  5A8R A;  1NK5 A;  4ZS6 A;  3P49 B;  5A8R B;  2DIT A;  3Q8Y A;  1RWU A;  1W25 A;  2VOO A;  1VRU A;  1VRU B;  2A10 A;  4DL6 A;  2ZH1 A;  3WZ0 A;  1D1U A;  1XTZ A;  2HZV A;  2Z2Z A;  1IBK J;  1JJH A;  2XHW A;  4Z37 A;  3DOM B;  4AT1 B;  2V4J A;  4NYP A;  2Z2Y B;  2V4J B;  4DR5 F;  1TEL A;  2FJA B;  2V2K A;  2CJB A;  4LT6 A;  3NMR A;  4CWB A;  3NGU A;  1RGV A;  3D3C J;  3GP9 A;  3OR2 A;  2QGF B;  1APS A;  2UVW A;  2PDA A;  2FTR A;  1RBL A;  3RBE A;  4PPD A;  3Q24 A;  2D3Z A;  5HMZ A;  3QIP A;  4FXW A;  1XMQ F;  1YZ6 A;  4M5L A;  1F1B B;  3UDC A;  2CPI A;  3QJJ A;  4ZN1 A;  3TAP A;  4B17 A;  2VBZ A;  4E0D A;  3M8Q B;  1N88 A;  2HUR A;  3H25 A;  1NK4 A;  1KOH A;  1JB0 C;  3VAM A;  4DUY F;  2YH1 A;  3MHY A;  5LM7 E;  3UDE A;  1HR0 J;  3Q8P B;  3OW2 R;  4I2Q B;  2NSC A;  1KQG B;  2JEG A;  2O66 A;  1T9X A;  2QEX S;  2YKQ A;  2KRR A;  3KLV A;  1JLF A;  1JLF B;  2C2R A;  4X64 J;  1UVM A;  2MHN A;  2OPQ A;  1C1B B;  5K8N A;  3FSY A;  1RAE B;  4OHV A;  2GJF A;  2HK2 A;  2LQ8 A;  3CD0 A;  4DN9 A;  3G96 A;  3RTV A;  5HMW A;  3M9M B;  2HHV A;  3M1V B;  1FFS B;  5DDO C;  1RHM B;  1U6B A;  2H5I B;  3UE2 A;  4MH8 A;  4Z7Y A;  1UJ6 A;  3ZTQ A;  3OFH A;  4CO1 A;  5A8K A;  3GMG A;  2VB6 A;  3CJ2 A;  4MIW A;  4DL2 A;  3OJS A;  1JJ2 R;  1YQH A;  2A3J A;  2XM3 A;  3C15 A;  2BUN A;  1TUG B;  3M9N B;  3DLE B;  2FVR A;  1RE1 B;  2HHP A;  4R5P B;  4YOE A;  1RUS A;  4RW9 A;  4DPO A;  2OI2 A;  4EO6 A;  2FVQ A;  5G0R A;  1IVZ A;  1EZZ B;  3KG0 A;  2ASD A;  4IRK A;  1X8D A; 
#chains in the Genus database with same CATH homology
 1NZ8 A;  1M1G A;  2K06 A;  1NPR A;  2LQ8 A;  3QQC D;  1NPP A;  3EWG A;  4ZN1 A;  3H7H B;  4ZN3 A;  3LPE A;  3P8B B;  2OUG A;  2EXU A;  1M1H A;  2XHC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...