3QQCE

Crystal structure of archaeal spt4/5 bound to the rnap clamp domain
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
58
structure length
58
Chain Sequence
EKACRHCHYITSEDRCPVCGSRDLSEEWFDLVIIVDVENSEIAKKIGAKVPGKYAIRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase subunit b, DNA-directed RNA poly
publication title Architecture of the RNA polymerase-Spt4/5 complex and basis of universal transcription processivity.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Transcription
total genus 4
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 2011-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF06093 Spt4 Spt4/RpoE2 zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.90 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 3qqcE00
1RYQA 3P8BA 3QQCE 4ZN3B 4ZN1B 3LPEB
chains in the Genus database with same CATH superfamily
1YUZA 1R0JA 1QYBA 1CADA 2R93L 1QQTA 2GMGA 1RDGA 3RZ6A 2A68D 1K83L 4AR4A 4JAFA 2V0FA 2EY4E 5IYBL 1PFYA 3HJWB 3QQCE 1PZXA 3P2AA 2KKDA 2CKAA 3P8BA 5C3EL 4A3BL 3HOWL 3GTGL 2XJTA 2C6AA 2M6PA 1LTLA 1E8JA 1WCML 3B0AB 3HOXL 2HVYC 2PYAA 3GTKL 1QCVA 1SMWA 5JVH1 4V196 3FDJA 2O5JD 3GTOL 3GTJL 5C44L 2B63L 3S1NL 2Z3QB 5MFPA 2ERSA 4G6BA 2VUML 3PO3L 1B71A 1BE7A 1R0IA 1YK4A 1RWDA 1DX8A 3H9BA 3PKIA 5FLML 1BQ8A 2RFKB 5K2ME 2WAQP 3PO2L 4AHZA 3HOUL 4TVMA 3MQKB 4AI3A 1Y1WL 3WWLA 1TWCL 2APOB 5IYCL 5IY0A 1NXGA 3LWPB 3ZG6A 2R7ZL 4RXNA 1YV1A 4Y7NL 4A3LL 3RYGA 1S30A 2WB1P 5MGNA 1YK5A 1T9OA 1LKOA 3PIP1 1JYBA 2BE5D 2J9UB 4BBRL 2XJSA 3GTPL 5IYDL 3NFPI 2JI2A 8RXNA 4A3DL 4B8CD 2CR8A 1RYQA 1TWHL 4K9FA 2HR5A 2Z3RB 4AYBP 2E2JL 3CQZL 3GTML 1VZHA 1Y1VL 4C2M1 2LCQA 2NYDA 2E2IL 2JI3A 1R0GA 2XJPA 4YWMA 2PPTA 7RXNA 2CKCA 5DM61 1NXEA 4JAEA 4GS7D 5EIOC 2XJVA 2M4YA 4ME3A 3H0GL 5H1Sc 4YWLA 1VZGA 2M6OA 5GADc 3PZAA 4AHYA 3GTLL 3S16L 4C3JL 4LHNA 2AQCA 1F4LA 4A3EL 4XGHA 1R9TL 1CAAA 2ZIXA 1I6HL 4BXXL 3H3VM 2JA8L 3HOVL 1ODHA 2AUSB 5M5XL 6RXNA 3MSUA 1FHHA 2XJRA 3I4ML 5MLC3 1T9QA 1RYTA 1S2ZA 2JA7L 1C09A 5GAGc 3LWVB 4POFA 1BQ9A 1YUXA 2PVXA 4AHWA 2XJQA 1TWGL 3LPEB 4Y52L 3J7Y1 3J7Z1 3VPBE 3S14L 2C6BA 4A3ML 1BRFA 3LWOB 2V3BB 2NVTL 2DSXA 4X6AL 1IU6A 3LWQB 3S15L 1RDVA 3S1RL 4A3KL 2NVQL 5M5YL 3I4NL 2A6HD 4C3HL 2MS3A 4BBSL 3KYYA 4A3GL 1TWFL 2V0EA 3RZOL 4JADA 3K35A 4POGA 5C4JL 1SMUA 3A44A 2JA6L 1B2OA 1S24A 2JA5L 1BFYA 2YU9L 3IU3I 3KYVA 1H7VA 4AI0A 1IW7D 3S1ML 5M3FL 4AR6A 5EINC 2VL6A 1R0HA 1P7PA 3M3YL 3GTQL 3QVDA 1B2JA 5C4XL 3HAXC 5DM71 4AR5A 2A6ED 3S1QL 1NNQA 4UY81 3MPSA 3HOYL 5AI3A 3SS2A 5GAHc 1SMMA 3S2DL 2NVYL 1OWCA 2PVEA 5RXNA 3LNLA 1DVBA 5AI2A 5M3ML 3KYXA 3HJYB 2ERJA 3S17L 4A3CL 4AI1A 4AR3A 5IP9L 1WJVA 3HKZP 4AI2A 4LHLA 1SFOL 2QL0A 4A93L 2K2DA 3RZTA 4ZN1B 1T9PA 2L0ZA 1R0FA 5MFZA 1TWAL 4C3IL 3H97A 4A3IL 3B08B 4ZN3B 2KN9A 3M4OL 5M5WL 1VCXA 5GAEc 1LKPA 2A69D 1IRNA 4TPUA 1VZIA 3PL5A 1Z92B 2JI1A 1PFVA 3S2HL 4JAGA 4E6YA 2Y0SP 3PWFA 2H12A 3K7AL 2AYJA 4WFN1 2RDVA 3PIO1 1I50L 5AN9H 3RZDL 3HOZL 4XXBB 3WWNB 3LWRB 1RB9A 3JR7A 4BY1L 4U671 2PMZP 1ZRPA 2E2HL 1OWBA 3PKJA 1IROA 2PSMC 3FKIL 5IP7L 2NVXL 5FJ8L 2XJUA 4QIWP 2B5ID 2M4VA 4A3JL 5MF6A 1LKMA 2R92L 3H99A 1PFUA 4A3FL 3H9CA 4AHXA 3KYWA 1B13A 1IU5A 1FHMA 1PFWA 4BY7L 1I3QL 3KYUA 5JVG1
chains in the Genus database with same CATH topology
1YUZA 3J7Y1 3J7Z1 2QL0A 3RYGA 1S30A 2K2DA 3RZTA 4ZN1B 5MGNA 1T9PA 3VPBE 1YK5A 2L0ZA 1R0FA 1R0JA 5MFZA 2C6BA 1T9OA 1QYBA 1BRFA 1CADA 1LKOA 3B08B 4ZN3B 2V3BB 2DSXA 2GMGA 1RDGA 3RZ6A 3PIP1 1IU6A 2KN9A 1JYBA 1RDVA 2BE5D 2J9UB 2A68D 1VCXA 5GAEc 2XJSA 4AR4A 1LKPA 2A69D 4JAFA 2V0FA 1IRNA 3NFPI 4TPUA 1VZIA 2A6HD 2JI2A 3QQCE 1Z92B 3P2AA 8RXNA 2KKDA 2MS3A 2JI1A 2CKAA 3P8BA 4B8CD 2CR8A 4JAGA 3KYYA 4E6YA 2XJTA 2C6AA 2V0EA 1RYQA 3PWFA 4JADA 2M6PA 3K35A 2H12A 4POGA 1LTLA 4K9FA 1SMUA 1E8JA 2HR5A 2AYJA 2Z3RB 3A44A 1B2OA 1VZHA 4WFN1 2RDVA 3B0AB 2LCQA 2NYDA 1S24A 3PIO1 5AN9H 1BFYA 3IU3I 2JI3A 3KYVA 1H7VA 1R0GA 2PYAA 4XXBB 2XJPA 3WWNB 4YWMA 4AI0A 1IW7D 1RB9A 1QCVA 2PPTA 4AR6A 1SMWA 5EINC 7RXNA 2VL6A 5JVH1 4V196 2CKCA 1R0HA 5DM61 1NXEA 2O5JD 4JAEA 4GS7D 3QVDA 5EIOC 2XJVA 4U671 2Z3QB 2M4YA 4ME3A 5MFPA 1B2JA 1ZRPA 2ERSA 4G6BA 5DM71 4AR5A 2A6ED 5H1Sc 4YWLA 1OWBA 1VZGA 2M6OA 1IROA 1B71A 3PKJA 1BE7A 1NNQA 4UY81 1R0IA 1YK4A 2PSMC 3MPSA 1RWDA 3PZAA 4AHYA 5GADc 4LHNA 5AI3A 1DX8A 3SS2A 5GAHc 4XGHA 3PKIA 1SMMA 1CAAA 2ZIXA 1BQ8A 2XJUA 5K2ME 2B5ID 1OWCA 2M4VA 1ODHA 2PVEA 4AHZA 1LKMA 6RXNA 5MF6A 3MSUA 5RXNA 4TVMA 3LNLA 1FHHA 2XJRA 1DVBA 5AI2A 3KYXA 2ERJA 5MLC3 4AHXA 3KYWA 1B13A 1T9QA 4AI1A 1RYTA 1S2ZA 4AI3A 1IU5A 1FHMA 1C09A 5GAGc 3WWLA 4POFA 5IY0A 3KYUA 1NXGA 4AR3A 1BQ9A 1YUXA 2PVXA 4AHWA 3ZG6A 5JVG1 2XJQA 1WJVA 4AI2A 4RXNA 1YV1A 3LPEB 4LHLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RYQ A;  3P8B A;  3QQC E;  4ZN3 B;  4ZN1 B;  3LPE B; 
#chains in the Genus database with same CATH topology
 1YUZ A;  1R0J A;  1QYB A;  1CAD A;  2R93 L;  1QQT A;  2GMG A;  1RDG A;  3RZ6 A;  2A68 D;  1K83 L;  4AR4 A;  4JAF A;  2V0F A;  2EY4 E;  5IYB L;  1PFY A;  3HJW B;  3QQC E;  1PZX A;  3P2A A;  2KKD A;  2CKA A;  3P8B A;  5C3E L;  4A3B L;  3HOW L;  3GTG L;  2XJT A;  2C6A A;  2M6P A;  1LTL A;  1E8J A;  1WCM L;  3B0A B;  3HOX L;  2HVY C;  2PYA A;  3GTK L;  1QCV A;  1SMW A;  5JVH 1;  4V19 6;  3FDJ A;  2O5J D;  3GTO L;  3GTJ L;  5C44 L;  2B63 L;  3S1N L;  2Z3Q B;  5MFP A;  2ERS A;  4G6B A;  2VUM L;  3PO3 L;  1B71 A;  1BE7 A;  1R0I A;  1YK4 A;  1RWD A;  1DX8 A;  3H9B A;  3PKI A;  5FLM L;  1BQ8 A;  2RFK B;  5K2M E;  2WAQ P;  3PO2 L;  4AHZ A;  3HOU L;  4TVM A;  3MQK B;  4AI3 A;  1Y1W L;  3WWL A;  1TWC L;  2APO B;  5IYC L;  5IY0 A;  1NXG A;  3LWP B;  3ZG6 A;  2R7Z L;  4RXN A;  1YV1 A;  4Y7N L;  4A3L L;  3RYG A;  1S30 A;  2WB1 P;  5MGN A;  1YK5 A;  1T9O A;  1LKO A;  3PIP 1;  1JYB A;  2BE5 D;  2J9U B;  4BBR L;  2XJS A;  3GTP L;  5IYD L;  3NFP I;  2JI2 A;  8RXN A;  4A3D L;  4B8C D;  2CR8 A;  1RYQ A;  1TWH L;  4K9F A;  2HR5 A;  2Z3R B;  4AYB P;  2E2J L;  3CQZ L;  3GTM L;  1VZH A;  1Y1V L;  4C2M 1;  2LCQ A;  2NYD A;  2E2I L;  2JI3 A;  1R0G A;  2XJP A;  4YWM A;  2PPT A;  7RXN A;  2CKC A;  5DM6 1;  1NXE A;  4JAE A;  4GS7 D;  5EIO C;  2XJV A;  2M4Y A;  4ME3 A;  3H0G L;  5H1S c;  4YWL A;  1VZG A;  2M6O A;  5GAD c;  3PZA A;  4AHY A;  3GTL L;  3S16 L;  4C3J L;  4LHN A;  2AQC A;  1F4L A;  4A3E L;  4XGH A;  1R9T L;  1CAA A;  2ZIX A;  1I6H L;  4BXX L;  3H3V M;  2JA8 L;  3HOV L;  1ODH A;  2AUS B;  5M5X L;  6RXN A;  3MSU A;  1FHH A;  2XJR A;  3I4M L;  5MLC 3;  1T9Q A;  1RYT A;  1S2Z A;  2JA7 L;  1C09 A;  5GAG c;  3LWV B;  4POF A;  1BQ9 A;  1YUX A;  2PVX A;  4AHW A;  2XJQ A;  1TWG L;  3LPE B;  4Y52 L;  3J7Y 1;  3J7Z 1;  3VPB E;  3S14 L;  2C6B A;  4A3M L;  1BRF A;  3LWO B;  2V3B B;  2NVT L;  2DSX A;  4X6A L;  1IU6 A;  3LWQ B;  3S15 L;  1RDV A;  3S1R L;  4A3K L;  2NVQ L;  5M5Y L;  3I4N L;  2A6H D;  4C3H L;  2MS3 A;  4BBS L;  3KYY A;  4A3G L;  1TWF L;  2V0E A;  3RZO L;  4JAD A;  3K35 A;  4POG A;  5C4J L;  1SMU A;  3A44 A;  2JA6 L;  1B2O A;  1S24 A;  2JA5 L;  1BFY A;  2YU9 L;  3IU3 I;  3KYV A;  1H7V A;  4AI0 A;  1IW7 D;  3S1M L;  5M3F L;  4AR6 A;  5EIN C;  2VL6 A;  1R0H A;  1P7P A;  3M3Y L;  3GTQ L;  3QVD A;  1B2J A;  5C4X L;  3HAX C;  5DM7 1;  4AR5 A;  2A6E D;  3S1Q L;  1NNQ A;  4UY8 1;  3MPS A;  3HOY L;  5AI3 A;  3SS2 A;  5GAH c;  1SMM A;  3S2D L;  2NVY L;  1OWC A;  2PVE A;  5RXN A;  3LNL A;  1DVB A;  5AI2 A;  5M3M L;  3KYX A;  3HJY B;  2ERJ A;  3S17 L;  4A3C L;  4AI1 A;  4AR3 A;  5IP9 L;  1WJV A;  3HKZ P;  4AI2 A;  4LHL A;  1SFO L;  2QL0 A;  4A93 L;  2K2D A;  3RZT A;  4ZN1 B;  1T9P A;  2L0Z A;  1R0F A;  5MFZ A;  1TWA L;  4C3I L;  3H97 A;  4A3I L;  3B08 B;  4ZN3 B;  2KN9 A;  3M4O L;  5M5W L;  1VCX A;  5GAE c;  1LKP A;  2A69 D;  1IRN A;  4TPU A;  1VZI A;  3PL5 A;  1Z92 B;  2JI1 A;  1PFV A;  3S2H L;  4JAG A;  4E6Y A;  2Y0S P;  3PWF A;  2H12 A;  3K7A L;  2AYJ A;  4WFN 1;  2RDV A;  3PIO 1;  1I50 L;  5AN9 H;  3RZD L;  3HOZ L;  4XXB B;  3WWN B;  3LWR B;  1RB9 A;  3JR7 A;  4BY1 L;  4U67 1;  2PMZ P;  1ZRP A;  2E2H L;  1OWB A;  3PKJ A;  1IRO A;  2PSM C;  3FKI L;  5IP7 L;  2NVX L;  5FJ8 L;  2XJU A;  4QIW P;  2B5I D;  2M4V A;  4A3J L;  5MF6 A;  1LKM A;  2R92 L;  3H99 A;  1PFU A;  4A3F L;  3H9C A;  4AHX A;  3KYW A;  1B13 A;  1IU5 A;  1FHM A;  1PFW A;  4BY7 L;  1I3Q L;  3KYU A;  5JVG 1; 
#chains in the Genus database with same CATH homology
 1YUZ A;  3J7Y 1;  3J7Z 1;  2QL0 A;  3RYG A;  1S30 A;  2K2D A;  3RZT A;  4ZN1 B;  5MGN A;  1T9P A;  3VPB E;  1YK5 A;  2L0Z A;  1R0F A;  1R0J A;  5MFZ A;  2C6B A;  1T9O A;  1QYB A;  1BRF A;  1CAD A;  1LKO A;  3B08 B;  4ZN3 B;  2V3B B;  2DSX A;  2GMG A;  1RDG A;  3RZ6 A;  3PIP 1;  1IU6 A;  2KN9 A;  1JYB A;  1RDV A;  2BE5 D;  2J9U B;  2A68 D;  1VCX A;  5GAE c;  2XJS A;  4AR4 A;  1LKP A;  2A69 D;  4JAF A;  2V0F A;  1IRN A;  3NFP I;  4TPU A;  1VZI A;  2A6H D;  2JI2 A;  3QQC E;  1Z92 B;  3P2A A;  8RXN A;  2KKD A;  2MS3 A;  2JI1 A;  2CKA A;  3P8B A;  4B8C D;  2CR8 A;  4JAG A;  3KYY A;  4E6Y A;  2XJT A;  2C6A A;  2V0E A;  1RYQ A;  3PWF A;  4JAD A;  2M6P A;  3K35 A;  2H12 A;  4POG A;  1LTL A;  4K9F A;  1SMU A;  1E8J A;  2HR5 A;  2AYJ A;  2Z3R B;  3A44 A;  1B2O A;  1VZH A;  4WFN 1;  2RDV A;  3B0A B;  2LCQ A;  2NYD A;  1S24 A;  3PIO 1;  5AN9 H;  1BFY A;  3IU3 I;  2JI3 A;  3KYV A;  1H7V A;  1R0G A;  2PYA A;  4XXB B;  2XJP A;  3WWN B;  4YWM A;  4AI0 A;  1IW7 D;  1RB9 A;  1QCV A;  2PPT A;  4AR6 A;  1SMW A;  5EIN C;  7RXN A;  2VL6 A;  5JVH 1;  4V19 6;  2CKC A;  1R0H A;  5DM6 1;  1NXE A;  2O5J D;  4JAE A;  4GS7 D;  3QVD A;  5EIO C;  2XJV A;  4U67 1;  2Z3Q B;  2M4Y A;  4ME3 A;  5MFP A;  1B2J A;  1ZRP A;  2ERS A;  4G6B A;  5DM7 1;  4AR5 A;  2A6E D;  5H1S c;  4YWL A;  1OWB A;  1VZG A;  2M6O A;  1IRO A;  1B71 A;  3PKJ A;  1BE7 A;  1NNQ A;  4UY8 1;  1R0I A;  1YK4 A;  2PSM C;  3MPS A;  1RWD A;  3PZA A;  4AHY A;  5GAD c;  4LHN A;  5AI3 A;  1DX8 A;  3SS2 A;  5GAH c;  4XGH A;  3PKI A;  1SMM A;  1CAA A;  2ZIX A;  1BQ8 A;  2XJU A;  5K2M E;  2B5I D;  1OWC A;  2M4V A;  1ODH A;  2PVE A;  4AHZ A;  1LKM A;  6RXN A;  5MF6 A;  3MSU A;  5RXN A;  4TVM A;  3LNL A;  1FHH A;  2XJR A;  1DVB A;  5AI2 A;  3KYX A;  2ERJ A;  5MLC 3;  4AHX A;  3KYW A;  1B13 A;  1T9Q A;  4AI1 A;  1RYT A;  1S2Z A;  4AI3 A;  1IU5 A;  1FHM A;  1C09 A;  5GAG c;  3WWL A;  4POF A;  5IY0 A;  3KYU A;  1NXG A;  4AR3 A;  1BQ9 A;  1YUX A;  2PVX A;  4AHW A;  3ZG6 A;  5JVG 1;  2XJQ A;  1WJV A;  4AI2 A;  4RXN A;  1YV1 A;  3LPE B;  4LHL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...