3QQNA

The retinal specific cd147 ig0 domain: from molecular structure to biological activity
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
117
structure length
117
Chain Sequence
MAGFVQAPLSQQRWVGGSVELHCEAVGSPVPEIQWWFEGQGPNDIMSQLWDGARLDRVHIHATYHQHAASTISIDTLVEEDTGTYECRASNDPDRNHLTRAPRVKWVRAQAVVLVLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Retinal Specific CD147 Ig0 Domain: From Molecular Structure to Biological Activity.
pubmed doi rcsb
molecule keywords Basigin
molecule tags Cell adhesion
source organism Homo sapiens
total genus 25
structure length 117
sequence length 117
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13927 Ig_3 Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qqnA00
4KQ3H 4KUCF 4M61A 4LRIA 3V52H 2Z92A 1NUNB 3O6KL 2J88H 1LEGB 1N7MH 4LEOB 3NZHL 1YJDL 3BWAB 3KPTA 4RMVA 5GRXG 4WW1A 1TQCB 1AP2A 4MAYC 4OCXH 4UQ3A 4YIQB 3GSNL 3HI5L 3FQUB 1JZ6A 4NCC1 1U3HA 4HS8L 2E8YA 1OM3H 3ZKSD 5D7IA 3UROR 4YHNA 1QSFE 5BV7C 1ZT4A 2Y06H 4Y4HA 3W39A 5DK2B 5I1KL 1BF2A 2PXYC 4ODXA 3QUYC 3MBEB 3PGCB 4ZDHB 3DIFA 1JPFB 2AJYH 4P2RE 4N0UB 4JGJA 3NCMA 4MQTB 2F58L 3BE1L 3TJHC 1VPOL 2GJJA 5A2IH 2CJUH 3VXMD 1PG7X 5CKGA 1S9VB 5T1KD 4MXWL 4OF5A 2Z31D 4PJAF 4ELKB 2R9HD 4L9LC 4JDVB 3MLSH 3UJIL 1U3HD 4QRPB 5FHBL 2GQHA 3DTXB 2C3XA 4RWYH 4GLRH 4EI6A 3U36B 5D2NB 2UY7A 5CWSA 4CVWA 3PL6A 2XNAA 3RUGE 3AREC 3KJ6L 4Y2OA 3ARGA 1TCMA 1ZTXH 4QTHA 1HHKA 1MELA 4ELMF 3VW3H 1F4XL 2W60A 2XN9A 5F88A 5MEPB 4IJ3B 2V5RA 1CL7I 1A3LH 1XCTA 2RBLA 4R8WL 4Z7WF 2CRIA 2IH3A 3CFJB 1A1MA 2JCCE 4LKCA 1FC2D 2OK0L 1SJHA 4YEEA 3G6DL 1TJIH 2A73A 4MAYA 3GJEA 3TBWB 3JWNC 1MHCB 3QRFM 3X13A 4MNQA 5CJ8A 2HT4C 2YEZB 5MP6H 3VGDA 5I1GL 3ARGD 5FYKD 3V4UH 1N59B 4RAHA 3CFKB 4OLWH 3MNZB 1C8PA 3TT3H 5EN2B 4OBRA 3S3JA 2HVKA 3K8KA 1EZVY 5HYQA 4D0BB 1NEUA 2PXYA 3FQWA 3QUYA 4M7KH 1MRDH 2RGSA 1H8SA 5HGAB 4H8WC 1T20A 1RK1B 1IEBA 3F12A 3N85L 3QBTB 5T3XE 4KDWA 2X6MA 3NPSB 4QHLB 1G7IB 1OPGH 1CG9A 2YPVL 3VXUE 2E27H 2ZUVA 1TXKA 1I7TB 4G6JL 2IGFL 5EBLB 1WAAE 4HEME 3KS0H 5HVFB 1I4FB 4LHUG 3MRNB 5C0DB 4ONHA 1NMBL 3KPRB 4L9LA 4XNMB 3RVXD 5K9OB 3MR9A 3OPZL 1MFDL 2AQ1A 2CIIB 1CU4H 2QQNL 4X9IA 3GB7A 3LMJH 1F58L 5E56A 4QT5B 4BQ8A 5BS0E 3QUYD 3AREA 5DO2C 5HHXL 1KACB 1Q9WB 4KTEL 2E7LC 1CGSL 3TJHD 1CF8H 5DLMH 1LD9B 3OKKB 1IGMH 3FO1A 2A6KA 4RFNC 4WHDA 4KUCD 1BAFL 3U48A 5E5MA 1KFAH 3RTQB 2H45A 3U7YL 5JUEH 2R4RL 4P3WA 2JELL 4RRPG 4LBEB 3WUWA 3F58H 2P5WA 3E2HB 3KNBB 2MKLC 4L4VE 5E2TH 3GGWA 1MREL 2YXFA 4M48L 3RX7A 5CMAA 5T5FL 3V5KA 3QDJE 1Z2KA 2HT2D 4Z7QE 1I8MA 3IXAB 4FHBD 1HOCA 2X4SA 2Y5TB 5GZOC 1YYMH 3CUPB 3JWDL 1H3PL 1NC4A 5DJYB 1ITCA 2H9GA 2LU7A 4XWGL 4OQTL 2XV6B 5IVZA 4TULL 4KMTL 1KPUA 3H3PL 4MA3B 3MRGA 4NOBA 3W9DB 3PDOA 4JFPA 3RGVB 1DBMH 1GC1H 2HN7B 4S1SL 1D5BA 5JOEA 4CRPA 1K2DA 3Q6FB 2P5WD 2A0LD 3REVB 1R3HA 1IQWL 1QHOA 1SYSA 4HFWA 5EIVA 4ONFH 4O5LH 3W11D 4O51A 1CZ8L 4Z7VB 4P5KB 4CU7A 1G9NC 1DANT 5J6GB 1NLBL 5BMFH 2HT4D 4M00A 4XCNA 5L2KE 4ZUTB 2QQLL 3BZFA 4F57L 2VXTH 3RQ3A 3WHE0 2IALA 2FLRT 1U8QB 2PCPB 1FNEB 4HKBA 1L0XA 3ZT6A 5KW9H 1U0QA 1CLOL 4DKEL 1DDHB 3O2DH 3V6ZA 4HCRL 1CVRA 5CZVL 1JUFA 3GHBH 1OLLA 1G7MB 2EDFA 4Y5YB 4Z95L 3MA7A 2HTKD 5B39A 1NGQL 2ID5A 4ZOBA 3BHBB 3IJYA 3NCFB 3OXSA 4GH7B 4DK3A 2LVEA 2W9LA 2K3TA 1Q94A 4G6ML 2DQIH 4M43H 3CSGA 1RIHL 4TSCH 5ISZB 2OCFD 1G7LA 5GSVA 1H3VA 5FM5O 3UTZB 1UXSA 2VNCA 4GUPA 15C8L 3O4LB 5LQBL 2VLLA 2X09A 2O61A 4L8BA 1RZJL 4RSVA 1OWWA 5E03A 4RA0C 5JHDA 4LCUB 4DAGL 3HLAB 4NO5A 1UWGL 2A77L 5IJKA 3KPLB 2WWKO 4HWZA 1PEZA 4GOSA 4HSQA 5DO2D 4J3SA 3QEHB 5EU6A 5DMJB 1EFXA 1V7ML 5EOQH 1KB5H 2ZUYA 5KS9A 2MCPH 1FVDA 3O4OB 3TZVB 2Y5EA 5H2BB 3IGAB 1U3ZA 2QL1A 4QHUB 1PSKL 5I1HL 3ZMRA 5DHVH 2AJXL 5IROC 1MWAA 2NY3C 4WHYG 1JWMA 4JJ5B 4YX2H 5J0BA 1YDPA 4J2XA 3O3EB 2LQRA 1P6AB 3THMH 3V5DA 1FRGH 3KAAA 3QPXL 4Y88A 5JHDD 4NQCE 1D5MB 5HYEA 4TUOB 3CD4A 1KG0A 3MRHB 4PRPE 2Q3AA 4FNLH 4N8VG 4Q9BA 3WIFB 1DQQB 1N0XH 1JZ5A 3JUYA 2X9XA 3BAEL 1MI5B 2R1YB 4PV9A 1EFXD 4KTYA 3U4BH 1NDGA 4P2OB 3MOAH 4L3EE 5C9JB 4HUMB 1H8OA 3QEGL 5F7FA 2FBJH 3ZKXC 3BDXA 2NX5A 4ODTL 1N6UA 5D2NC 2BFVH 3WUZA 2Y07L 1CE1L 4BSVB 1BOGA 5TH2B 3WHXB 4EBQL 5DJ6A 2FX9L 2N4IA 1TZGH 2QJDA 5CSBA 3T0ED 1U92A 4IRSB 4HT1H 3ARFA 1I7UB 2C1PB 4K94H 5EBWB 3VFVA 1P4IL 2X05A 4XNQA 4R4NC 5D70L 3QR2A 2HKHH 4ZNCD 1VFAB 4U7KA 1QSFB 3G5VA 1UACL 2A74A 4W68A 1CQKA 2PW2A 1HHGA 1TQBB 3QDGE 1LEGA 3B9KD 4RGNE 2A83B 1WQVT 4P2RB 2PF6A 2B2XL 3AY4C 1U2HA 2C9AA 4QYOB 5IFAL 4ZTPL 3MV8A 4XAWL 2YA2A 1LQSR 2ZWLT 4J6RL 4QXUL 2AJSH 2V7NA 4XNUH 2DQGL 4F7MA 2BOCB 3FQUA 1C7SA 4HUUA 3CVHB 2ARWA 3LKNB 1JHLH 3GBNH 1R24A 2J4WL 3SE9H 3BYYA 4HQQL 4KKBC 1KT2A 3QUKB 4U2YA 4YDLB 3I6GA 5C6TH 4PBWD 1MAKA 1PLGL 3TVMB 2YC1A 1QZ1A 3RNKB 2XTLA 4U6XB 2RQ8A 5DK2A 5IROA 3RL2A 4UDUB 3U9UA 4Y4FC 3IDMA 2ESVA 5TDPA 4GXUN 3BW9B 4FQ1H 4KVCH 3HPJB 3NIFF 3HNSL 3PHOB 5CP7B 3RWJB 3KXFE 1DQDH 3LD8B 4TSAH 5DR5L 1IC7L 3RUGB 3UCRA 2F8VA 5DD3L 3MGTB 3SDCB 1BZ9A 2DM4A 5KVFH 2FDBP 3C9NB 2GTWA 1U93B 4Q6IC 2AABH 1K4CA 5DJCA 1B9ZA 4WUUA 1QPPA 2HJLA 4NKIL 1IQDA 4X6FA 2Q86B 4NQDE 5KTEH 4L1DA 4RNRB 1A3QA 1ULVA 5GS0C 2ORBH 3DV6B 3QO1B 3Q48A 1UFUA 2UZYB 4GKSA 1RQ5A 3U36A 1KTDA 5D2NA 2EE2A 2JCCB 3H2WA 3TWCH 3N06B 2J3SA 2NY3D 2VLME 5AWNH 1F4YL 3KYAA 3MBED 1BWWA 5CZKA 5LGKA 1PW3A 3OKNA 3EDDA 3OSKA 2VH5H 3RIAF 2MSPA 4RGMB 1AO7A 1H0DB 1JJUA 2IFFH 5I16B 1LHZA 2FJFA 5F9WC 1JNLH 2VXQL 3HUJA 5FF6A 4U2ZA 4F7PA 1CD9B 4Z7VF 2IMNA 3P0YH 3I2CL 1KENH 3GSWA 4HS3B 2Y7QB 5KN5A 4QRPD 3AY4A 3RGHA 5DRXA 4PGZA 1KSRA 3RBGA 4UINH 4LOUD 3W81A 2GY5A 3SGKC 2YWYA 4N0YL 5I76B 3VXUB 5D7SH 5HDQL 4S2SB 3D3VE 5HHPB 3O6ML 3GSRB 3LY6A 3MNZA 1MEXL 3ULVE 1BJMA 2W0PA 2IPUG 1PGRB 4X9HA 1D5IL 1TJGH 4X80H 5C1MB 5L8KB 3UYRL 3FO9B 1E6OL 1UVQB 4I5BA 3ZE2E 5F9DC 3HC0A 4R90L 4R4ND 4Y4FA 3QUMA 1DUZB 2NY5L 5DURB 3OBAA 4XWOC 2BY3A 1CK0L 5BS0B 4X6BA 2BC4A 1HQ4B 4X5XA 4JO3H 4OD1L 2P5EE 1XGUB 4OGZA 4Q6IA 1LEIB 1ED3A 3GI8L 1MOEA 3P0VL 1QFUL 4U1SB 1RJYB 4O9HL 2GW5A 3OJDA 1BX2B 2BSRA 3QEQA 4YHIA 3QWRA 5F9OH 2CIIA 1Z5LA 2EIBA 4CJ1A 1HILB 4L4VB 3QDAA 1GOHA 1Q9OA 3C2SA 2VL5B 5IB2B 3ILPB 2C3HA 3ECBA 1G7JA 4O02L 4LKXA 3QDJB 4PB9L 1LD9A 3IRPX 3DARA 3QFJE 5LWYL 3RWCB 1C08B 4Y2DC 4ZNEE 2VL4A 2V5SA 4ZUSA 2AEQH 3RVUC 5ECJE 7FABH 1WBZB 1XR9A 3BJ91 4DFIA 4Y19E 3BSZH 1DEDA 4I0KA 3FT3A 2GI7A 4W6XB 1LO5B 4HXAH 3KPRD 4KUZH 1ZVYA 1X5LA 2YRZA 1OTTD 3PHQB 3DVFA 1KJ2L 1V3MA 2JLLA 4YXKH 3WMSA 3SGKA 1I9RL 4KJWD 3PV6B 4HXBH 1DLFL 2C4FU 1RVFL 3BESR 3VD5A 3QHZL 5I18L 2D7TL 4LGSB 4PRDB 3HG1A 5L2KB 3O45A 5GJSL 5ILTH 3BYTA 4HK3N 5FM8A 3GDBA 4OCYH 3PWJA 5JHLH 4UB0L 5I2IA 5E00B 4PRHE 1RZGB 5B8CC 3TM6A 4ONGH 4GKZB 3RWHB 3PUCA 4ISVA 1FL5B 1NH6A 1JYVA 3FOLA 2O26U 4JEGB 4MCZB 4OI7A 2XACC 3D25B 5DQ9A 1IARB 1RJLB 4JKMA 2OL3H 3OR6A 3D85A 4LHUB 3U9PL 1EVTC 2P8LB 2X4OB 1AFVH 4PJ7E 4ZUTA 3VD4A 1TVBA 3ETBF 1OAYL 1EAPB 1FNEA 1VEMA 5ACZB 4WI6A 4P2OC 2UUDH 3V52L 3QZWG 2J88L 3V4VH 1N7ML 1S7WB 1X7QB 3EDFA 4ZFGH 3RGVD 4XWOD 3U7AA 5EORH 2BMKA 4U31A 4A2MA 1ZHKB 3MRLB 4NZJA 4OCXL 4MD0A 4PGDB 1I8KB 3IAGC 4Y2DA 1WZKA 2GSGB 4BSWB 3G04B 2VDQH 5E4EB 3D85D 1B4JL 2R2EA 4JY4A 1NAMB 4LLYB 3V7AG 5GGRB 2Y06L 3AAZB 3BO8B 3WS3A 2EDQA 2VITA 3X3GH 2CR3A 4XZUB 5IVXA 4GW1A 3RVTC 1XH3B 3L3IB 1M7DB 4GW4A 5J9PA 2R8SL 3ARRA 4QHKI 1PYWA 5EU4B 5SWQA 3G5YA 4NQCB 1P5UA 4PRPB 3T0DA 1T22B 1I9JH 3JTSA 4Y2DD 2OR7A 4K2UH 3O8XC 3E1F1 1BREA 1IKFH 1ZEAL 2I07B 3MLSL 1XF3A 1YPZA 1DTUA 4ZQKA 3SPVB 5ISZD 2DRUA 3DMMC 1INQB 4Y8AA 3C09B 5B8CA 4L3EB 3PNWA 3ULUH 2FEEL 3MREA 4KKNA 5TPWH 2Y6SD 1YMMA 3ESUF 1DZBA 3AROA 5EH1A 2FO1A 1PY9A 3I6LE 1ZTXL 3DPBA 1D6EB 1S7UB 1JPSL 3NN8B 2DQHH 3VW3L 4MZ2A 1SJEA 2E9JA 4NZDA 1EO7A 3NFNA 2PO6B 5IHLB 1YEHH 5IB1A 1T0PB 1YZZA 3CH1A 1XF4A 4IOIB 2ZUTA 5KBNC 4XMLH 4W4NA 4P2OA 3LKQB 1A3LL 4HC1A 3TZVD 1NPUA 1CDUA 3QDGB 4HH8A 2R23B 3S96B 4RGNB 1WAAF 5C7XH 2R0ZH 3O9WB 3V0WH 1TJIL 3U0WH 3OKEB 5HJ3B 1A3RH 1B4RA 5DJDA 5MP6L 1A9BB 3V4UL 5DGRA 2C1PA 4NQUA 3TT3L 1M71B 5IT2L 1NFIB 4K8RD 4XCCH 4EOWH 3C8HA 3NH7L 4W4OC 1SY6H 1MRDL 2ZCLH 3C08L 2SEBA 3FQTA 4S1QH 1MI5D 5DDHB 1O5DT 2GKIA 4P2OD 2UWEF 5LBSH 1B0RB 2HFFA 3IXTA 1KIQB 3KXFB 1K3IA 3B6SA 4QTIH 4WJ5B 2E27L 2Q1EA 4U1IA 3P77B 3LQZA 2ILLA 3V7AE 4XCYB 3O8XA 1AQDB 4O2EB 4GLRI 3MRFB 1G6VK 4GG8A 2D31B 4IRSD 2NXZB 4NQDB 1IAOB 3B5HA 4CNIA 1A21A 5C0GB 3DMMA 4LARH 5T33H 1HINH 3EDEA 4WI9A 3S36H 1QSFD 3LMJL 4TUJB 2H2PD 3QJFB 3T8XA 3U0TA 4ZXBC 4LP4A 4IRJB 4OZHE 5EIIA 1CF8L 3DX9B 5DLML 4N8VB 1IGML 2I60H 5ESQB 3Q3GB 1KFAL 4OKVB 5IFHL 5JUEL 2W92A 4PJXF 5TQ2H 1FFOA 2XWTA 3SDAC 3MJGX 3CDGB 4OZ4A 4KRPC 4PRIA 1WIOA 3F58L 3O8XD 3T3PF 5C6WH 1JGEA 2KQNA 4HLJA 4ZYKB 2W9DH 5E2TL 3SKOB 2JCCA 1C16A 1ADQA 1MFAH 4JPIA 4PJ9B 3UBXA 4ZUWA 2AXGA 1HYRC 1LNUB 4JM2C 2CKBL 4M1CD 4NZRH 2W65A 2BY1A 1YYML 3SDCD 3D3VB 3EUUA 1WZMA 1X5GA 1FHGA 1EHNA 2D03H 1F90L 4YR6B 3U0PA 2XZAH 4B41A 4W4OA 1TCRA 2B0SH 1AGFA 1DBML 3GRWA 1SYVB 5T1MB 3KYNB 3DO7A 2WM0A 4MDJB 2VO5A 3NOIA 1UJ3C 5D6CB 1V7NL 3O6FB 4ONFL 1CQYA 1CLYH 4N0FB 4YO0B 1HWHB 3BD3A 2P5EB 4NRYA 2IH1B 5DEFB 1NMCB 4R3SA 5GIRA 5BMFL 4A6YH 4CADB 2VXTL 4HFUH 5BV7H 5FO8B 2VABA 5IMKA 3VFPB 1WGOA 2VXUH 3EO0A 2OTPA 3O2DL 5EZLB 4Z77B 4JZNB 4MAUH 3GHBL 1F45A 4DUVA 3V6OC 1OGAE 1RZKH 4C83B 3MUHL 4P46B 4P2YA 4ZFFB 4ZXBA 1KEGH 4XT1C 3QFJB 5T3XD 3IKCB 2WQRA 4JVPA 4YHPA 4F2MB 3TO4B 5E8OA 1YN7B 4M43L 4TSCL 3SDAA 4QOKA 2FEDC 3SE4C 3BP4B 3RWEA 4Y19B 1PKOA 1ES0A 4HWBH 5DFVD 5JO5A 3GSNB 1R5VB 3FFCE 5L8JB 4MS8D 1R5IB 1UZ6E 5HYJE 4F7TB 1DVFB 2EDOA 3ZHKA 1FL3B 5DURD 4TNWF 4ODWB 3FB6A 4JM2A 3ZTJH 5INCA 5BS0D 4YDKH 1UXWB 2DMCA 4U1NB 2HFGL 5F1KC 1BP3B 4S1DD 2VLKA 5D1QB 4OM1H 1KTLB 5EOQL 1KB5L 2BVUA 2MCPL 2ZSVA 4Z7UF 4ZPVB 1AY1H 2I9LA 1LO5A 5CCKH 1WCBB 2B4CC 4HV8B 4PRHB 3WKMH 4KRPD 4YX2L 5E6YA 1UJ3A 2IJ0C 3DYPA 2KDGA 4HK3J 3THML 1FRGL 1NCWH 4L4VD 2UY6A 2Z35B 5KSUB 4C56E 4JFHD 3PV6A 1FG9C 5AD0A 5J1AA 4FNLL 5E5RB 3QDJD 1YEDB 4XBEL 2X42A 4UILH 4HG4J 4PRDA 4PJ7B 1N0XL 4JRXE 1MUJA 4CU8A 4J3VA 4LK4A 3U79A 1CYGA 2HMIC 5CJXC 1S7SA 1RHFA 4M7JH 2QSVA 1ZT1B 5TDOA 2FBJL 3RWGA 3FAWA 3V6OA 2BFVL 3DVNA 4GKZA 3KDMB 2Z8SA 4X4MA 5E6IC 2XOTA 1W0VB 3B8YA 1CTOA 1TZGL 2NY1B 5EO9A 4N90E 1P9MC 1IJ9A 3WD5H 1BLNA 1UB6B 2GIYA 4K94L 3SE4A 2XPGB 3QUZB 1KJVA 1QACA 2PO6C 2V2WB 3TO2B 4BQCA 1QTYT 1IGFH 1T2QH 5IESH 1AXSB 4FQXC 4ODVH 1FZMB 2YD3A 5L2KD 3HC4H 3FB7B 1TVHA 3HZVA 4PRNB 2GUOA 4X7TA 1AR2A 4N68A 1P7HL 4HGKC 3VJ6A 4Q9RH 1EZVX 3P9WB 4X99B 3P4NA 4MB5A 4HJJH 1G1CA 3IFLH 4QRTB 1I8KA 2AJSL 1QFHA 4UT7H 4XNUL 5B4MC 2BCKA 3SE9L 3T0AA 1JHLL 2EO1A 1WSST 1TNNA 1FL6B 3PV7A 2YUZA 2DICA 5I9QB 4OF7A 1IM9A 1DE4B 4TVSa 5GXBB 3BO8A 5DHYB 1CLZH 4P57B 3QO0A 4KVCL 2J8HA 1T66D 3DVGB 4KKLD 3B3IB 1M7DA 3AXLA 1DQDL 2O5XL 4TSAL 4RDQG 5D1XB 1Y18B 4OFKA 4AM0A 5KVFL 4YBLC 4V2CB 1L6ZA 4MJ2A 4PBXA 1YNKH 3DSFL 3HHRB 1DUYB 2AABL 5D7JB 2QR0B 5J11B 3PJSB 2QADB 1JPST 5C3TA 5JZ7C 3C5SB 2GJ6E 1JYWA 2JIXA 3P4OA 1JGLH 1PQZA 1MCCA 5KTEL 4QCIB 4MX7B 1HCFX 4NNYB 1JHTB 3BP6A 1UM4H 4FXGB 4NN7C 5D5ME 2ORBL 3VE0B 5CJXA 4K3HA 2F54A 5AUMA 3VFWB 2LV4A 5ADOH 3TWCL 2IAMA 25C8L 1YEJH 1KJ3H 4MA1B 5E6IA 4BFGA 4W81A 4L5FH 5IBLD 1J12A 1J0JA 3NCCB 1P9MA 2BVQA 2FYYA 1P1ZA 2JB6B 1S7UA 2VH5L 5ETUA 2IFFL 5HHME 2VAAB 1F3JA 5ID0A 1FIGH 4NQCD 2PO6A 4NBZB 3SOBH 4YDVB 3N0PB 3CFBB 4PRPD 1JNLL 1A6TA 4L8SB 1JIBA 1A1NB 1IZKA 4FQXA 4PJHA 3QZWB 4L4TA 4LLMB 1AE6H 4AMKH 1XR8B 4AZ8A 2JIXD 2UYLB 3KG5A 2V9TA 1KENL 2NW2B 3QDGA 4R2GB 2R23A 2YUWA 3G6AA 3UTPD 4OIIH 4NUJB 4L3ED 4JHWH 4UINL 4S11A 1ZGLB 3NZ8A 4HGWB 4D2NA 5EBMB 4HHAA 2YMXH 5D7SL 5F8RC 1PVHA 4OB5H 1JE6A 5HYSG 4WIQA 4RMTA 1TJGL 4X80L 3HNVH 5EO0A 2P48B 5DMKA 4XVTH 4P4RB 4C59B 5EU3A 2PO6D 4KKAD 4OLXL 2R56L 4NBXB 5DDHA 4CMHB 4WFGE 4G6AD 1EH9A 2RFXB 3QDGD 4F33A 1U36A 4HK0B 4JO3L 4OZHB 1FZJB 5CBEB 4YGVA 3MJ6A 4XCEB 1IGYA 3P77A 2BSSA 1SVZA 4XCYA 5I19H 4W6YB 5FV1L 4AK1A 5DD6A 5B4MD 3JSSA 4HKJB 5ALBH 5CD5C 2LABA 4OD2A 2CDFB 3G6JE 2D7NA 3U46B 5F9OL 1BQLH 1QD0A 2JJUA 2L7UA 1IGJB 4YLQT 1FSKB 1NEZA 3EYFB 3MRIA 2J12B 2ARJB 3QJFA 5FUOL 5HVHB 4P46C 1KIPA 2FB4H 5E5UB 4FFVC 3AMLA 3LB6C 1U42A 2IPKB 4PG2C 2NXYB 1YJDC 5HHOE 2AEQL 4E5XA 7FABL 2ADGB 3BSZL 4IIQB 5JZ7D 4QXWA 2FO4B 3MJ9L 3KGRA 4C58B 2NXZD 4NQDD 4UU9B 4XMKH 2ICES 3PWUB 4PY7B 4CBPA 2XA8H 3QA3B 1MCBA 2WBKA 1WV7T 4XPAL 1DLHA 4FZ8H 3X11A 1NCDH 5FCUH 4YXKL 3HE7B 4PJ7F 1T21B 5BZWA 4YBHA 1OCWH 1CD1A 4HXBL 3KPSA 2VLMD 1Z0MA 4FQHB 3MRCB 1FFNA 1A0QH 4IRJD 3OWEA 3NACH 5DI8B 4HIJB 1N5AA 1T1XB 3S5LG 5ITBH 4QRSA 4YR6A 5F9JB 1U8IA 5B3JE 2MQCA 5JHLL 3FT2A 1J05A 4P0DA 3C60C 4LGPB 4NSKA 5DF0A 4KK5C 1OGTB 4ONGL 5FKAA 2C4FT 5KSBE 1S7TB 1OGAB 3VRLF 5JPNA 1N8ZB 3MLVL 2DM2A 5HI5D 3R06B 2OL3L 5I8OH 2MWCA 1T0NB 4WEMB 3KJ4B 1KF9B 5BZDA 4KI1A 3VFMB 2VLJE 1AFVL 1UKQA 3KPSD 4UNVA 4XP5H 3SKMA 3BH9A 1Y0LA 1AC6A 2H26B 1KIRA 5IKCB 3D3VD 4GRWH 4MQXD 4I3RL 4U1LB 1NUGA 3ULVD 2AJZA 3FFCB 3HMXA 5C0CE 4LVHB 3V4VL 4KQ4H 5HYJB 5E2JA 4YWGH 5FYJE 1BZ7B 2R2BB 4ZFGL 4CVUA 5DMGC 4P46A 5EORL 3GBMH 5D93C 3WFCH 5LCVH 3CX5K 2NY1C 4XHQA 4PG2A 3O6FD 2JK5B 3GJFH 3OGOE 5I74C 2XY2A 2VDQL 2NY2B 2AEIT 5C0AE 3DUSB 3VD9A 2P5ED 4ZUVB 4EDWH 1H3GA 1INDL 3HKFA 2HG5A 3K4ZA 1JVKA 3MXWH 3UO1H 2L0DA 5CD5D 1QQDA 5EC2A 3X3GL 1LP9F 5IB4B 3HPLA 2OI9C 1WISA 5TE6H 1WZLA 1JGUH 1S78C 1T1WB 3QJHB 4C56B 1ZVSA 4P2QA 4U1NA 1OF2B 4P46D 3SGDI 3CSBA 1P7KA 2YD8A 1BWMA 1YY8B 3RVVC 1I9JL 3LB6D 4XH2A 5DZLA 4ZPVA 1IKFL 5SX5K 2X10A 3HRZB 4JRXB 2UVEA 5HYIA 4JG1H 2N1KA 5LG1A 4Y19D 3C60A 3OAZK 5IQ7H 3P2TA 3ULUL 3CFDA 4PJEE 4U49A 2DWDA 5FCSH 5TPWL 3RRQA 2JB5L 5DJ0A 2PW1A 3ME0A 1DVFD 2DJ4A 2Z35A 3QHFH 5JPMA 3HMWH 4JKLA 3V8OA 4FFYH 4DOHE 3F7YB 2DQHL 5D7JC 3EOAB 1XF5B 4PRAB 2QADC 1GGTA 2CO6B 3L9RB 4JFQA 1YEHL 3GKWH 4F9PC 4XMLL 2AV7A 2GAZB 5EOTB 1BD2A 1W0YT 4U0RC 3TNMA 4NKMA 1TTFA 4GMTL 3ZL4H 1OW0C 4WI8A 1XCQA 1MJ8L 2IF7A 2E9IA 3V0WL 4PRHD 3VGBA 1H3XA 1ZHBB 3U0WL 4E42B 2A9NH 1CE6A 4WTXA 1JNJA 2W0LA 1VGEH 2GJZB 4D8PB 1H5BC 2R69L 1EJ6A 1MCLA 1P84K 4HF5H 4XCCL 4WV1B 3EJJX 5ACLA 1AXSA 4ZO6A 4OZHF 1FZMA 5FYLH 5I1IH 5KSAB 1SY6L 2ZCLL 3JWDC 3JTTB 4S1QL 1LMKA 4FMFA 3VG9C 1YEIH 1G7PB 1KELH 3CFEA 1Q9KB 3MLXH 1QSEA 2ED7A 3MFFA 5IIEA 4YXHH 1Z0NA 2L4OA 4QTIL 5DMGD 4O2FB 3OKLB 4HBCH 2ATKB 4LNVA 2MOVA 2NY1D 4WY7H 3IFOB 5IF0A 2GJ6B 1M05B 4XC3H 2YS4A 3SE3C 3WN5C 3QUZD 5D5MB 4LARL 5T33L 1HINL 4RMSA 3DBXB 3O81A 5GJTH 3S36L 1J0YA 3AVEA 4D3CH 4G8FB 4HKXB 2MNUA 5DVNA 5FAAA 1KCRH 2XQYK 3CXDL 1Y18A 4JFFE 1FDLH 2I26N 5I75C 2VJXA 5J13C 3B5TA 5ELIA 2I60L 5D7JA 2ZCHH 5HHMB 1Y6KR 5TQ2L 4XXDB 4AEEA 5E2WH 3V7MA 2X1WL 4F9PA 1W72B 4U1KA 4X7CC 1I1YB 4LLUB 2LE9A 3EO9L 3NIDE 2WNGA 1XIWB 4AL8H 1T7YA 4OT1H 2QSTA 3NPZB 5DVLA 2W9DL 1OW0A 3BPCA 4G8EB 1FSKC 2VQ1A 3K2UH 3IFNH 1MFAL 2BVEA 5C0BE 3JV6B 5D71L 5IMOA 3WFBH 4GAJH 5TFSL 5FYJU 4GAGL 3IDJA 5BOPA 2K7PA 1U8JB 3L3KB 4X8JA 4DTGL 4HWEH 1H5BA 3CZFA 1RZJC 2JB6A 4NZRL 5D1XD 4BKLA 1EHLH 4P99A 3OG4B 2VAAA 5MERA 1EEYA 1VFUA 4YK4B 4YAQA 5A40E 3I6LD 1IEAA 5D7JD 1YEFH 1BZQK 2QADD 5I66A 3QZWA 1WZ1H 1RJCA 2K9UA 3BGMB 5CSZA 2VZOA 2B0SL 3VXQB 1MAMH 2DKSA 2N7BA 1KLFA 2OR9L 4EXPX 1WWWX 1OAQL 4OQTA 3H0TA 3EYOA 4XXCC 4OZIF 1ZGLA 3VD3A 3CC5A 4Y5VC 1YNTA 4ZPTA 2OJEB 4LU5H 1YYLH 1WC7A 1XZ0B 1UZ6F 4A6YL 5SV3A 4LIQE 1F4WL 4DKFH 5EOCH 3RY6C 4HFUL 2DIAA 4IMKA 3A6BH 1OARH 4XP1H 3SE3A 2ZG3A 1YUHB 3WN5A 3LEXA 3G6JB 2ITDA 3G5XB 4DZBB 4MAUL 1U95A 4B7LA 2C3VA 3MLZH 5HPMB 3UTSE 2DQDH 2J7LA 1A4KA 1RZKL 5B38A 1KEGL 4G6FD 1NCCH 4RFEA 3QXAA 5CBEA 3UPRB 4HCRA 1JN6B 2BVYA 3MRJB 1R3KA 3GMQA 4LCIH 1S9YB 2VSDA 5HHOB 1RPQA 2AV1A 1BM3H 2ZPKH 4YC2C 3JV4B 1EJOH 1UH3A 4HWBL 4XHJC 3U46A 1ND0A 5JDSB 2DI7A 1N26A 2J6EH 5CINH 4PJBA 4PJ5E 4CGTA 4ODBD 1X5ZA 5F70A 3PWPA 4ZO9A 1X4YA 1UENA 1ZHNA 4KZDH 4Q2ZA 1K8IA 4CJ0A 4HJ0D 4YDKL 1T5WB 2YD2A 3FN0L 3RY4A 2P8PB 3MXVH 2XI9A 2OMNA 3S35X 4OM1L 4PV8B 2NY2C 4WHCA 1CN4A 4X5WB 5FA3A 3K80A 2BSTA 2IQ9L 1QFWI 1AY1L 4HIEB 5IB3B 2DQUH 5ITFB 3SQOH 1UCBH 2FO4A 4LF3A 4M6MH 3V9FA 5CCKL 5LVEA 3P30H 4QGYA 4R0LC 3WKML 4R7NA 3HZKA 2YR3A 1A7RH 1QNZH 3MCG1 3RX5A 4XXCA 3L95A 2K1MA 5KSBB 1NCWL 1EEZA 4Y5VA 3MZTA 3IFPA 3OJMB 2E8ZA 4LMQI 3MCLL 5HYSB 1LO4H 2FJGB 1XT5A 2PTVA 2X4PB 2EIDA 3ELAT 3CSYA 4HIJA 4UILL 3KPOB 3OX8A 1ZA3B 2VLJB 4U1MA 3MNVA 3RY6A 2NXYD 3KYKH 2YD1A 4QRRE 4IRZH 3MLUL 1HSAB 3DX8B 4FQJH 3BKJH 4K9EL 4UIKH 2R1XA 3FB8B 4M7JL 3BP5A 2LVCA 5C0CB 1YC7A 3D69B 3VFOA 5CLTA 2IADA 1DN2A 4HDIA 3TH2T 3T0VA 1OSZB 2XZCL 2GFBB 2YA0A 4ORGA 3WFEH 4QLRA 4M9OA 4XCFL 4XTRC 3HE7D 3B9DA 3BKMH 4HZLA 4LQFH 1R5WA 3WD5L 2CLVA 4I48B 1RJZB 5C0AB 1J8KA 5CEXA 5FB8B 4XNZB 4LAQL 1G0YR 5FA4B 5D96C 3SDYL 3OKOB 4F80A 5IESL 4U1LA 5K9QI 3HC4L 2JJTC 4PGCB 5I1AA 1AJ7H 2IBZY 4ORZC 3MUJA 3RAJH 2IMMA 3DETC 4Q9RL 3CU7A 4GRLB 5AZEH 4P4KB 4EEEA 2CKNA 5FO7A 1G7QA 3IS1X 1BQUA 3LRSB 4HJJL 1NJ9A 3QQ9C 1UKSA 3RP1A 1A7OH 4IS6A 3IFLL 5ANMA 5F7EH 3ES6A 1MNUH 5FO9A 4UT7L 1JK8A 1KPRB 1Q0YH 3ARYA 3E6FB 3FCTB 4HIHA 5D5MF 2ADIB 3F7QA 1FBIH 4KZEH 2ICWA 4Y16C 5JW4R 4I3SH 2FZ3B 3U82B 4R4BB 1AHWB 4O2CB 2PR4H 2WINA 3R8QA 4R0LA 1GXEA 1CLZL 1FVCB 4XHJD 1I7RA 1FQ9C 4NRXB 3FFCD 4PJEB 2ERJC 5HYJD 2Q87A 3W0WA 4FA8A 2NY5C 1F4HA 1XFPA 5KAQF 5ALCH 4DZ8B 3EIFA 1JTTA 4DOHB 3S6CA 4MXVE 4EUPG 5A2LH 1NGZB 3LRHA 4L8DA 4ZS6C 2AI0L 1JGLL 1UM5H 3BUYA 2NY2D 1MCJA 4JGMA 3S4SG 1UM4L 5FECA 2V2TB 4NJ9H 1FE8H 2Y72A 4PR5B 1U58A 2YOCA 5ADOL 3MLTA 3CDFA 5I71C 1YEJL 1MLBA 1OB1A 3MACH 5HY9B 3N1MC 4L5FL 1W2KT 3OGCB 1PBYA 5LAXA 1S9XB 4N5EC 2VRAA 3H9HB 4PJGA 2AKRB 3O0RH 1OTUC 4LFHG 1A22B 1CFSB 4WUKL 4C56D 1Q1JH 1EBAA 4GMSH 3GSVA 3SDXE 1L4IA 5DT1L 3EHBC 3QAZC 1AE6L 2JJTA 4AMKL 2AXFB 3DX6B 4GKNB 1RK0A 4J4PC 1G6RH 4YBQC 4JRXD 2OTWB 4UDTA 1FFQA 3B9VA 1NBYB 4OIIL 3OXRA 3ULSB 3A67H 3BKCH 4M62H 5FV2A 1GZQB 3BIKB 3REWA 4JHWL 1HKFA 3RJDA 2NYYD 1KN2H 2VZUA 4XVSH 4DGIH 2YMXL 4ZTOH 2GJZA 2E3VA 3G6JF 5D4QA 2K7QA 4LEXH 4OB5L 2Y36H 4U1HA 3O3BA 1C12A 2VMFA 4Y16A 4X4XB 4RDQF 1MCKA 2IQAB 3HB3D 1ITBB 1N3NA 2WMPA 4XVTL 3ARQA 2EXYD 1OAXH 1KB9K 4JN2B 2X70B 5CGYC 2FBOJ 4JFEE 4LNRB 4G9DB 2CRZA 2ADJB 3DETD 3BQUB 4JFFB 7CGTA 3ZKMD 4YHYC 3KYMA 2NCMA 3QQ9D 3MLPA 5EB9A 3GMMA 2ATKA 3MRQA 5I19L 1NGYB 3T1WA 4X0KA 2CLRA 2X89D 5C2BH 3V5HB 3VFRA 1IAMA 5ALBL 1TZHB 1WK0A 1FYTA 2DQEL 3FOMA 3PIQA 3WCYA 1SBBA 2B4CH 1BQLL 1H3WM 2ZOKA 5HGDB 5IW6A 2VUYA 5LGJA 4HKXA 5KSAD 4FXKA 5E94B 5C0BB 2FB4L 3ZE0E 5B3JF 3P11H 4HIIA 1MRCL 3WLBB 3OJ2C 5C08E 2V6HA 3L3DB 5JMOC 2EDJA 4KFZC 5HHVL 2OM5A 1VHPA 5ACMA 3GSQB 1JPGA 3BZ4B 12E8H 3H9SA 3AB0B 2GJ6D 4UUJA 4FQIH 4J4PA 2CGRH 4NCDA 4L29A 2XA8L 1NDMB 3FRUB 2DWEA 5EZOH 2ITCA 1I7ZA 4FZ8L 1BFOA 1NCDL 4EN3C 4M6AA 1KYOJ 2O5ZH 2JJVA 8CGTA 1OP3K 2A9MH 3FONB 1OCWL 2ICEB 1NFKA 3K8LA 3V2AR 1KJ2A 1MFCH 5IG7B 3NACL 1ZLUH 3T2PA 1NQBA 2H3NA 2VR4A 2VE6B 1OTUD 5CHNB 3CCHB 4Y4KB 5HHMD 3R8BB 2KBGA 4NZTH 4P59H 5K9KA 4HUVA 4YHKH 3EHBD 3DV4B 1XIWD 3D18B 2KH2B 1DQJB 3UTSB 4YBQD 5HI3C 5GGSB 1ZT7A 1C5DB 2G60H 5MENA 1ZS8A 4FQ2H 2R0WH 1UEYA 5BRZA 1ZLSH 1LDPH 4PD4K 2EKSB 5CEZH 4XP5L 4Q9QH 2B39A 3ARBB 3WFZA 2RJMA 2H32A 4PP2B 2PKDA 5T3ZE 3NCJH 1KPVA 4U6YA 2MHAA 2WUBH 3G5XA 3DXAA 3WNOA 3S37X 4KQ4L 2EDEA 4PJ5B 3VXTA 3NABL 3FQXB 5TE4H 4D0DA 3L7EB 5CGYD 3M1BB 1WWAX 3HNTH 2EEDA 4KC3B 3GBML 3WFCL 5EDXA 3QNZA 5LCVL 5KSVB 2Q8AH 1DEEB 3MRKB 5DUML 3TIEB 1MVUB 4WFGD 3MRJA 2VDOH 1QBMH 2IBBA 2YPLA 3C5ZC 2V2XB 2IANE 3DO3A 3ROLB 2BVOB 4EDWL 4PJEF 1CICA 3QCTH 3E8UH 5CGTA 3QXDA 3HZYA 3CLFH 1BQHB 3MXWL 1O7VA 2DKMA 2YD6A 5CILH 3CDCA 1E4WH 4EN3A 4WRLA 5J1SC 1JWSB 3GKZA 3AU1B 2Y1VA 1BF8A 4KHXL 2DJSA 1IMHC 3ILQC 3KPNB 1W8OA 5ERWA 2M1KA 1G7HA 1FGNH 2F74A 4LLVB 4XBPA 4X9GA 4Y89A 3JXAA 2DM7A 1KJMB 4YZFE 2YPLD 1X4ZA 1OLZA 4JDZA 5HHOD 2UWEA 4QRRB 5ITFA 4JG1L 4WI3A 1NANH 4DGVH 5IQ7L 5DRZA 4ZFOL 1MCDA 5D7IE 1CFNB 5BXFB 1T5XA 5F6HI 1MF2H 2P45B 3P4MA 4JN1H 3QHFL 3MCKA 2H8PB 1FGVH 1PY4A 3OF6D 1MH5B 5DC4B 2CDGB 5A3IC 4FFYL 2X4PA 3IDGA 4M8QA 4WI2A 3ZZ1A 4EIGB 4MJ6B 5SX4I 4HEPG 5K9QG 3GKWL 1LK2B 5F72S 3DX8A 1I1CA 3F7PC 2OX5A 3ZTJG 3NCEB 4PLJC 1D3CA 3BRDA 1EVUA 3TF7C 3ZYJA 2HA1A 4HH9A 3H8NA 2CO7B 1Q38A 4FABL 3SBWC 4PJXA 5HI3D 2E6PA 2WWMD 3WUWG 4GKOA 4KK6C 2ATPB 2OLDA 3C5ZA 4YE4H 4M93C 1LWRA 3UYPA 1A7NL 4N1HB 5EG6C 3Q5TA 3VWJB 3O3DB 4G8GA 1UCTA 4QHNA 1WBYA 5I1IL 4N0RA 3HMXH 1FORL 4X6DF 1QO3B 4TOYH 2XN9E 2ED9A 3NCBB 3DUHA 3MLXL 3ZDZE 4PJDA 5C0CD 3GSXA 2VISA 3HR5A 4YXHL 3GZKA 4QWWC 5EZJB 3O6KH 1JWUA 4MJ5B 1GC1C 1T1ZB 4WCYL 4WY7L 1I9EA 3GM0A 3ZT7A 1NFDA 5GRVL 3C5ZD 3GMLB 4MNQE 1DJSA 2XKNB 4XC3L 5IBUG 1UG9A 3C6SA 5C0AD 3QQ4B 3ARZA 4G8GD 1PX4A 4Z0BL 2UUDK 1JGVH 5GJTL 1JGDA 2P8MA 3WFHB 4HS8H 1AXIB 4LMQE 2FSEA 1I75A 4P23B 2Q6WB 1KCRL 2NY6B 5I1KH 5EU5A 2G2RB 4MD4B 4NFCA 1HH9B 4GRLD 4YHOH 3WXVH 4P4KD 1RHHB 3EDKA 2ZOLA 5ENWB 3BE1H 3ILQD 3K1DA 5HBBA 3S5LA 3BX7C 4P9HH 4M4PA 4KKCC 5L2JB 4J3OC 5GRZA 1G84A 5B39G 2CLZB 3SDXB 4OT1L 4YFDB 4MXWH 2NTFB 1D6VH 2X4TA 5ESAA 3I02B 3K2UL 3IFNL 3VD7A 3UJIH 2PYFB 3GMNA 5HY9A 3SBWA 3WL9B 5FHBH 4QXTA 3WFBL 2P24B 3VWKB 4KHTH 3FTGB 3QT2A 4CMMA 4HWEL 4KJYB 5FDYA 1U6AL 5DSCA 1HQRB 4Z18A 4KXZH 5DD1L 1J11A 5EA0H 4P5MB 1EAJA 1YEFL 1UZ8B 5GSRB 2EC8A 2CKBA 3CU1A 4JFZH 4OTXL 1WZ1L 4NKDB 1EXUB 3O11A 4BFEA 4EVNA 2D0FA 1MAML 3PGDB 4U1JB 1D5XA 1CFTA 2OTWA 4RZCB 2MCG1 4JFEB 3ULSA 4PLJD 4Z76A 2Z8VC 3F5WB 1P2CB 2P5WE 1HKLH 4X9FA 4Z7UA 2FWOB 1BJ1J 4XAKD 4LU5L 1YYLL 1U8NA 1Z6JT 3NFSH 4B7IA 1M6OB 4J12A 1JRHH 3HC3L 3G6DH 1IL1B 3MRPB 3BZEA 5EOCL 1G9MH 4HJGA 4X98A 5CIPB 1OARL 2OL3B 3TBSB 4XP1L 4Z0XA 3W9EA 4JVUA 5IK3A 3NCYP 1UYWH 1R0AH 2D3VA 3MLZL 1RIVH 1U8MB 2DQDL 1Q9LB 3VXPB 1U3JA 3W5MA 2BNUA 1NCCL 3U30B 3O2DA 5SV4A 5IFJB 1UWXH 1TMCB 3B9EA 1MHPH 5D2LA 3RIFF 4GRMA 4EUPB 4LCIL 2YPKA 3MLYH 1FNFA 3C8DA 4AENA 1G0DA 4JZJC 3S4SB 5C08B 1BM3L 3ARBC 4ZUUB 1J18A 2WIIB 2ZPKL 5C07A 2YPVH 1EJOL 5L7XH 4QHMA 5JIKA 4G6JH 3WIHH 5FOBB 2WBJC 2AK1L 1H15B 2J6EL 5CINL 4HULB 4K94C 1NMBH 4J23A 3C6LB 5GS1B 2CK0H 4NYLA 1HHHB 2OTUA 3MMEA 3OPZH 4KZDL 1N4XH 5E94A 4PJFE 1ZHLB 1F02I 4FQQB 4H26A 5JLZA 1KV3A 4QY8A 4HLZH 1R3JB 1F58H 3BQUD 3LH2L 2HJKA 3LCYA 1A64A 3UMTA 3LN4A 2DQUL 4DVBB 3SQOL 1ZK9A 4M6ML 4KKCD 5FYKU 3NGBC 1KB5A 3DROA 1OOAA 1CI5A 3S8WA 5A2JH 5DJ8B 1OAKH 1A7RL 3BXNB 4E0RA 1QNZL 2JELH 3JWOH 5HHNB 5DHVA 1AD9A 3D2UB 1IEHA 3MZGB 5TF0A 4LLAA 2V7HB 3UZEA 1MREH 4OLYH 1LO4L 5C0BD 1CXFA 3SCMB 3LKSA 1DBKH 1LE5B 4O4YL 2VE6A 1T0MB 5KVDH 3KYKL 3VRIB 4IRZL 2Z91B 1FV1B 3CCHA 4FQJL 4UIKL 4X6CE 5H35A 1U8OB 1A1OA 3MUY1 5EU6E 1H3PH 5KS9E 4WEUD 4XWGH 2EH7L 4OQTH 2YBRB 2EE9A 4ZS7L 1NBZB 2HT3D 5T5NG 1JP5A 1IBGH 1D9KB 4WU5B 2DJUA 3ARDC 3WFEL 4QRUB 1MQ8A 1U8PB 2X4NB 1FZKA 1E4JA 2MQ0A 5J1TC 4R97C 4LQFL 1T6WA 2OR8A 2ZZUT 3TNNB 2Q76A 3A6CH 2IANB 4JZJA 3CAFA 1N2RA 5I1DA 5TGBB 1A2YB 1CZ8H 2DTMH 3VGEA 3T4AA 2BOBB 2CPCA 4U05A 2WBJA 1FO0B 3QIBC 5BJTA 3RAJL 3IT8D 3WNKA 3P3YA 4Y4KD 4JY6B 1AXTH 5C0FA 1WLHA 4MXVF 1A6ZA 4M61B 1XGYH 4JAMA 4DKEH 1A7OL 2Z92B 2NX5E 3IETA 3T77A 1Q0YL 3RNQA 3VH8G 1FBIL 4KZEL 2I9TB 4WW1B 1NCNA 4APQC 3BMVA 3CPLA 1AP2B 4I3SL 4P48A 4UQ3B 3E6HA 2W0FA 2PR4L 3ARBD 2YA1A 1L0QA 3UBXI 2VXVL 4CDGC 4L3CA 1U3HB 1KCLA 4LSQH 3QIUC 2CUMA 1ERNA 1S7XA 5A2FA 1VKXA 2WBJD 5D7IB 4YHNB 3TBTA 4Y4HB 3W39B 2W9EH 5ICXA 4JJHA 4ODXB 4PJ5D 4YFLI 3CH8A 4WI4A 1QHPA 4JHAH 3SDXF 5DFWH 5ALCL 3KPNA 1T3FB 1CXLA 5IHBA 3E0GA 2DLGA 3BPNC 3LKOA 1VFOA 1GVIA 3MV8E 3NAAL 5FM4A 1UM5L 5GGVL 5EZIH 2GT9A 4PGBA 1IT9H 4QXGL 1KCKA 1YEKH 2DYPA 1JMXA 1NL0H 3M17A 1DCLA 3WLWC 3GSOB 3MACL 1GGIL 4P23C 3LPWA 3ARDA 2VLRA 2ESVE 4EI6B 5IGXL 5I8EA 1INEH 1RZ7H 5CWSB 3PL6B 1T2JA 2XNAB 3IDXH 1KCUH 4Y7MA 4X83A 4U3CA 3ARGB 2DI8A 3QPXH 1WITA 2R1WA 4GMSL 3GMRA 2APWA 3DHMA 3QIBA 5EU7C 1VADA 4QTHB 1HHKB 4WUUE 1G6RL 1T2XA 1EO8L 5ICZA 4QRRD 2W60B 2XN9B 2UZIH 3A67L 1S5HA 5CBAA 2BZDA 3BKCL 4M62L 2DYPD 2GITA 5IV2A 4OLZL 4LLWB 1XCTB 1KN2L 5DYOA 5JOPE 4OUUA 2IH3B 4RX4A 1BIHA 4XVSL 4AY0A 4DGIL 3I50L 4ZTOL 3QEGH 1A1MB 2WANA 2G9HA 5T1LA 3SGJC 4LEXL 2Y36L 3G5ZA 4LKCB 1SJHB 4APQA 3RL1A 4EBQH 2A73B 4MAYB 3GJEB 5JNYA 3X13B 4MNQB 1HEZA 1UC6A 3SKNA 5ID1A 1AO7E 3IU4H 5IWLC 4AEHH 3ZE0F 4X4YA 3QIUA 1P4IH 5GGSY 2X9WA 5GS2H 5T1DH 2YXMA 4JFDA 3HUJE 1T7ZA 2HVKB 3EGSA 3QIBD 4OZFA 5TJWK 5BV7B 5C0EA 3GHEH 5HYQB 2PXYB 1UACH 5JIPA 3FQWB 3QUYB 1OL0A 2X4RA 2VERN 4MJ5A 1T04A 1T1ZA 1T20B 1Z9SA 1IEBB 3T2NH 2B2XH 2XFXA 4JQIL 3VRJA 4M3JA 3L5XH 5IFAH 5E1AA 3QUXC 1CG9B 1AKJA 5TQ0H 2J1KA 4QXUH 4S0TD 4PTUA 1NLDH 4NP4L 4ONHB 2OBGA 3UTQA 3O2WH 3ARUA 2NW3A 4L9LB 2IBGA 1SJVA 4HWUA 2DS4A 1K5NA 1PLGH 4GRWE 3LPGA 3MR9B 4OAWA 3SJVA 3BT2H 1VEPA 4P5TC 4WDIA 1P7QA 3BVNA 3U30C 3GB7B 3P11L 4M6NH 5JIIA 2AQ3A 4I4WA 1I3VA 3AREB 5DR5H 1IC7H 1QR1A 3HI1A 5DD3H 4LDOB 1WTLA 3FO1B 2A6KB 5GRYA 1GL4B 4PRBA 1HI6A 4UT6H 2CGRL 1ZAGA 3MA9H 5EZOL 1QKZH 1P84J 4EI5C 3QEQE 5DUBA 2O5ZL 3MJ9A 3KPQA 3WUWB 3WLWD 2P5WB 2A9ML 4WTZA 4FN0A 8FABA 4P23D 1IC1A 2NY6D 4KJYA 4M5ZL 3SGJA 1MFCL 5HPOA 3P9MB 5CMAB 3QH3A 4LCYA 1P7QD 3V5KB 1PZ5A 4M1DH 4LP5A 3VMNA 3WBDA 2E6QA 4P5MA 4KJQD 1LP9A 1I8MB 4N9OB 4NZTL 1HOCB 3C87A 2XWJA 2KZ1B 4P59L 5IWLA 3FL7A 3LDBC 3HAEA 5DJXA 3L5JA 1E4XL 1NC4B 3NBNA 2H9GB 3BZDA 4UIMA 5IVZB 5GRJH 4DWHA 1X5KA 3S88L 4HGMA 5F6IC 1AC0A 1K8DA 2G60L 3MRGB 1M7IA 2R0LH 1SEBA 3PDOB 4K7PL 4BFBD 2IC2A 5JOFA 3Q1SH 2R0WL 4PJIE 3X3FL 1D5BB 1ZLSL 3ULUC 1LDPL 5FYKL 4ZD3H 3VWKD 1R3HB 4RMRA 2D9CA 4WHTA 4NO3A 1SYSB 3IAPA 3QUXA 3NA4A 4HFWB 5IBUB 5MHSE 3VI3F 4Q58C 1T83A 4WU7A 2GCYA 4K8RH 4O51B 4DEPC 1XGTA 3FN9A 3GUTA 5HDQH 2ZUSA 3QULA 2WUBL 3HG1E 1MEXH 3BZFB 1NC2A 1CFBA 2IALB 5TE4L 1E6OH 5K33A 3VXPA 1BIIB 4HKBB 3T04D 4R90H 3HNTL 4P5TA 5E2UH 2NLJA 2OQJB 2IBZX 4YZFF 4PJFB 2Q8AL 3V6ZB 1EPFA 1JUFB 2VDOL 1QBLL 1QBML 2CMRL 3GSUA 3LS4H 5L88L 1RI8A 4X8XA 3MA7B 1MLCA 5B39B 1CD0A 3QCTL 3IJYB 3E8UL 4HMDA 3CLFL 3QUXD 5DQJA 3OXSB 4RFNB 1EA9C 1Q94B 4U3XA 3P0VH 4XC1H 5CILL 5F1IA 5CAYB 1XGRA 1E4WL 2PTTA 4EI5A 1BQSA 1G7LB 2G5RA 4QNPE 5FYLE 5GSVB 1UXSB 4GUPB 3UX9B 1NC2D 4KGJA 5IVOA 2VLLB 2O61B 4L8BB 1QFOA 3CIQA 4XP4H 1FGNL 4HKZA 4NO5B 1Q72H 1SMOA 4O02H 3EKCA 1QBBA 3MV01 3GO1H 1T4KA 4HWZB 4PB9H 4D9QE 3NIGE 1ONQB 4OV5A 1FC1A 5C08D 3K8MA 3MROA 4X9BA 5EU6B 3WIIH 1EFXB 3FMGH 2VDMH 3OJVC 4UTAH 4DGVL 5KS9B 1FVDB 5FGBC 4N8CH 1XEDA 1F8TL 4D9LL 3T2QA 4XPFH 5HHNA 1WFNA 4Y4HC 3D39A 1MWAB 3I6KA 4JN1L 1L0YA 4EI5D 3U4AA 1JWMB 1FGVL 4CVXA 5IVXE 1YDPB 1KJ2H 4LVNC 4BH7A 3EJYC 4LFHD 4MD5A 3V5DB 1LE5A 3L3OA 3ZDZF 3N1FC 4J3TA 1X5IA 1U8LA 4QEGA 2E6JA 1QEWA 3AC0A 1OWRM 4BYHA 3KPPA 1QLEL 4BZ1H 4NC1C 1YPZE 2ZG1A 2B1HH 4UBDC 1NDGB 4ZOEA 1U8PA 2Z93A 2CRMA 4AQ1B 2NX5B 5DA0B 1YMME 3BISA 3X12A 3ZYZA 3D2UD 5CJQH 1BOGB 1T03L 1NCUA 3AS1A 1BOYA 5DJ6B 2E9WA 4G6KH 3D9AH 3H7BA 2H32H 1KEML 3SQBA 3UBXG 5C70A 1KXVC 1U92B 2QHLA 3FT4A 3ARFB 3TCXA 1Q8MA 1IFHH 3KS0J 1JF6A 3VFVB 4LSTH 2XXCB 4XNQB 4ENEC 5T3ZD 5A16A 4XPTH 4N8PA 3G5VB 3JV5A 4DKDC 4WWKA 2A74B 2PW2B 1SY6A 1HHGB 2FJHA 1FFPA 2EE6A 1EBPA 1D9KD 5LJYH 4U6VH 2I9TA 5A1AA 1F11A 3MV8B 1GH7A 2V7NB 4YUEL 2IAND 1CDGA 3IU3A 4F7MB 5JXED 4OZIA 4HUUB 4PLNC 1JGVL 1R24B 5FGBA 1KT2B 1B4JH 4F9LC 3I6GB 2APTA 2GK2A 4LL9A 1DN0A 1A8JH 2YC1B 3UJJH 43CAB 4XPGH 3RL2B 2NY3B 4JCMA 3U9UB 2W1NA 2YD9A 3MO1A 4YHOL 3IDMB 2ESVB 3WXVL 3D0LA 5TDPB 1T3FA 2EYSA 3GJFK 1RZKC 1N64H 4P9HL 1CDIA 3L3GA 2R8SH 4RAVA 3G08A 4NT6A 1BZ9B 2EEBA 2GTWB 1K3ZA 3DURA 1K4CB 3MJ8B 1KNOA 1RD6A 3NFPA 5DJCB 1OD9A 4WUUB 4RISH 2EZ0C 1D6VL 2HJLB 1IQDB 1VESA 2BVTA 4X6FB 3ZDYE 2BNQA 2MMXA 3GSOA 3EW3B 4NRZA 1ZEAH 4Z7NE 2NY0C 5AG8A 5JORA 1X5HA 1JPTH 3IDIA 4UV4L 5HGHA 4KHTL 3ZKXB 4GKSB 2IPTL 4MA8L 4Y4HD 1KTDB 2EE3A 4NO0A 1F6LL 3OKNB 2P42B 5EA0L 1DBBH 3FQNA 3EFFB 3MV9A 1B0GA 4F37K 4JFZL 3QQ3A 2FIKA 1JPSH 1AO7B 4GJTB 1L9MA 4GW5A 3GNMH 3Q6GH 2FJFB 3V6FA 3LSOA 4J8RA 3HUJB 2DMBA 4PRIE 5FF6B 4F7PB 4LLWA 1C5CH 1HKLL 2BNQD 4ZOCA 2KPNA 4I1NB 3GSWB 4XVUC 2C26A 5KN5B 4JZOA 3NFSL 5DRXB 4OIBA 5DWUH 1JRHL 2H6PB 1G9NL 4KH2A 4NN5C 1G9ML 3CNKA 3EJZD 1AR1D 2F5AH 3PL6D 3L3HA 3IDNA 3RWDA 1UYWL 1R0AL 3CMOH 4A6YA 4XP6H 4F9LA 1TZIA 1MY5A 1WFTA 1RIVL 2XWBA 5IT2H 4K3GA 4PP1C 3D5OF 4I5BB 3VXNB 4GRWB 3HC0B 5F1SA 4K9EC 3NH7H 3RKDC 4Y4FB 2XN9D 3C08H 3QUMB 3TPUA 2FCBA 1MHPL 2G5BA 1BVKA 4NO2A 3MLYL 4NM4H 4JY5L 3RZCC 4X6BB 2BC4B 4KK9C 2VQTA 4X5XB 4MA7H 4RBPH 3BIAX 3RDTC 3P4LA 5L7XL 2AJ3A 3WIHL 4Q6IB 5L0QC 2OSLA 1L7TH 1ED3B 1MCIA 4MAYD 4DQOH 4AH2A 4MNQD 3TA3C 4RQQA 3VCLA 5FHAL 4XPHL 2CK0L 3OJDB 1DBJH 1FNLA 4HWBA 1N4XL 2BSRB 3QEQB 4YHIB 3BUTA 5E8NB 5F1NA 3BH8A 5B3NA 1Z5LB 3OKYA 4G9FE 2PXYD 5CLWA 1Q9OB 3STBA 3STZA 4NQEA 2AQ2A 5KS9F 3ECBB 1G7JB 4LKXB 5GRVK 2EXWC 5EWIH 1VACA 2Q7YA 4ZUSB 5FK9A 1NAMH 5IFHH 4IDJH 1AGCA 4QOKE 1S7RA 4GT7A 1IGCL 2HRLA 5ESVA 5F9WB 5I0DA 1XR9B 1OAKL 3RA7H 3HTLX 1B0WA 3FT3B 3BDBA 2EZ0D 3JWOL 5DRNA 1IAIH 3QIWC 1WJ3A 4Z7OE 3QXTA 4PJIB 4JFHE 4OLYL 3P9MA 3ZT5A 2AVGA 4JHBA 5FDWA 4KMQA 1DBKL 3T08A 1E28A 5KVDL 4MB4A 4NDMA 5IJKC 2QHRH 3RIFK 2X9YA 4FS0A 3ARED 2CKBH 2VLKE 3PQYA 4FOMA 4GSDL 4NN6C 3HG1B 3O45B 1F90H 1IBGL 2HFEA 1QYGL 2FHBA 1I85C 3PWJB 5L9DL 4KK8C 5I2IB 2MKWA 3WEXA 3CXHK 2GSIA 4P3CH 2EDRA 3PWNA 4GAFB 2FH6A 3RZCA 4ISVB 3A6CL 1V7NH 3FOLB 4F58L 3BDYH 5F3HA 1GGUA 2NZ9C 5I0ZA 1E4KC 1ODAA 5DQ9B 3RDTA 2A6IB 2DTML 3OR6B 3D85B 2DB8A 2VAJA 3TA3A 1ORQA 5LXGH 1AXTL 1TVBB 2DQJH 4QGTA 5CFHA 1BIIA 1NC4D 1BBDH 5CUSH 1RUPL 3BGFC 4ETYA 1XGYL 2OQJA 4PJFA 4PP1D 1MRFL 3PE9A 4J7RA 3V6OE 5CEYA 2R29H 3U2SA 2DBLH 2O5YH 1AH1A 3EOBB 4WTWA 4X4ME 4J1UA 2BMKB 4FQCH 1NGWB 1WBXA 2XY1A 4MD0B 3PDDA 3VXSA 5F21B 5E4IA 4Y2DB 3HZMA 1MHEA 3ARFC 4JY4B 2R2EB 4LSQL 2D2OA 3MGOA 5EUOA 1WIUA 2BRQA 5CSGA 5KOMC 4YNYA 2W9EL 2VUOA 5I8CB 2DOCA 3EDJA 3WS3B 3QIWA 3BKYL 2VITB 4JHAL 4UQ2A 3TEUA 3UTTA 1O7SA 3D0VA 4RAUB 5IVXB 4GW1B 4JPWL 1P4BH 4HBQA 4MJ4A 1X5XA 4GW4B 5J9PB 3K0WA 5H37G 1PYWB 5SWQB 2HFGH 5EZIL 3G5YB 5J3HC 1WUNT 1ONQA 1IT9L 1I1AA 4X6CA 1YEKL 4KROC 4UOW0 1DQMH 1YQVL 3OAUH 3JTSB 1NL0L 2IEPA 3B8SA 3OAYK 1DP0A 1XF3B 1I85A 1YPZB 3IDUA 4ZQKB 1CWVA 4R96B 3P73A 2UV3A 1IAKA 5B8CB 2ZUQC 5FEBA 3PNWB 4DGYH 4TQEL 3T3ME 1INEL 3MREB 1RZ7L 5IBTH 3TIDA 1YMMB 3K7UA 3QIWD 4DN4L 3UP1A 3IDXL 1BECA 3IJHA 1KCUL 1NEZG 2NY4B 2H41A 5JQHC 1MHHA 1E4KA 3HUJF 2HLFC 4G7VH 2A6DA 2J5LC 4KJPC 5JDJA 2NNAA 3DHJA 3ZSTA 4XBEH 1SJEB 4OFYA 2N56A 1VGKA 3NFNB 1ZANH 5GZOD 5IB1B 2UZIL 3CH1B 1XF4B 4U6HA 5EU6D 2DF3A 4GG6A 3UTPE 2F54E 1RUAL 1JZ4A 3T4YA 1S7VA 1S8DA 4ONOA 2AAVA 1MVFA 3WDJA 4H20H 1I3GL 5DJDB 2R2HB 1A4JA 3HRPA 3IU4L 4AEHL 4MNHA 1K9TA 3M07A 2FATH 4K3EL 5T1DL 1SEQH 2G75A 2DMKA 4ETQA 1FNGA 2D7MA 2D4FA 4PJHE 4L4TE 3GHEL 2OJZH 4Z78A 1TJHL 3FQTB 2SEBB 1BHGA 4U6TA 2X1PA 3T2NL 4X7EC 2VZSA 3L5XL 2HFFB 3IXTB 1I3RA 3VXRE 1GIGH 2NX5D 3B6SB 3MLWL 5TQ0L 1MCWM 1TENA 3MQIA 1HXYA 4Y5XC 4U1IB 2VOTA 3LQZB 5CEZE 3OMZA 5F96H 1NLDL 5B22A 3O2WL 3O8XB 1FNHA 1W0WA 4GG8B 1K4DA 4MNGA 5GGUA 3ARFD 1CXKA 43CAA 3ZTNH 4CNIB 3BT2L 1JZ7A 3DMMB 3V0VA 4TPRH 4JFXA 4M6NL 4DCQA 2Z0BA 3VI4E 1KIUA 3T8XB 1JI1A 2O5XH 1OP3H 3U0TB 5EIIB 1I3UA 1LILA 3QDHA 3WDHA 4KWUA 2MPAH 4S1RH 1RULH 3DSFH 2XQBL 4JRYA 4G42A 2FECL 3MV8D 3MJ8A 4UT6L 4HS6A 3BEVA 1FFOB 2WLZA 2XWTB 3MA9L 1QKZL 3UPCA 4OZ4B 1F97A 3TC9A 1A14H 4PRIB 1YQ2A 2Q3ZA 1JGEB 2ZSWA 5MEOA 5E08L 1U2CA 2XXMB 5CD3A 5JR1H 1GZPA 2B20A 1C16B 4BSJA 25C8H 3GBLA 2ESVD 4GS7C 4JPIB 3F7VA 2WZPD 4M1DL 3UBXB 4I77L 1CGUA 1RZIA 3EFFA 4ZUWB 2AXGB 2WK2A 4XGZA 4EIZC 4YGAB 1JZ8A 2W65B 3IAQA 1EGJH 2HLFD 1JTOA 4KJPD 3WHE1 4HUKB 1FJ1A 1S7QA 3N1GC 4JRYD 1VSCA 5GRJL 4OGYL 3U0PB 3V4PL 4WUUD 1B88A 1QA9B 2R0LL 2ICWI 5I1LA 1TCRB 4RCAA 1AGFB 3Q1SL 5JA8B 3VH8A 2QV2A 3DO7B 4ZD3L 1CDJA 1AIFA 1C1EL 1FLTX 5JOPD 2BNRA 2H6PA 3FRPA 3BEWA 4YHZH 3KPSE 4K8RL 4Y5XA 4QNPF 4KDVA 4NRYB 1GOFA 4MSWA 3LEYH 5IJVB 4R3SB 5GIRB 4NQXA 3SY0A 1L7IL 1Z3GH 3AM8C 4XNYL 2RB8A 4OZFH 1AO7D 4M3KB 1MIEH 3VXNA 3UJTH 2VABB 5IEKA 3QI9C 5IMKB 5E2UL 4LAJH 3WV0A 4NNXA 3DRQA 3EO0B 4OLXH 2R56H 2WP3T 3NIGF 4OCLC 3BPLC 2ZG2A 2BSED 4G9FB 2HVJA 3R0MA 3LS4L 4OD3H 4ZXBB 4PJAE 1CDYA 4NHCH 1AGDA 4WFHE 4K07A 1PAMA 4G8IA 4YHPB 1A6AA 3GJFA 3JVGC 2VIRA 1IILE 3G9AB 5E8OB 1HH6A 2UZXB 1LO3H 1IZJA 4XC1L 3TYFA 5IVXF 3MRRA 3SDAB 4QOKB 4PBVC 3BN9C 3RWEB 4MJIA 4KRPB 5DEGA 4KKBD 1ES0B 5JO5B 5E8NA 2DQFA 2AK4A 4L8CB 3FQRA 4Y4FD 3MRBA 2BVPA 5FUOH 4XP4L 2VWEC 4X6DA 4OBSA 1Q72L 3O6LL 2WLYA 3FB6B 2VDPH 3GO1L 4JM2B 4TYUA 5INCB 3CVHL 1YPZF 3QISA 2A6JA 2EH8L 1S9WA 4WNQA 4Y1AA 2VLKB 2CDEA 4Z7WE 4YDJA 3WIIL 3FMGL 2VDML 4UTAL 2ZSVB 1P5VA 4N8CL 3QNYA 2I9LB 4XPFL 3MJ9H 3MUZ1 5GGTH 1T1YA 3WSQH 2EDTA 4JDTL 4NOFA 4PJIA 5GS0D 4PS4H 3QEQD 4ZFOA 3QWRD 4XPAH 1UJ3B 5DJ2A 3HI6L 4EQ2A 2Q8BL 4JRWA 4P2QE 4OGXL 5HGGS 3UAJC 5D7LA 5AD0B 5J1AB 3QEUA 3PABA 4CN1A 3HAEH 1LGVA 4HLZG 2BY0A 3AM8A 1U8KA 3TN0C 3MUGA 4JFYA 4BZ1L 1MUJB 3NA9H 3QI9A 1M1SA 4TTDC 1CTNA 2B1HL 4TUKH 3MRMA 4IMLA 1S7SB 1BPVA 3TT1H 5TDOB 1G6RB 3QWOA 5HDBE 5FGCE 3RWGB 4NQVA 5EO1A 4MDIA 3DVNB 5CJQL 4QRQA 4HUWA 1ZLUK 5BW7C 2NY4C 3MLVH 4G6KL 4AT6A 3D9AL 2A6IA 1TVDA 3VFGL 3BGAA 5EO9B 3JVGA 5MHSD 1BLNB 1IFHL 1KJVB 4LSTL 2LTQC 3SO3C 4XPTL 4N1CA 1CGVA 4I3RH 4PJCA 3HG1D 4JQXC 1BD2E 1F4AA 4P3DA 1TVHB 3HZVB 2XRAL 2GUOB 4X7TB 35C8L 3VJ6B 1DANU 5E70A 4YDIH 4DKAA 4U6VL 3EOBA 3P4NB 4I18B 4TSBH 1NGWA 1CLCA 4QF1A 1P4LA 4Z7NF 5IMLB 1C5BH 1JBJA 1N6VA 3PWVB 2YD7A 2BCKB 2COQA 1XGQA 1INDH 3UJJL 5ADPH 4X5LA 4JLRA 3RUGF 4XPGL 1IM9B 4E41A 1NBVH 5I8CA 3BN9D 3WNMA 4IHOA 2P7TA 3QNXB 3QO0B 4G80A 1QSEE 3QP3A 4RAUA 5FYLD 3K4DA 3AXLB 2GK0A 3L5WA 1N64L 4JM4H 1FP5A 2Z4QA 3FKUS 4AM0B 5B38G 4NWTH 1K6QH 2FHFA 3DSNA 4UT9H 1UB5A 3H9ZA 4L3AA 3MX0A 5DVOA 4RISL 2JCCF 2B1AH 4FFZL 4D9QD 3TN0A 2JIXB 3P4OB 1PQZB 4NUGH 2EYRA 3RVUD 1SBSH 4PPTA 3BP6B 2WQ8A 4PY8I 3LHPH 4R96A 5D72L 1JPTL 3ZKQD 5EUKA 4GBXB 2F54B 2EYTA 1I9IH 5AUMB 5KANI 5HGBA 4MYWB 2X41A 2IAMB 4KI5C 3EYVA 4YFLF 2JB5H 2E7HA 5E6IB 5BW7A 4KAQL 1DBBL 3EYUH 2ADFH 3IJSA 3DVIA 2BVQB 2FYYB 1P1ZB 32C2A 1HWGB 5ETUB 5E7FA 5BO1H 1F3JB 5ID0B 3BPOB 3GNML 3Q6GL 5DA4A 4HMEA 5GRUL 1BEYH 1A6TB 2X4QA 5I30H 4FQXB 4PJHB 4JQXA 4L4TB 5GRWA 3LQAH 1C5CL 2MJWA 1CBVH 1KGCE 3KYOA 3G6AB 3BOVA 4GMTH 5DWUL 1MJ8H 4MGXA 5DZNA 5FUCC 2J8UA 3VXRB 1MCFA 3NZ8B 4HX1A 3RWFA 1YMMD 4HHAB 2F5AL 3RPIA 4WW2C 2R2HA 2NY4D 3CMOL 2R69H 3LN5A 4XP6L 3ET9F 4I0PC 4AIOA 5EO0B 3CLEH 3U6RA 5DMKB 4JVWA 5EU3B 4TN9A 1F5WA 5EULV 3OR7A 3L1OH 3MPCA 5FOJA 4R4FL 2VZ1A 4NM4L 1HYSC 1AGEB 2X44D 4F33B 2HWZL 3D1MC 4MA7L 4YBLB 3JV0A 3ZSSA 4KY1L 4GXVH 4YGVB 5FKPA 4JGUA 5F89B 4PGEB 5DTFA 3SGEH 1L7TL 1IGYB 2BSSB 5F7MC 4DQOL 1RAMA 5K59E 4Z7OF 1RUQH 3TH3T 4IOFC 3P40A 5DD6B 2AJVH 3MYJA 2F53A 2FEEI 4OF6A 3H42L 1DBJL 3MLRL 4LPWA 4OD2B 3UC0H 4NN7B 4JM2F 3SDDA 4Z7QF 2J6EA 5EPMA 1A9EA 4H5SA 3UDWC 1LDSA 1NEZB 3M45A 3MRIB 3QFDA 4MHHI 5DD5H 3X14A 5J6HA 1ZSDA 2VKXA 1BFVH 4KRMB 3CXDH 4XPBL 1KIPB 3RVTD 4YPJA 1CVSC 1CIUA 4NC2B 4GFTB 5EWIL 2BHZA 1NAML 2JTDA 2X4UA 3T65A 1PG7H 1W8NA 4IDJL 5E9DA 4E5XB 1JFQH 4NFBA 4G43A 3B83A 3OB0H 4OZGA 5SWZA 3RA7L 4Z5RA 2CIKB 3EO9H 4Y8DC 2AEPH 1IAIL 4CN6A 2HLAA 4PJBE 4UTBH 3O3UN 4XNXH 2E7BA 3DMMD 3PWPE 1DLHB 3X11B 5D71H 4ODUA 4KI5D 5BZWB 1EUTA 1CD1B 2QHRL 2QKIA 5TFSH 5BOZG 3KPSB 4WW2A 3GM8A 4GAGH 1J0IA 1N5YH 4DTGH 1FFNB 4BH8A 2F19L 3LIZH 3ARPA 1N5AB 4NZUH 4I0PA 2EDBA 3S3SA 1S9KC 4C4KT 1I1FA 4QRSB 1U8IB 1QA9A 3B2VH 4MLSA 3FT2B 1J05B 1QBAA 4NSKB 2OR9H 4P3CL 1CR9L 1OAQH 4PRID 4YQXL 4OUOA 5FKAB 2ZJSL 1QLRA 1KLGA 5F7LB 1QLFA 3BDYL 5JPNB 2FL5A 1X5YA 2M26A 1QG3A 3BRGC 4KDTC 2FHCA 3VFSA 2FGWH 5BZDB 5IJVA 2KQMA 2XG5A 3CX2A 3QWQB 4CVZB 1IC5L 5DJZA 5LXGL 3SKMB 1F4WH 3BH9B 2DQJL 1MQKL 1Y0LB 1KIRB 1BBDL 5KZCB 5CUSL 4I0PD 5C09A 2HP4A 2AJZB 3UDWA 3MRDA 4PJ8C 4G9FA 2R29L 3HE6C 3FJTA 2DBLL 2O5YL 4FQCL 3PWLA 2IFGA 2WW8A 1HYSD 3FFDA 3KR3L 4UAOB 3B4NA 4Z7WB 4AIZA 1HSBA 4MXQC 3LPFA 2PYEA 4S0SD 1AGBA 2P4AB 2HG5B 3H3BC 4PUBH 4IOFD 3OTTA 1I8LC 1QQDB 3ESVF 3QPQC 4G5ZH 2W59A 5EC2B 4L8CA 5F9AC 1UWXK 4V1DA 4K3JH 5F3BA 5GZNC 3HPLB 3TBVB 1P4BL 3IVKA 4Z9KB 3T1FA 4C55A 3F62A 5H94B 4G9FD 4I18C 5ANME 1U8HA 3E3QC 1ZVSB 4P2QB 4HG4K 4LSVL 1F3DH 4FTVE 4ZXBD 3FN0H 3GMOA 2WV3A 4FRWA 1JCKA 1P7KB 4LLQA 1DQML 1XGPA 3KLAA 4WEBH 3OAUL 4XH2B 2NMSA 3IS0X 2IQ9H 3ROOA 1ZXQA 3L5IA 1QRNA 3VXOB 3SDAD 4QOKD 2RR3A 1IRAY 2EDDA 3C60B 5MEQA 4DGYL 3CFDB 5FGCB 5IBTL 2DWDB 1QUNA 5DJ0B 2PW1B 1J8HA 3W0WE 4G7VL 3VGHA 4PJHF 3MC0A 5JPMB 6FABH 3MCLH 4KDTA 1UGNA 3NCYS 5IEHA 1ACYH 4JM2D 1AD0A 5GGQL 3HFMH 1W72H 2ED8A 1HHIA 1ZANL 4JFQB 2VLKD 4PREA 1BFTA 3MLUH 1II4E 4K9EH 2AV7B 3JZ7A 4HAFA 1BD2B 1G6RA 4GBXC 3TNMB 4NKMB 4PJ8A 1E6JH 1IVLA 2V9QA 3EOYG 3HE6A 2IAMC 1XCQB 4JR9H 2XZCH 3ORJA 5D93B 3I75A 1B2WH 4M8VA 3MV7A 1WIPA 4U33A 4H20L 1CE6B 4PJGE 5J12C 4XCFH 1EERB 4OCRH 4PG9A 5I74B 3ULVL 5INDA 3VG0H 1IC4H 2FATL 5TDNA 3BPOC 1SEQL 3CVIH 4LAQH 3SDYH 3VI4F 1RIUH 2OJZL 5C0NC 1WCQA 3DGGA 1I8LA 2VZ3A 1BBJA 1OD7A 2OI9B 1QSEB 3CFEB 4HMCA 2YK1H 1GIGL 3MFFB 4NJAH 4I18A 5IIEB 1FZOA 3W82A 5JW4M 5IMLA 3PWVA 3MV7D 2WSKA 3VMPA 1IM3B 5F96L 3IF1A 4OCNC 5IF0B 3QCUL 4OFIA 5IHUH 4ZSOA 3ZTNL 5E0QA 1SVCP 4CW1A 2FEDD 5KANG 1UKTA 4BZ2H 4TPRL 3QNXA 5I1CL 3GMPA 4MZ3A 4AEFA 1JF1A 3QPQD 2P49B 1RU9L 1G1YA 5GZND 1CL7L 2MPAL 4S1RL 1RULL 3VXMA 2YWZA 5HHQA 1UQSA 1I8IA 5JW3H 2QSCH 1IAIM 5T1KA 4LVOC 4K71B 2Z31A 4FZEH 2AI0H 1A6UH 3RVXC 5IHZA 1FYTE 2XQYG 3DGCR 4U1KB 5IOPA 1L9NA 1A14L 4M4RA 4F7CA 3P9LA 4GBXA 4U0RB 5JR1L 3BPCB 1IM9D 2VQ1B 1RZ8A 5BVJA 3S36X 3ULVF 1UT9A 5IMOB 4Q74A 2AW2A 3ZE2F 3IDJB 4X8JB 1H5BB 3CZFB 3O3AA 4BKLB 1EGJL 5HXMA 4CUCA 2LU3A 4WUKH 2V9RA 5GGVY 5MERB 5F6HJ 1EEYB 4YAQB 4ODSH 1FH5H 1IEAB 4X7DC 1F3RB 5I66B 3H9SE 5AYQA 5DT1H 4NPYA 5CGMA 5CSZB 4ACPA 1QVOA 4G6FB 3VG9B 3H0TB 3VDBA 2HMID 3EYOB 4GBXD 2F54D 4LLDA 1HXMB 3VXRA 3CC5B 2IAMD 4I0CC 4YHZL 1YNTB 2HT2C 2VDRL 3I3BA 4ZPTB 5E6ID 1WC7B 3TBYB 3HS0A 3LEYL 1ORSA 1YA5A 1ZOXA 1WWCA 1Z3GL 5CJBA 4L9DA 3WS6C 1ZA6A 1YMHA 5DXWA 3L3JA 1NSNL 2I24N 1MIEL 2BRRH 3UJTL 3WN5B 3KPMA 3LEXB 4NQSA 2ITDB 5FYJH 4MHHG 3J7HA 4FQXD 1U95B 4FQPA 4L4TD 5C0ND 2C3VB 4D0CA 1A4KB 2A0LC 4OD3L 4YPGA 5B38B 1AGEA 3STLA 2CK2A 1FN4A 5I75B 3DUUA 1OVZA 3N1QC 4NHCL 5MENE 4RFEB 3QXAB 3W11C 5C0JA 3FO2A 5J13B 5BRZE 3TCLB 5F89A 1R3KB 3VFTA 4PGEA 3GMQB 3VXRD 1U91A 4RIRA 1LO3L 4MWFA 2AV1B 1XAUA 1EFQA 2DQEH 5CEZD 3RIAK 1ND0B 4R26L 4MVBC 3DXAE 4TTGA 2YSSA 4PJBB 1OAZH 4JFOA 5DVMA 4M9PA 5F7DA 1MJJB 3PWPB 1X44A 3DX7A 1ZHNB 4Q2ZB 2HTKC 1K8IB 2VDPL 2Q7NA 1PX3A 3WJLC 4D9RE 2YPLE 4OI8A 1RFDH 4UAOC 1DQLL 4EDXA 1MRCH 2D7PA 5HDBF 4JO2H 5FA3B 3C5JA 4N9GA 5HHVH 3T0XA 1MCPH 2BSTB 4GAYA 2GTZA 2C7UA 5E24E 5F7KC 2CIKA 4GQPH 4LF3B 5K93A 5GGTL 3RWIA 3WSQL 1NCAH 4R7NB 3HZKB 4RGOH 4PS4L 5DD0H 1DBAH 3L95B 1WICA 2VC2H 1XF2B 1EEZB 4JANA 2OP4H 2BERA 4Y5VB 4IM8A 3IFPB 4I2XA 3VGAC 2JJSC 4OM0L 4X4ZA 1WWBX 3CSYB 5C8JA 1YECH 4HPYL 3OX8B 3V79C 3WS6A 4U1MB 4P9HC 3MNVB 3V6BR 2AS5M 4FP8L 3LS5H 1D5ZA 3MOQA 2UWEE 3NA9L 4F7EA 3PXJA 5HVWA 2R1XB 4TUKL 2NPLX 3TT1L 1TPXC 3BP5B 3VFOB 5HTSA 2IADB 4HDIB 4DW2H 3QDME 4ORGB 4PJAA 1HDMB 5C0IA 5IB5A 1WTGT 5EFIA 4HZLB 3DJ9A 1R5WB 5AG9A 2CLVB 4CVZA 4XRCA 2DL2A 5CEXB 1Z9OA 4M7ZC 4YC2B 1OAUL 2QSQA 5IMMA 1KLUA 1L6XA 5I73C 5E7BA 1JNHA 5I1AB 4YHLH 1SM3H 1BVLA 1LEKA 3NABH 3S3PA 4YDIL 1MJ7H 4K7PY 5FO7B 1G7QB 2WP3O 2N7AA 4ELMA 1NJ9B 4PJXE 4TSBL 3WJLA 4IS6B 5ANMB 5DUMH 1QFPA 1C5BL 3ES6B 5FO9B 3L6FA 1DFBH 1JK8B 4FTVB 4HIHB 3T0EC 3T3PE 5H8DA 2ICWB 4Z7WA 4F3FA 4WFHD 1PKQA 4G8GE 3MTRA 1M4KA 1G9MC 5ADPL 2ICCA 2VN4A 1NBVL 1GAFH 2WINB 4S10A 4R0LB 5EC1A 2DBJA 5KZCD 1N0LA 3B9KC 1I7RB 2XIDA 4PJDE 1XF1A 4KTDH 4MVBD 3TBVA 5IW1A 4JM4L 4KHXH 5H94A 3R0NA 3W0WB 2EIZA 3LKPA 4NWTL 1K6QL 4H88H 4EKXA 2JJSA 2NQCA 2LU4A 4UT9L 3CXHJ 5DS8A 3DRTA 2E7LA 4TVPH 4FFVD 1Y6MR 1NFDE 5F7HA 2B5IC 2B1AL 4L8DB 2HFTA 1H9VA 4RMUA 5DRWB 4ZFZA 3WDIA 3BUYB 4NUGL 1T7WA 1SBSL 2CXGA 3VXOA 3LHPL 5FECB 4JREC 4LCCC 1U58B 1I9IL 5CKAA 2ZKHH 4JPVH 5BQ7A 3MLTB 3S7GA 3LN9A 1N6QH 1MLBB 1OB1B 2YN3A 4YFEA 3DI2B 5LAXB 3EYUL 2ADFL 4PJGB 3I9GH 4DUWA 2IG2H 3OKMA 4G7YH 4F8QA 1TQCC 3DWTA 5ICYA 5BO1L 3CFCH 4P2QD 2GY7B 4K71C 1BEYL 5D96B 3MJ7A 5DJAA 1FVEA 3GSVB 5I30L 3Q5OA 5EOCJ 5KVGH 2DAVA 3LQAL 5F7UA 1CBVL 1RK0B 3OHXA 5KG9A 4UDTB 4NGHH 3OXRB 3QG6A 4PYHA 4XAKE 5J06A 3U7WL 5K59F 4I8DA 3MBEC 3C60D 3REWB 1KC5L 3JWOC 4FABH 4KK5D 1LE9A 5D9SA 1IKNC 4YXLH 1CDCA 3T0EA 4LIQH 5DHXB 4G3YH 1A7NH 3CMGA 4U1HB 3O3BB 1C12B 4Y16B 1GPOH 4NHUA 4IBLT 1N3NB 3CLEL 2NZIA 1FAKT 3OKDA 1VFBB 3I84A 4P9MH 43C9A 3PG2A 1FORH 3SN6N 3L1OL 3B9KA 1CDHA 1IGTA 4BQ6A 3C2AL 1BD2D 2ERJB 4M1GL 1NGXA 4LOUC 4Z7UE 5ABDE 4GXVL 3BP7B 2VB5A 3KYMB 3GMMB 3MRQB 2FR4A 4WCYH 1IM3A 1FG2A 4PJBF 2UVFA 4WGWB 4X0KB 4W70A 1RUQL 2CLRB 1EK3A 2AJVL 3BD4A 1EHXA 3VFRB 3UC0L 4BFIA 3FOMB 1FYTB 3PIQB 3WE6A 4IMKC 4MB3A 3WIHA 4X6EA 4LCCA 1Z9LA 4Z0BH 2ZOKB 3L7FA 4IJ3C 5IW6B 5FXCH 5DD5L 5I71B 5LGJB 2AJUH 4FXKB 1MJUL 1BFVL 1ZE3C 4LEOA 2EDYA 1QSED 3BWAA 5D2LE 1RMFL 4TNVF 4HIIB 4ZAKB 1S78D 1PG7L 1RZFH 4M03A 1JFQL 3IKKA 4YIQA 5C07E 3RVVD 1JPGB 5D7KE 3QAZB 2CXKA 3H9SB 3RHWF 4UUJB 2AEPL 4KMLB 1HZHH 4L29B 4WFEE 4UTBL 2DWEB 3ZKNC 4XNXL 2ITCB 1I7ZB 1BFOB 3MBEA 3PGCA 3MSPA 4ZDHA 3D87B 1JPFA 1H3TA 4N0UA 1IKNA 2Q20A 1N5YL 3NPSC 1KJ2B 4OF0A 1U6AH 3LIZL 4NZUL 5DD1H 2H3NB 5DGQA 1OTSC 5M7QA 6CGTA 2VN7A 1S9VA 5K9KB 3B2VL 4OTXH 4HUVB 4ELKA 3T0BA 4O00A 4JDVA 1OTTC 5AAMA 3KHQA 4QRPA 4U7SA 3DTXA 3SGEI 1KGCD 1ZT7B 1HXMA 4K7FB 3CZJA 4YHYB 1CS6A