3QQNA

The retinal specific cd147 ig0 domain: from molecular structure to biological activity
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
117
structure length
117
Chain Sequence
MAGFVQAPLSQQRWVGGSVELHCEAVGSPVPEIQWWFEGQGPNDIMSQLWDGARLDRVHIHATYHQHAASTISIDTLVEEDTGTYECRASNDPDRNHLTRAPRVKWVRAQAVVLVLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Retinal Specific CD147 Ig0 Domain: From Molecular Structure to Biological Activity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
molecule keywords Basigin
total genus 25
structure length 117
sequence length 117
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13927 Ig_3 Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qqnA00
1FG9C 3FO2B 3PHOB 1U8PB 2CK0H 3RDTC 1LE9B 3DPBA 4NN5B 3GSVB 5EA0H 3AROA 1T1YA 4JPVH 2B39A 5IP4A 1MEXL 4FQ2L 2GY7B 1WZMA 3QAZC 4V1DE 3ZL4H 4G8IB 4NHUA 2DDQH 2MQ3A 3EZ8A 2PXYB 4L9LC 4WFGD 1IGCL 2NY4B 3BP5B 3ARGC 1XEDA 4HUUA 2DQHH 1FQ9C 1RIVL 4YBQD 3KPSB 4MYWB 5ERWA 5TH2A 1D9KA 4WRLA 4L4VE 4CN4A 4UMGA 5I1CL 3QEQE 1ZKAA 2UZYB 2LE9A 1BEYH 3RWCB 4LLDA 4H88L 2J7LA 4HIXH 5I1KL 2H6PA 4FQHB 4J8RB 3PGDB 3BZ4A 4WI2A 1GGBL 1NEZB 3D25A 4AYFA 4ORGB 1XCQB 1P9MC 1HEZA 3NIFF 4DZBB 1HXYA 1FVCA 4E5XA 4P2YA 5EU4A 2IGFL 4AEEA 3Q48A 5C8JA 5HBBA 3CXHJ 3BGAA 3QUMA 2Z31A 2FZ3B 4CVXA 4M62H 1G9MC 4BFIB 2AERT 2IBZX 3DYMA 2ZSWB 3GB7B 1R5WB 4H20H 3O8XB 5EZIL 3QJHB 4RWHA 1N6VA 2FBOJ 1WBZA 3ZYZA 1VGEL 3PWNB 4YPJA 4LLWA 1EAJA 3UAJD 3VU2A 1OARH 3U4AA 3MOAH 3BMWA 1BFTA 4MNGA 1FSKB 4OI8A 1P6AB 4XZUB 2NW2A 1OT1A 1GC1C 3V5KB 1FL6A 2A74A 5FYLL 3C8KA 2ITDB 1KLGB 3FCTB 3EYFA 4PJIA 5FB8B 2XG5A 3OKEA 2AK4B 4LCWE 4QHKJ 1FFRA 1VFOA 3MFGB 5CZXC 1RMFL 3O3EA 2P4AB 5EWIL 4F7TB 5I30L 4HUWB 3T08A 2NXZC 4XAKE 5IUSA 4QRTA 3CU1A 5KAQF 3IDYC 2VWEE 1K5NB 3UJJH 3H9SD 5INDA 1CGUA 3S37X 4IBLT 1X5XA 3OPZL 5EN2B 4F2MA 3SCMC 4LNVA 4PP2A 2R2HB 4FFWD 3IVKA 2F54D 2I5YL 4ZQKB 2YEZA 4OCNC 4P0DA 4X4ME 5CWSA 1AGCA 3SY0A 3TZVC 3HE6C 4JO3H 1MF2L 4ZUTB 5C0CB 3LVEA 3N06B 4PRBB 3MRPB 3SE3A 1T2JA 1AY1H 3MRMB 4CDHA 5FA3B 1NL0L 5B3JF 4X0KB 1V3MA 4HMCA 4K2UL 3X14A 4ODUA 3O9WB 3BAEL 1OGTB 4X6EB 1XCTB 2BRQA 1RI8A 1A6AA 1BIIA 3P77A 3GK8H 5C7XH 2ZOLA 4GKSA 1HI6B 5F70A 3UTSB 3T3PF 1XF3A 3N1MC 1IBGL 1UZ8A 2D7OA 2YOCA 4WTXA 1T22B 3VGAB 1F02I 4O5LH 5SX4I 1HHJB 2VNCA 2A38A 4J3OC 4Z7QF 2FEEI 4JJ5B 5D7IB 1IAOA 1DQQB 2GAZA 4J3XA 5K93A 3O9WC 4HC1H 1GOFA 3H9SA 5DA4A 3KPTA 5ENWA 5KVFH 4XB8A 2JB5L 4HFWB 4JCMA 3BWAB 4JKPL 2E9IA 4M43H 5F3HA 3LN4B 4XVSH 5J3HD 2WK2A 2F54A 4XVJH 3W11C 3MLTB 3TVMD 2I07B 1JZ7A 3MFFA 1D9KC 2VLJD 2HH0H 3WS3B 4Y4HC 4UIMB 4RWYH 1JJUA 1MAKA 3CPLA 4UV7L 4X4YB 3MLUL 1TCRA 1XGTB 4HC1A 3LQAH 2AK4D 4J8RA 4RAVB 2N4IA 3AMLA 4DKAA 2VR9A 5GSRA 4NZDA 4POYA 4K94H 3RKDC 4JO1L 1NGYB 4I77H 4G6FB 1QD0A 3PGCA 3U83A 2Y7QA 3ARFC 3JV0A 3PQYE 4U6XA 4UQ3A 5D4QA 2H3NB 3HPLB 4Y7MA 5FO7B 5HVHB 2ICWJ 4ONFL 3FQUA 4AIZB 1B88A 2XRAL 3MV9A 1UWGL 3QG7L 5IVNA 3W2DL 4M1DL 1G7QB 4BFIA 3G08A 4RNRA 5D1ZB 3UBXI 3WS6A 3SKUD 3RNQA 3KYMA 1UCBL 1ZHNA 2WV3A 4I18A 3ARBC 1IQWL 4U7KA 5DRZB 2VIRB 1NGPH 1MQKH 1IVLA 5JXEC 3GM0A 3TC9A 3CH8A 4RMRA 3TVMA 1Q1JL 2OTUB 3NCJH 3RVXC 1ETZA 2Z35B 4F58H 1TZHA 4LNRB 3A67H 3LQZB 5IMKA 4YNYA 1CF8H 4N0UB 4Z8FL 4XWOD 5EUKB 4YHOH 1ZEAH 4KRLB 2XY2A 5MERB 5D7JB 4DCQB 4P2RE 2PO6C 1M1SA 3QHFH 2LAGB 2AEQL 4PJXF 4PJFA 3RRQA 5C09B 2YUVA 4ZPTA 2X1QA 1IE5A 3MGTB 4R2GD 5AZEH 2X4TB 4NKOB 2WANA 1YJDL 5EUOB 4JDZB 1UZ6E 5GS1B 1ZS8A 3GMLB 3BKML 3VXUA 4YR6A 3SJVE 3V5HB 2D0FA 1UB5A 2P8MB 3TNNB 3TPUA 3ARGB 1IAKB 1SJXA 1WC7A 4WV1B 4D9RE 2APTA 3MBXH 1C5CH 5DJAA 2PXYC 4AL8H 5AAWA 3EOYG 5GS2H 1NGXA 2W0PA 1ADQA 5DJZA 4M4RA 1NAKL 5ITFB 3DHJA 3VXNA 4H26A 4OLVH 5EZJA 3MRRA 3QNYB 5IB5B 2GYSA 2OLDA 4Y1AA 3BPOC 1QP1A 3BIKA 1HH9B 3GSNA 3BDYH 1VFAB 3RDTB 5FKAB 2IQAB 5E7FA 3OKNA 1TVHA 2G9HA 4P23B 1C7SA 2AJ3B 4AY0A 1E4KA 1OAUH 1IFHL 1QVOB 2XN9E 4ODTL 1AR1C 1RFDH 4QXUH 3TJEL 1FGVL 4JKMA 1WWBX 1HHJA 3N1QC 2GJ6D 2FO1A 3IDJB 1U3ZA 3MGAA 4JHAH 2HT2D 3WUZA 1FG2A 2XPGA 4LLMB 1QBLL 4IRJB 5KSAB 4LCUB 2O61A 3W9DB 4QRTB 2R9HD 1CDIA 1N3NB 3T0DA 3ROOB 2WBJC 5D6CB 1JNJA 3WNKA 4TYUA 3RIAF 4CU8A 1G1YA 2IBGA 4LCWA 4GKZA 1D6EB 4JFFD 4KY1L 5IB1B 1EO8H 4I0CC 3O45B 4JPIA 3SE4C 1WBXB 2XWBA 1A6TA 3MXVH 1Z3GL 1T21A 1CDCA 1E6JH 3GI9L 3GMRB 4TTDD 3QEGL 1A7OL 4CL7A 2VLME 1CVRA 4PY8I 2C9AA 5D96B 1N0XL 1G7JA 4HIEA 4XGZA 3U30B 3MRIA 3V8OA 4BH7A 3TN0B 3BPOB 3SDAD 2VKWA 5TDOA 3CPLB 4L9LB 4MXQD 3BH9A 4HUVA 2E5EA 5CD5C 4JREC 2XKUA 3MLZL 2A77L 4Y1AD 4FQLH 1GZQB 4M61B 4JFXB 2W91A 2VLRB 4XP6H 5FKPB 5CHNA 2F58L 4BJLA 2ZCHL 4FQIH 1INDL 4MNQE 3TV3H 1QNZL 1CDGA 1DBKH 2IAMB 4OFDA 4PJ8C 1PBYA 32C2B 1QFWL 2XNAA 4LLYB 2GJ6A 1MVUA 5JXAL 2BVPB 4ZTOH 4X83A 2CKBL 3BPLB 4R26H 1CTOA 4HWZA 4ZNCD 4X7CC 4TNWF 4WUUD 4JZJA 2QQNL 3TT3L 4O9HH 4OUUB 4JRXD 1PD6A 2J6EH 4XNQA 2GW5A 4O2FB 3CFBB 1RY7B 4LCWD 3BWAA 1UZ6F 4YQXH 3L5HA 4ZAKD 3S88H 4A6YH 2XKNB 5HGDB 1GC1L 4Y4KC 4UDTA 3MRKA 2FX9H 1D5XB 1IRAY 1MSPA 4L8SA 3JV4B 4XCEB 3S7GA 2DBLL 5IFJA 4MZ2A 4B41A 3CZJA 1ZT7B 4JDTH 3MNZA 5F7MC 5IHBA 2B0SL 1I1AC 4ORGA 1TCRB 1XGTA 3RI5K 4KH2A 2F54E 1EX0A 2X70A 4WWID 3QWOB 4FMFA 3B9EA 3LKNA 1NBVH 1ND0A 4JFHE 1J10A 4G6AC 4R4BA 4HLZG 2BSSA 2GTZB 3U7YL 1JGDB 2P24B 4U3CA 1DFBL 2RB8A 4HKJB 3S34L 4Y16D 4MJIB 2Z4QB 3C2AH 4XNUL 2BDNL 4JQIL 2BJML 5HHVH 5KZCD 1KIPA 2H45A 3HC4H 1JPGB 2F19H 4Q9RL 2YPKB 4WNQA 1A7OH 2B2XH 3MLYL 3SEPA 1GYAA 1D5ZB 3GSQB 2CJUL 4C58B 4JM2A 1W72H 1PG7W 4P5TC 15C8L 5C9JB 4K3EL 3SGJA 4AEFA 4BH8B 3LS4H 3VXNB 5ITFA 3VMPA 2CQVA 3FCTA 4ZXBD 3VE0B 3ZKNC 1PYWB 2DLTA 1UJ3A 5ILTL 5I2IB 1S7TB 3VWJD 5DD6B 3WXVH 3DX8B 1VCAA 3FB7B 1UB6A 4P46B 2XWTA 3B2UC 1CFBA 1U41A 2GI7A 3GSXA 3WKML 3H2WA 4WO4C 3ARBD 2KQMA 4PRHB 1A9EA 3VDAA 5CEYB 1CIUA 4LP5A 1AR2A 1KYOJ 5DYOB 2APBA 3LY6A 5I1GH 4JANA 5DT1H 5A3ID 5CP3H 5HVFB 4UIKH 2BSTB 1FYHB 1U8NB 1X7QB 2YEZB 5FYJE 1GGCL 4HUKB 2Z92B 1CN4A 4HJGB 1LVEA 4NFBA 5ADOH 3OGOE 1RUKL 1UACH 5INCB 1RZGA 3B2UD 1ZVSB 4LVOB 1A6ZB 5DSCA 5JXAH 3HUJA 5I1DB 4ZFOB 4ZPVA 2P7TB 3CSYB 5DUPL 4HKZA 5CD3A 4M5ZL 1S7QB 1L6ZA 4AEHH 3NZ8A 1R6VA 4H25A 1T1YB 3WO4C 1J18A 3TJHC 3RWFA 2ICWB 4XNZB 5E00B 4FQXB 2A0LD 3GO1L 4LQFL 4K8RL 5I66B 2J4WH 3MPCA 4JN1H 1CFTA 3VXSE 3T4AB 1PLGL 5HHOB 1RZFL 1BREA 1CD1A 4P3CH 4A2MA 4XC1L 1S5IH 5IW6B 1JGUH 4A6YA 1PEZA 1F2XK 3K81A 5T1MB 5IEKB 5DHVH 3QEHB 1MHHA 3WFBH 1U3HB 2J6EA 1T83A 4MD4B 5KS9A 4WY7H 3BIBX 4LF3A 3IDNB 1IC7H 3KPPA 5HGAB 2FH8A 2FJHB 2VDML 3OB0H 2YD6A 4YFDB 3C8DA 3F65A 1CDBA 4U2ZA 1U8PA 4J3UA 4FFZL 1P4LB 2JB5H 3BRGC 5E95B 3MV7D 3LKOB 4KRPC 4JZNB 3VWJB 5E8NA 2AV1A 4PGCA 3UTQA 1FO0H 4WI6A 1F3JB 4DVRL 1JGEA 4O51B 4PJGB 3FB6B 2Y5TB 5BJTB 4R96B 4EOWH 3QIBC 3DUSB 1KFAH 3OX8B 4D9RD 4LQ1A 1KULA 3V6FA 3ZHKA 5F21B 3EFFB 5F7UA 1B6DA 3TCLA 4KHTL 2E6JA 3OKMB 1FCGA 3B9KC 3CH1A 4G9DA 1IAOB 2X1WL 2A73A 1OTUC 5D7SL 4HKJA 1FFOB 2GCYA 4JPKH 2W9LA 1NJ9A 5LGKA 4LARH 2VIRA 4X9GA 3M1BA 2ZNWA 3QIBB 3RUGB 4FFVC 4E42A 3HZYA 1I1FB 2P5ED 3VXOB 3VXQA 4U1IB 3X3FH 2XWJB 5HSFA 5CJXC 2PTVA 4UIMA 3HG1B 3MLSH 7FABH 5ALCH 3KPNA 1IT9L 4ZD3H 4YDVB 3QT2A 4XVUC 1VADA 3RGVB 3WFDH 1JYWA 4PB9L 1NAML 1F6FB 1AXSB 3DJ9A 2JJSA 2AV7A 2I9LA 5GS0C 3SKMA 3T4YB 4TOYH 2GY5A 5JA8B 5IK3B 5EU5B 4X6FA 4R97C 2D9CA 4YGVA 3PGCB 3KS0J 4PJCA 2KL6A 2EH8L 1MLCB 2F53A 2Y72A 4PJIF 3LEXB 1FBIH 4K8RH 3MCLL 4AM0A 3DWTA 1E4XI 3RL2B 4HUXB 2PYEA 3MGOB 4Y4FB 3ZTNH 3WL9A 1YJDC 4P4RA 1DQJB 2ZUTA 3QXDB 1SEBB 3QEGH 1JRHI 4K3HA 1WCQA 5DLML 1XR8B 1TIUA 5DJXB 2X4PA 3BHBB 5M95B 4WDIA 4XCNB 5BCAA 2IMNA 4MNQD 5DMJB 5E9DB 2IGFH 3GSUB 5SX5H 3LS5L 4GG6F 1QYGL 2GT9A 4IRSD 3WFHB 3IETB 3DURB 1XF4B 4OAWB 3P3YA 4WHTA 1DCLA 5FYJL 1I7ZB 3HE7D 1KFAL 1OF2B 2VDMH 3FL7A 3I9GL 4M7JH 3G6JA 4YXHH 3I3EA 3P2TA 3OBAA 1UG9A 5CWSB 2DYPB 2AXHA 2IAMD 2F5AH 4AENA 3CUPA 1HOCB 1WGOA 1CL7I 3H9SE 4K7PX 5B8CC 3HMXH 1BIHA 5I1HL 1T80A 4CJ0A 2HFEA 1O0VA 4NRYB 3FO1A 1UJTA 1KPUB 5FV1L 1SEQH 1GZPB 5GJTL 4RFNC 3PIQB 2R69L 4CUCA 1B4RA 5IIEB 1JZ2A 1UB5B 1AI1L 2XFXA 4OD1H 2ZNXA 5KVFL 3MOBL 1PY4A 1RMFH 4QOKE 4WU5B 3PHOA 3JWOL 1T5XB 3MV11 1OAYH 2FYYB 1FC2D 5L2JA 1RSFA 3S96B 2X9WA 3GSOA 3HC0B 3PP3H 5IB5A 2B5IC 3FRPG 3QUXC 3EYSL 1HYSC 4ZUSA 4MDJA 4KKLC 4LSQH 4KK9D 1V3LA 3QB7C 3U7WH 1BOYA 4IDJH 4NQCE 3W82A 1FLRL 1J8HB 2I60H 5GGRA 4XNMB 4RA3A 1ZHBA 2CK2A 4R9HA 4ZNEA 3OX8A 5HI4C 5DJDA 5K33A 1EHAA 5LBSH 3ZTJH 1MCEA 4IOIA 2VR5A 2YD5A 3OWEA 3LAFA 2VABA 3SPVA 5C0CD 4GAJH 2DQJH 3V4VL 5KZCB 3AGVA 1P2CB 3TT1H 5AD0B 4HS6B 2BC4A 1NLBL 2Z35A 3EGSA 4XMKH 2RAMA 3FO9B 4N9GB 1Y6MR 1RUAL 3O11B 3B2VL 1UCTA 4GKZB 4LPWA 3QULB 4NKQB 3WEXA 2R8SL 3VH8B 4M6OL 1DANT 4OLEA 3K8KA 5EIIA 4R6UA 3WFCL 2VLJE 3WJJC 1QR4A 1QFWH 1UM4H 2DB8A 2VXQL 4P4KB 5D71H 2L7UA 3MROB 4LKXB 5FYJH 3OAYK 4Y4HD 2R1WB 4YXKH 5EOTB 1XGQA 2EDLA 3ARDA 4PBXA 4OLXL 5F8RC 1Q1JH 4JDVA 1VESA 4BZYA 4D9LL 3ES6B 3RJQB 3CFEB 4OF7A 2G60L 5FYJD 5DQDL 2HJFB 5ABDE 1AP2B 4GW5A 4NZUH 3VGBA 2J88H 5GGSY 4TN9A 5GGQH 4KDWA 4TNVK 1CLOH 4N1HB 4F8QA 1NGXB 4M93C 1H3UA 4XRCB 4M7ZC 3H3PH 2DQFB 3F5WA 3HZKA 4YX2H 1KCRL 4LLDB 1GPOL 1KNOA 1S9XB 3VCLA 4I48A 5MEND 4X5WA 3P30L 3D6GA 2EH8H 3CXDL 4MB3A 2YXMA 2EDEA 3OKNB 3W9EA 3E6HA 3INUL 4P4RB 5C0NC 3KLHC 1WISA 2X7LB 1DDHA 3KYAA 3WNOA 2NY3D 2QTEA 5GJTH 3G5XA 4DGIH 4OLUL 4YUEH 1UVQB 3F7YB 3P11H 1AIFB 2WBWB 4HLZH 4JFDA 4OD2B 4LCCB 3ZSTA 1RQ5A 4FQXD 2QSQA 5E2VL 1QG3A 2DD8H 3OKOB 5CJQL 2H41A 3WD5L 4PJDB 3MYZA 1H8SA 4X6CE 5LWYL 1IM9D 3KDMA 5E2WH 3B8YA 1AXSA 3P73A 5I1KH 3EJZC 3HRPA 1WC7B 3CVIH 4EDWL 4TPRL 2AKRB 3VI3E 4YGAB 3ZL4L 2OTPA 4M5YL 1RJYA 4DN3H 3ARYA 4ODTH 2ORBH 3QPQC 1E27B 2AVGA 3MZTA 2DQIL 3T1FB 1OGTA 4X6EA 1Z9OA 2AEPL 3SHSA 3FOLA 5GGSA 4NFDA 2HYMA 1R3KA 3VG9B 1B2WL 4X99B 3Q5OA 1EHNA 1A6UL 2ID5A 4KMLB 5EU7E 5CSBA 4BELD 1T1ZB 2X41A 4Q6IC 4R4FL 5JORA 4HIJB 1A6ZA 3ORJA 4NM4H 1VACB 3BDBA 5KVMC 4S1SH 5DEFB 2ZSVA 4HULB 2E7CA 3GSWA 3KG5A 3GMMB 3IAQA 3MXVL 2R56L 1JI1A 3RWIB 2X4UA 3VA2C 5TGBA 3IGAA 4WO4A 4F7EA 3FN0L 3G5VB 4PJXE 5J12C 4JFDD 4XAWH 4YBQC 2VQ1B 2X4NB 2A83B 5IMLB 4HWZB 5AZEL 5J7CC 4N1EA 3E3QC 4FQXA 4MA7L 3UTTA 4OT1L 4DK3A 1JF5A 1UM4L 1P9MA 5DMIH 2OBGA 3ECBB 4XC3L 2V2XB 4ZUTA 4XPTL 1H3PH 3MV8D 4QHUB 4KKBD 1DN2A 3TNMA 3FQTB 3L9RB 3TZVA 3WS3A 1F4XL 3MRBB 3QXAA 1QFPA 4NUGL 4X0KA 3HHRB 1HOCA 2J5LC 2OJEA 1FLRH 5GGVY 3P30H 3QJFA 2VABB 3SPVB 4DVBB 3QQ3A 4WI3A 1HHKB 1P7KA 3NCMA 4HXAL 2EDNA 1KG0B 2J8UA 3DETD 1WTGT 3EYUL 1KEMH 1QSFA 4K9EH 1DE4A 3D3VA 5EUOF 3KLHD 2DKUA 1QRNA 3Q1SL 3I6LD 43CAA 4X9HA 5HHPB 5CBAB 2ERJB 1NGZB 5EC1A 2YN5A 3TIDB 4O2EA 5CINH 1AGEA 1Q0XH 2P5WA 4JGMA 2HA1A 5A3IC 5GIRA 1EEYB 3LEVL 1JNHB 4WU7B 3SCMA 5BZDA 5FCUH 3VFNB 5K9QI 1FYTE 3BMVA 3CJJA 1NCBH 1BX2A 1WWCA 5HDQH 3OKDA 4YWGH 5FYKD 1HILA 3QI9B 4LPYA 4WO4D 5EBLB 2BNRD 2BFVL 3X17A 4LSTL 1I3UA 4ZOEA 5BV7B 5IEHB 4PTTA 1FE8L 5I6XB 4UOW0 1TXKA 3WXWL 4W6WB 4OLXH 2I5YH 4CADB 3VXPB 5BZWA 4F15B 3NCYS 3MV8A 4PBWD 1YEGH 5SWZA 4XH2B 5E4EB 4HS3B 2ADJA 3C6LC 2DWEB 5DK2B 4D8PA 5DJYB 1CD8A 4N0UA 4PJ5A 4NM8L 4LHUD 3I3DA 5J6HB 1BOGA 3E8UH 5DD0H 4OGZA 2JK5A 4NPYA 4PRIA 2ORBL 3L3OB 4UNVA 3VG9C 1CXEA 4G8FB 3TYFA 5HHQA 2DL2A 5H37H 1QO3B 2QQQA 4U6XB 1WT5A 1LK3H 2C3WA 1MFBL 3DLQR 5DYOA 1K8IA 4C56A 1MFDH 2P5WD 4R4BB 2JELH 4Y19D 1BLNB 3I50L 1NFKA 4K3EH 2UYLB 4LARL 1CDUA 3LS4L 1SYVA 4KUZL 5ELIA 5H37G 4QCIB 1UWEL 4GRLB 5IG7A 1G7MA 2BNRA 3UP1A 3DVNA 4X5LA 3DXAB 2Q87A 5MEPB 3BKCL 3NABH 3Q3GB 5CKAA 3KYKL 3ESVF 4F9LC 4PB0L 4Z95L 1A1MB 5K9JH 1FNGA 1ZHLB 3CFJB 3QH3A 5GQBA 4DGVL 3MRJB 4EKXA 5HVWA 1PAMA 5KTEH 1WK0A 2DQUH 1MREL 5FKAA 4BH8A 4I3RH 1FV1A 2UWEA 3LQZA 1T0MB 5IMKB 4GMTL 1IGFL 3QFJB 4ONFH 4QHLA 4RWYL 1UFUA 4U1JA 1RHFA 3SDDB 4H1LG 5T1KB 3GMOB 1FNEA 1KBGL 1F4HA 4M9PA 3EO1B 1DDHB 5KSBA 3MLXH 1NCBL 1KJMB 4K9EL 4M7ZB 4JFPA 5I16B 4ZPTB 4RMWA 2VWEC 3ROOA 4WEMB 5D6CA 3ARFB 5HHMD 2ZCKH 1YY8A 4NWTL 5ICXA 5IM7A 5L7XL 1J8HD 1E28B 1QLFA 1WAAA 1OWRM 4DK6A 3IFLL 5F1SA 4E9LA 3PL6C 1LNUA 4OCYH 1LEKA 3CUPB 3KDMB 4JB9L 3VXRA 4MA7H 4YHNB 2YUXA 3ALWA 4L4TE 3LS5H 1MEXH 4P46C 4Z77A 1S9YA 3MJGX 4JZOA 4NDMA 4OLWH 4P2QE 2PXYA 2YKLH 4MDIB 2AJZB 5B8CA 3AAZA 4PLKC 2EIEA 3IDYB 3PWPA 4OCSH 3C09B 3T2OA 6FABL 4Q6YA 3V8CA 3GNML 4EI6B 1PSKL 3WIHL 4HF5L 1JGEB 3IFPB 2ZUVA 3VRJA 3BFOA 3R0NA 1P5UA 1PY9A 3OXSB 5H94A 2VXQH 5E5MB 4OTXL 2FYYA 2D7MA 2XNAB 2FD6L 1FG2B 4W4NA 5E9DA 1H0DB 5T33H 2HTLC 1E4WH 3QIUC 3KPRA 1Y18A 2ZJSH 1FL3B 2CKBA 3MOBH 4MQ7A 1HQ4A 1TNNA 1OQXA 5F7YC 1NBQA 1J8HA 4YC2B 4JRYB 1ACYL 2J88L 2CO7B 4I2XB 1CT8A 3O2VH 1NANH 4WTZA 3W0WB 3QCTL 2DWDB 2YPLD 3KPMB 4O02H 3G6AA 4YHPB 3ZKMC 4R4NC 1VERA 4OZHA 2JJVA 3KLSA 3QO0A 3FO9A 4M8QA 4N9GA 4PGBB 2PXYD 1OD9A 4DN4H 5AWNH 2XG4A 4HGWA 3NTCL 4Y4KD 3T2PA 4RQQB 4TUOB 4FQJL 1T1WA 2EDQA 3TESA 2B1HL 4LEXL 3GGWA 3NAAH 3KPSD 3QFDA 3U9UB 4H88H 3T0BA 2J4WL 4JN1L 5SWSB 2OSLB 1IARB 1WICA 1NANI 1TTGA 5FO8B 4LLVA 1OAUL 5CLWA 1Q9KB 4KKNA 2VDKH 2A6DA 2IH3A 3OV6A 5D9SB 1K3IA 4J3WA 4XMKL 3GKWH 2IF7A 3FMGL 2J8UE 4IRJD 5KSAD 4P3CL 3KYOB 4YHYC 1EIBA 1A7QL 2FHBA 2WUCH 4E0RB 1P6FA 1GHFL 3LB6C 3GB7A 3SDXB 4Z5RB 5GJSL 1YEFH 1FH5H 3R4DA 1F90L 1MUJA 4WI4A 1G7PA 3GMPA 4L4JA 1NJ9B 4RMVA 3I02B 3PV6A 4KK6C 4P2OC 5F9OH 1NSNH 2MJWA 4NHUB 4XMLL 3BKYL 4UDTB 3GZKA 4P99A 1TFHA 5I1JH 2BSRB 4CVUA 1FNGB 5JW4Q 1NC2B 4FFZH 2YPLA 3UJTL 4YDKH 3DURA 3NFSH 1H5BA 4JO3L 1EHXA 3TA3B 4PJHA 2HKFL 2BVTA 3O11A 4JY6B 2C1PB 2KDGA 4QY8A 5FB8A 3O8XC 1IGIH 5TDPB 4JO2H 1T0NA 1MCCA 2RQ8A 4V2CB 4N8VG 3MV8E 1M7IB 1EEZB 1S7VA 1UM6H 4M3KB 3JXAA 3D5OF 3L3DA 1NMBL 4LCCA 5JQ6L 4IHOA 1JRHL 5HGBA 2ZCHH 4FQIL 5B39G 3TV3L 5JXEA 3C8HA 3ARVA 2MCPH 4NNYB 1SHMA 4YHIA 4JDVB 1Z5LB 3LMJH 3INUH 4L3AA 3NH7L 4BQ8A 4ZTOL 3P9LB 5D7SH 2YPKA 4WNQB 1U0QA 5EPMB 3OR6B 5ESQA 3FB8A 4PJGE 2OR8A 5ISZB 2HLAB 3KJ6H 1MCIA 4UDUB 1AJ7H 2WUBH 4DAGL 2M1KA 3D39E 2DMCA 1CTNA 1FFQA 3EYUH 2X4SA 3W11D 4ODUB 5EOQH 5E8EB 4TSBL 5HPMB 1IAII 2XZCH 4BUHA 1JV5A 4F9PA 2EKJA 3BYYA 2YPVH 3KR3L 3SGDH 5BW7A 2G2RB 3C6SB 4YXLH 1UGNA 4F7PB 3OHXB 5GZND 1U36A 3QUYA 1HQRB 5F3BB 1C08B 3Q6GH 3NTCH 2NNAB 5HYFA 3MLUH 4R2GC 4HH9A 1FZJB 1AHWB 3SO5A 4MZ3A 3TH3T 1PG7L 3NMEA 4L8CB 2EYRA 5DD5H 2VDPL 5KS9B 3EDJA 4D0BA 4Z7NF 2SEBA 3GRWL 1MCPL 2X89A 1MQKL 3VWJC 4OCXL 2QKIA 2ED9A 4JM2D 5E8PA 2CIIA 3U7WL 4LSRH 1J1XH 3UDWA 4F7MA 5F6IC 4Z7OE 3MO1B 1A9BB 4JFOA 4WU5A 3VXUE 5I1CH 4JKPH 4MSWA 2P48B 4XVUD 2KZ1B 4UBDD 3TO4D 4MXWL 3DBXA 3JTSB 1W72L 5EULV 4XBEL 1OVZA 1YMHA 1NGPL 5GRUL 2CLVA 5HHPA 4WW2B 4ELME 4Z7WF 3VFVA 4F37F 5I1AB 8FABA 1L7TH 4Z76A 2YUZA 2APFA 4KHXL 1XH3A 1JI2A 1U8MA 1T7ZA 1R3JB 5IF0B 5I17A 1YEKH 1YN7A 3I84A 4OF0A 4TQEH 4LFHG 1ITBB 3P0GB 4PGEA 1QBAA 4GG6B 3BVNA 5D2LE 2DM2A 3QEUB 5KANI 5KVEH 4YXKL 2RBLA 5FF6A 4U3HA 4XP1H 3MUGB 5FK9B 4S1QH 1CFNA 4E42B 5DQ9A 3FMGH 2BVOB 1NMCC 4ZTPH 5IBTH 1NCCH 4OGAC 1K6QL 4RGNB 1ZLWH 1FPTH 4XPAL 5C0CE 1HYRC 1MI5D 4KJWC 4LGSB 5ADPH 3NACH 5EU7C 4M93B 4S11A 3T04D 1P4LA 3KHOA 2ICCA 1DEEB 1OB1A 4N5UA 1MH5B 5FM4A 2ADFL 1GIGH 5HHME 3VG0L 4Q9BA 3REWA 4NC0B 4DFHA 2IALB 4U6HA 3VD3A 3DUSA 3RDTA 2OJZH 5LBSL 5FA4B 2I60L 3OKMA 1DL7L 3QUMB 1MHCA 3UTPE 4NSKA 1X44A 1RK0B 2AGJH 4PYHA 4RFOL 1Q9KA 1T4KA 3QSKB 4NM8H 3VXMB 4FABH 4MNGE 5F7DA 5BVPL 2V2TB 1AD0A 1MNUH 1CICD 5E2JA 5TF0A 4XBPA 4U6VH 3IU3A 4G8GB 3TJEH 3BZEA 5C6PB 5D1ZA 3P4OA 1ZLUK 1XR8A 2WW8A 2P8MA 1N7ML 5BO1L 5IQ9A 5D5MB 1FVEA 1OP3H 1MCOL 3C60A 4XVTL 4HK3N 5C0BD 2K3TA 1FO0L 4AMKH 2YKLL 3DROB 4K2UH 5F97E 2UZIL 2BNUA 1UVQA 3F7YA 4UNUA 5MENE 3TN0D 5GRZA 3B9AA 4LL9A 1K8DB 1PSKH 4HV8A 1Z3GH 2HVJB 3HLAB 4NQSA 1PZ5A 3VFPB 4OJFL 4HIEB 1CGVA 4ONGL 1CLZL 4NKDA 5CZVH 3RWEA 3F7PC 4BYHA 4D9LH 4JM4L 5EOCJ 4YHZL 3TP4A 2VDRH 3BH8A 2B5IB 3QUXB 4OGXH 5GGTA 4F7PA 4YBHA 3O6KH 3L9RA 3TZVB 5C8JB 3K80A 2MHAB 5HI3C 3TF7C 3RDTD 1WITA 1UC6A 3DSFH 4BKLB 2WLZA 4JFZH 4P23D 4NCC2 4OM0H 4NZRH 1E28A 1QLFB 1TQCB 5I75B 5F44A 3IDXL 3NIDE 4ZS6D 4P9HC 1CR9L 1D6EA 3MLVH 3KPSE 2I24N 4PFEA 1P7QB 5ACMA 1T66D 5E8PB 5TQ0H 4G9FA 4DGIL 5EPMA 4OCRL 5JMRA 3PWVA 1EBPA 5GIRB 4L5FL 1CLYL 2AJZA 5B8CB 3D2UD 4Y4KB 3D3VE 3EDKA 4ZXBC 2VAAB 5BXFB 2QQNH 5KSBF 5CIPB 5BOZG 1MPAH 1CXFA 4HPOH 1ERNA 4HIHB 2AS5M 3DVGB 3BH9B 1FBIL 4CGTA 4LIQE 3GHEH 3QNZA 4PJAF 1ZLVK 3MUZ1 1KN2H 1QZ1A 4TOYL 4TPRH 4FQ1H 4I5BA 3K2UL 2VISA 5HDLA 5CJXA 3CFCH 4OUOA 1NCWL 3LD8C 2PYED 1EFQA 2BC4B 2Q6WB 5L8JB 1JPTH 1KJ2B 4GLRH 3CX5K 1A6WL 1CXHA 1YMMB 3FTGA 4PJ8A 2BVPA 4PRAB 3NCCB 5EDXA 1NDMB 1JGVL 1F45A 2WP3T 3WE6A 4TTGA 2VDOH 1CK0L 1J5OH 3V5DB 4ZUWB 4OB5H 1NCNA 1LP9E 4AEIL 3U4BH 1T5WA 1GCFA 1KIPB 4FZEL 5MEOB 3L3HA 4Q7DA 3TBSA 3C5ZB 3NCJL 5AYQA 2ESVE 35C8H 4ZODA 2Z31B 4X6CF 2QQKL 1FORH 3UBXB 1CLZH 5ALBL 1MCOH 4ZAKB 2J5LB 2FBJL 3O8XA 1HSBA 3DGGB 4ZOBA 3AMKA 2JLLA 3BZDA 2IAND 5T1LD 4NC2B 5HY9A 1MCKA 4I3SH 1CFQA 4JN2B 5I1EL 5J6GA 2OZ4A 5I75C 4IRJC 3HAEG 5KSAC 4AZ8A 1XR9A 3CCHA 1KLUB 4PY8J 4XP5H 4KGLA 4EN3D 5FYKE 1IAIL 3D39D 3DSNA 4OI7A 1FZMB 2EXYC 3NH7H 5A2KH 3WV0A 4LSSL 4LLQA 4I77L 9CGTA 3MODH 3IKCB 1I7UB 1FNEB 4FTVE 5D2NE 1F3RB 1CS6A 2R1XB 5ACLA 1FIGL 4YHPA 1N2RB 2ZPKL 4P2RA 1QSED 5DD1L 2ESVB 3BT2L 2DKMA 5HGDA 5GGUB 5DVNA 3MBEC 1LK2B 4P5KA 5DGRA 1XF1A 2LABA 2YHGA 3DV6B 4JO4L 2X4QA 2F15A 2X2YA 2OL3H 5FXCH 3ARPA 3HNTH 2ATKB 3C2SA 4GAJL 3GI8H 4HMDA 5TDPA 3LN5B 3NVQA 3SJVA 5SWSA 5I1JL 2VKXA 5BRZE 4ZXBB 1KCKA 5F1NA 4BA8A 2HVKA 3C5SA 3VRIA 3PP4H 4NZJA 4ELKB 3CD4A 5IVZB 4F9LA 1KOAA 5IJVA 1PG7H 1MJ7H 4FHBD 5C70A 3PP3K 4LCCC 4O4YH 2Q76A 2VXUH 2W60B 3ULSA 4NO5A 1BZ9A 2Y36H 3PQYB 5JW4N 1YEDA 3QWQB 4NNXA 3H7BA 4FXKB 5IOPB 4G80B 1G7PB 3GMPB 3PWUA 2AXFA 3I02A 3NCBB 4P2QA 1JPGA 5DK0A 1FVEB 4Y4HA 4XX1E 4DEPC 5F93C 1JIBA 1PGRB 2A6IA 4PJEF 2EEBA 4MA3B 4TNWK 5DC0A 1CLOL 1N6UA 3ULUE 1JV5B 3OKYA 3ZYOA 2CDGA 1SJEA 4LHJB 35C8L 3HI1B 1DBAH 5I76A 2FX7L 3H9HB 1D6VL 3C6LA 1F8TL 5HVHC 1XGYH 3TYGH 1HIMH 2EDDA 3VFOA 1A1NA 1NEZG 4X6BA 4X6DF 2DQEH 4TVPE 1NGZA 4XPHL 2NTSP 1A6PA 1OQOA 4KDVA 2QSVA 2ATPA 2F8XC 4IOFC 1A6WH 5GSRB 1NCCL 1J12A 1FIGH 3V5DA 4OIBA 2XIDA 1WFNA 5IMMB 5DD1H 4EIGB 4P2QD 1G0XA 3GBLA 1KJ3H 1QBLH 4LLVB 5DJZB 1F6LL 4XVJL 3V6ZA 3VI3F 5I8CA 3CVHH 2BY2A 5FDWB 3FB5B 1U95B 3NIGE 4M7LH 2FWOB 1DSFH 1I9IH 1DN0A 1H0DA 1IM9A 1XF2B 1J0JA 3S5LA 5HYSG 1QKZL 1ED3B 1L9MA 2WAHA 4WUKL 5AZ2L 1LE5A 1NFIA 3JTTB 5EFIA 2DQIH 3ECBA 5I73B 3RWFB 4YPGA 5DRZA 2ADGB 3QHZL 5F3HB 1J1PL 2OI9C 5I17B 5I19H 4I2XA 4PJBB 2F54B 1N0LA 3D0VB 1CFQB 4JN2A 2HFTA 5HDBF 3MMEA 3QIUD 3MZGB 5C0BE 5BVPH 3L3IA 4M7KH 1YYLH 3HNTL 1NC2A 3HNVH 2J8UB 3BQUB 2BMKA 2YA2A 1UWGH 2JK5B 3JV5A 4NN7B 2ARJA 2AEPH 3F7QA 4UUJA 1VA9A 1GGUA 5T5FL 2VXVL 1NDMA 2GQHA 1XMWA 3UXFA 5EU4B 4XP4H 5CILL 5F9JA 1A9BA 1VHPA 1X3DA 4MGXA 2OSLA 4H8WH 4IJ3B 1AQKH 1WIPA 2Y06H 1I8MA 4Y5XC 5KAQG 2A6DB 5FGCB 1B9ZA 4P46D 1JF1A 1DVFB 2HT3D 3O6MH 5JPMB 1IZKA 5T33L 5EUOA 2BHYA 1WJ3A 5L2KA 4OCMC 4ZTPL 5IBTL 3R8QA 5FOBB 2ATKA 3O3AA 3FFCD 3TZVD 4KZDH 4LLUB 3DGGA 3QDJD 4DZ8B 3PDDA 1J0HA 1TZGL 3FT3B 1X5HA 4I8DA 3U0WL 3WIIL 3BISA 5BMFH 4XCYB 1HYSD 3SDCB 1JYVA 1CQKA 1O7SA 3EFFA 4YE4H 3D3VD 4HS8L 4JHBA 1GAFH 2ZUQC 5IFAL 2AJUH 4FRWA 2Q76B 4CAGA 5TJWK 1MJUH 3QQ9C 2G5BA 4O2CA 4QRSB 1RUKH 1UACL 1YYMH 3E6FA 4Y5VB 4O00A 3NA4A 5IQ9B 3JWDH 3X12B 4JVUA 5BV7H 1KB5A 4S1RL 4Q9CA 5GZOC 4LRIC 4MQTB 3MLRH 2VDKL 3DUUA 2DM3A 3RP1A 1VFBA 3PNWA 2AK1H 2ICEB 4HG4J 4BUGA 2EYTB 4X8XA 3SGEH 2XI9A 3L5IA 1BFVL 1IGYB 4NKMB 3L1OH 5JZ7C 5FUCE 2G75B 3BDXA 3DV6A 1A7QH 2SEBB 1G9ML 2EICA 4KVCL 1IQWH 3L95B 1Q9WB 4I3GA 5LCVH 4GRWE 2V9QA 4NN5C 3FFCA 1H15A 3A6BH 4JZOB 3L3KA 1HHIA 1IFHH 1MCWW 3G5YA 4YHYB 3HUJE 1VB9A 1A2YA 3ZHDA 2Y4SA 3WIHA 3F58L 2VB5A 3RGHA 1ZT1A 5CEXA 4N0CD 3C8KB 2DM4A 4KI5C 3C5ZC 1X7QA 1J1OL 2OZ4L 5EORH 1ES0B 5JHDE 1NGQH 4YDKL 4NHCL 3ZT7A 4S2SA 4QXWA 1K4CB 1X5AA 5TFSL 5E8EA 3VRJB 1INQB 1JWSA 4LEOA 3OAZK 3AM8A 4U6TA 4Q74A 1CFVH 4MWFA 3OR7A 5DURB 3BJLA 5J06A 2P47B 2W0LA 3HFMH 4XXCA 3EO1A 4G6MH 1EHLL 3UO1H 3VGGA 1R3HA 2WWMD 5I8OL 4QF1B 2OYPA 4X9FA 3KS0H 1SY6A 4GKNB 1AE6H 2VZUA 2GEEA 3ARWA 2MCPL 1N5AB 3O3DA 4Y19B 4U1KA 1CU4L 4P3DB 4HV8B 5K9JL 2XA3A 2HG5B 2EIDA 3IVKB 3CVHL 5TQ0L 3RL1B 5K9KA 4M9OA 5GRUH 4EI5D 4KUZH 1N4XH 3B3IB 1VGEH 2XZZA 4PJBA 4LFHD 4OKVA 2EC8A 3S35H 2YA1A 5IVXE 3MMEB 4HJ0D 3R8BB 1GOHA 1IKNA 2CLRA 4TUOA 1BAFL 4HFUL 2H2SC 4UQ2A 3P77B 5CMAA 4WUUA 2OL3A 4LDEB 2ITCA 1QRKA 3QDME 4GUPA 5C08A 4R26L 2P8PA 1XGUB 3IDNA 3QQ9D 4YEEA 1ZWIB 1QEWB 1R24B 4EJ1C 4JFXA 3QQ4A 5DMKB 1JZ6A 1I7RA 5CHNB 4ZPVB 5BRZD 3DIFB 1JPTL 1D7FA 5CIPH 4G5ZH 4GRWH 4L4VB 4PS4L 2GAZB 1C16B 3JWDL 1VPOH 5BV7L 1MRDH 4RX4A 2QLVB 2C4XA 3LKPB 4LRIA 3S37H 4X7SL 1A47A 5JIPA 5JLZA 4NT6B 4OZIA 1A1OA 1KPVA 3CIQA 3IXAA 3VXRD 2X1PA 4KDTA 1ZVYA 3BAEH 5EB9A 3VXTA 2JTDA 4KKAC 1RUPL 3CFBA 1JE6A 1I1RA 4OZIF 5D2LF 4Z18A 4LMQI 4EI5A 3H8NA 4QRUA 3UTTE 1N0XH 3PGFH 4O4YL 2OZ4H 1G9MH 1KPRA 2KPNA 4NZUL 1KNOB 1S9XA 1S5HB 4G8GE 3MYJA 3FONA 5KS9F 5MI0C 3HFML 3MNZB 1I8KB 4R0LA 3IT8D 2DLFL 5J8OA 3GSXB 4JHWH 4LVOC 3MJ9L 2NY1D 2W9DL 4XCCL 5DS8B 5E9DD 5CJOH 2HFGL 2Y07H 5DD3L 4PJFB 3FQUB 2PR4H 4AIZA 2C7UB 4G8EB 3C5ZA 4GH7B 4JFDB 4JPKL 3ILPB 5IWLA 3FKUS 2YSSB 3KPQB 4JZNA 3VWJA 1ZGLP 5T3ZL 1IAKA 3T0XA 2Z4QA 4LOUD 2R56H 4WW2F 5DJAB 4UU9A 2YRPA 4S1QL 2ICWI 1G7HB 3O6FC 3GJFB 5E2UL 4Q97A 4NNPL 3VRIB 4IIQB 1Y0LA 1RJYB 4GRMA 1LEGB 3U0PA 4J4PC 3V4PH 1XIWC 2V17L 4PGDA 3F5WB 5HPMA 3KLAA 4PV8A 2EKSB 4Q2ZA 5CEXB 3PL6B 1MCLA 4EZMA 2C1PA 3VH8G 5IB3B 2W65B 4NQED 5IB2A 3FT2B 3DVGA 1K4CA 3JUYA 3T0EE 3P9MA 1T7YA 1NMCB 4R7NB 1HDMB 1J8KA 1WLHA 2X7LA 3MLVL 4HPYH 3GUTB 3D0LA 2YD8A 4P2RB 3MJ8B 3U7YH 4Y88A 1DL7H 3DXAE 5HYSB 1F4YL 1M71A 2BY1A 1HCVA 2ENYA 1IKFH 1Z5LA 4F15C 3DVIA 3AU1A 5IB1A 2BSTA 2K7QA 1QFHA 1QQDA 4MJ6A 5BOPA 4U7MA 5A2FA 4MXQC 3UEZA 4ONHA 4M1CC 5CBEA 4RISL 1T3FA 5DMYA 1WV7T 4QOKA 3DX6B 1JPFB 2JF1A 4ISVA 1IGIL 1A6VH 2P7TA 1KCLA 1KPUA 2FB4H 5KOVC 1C5DB 5T3ZE 3QUZB 5F1KC 1NCWH 3SQOH 4AM0B 2COQA 1BZ9B 3BIAX 3NCEB 3WL9B 5DTFA 1RURL 4NQDE 1SVZA 4G80A 4M3JA 2EC9T 4TNVF 5GISH 1KJVA 1MCQA 5BS0E 2R0KH 5IGXL 1UA6H 2F8VA 1R24A 5ACZB 2R0WH 4YHLL 1IL1B 3S4SG 1I7RB 3PG2A 2HT2C 1ZAGA 3FOMB 3GSOB 3HC0A 4TUJA 4NQTA 1U8IB 4F7TA 5A2IH 5EZIH 2N7BA 3VGEA 5L9DL 3IRPX 1NC4D 1JRHH 3QDGB 5GS0D 1INEH 4L3EA 4KJYB 1MCRA 1CGWA 1AD9B 2DTSA 2RFXB 5LGJA 3JWOH 4JFOB 2Q86B 1Q9LA 1ZA3A 1DSFL 5J12B 1C7TA 5DVKA 1WIUA 4BH7B 1YEEL 2JJUA 4ZUVA 2PN5A 4L9LA 4UV4L 1B6UA 5C0AD 4U6HB 1OAQL 3LRHA 3SDDD 5LGHH 5EWIH 3QUYD 1FFPA 2GHWB 5DFVD 4TVPH 5DDHA 3OAYH 4U33A 1BIIB 3BYTA 4BSWB 2CRYA 5D2NB 1P1ZA 3DMMD 5DD0L 3KPOA 2ZUQB 1BD2B 4DZBA 1JGDA 2MFNA 3BO8A 3WBDA 3TT1L 4ZYKA 1OP5K 2Y9RT 5JW5B 4RAHA 1IM9B 1UM5H 3P4NA 4NCC1 4NO2A 4WTZG 3WFEH 4DKFL 1CZ8H 4DQOL 4LRNH 4N90D 1AO7B 2DQTH 5B38B 5AG9A 4JJHA 3ZT6A 5F9WB 3GMQB 3CLEH 5C6TL 4X80L 2NY2B 3E2HC 5TDNB 3T1WA 2DIJA 2F53D 1FDLL 3ZKXC 12E8L 3L3IB 3N1GC 4G6KL 1B2WH 6FABH 1J1OH 2FCBA 5DEZA 3BQUA 5EORL 5KJRH 3EFDH 4YFLI 2MKLC 1TQCC 5CGYD 5F96L 5B3JE 2MPAL 1OLZA 4QHMB 3K3QA 2QQKH 3TM6A 1RULH 3EOAB 4BSVA 4XBEH 5ALBH 3AY4C 1SJHA 5B21A 5C0AA 3UDWC 1MY7A 4PRHA 3WIIH 3U0WH 1P4IH 2E7BA 4RMUA 4GOSA 4KGJA 4PG2C 3MRQB 4RCAA 1ZLSH 3MXWH 2J6EL 5JOEA 1CD9B 3ILQC 3DX7B 4PJIE 4IRSA 4YQXL 5DJ2B 5H94B 1T2QH 3FRUA 4MNHB 1LILA 2R0LL 2K1MA 1WZKA 4N1CA 3LDBC 1GZPA 3IU3B 5ADPL 5FO9A 3JUZA 1FP5A 3WO4B 5JIIA 2H32H 5I73C 5I71C 1ZGLB 2FD6H 3QJHA 4PLKD 4OLUH 4QRPD 3I9GH 4M7JL 3O4OC 3U0TA 4LLWB 1T7WA 1OM3L 2BNUB 5J0BA 2DQDL 2IMMA 2P5EB 2JCCB 2MWCA 4JKKA 4QTHB 4X4MA 1C5DA 1LP9B 3GJEA 5GRJL 1W72B 3BGFB 2V9TA 3F12A 1A6AB 1G6RL 5I8KL 4WFFD 1MJ8L 1RK1B 3OR7B 5ICZA 3RVTC 4Y16C 3N9GL 3BP4B 2VLKD 4XPGH 3O3BA 1P84J 2MHAA 4JM2F 4I9WD 1KF9B 3QFDB 3U9UA 3TO2B 1MJ7L 4MJ4A 2R0KL 3WSQH 3BN9D 5D1ZD 4MAYB 5AD0A 1S9VB 1U8KA 1CICB 2Y36L 1NCDH 1W0WA 2AAVA 4G8GD 4FP8H 4XI5C 1T6WA 2HWZH 1QRNE 2OQJA 1KC5L 1LO3L 3V0VA 4OKVB 4XHQA 3CLFH 2PW1A 4D0DB 3WMSA 3SGJC 2BOCB 5BXFA 4OI9A 2C4FU 3NIGF 2ZG3A 4JRYD 4BK4A 4DEPB 5E5RB 1YYLL 1FZKA 5ESVA 4OT1H 4U1GB 3R1GL 2LU7A 2NY5C 1XCTA 4L8BB 1EMTH 3T3ME 2OTUA 4JHWL 5A43C 2GJZB 5EO9B 2FX7H 4QEGA 4FN0A 4U49A 3SDYH 4NJ9L 1KELH 1AC6A 1MIEL 4ZFZB 3ZE2F 1IC4H 1MWAL 4DKDC 4WU7A 5C0DA 4XRCA 1MY5A 1I85A 1LO5A 3CZFB 5H35B 3RPKA 4P5TA 3G5VA 3DOSA 4PJEB 4C55A 3AY4A 1LO4L 1JHKH 5IW6A 2OM5A 3DO7A 3SDXE 3K8MA 4JY4B 3OKKB 4NO0B 4M5ZH 2ARJB 2ZSWA 3BKCH 1FNSH 3GKWL 2V2WA 4Y0GA 3GBNL 2VSCA 3D2UA 3BN3B 2WWKT 5E8DH 1DBBL 5IV2B 4UBDC 3TO4C 4MAUL 3U48A 3WS6C 5DUMH 1ORQB 5ETUB 2EYTA 1QFOA 4C56E 1JFQH 3IDIA 4HCRH 4MCYA 1MLBA 4L5FH 4G6JH 2C1OA 1IGYA 5JUEL 4X6DB 3HR5B 3GJFH 4L3EE 3TLRA 5SWQA 4CMMA 3PGDA 1SYSA 1UKTA 5GRVK 3P4MB 1M05A 1UWXK 4PREB 2QSCH 4QYOA 1XGUA 4G8FA 1LWRA 1N26A 1JF6A 4X9BA 5DI8A 2BZDA 2DQHL 2XXMB 4LDOB 4Y4FC 3IJHA 1CVSC 4LQFH 4PJXB 1WZ1H 2KQNA 1HHIB 5HYJD 1TTFA 1TVHB 2G9HB 5EO1B 4PJ8D 5HHOD 1BX2B 1KN2L 4U0RC 1NCDL 4ODHL 2PYEB 4JKWA 3HAEH 4YFLF 3RZWA 4NGHL 4U3XA 2CRZA 2F74A 2UWEE 4JFYA 2A2QT 4NQDD 1ZGLA 1CLCA 3V6OA 1AKJD 3E6HB 2APWA 2DQGH 3N50A 5D96C 5C07E 3MR9A 5GSVB 2FX8L 3O6FA 2NTFA 5IT2L 4OLWL 5EG6C 1LEGA 4OGYL 4I0PC 4QF1A 2Z31C 1CGTA 4Z7VA 3HG1A 3EYQC 3V5KA 3KPLA 4OCSL 2X4QB 3MLZH 4YBLB 2CDGB 1MRCL 5ISZD 3FONB 4PJDA 4NPYB 4DWHA 1TZGH 2PF6A 4R90H 1EFXA 5I1LA 5L88L 1NBZB 4UAOB 3R1GH 1A1NB 1I3GL 4GAYB 3U6RB 5HYJA 1EEZA 2PTUA 5ID0B 3ALPA 1EV2E 4ALAH 3RKPA 2VDNH 1YN7B 1SJVA 5IHZB 3CXDH 3BP6B 1KJ2L 5E08L 3SKNA 2BSSB 2GTZA 3UYRL 1BZ7B 3X3FL 4NNYA 1DJSA 5C0AE 4PJBE 5KBNC 3WFZA 5C0JA 4LEOB 2EO9A 3ZSSA 4HPYL 2AJVH 4Q6IB 3O45A 2OL3L 3OKLA 2FIKB 1D9KD 3LV3B 1AKJA 1JFQL 5CGTA 4GRMB 2HLAA 3O6FD 1IKNC 3RA7H 3PJSB 4JFFB 2RIKA 4RGOH 3HG1D 1LE5B 5JIKA 5JHLL 1KLGA 1QLEH 5SWSD 4ZAKC 3KPRE 4U1JB 3MCKA 4XCFH 1MFAL 5GRXG 1ZHBB 4XCEA 3OXSA 1S7WB 2O5ZL 3NBNA 3QO1B 5DEGB 1NUGA 5F89A 4PJCE 4M1DH 3F58H 2P1YA 4ZFGL 1BGXH 2GK0A 3KJ4B 1TZIB 5L8LB 3WFEL 3DX9A 3M07A 1I8IA 3Q5YA 4FXLA 3KYNA 2BHUA 5J13C 2CKBB 5GJSH 5D70L 1WFTA 1LO0L 4YLQT 2IH1A 5DJCA 4YDJA 4ZSOA 3UPAA 3ARDC 3MLTA 1GH7A 3N85H 5IW1B 1MELA 2P46B 4K8RC 1FRGL 3BQUC 3TT3H 1CBVL 1K8IB 4HW6A 2DAVA 3WJJA 1QR1A 3CFIC 3NPSC 4HKXA 5F96H 1FJ1A 5KG9A 1N7MH 1UXWB 4XGZB 4KJQC 1DR9A 1ACYH 4HJJL 1FFPB 4EI6A 5L0QB 1H3XA 3ZKSD 3UJIL 3G6JE 4HCRL 3E1F1 3PWJA 5FYLE 5GPRA 1F4XH 1WUNT 3B6SB 2R4SL 2C3VB 3VW3L 2QSCL 4FXGA 2EECA 5DZNA 3MV01 3MV8B 5I1IL 4LVHC 4G7YH 4U1HA 1KPRB 4HZLA 1EUUA 3LMJL 3CZFA 1FIEA 4F3FA 5H35A 3ARXA 4OM1L 3PL6A 1MVUB 2XZQL 3Q1SH 4MQXC 1QTYT 3LKSB 4K94L 4KJYA 5D5ME 3UYOD 4OCRH 3V5HA 4KQ4L 5DQ9B 4V1DD 4ZDHB 4JEGB 2YMXL 3O6FB 4Z7UB 2NTFB 3DETC 3RTQD 1JZ3A 4E41E 4I9WE 4WI7A 3IDXH 3CVHA 4NFCA 2IQ9L 3OZ9L 2R1WA 3QO0B 1S7UA 4XTRD 1R3IH 2HTKD 2D9QB 4QHMA 1LEIB 1MFCH 3G6DH 4H26B 3ILPA 1I1AA 4L4VD 5J3HC 3WIFB 4EIZC 4NP4L 4XWGH 2QEJA 2M26A 2B4CH 4QRRB 2APXA 5JA9A 4OKDA 2DM7A 2C5DC 1NCAH 3DXAA 1M7IA 3LPGA 5F1IA 1RIVH 4HWNA 3V52L 3ZHLA 4OJFH 3SDCA 4PJGA 5CUSH 4PG2A 2IADA 1NDGB 4ONGH 5AG8A 3DX6A 1TVBB 3EYVB 5CILH 3U0PB 2X4TA 1YEHL 1N8ZA 3D85D 4F37K 1IKFL 4JO2L 3G9AB 5C0ND 1G84A 4DGYL 5IROC 1SY6L 3BGFC 3AUVA 3CC5A 1KUMA 3QFJE 2WQRA 4Q6IA 5D1XC 2V7NA 4PY7A 4OIAA 4J4PD 2VLJA 4UZGA 2H2PC 2KH2B 3IGAB 4B0MM 2RHEA 1RAMA 3LH2L 3SDAB 1OT2A 1QHPA 3HZYB 4PTUA 3MJ8A 3I6KA 3IFOA 3RTQA 5L2KD 1TJHH 4FTVA 4NQEE 3PWPD 2GUOA 2ZCLH 4DVRH 5MEQB 2A6KB 3MRGA 3OJDA 3WUWG 2A77H 4PRPA 5GS3A 3QHTC 5ICXB 4LOUC 2QBWA 2RJMA 5I15L 1K8DA 3V6OE 1H3GA 2H8PA 2R4SH 3JWOC 3EDEA 4P2OA 5GRYA 5T3XL 2GFBA 3SDYL 3V95A 2EXWC 3WN5A 3LDBB 5B22A 3MV9D 1YYML 1F97A 2ZUYA 2GTWA 3DXAD 1E27A 1A9EB 1EBAA 5CEYA 4M8VA 1ZT1B 4FFVD 3FRUB 4YK4B 4R7DA 3SE4A 4WFEE 5E8OB 1JWMB 2GJ6B 3FO2A 2AK1L 3HA0A 2BNQD 1S5IL 3X13B 4ELMA 2NW3B 4A6YL 5ESQB 5EU3B 1GC1H 4JREB 4F7CA 1A14L 2FO4A 4JHAL 1V7NL 4M48H 2HT4D 2Y7QB 2NY3B 1WBYB 2VDOL 5HYJE 3IS1X 1C16A 2JE8A 1IL1A 3T3PE 3ULUC 3EJZD 1F4YH 3QZWG 2YBRB 3N1PC 4D94A 2ZCKL 4X4ZA 4QWWD 2NY2C 2P49B 3E2HB 4Y4KA 5FAAA 4XCNA 2D7NA 4DJMA 1NCUA 3U1SH 3U36B 1RUMH 4N8PA 4QWWC 1Y18B 1D5IH 4Q0XL 4R97B 2EZ0C 1EXUA 1E6OH 4TULH 4PRPD 4I13B 1QFUL 1BQSA 5E00A 4QXTB 4S0TD 1JHTB 1A7BA 3P0VL 1MCDA 1PX3A 2R0ZH 1XR9B 1YY9D 4IRJA 5KSAA 1XCQA 3UO1L 3ALXA 2IBZY 2H26B 4NQVA 25C8H 1CWVA 1OAZL 5I18L 5E1AA 1CG9A 3DNKA 2BXZA 1N64H 1BHGA 5FK9A 4D0BB 2RR3A 3NN8B 4NRYA 4OFYD 5GISL 5ISZE 3QXVA 4H0HB 1Q8MA 2F5BL 5IT2H 2AEIT 3DVFA 1D5MA 1CXIA 3GM8A 2BNQA 2PTTB 4ODVH 4PG9A 4K71B 1S9WB 5JNYB 5L6YH 1OB1B 3I2CL 3MACL 4BZ1L 2DTML 5SWQB 1G0YR 3BEWA 4YXHL 5DGQA 3FN9A 4KK8C 2CLVB 2HJKB 3MNVB 4OFVA 1S78C 3MRHB 3TPUB 2EDXA 3TN0C 1F8TH 4EVNB 4MAUH 1F3JA 3DX8A 3FB7A 3MLWH 4ENED 2VLLA 2ZUUA 3EYFB 4PJIB 3IDMB 1P84K 2QADB 4P3WA 1F42A 4GG6A 5KVGL 4OD3H 1WTLA 5C08D 1ZGLM 1GGCH 4HWBL 1D5BA 1CI5A 2PW2A 2B1HH 3O2WH 2WM0A 4P5MA 1KB9K 1YJDH 1XGPA 2A9NL 3VXSB 5HDQL 4I0KA 1KJ3L 5C0AB 1LDPH 3D2UB 2F53E 2H2SD 3WNPA 5M7QA 4N0YH 3LSOB 3RX5A 2R2EA 1I9IL 3GMNA 1HNFA 4RX4D 1AGFB 1FZJA 1IC5H 3SDAA 1PKQB 1UM5L 4U6VL 2K9UA 3MRNA 5E94B 2WUCL 3NCYP 3MA9H 1SYVB 3V6ZB 4GAGL 3KPNB 2E9JA 1IGTB 3C9NB 4XTRC 1WCBA 4B5EA 2AXJA 3ULVD 2B4CC 3SKOB 3RU8L 2QKIB 2EIBA 5EC2B 4BFBD 4PRBA 3GIZL 1NAMA 1FHGA 1ZANH 4BZ2L 15C8H 2H2PD 4S10A 1RHHA 5FA3A 4U1LA 2X4RB 5BS0B 1L7IH 3HNVL 1KCSH 1GGBH 4BKLA 5DK3A 3UJTH 3HRZA 1YQVL 5IHZA 3ULVF 2UWEB 1M6OA 1CD1B 5D70H 4N0UE 3MRFB 4MLIA 3CSGA 3WSQL 3DV4B 4M6OH 5MHSD 1HSAA 3BN9C 2FJFB 5DD5L 4WIQA 4X5WB 2CGRL 1XF5A 3C5ZD 3MC0A 3C6SA 1KGCE 2LV4A 4NBYB 1S7RA 1VDGA 3U7AA 5C9KA 1K5NA 4J7RA 4P9HL 3BHBA 2WIMA 4Y2DC 1IEBB 4KJQD 1Y6NR 2BVUA 4L3EB 4HAFA 4WFFE 3QEUA 4IOSD 5DMGC 2EC9U 2CDFB 1OAYL 4NWUL 1J0KA 2AP2A 2DQUL 2HJLB 5GGVH 3QDJB 4Y2DB 1JYXA 4U1GC 4NQXA 1HHHA 2MQCA 5F7NC 1OM3H 1L7TL 1R3LB 4LVNC 1F5WA 5F6HI 5KVGH 2ADIB 2KKQA 3RVUD 4Y16A 4F80A 1T04A 1KBGH 1CL7H 3FT3A 3L7EB 2OTWB 2VERN 1T66C 3PDOA 3QUMH 5DDHB 4RRPG 5FM8A 3V7MA 1K2DB 4HJGA 4K3DH 3F6IA 1BVZA 1T22A 4D3CH 1OAXL 4EN3C 3RQ3A 3P11L 1S7XA 3CFCL 3Q6GL 1V3KA 2GITA 2W0FB 4JFFE 4POZC 4HKZB 4JO4H 3RVVC 5DUML 1XGRB 5B39B 1DZBA 3GBML 4BM7A 3WFBL 4H25B 1D3CA 2E7HA 4HK0A 3PNWB 4I18B 1FO0B 1WAAE 4K3JH 2HTKC 2HWZL 3PHQA 4PD4K 4HEME 4HQQL 3MBED 4RRPA 1AGBA 1RZ7L 3MSPA 4WCYH 2R4RH 2X1XR 2NXYD 3ZYJA 4DZ8A 1BFVH 3GNMH 4F8TA 4IIQC 5ID1B 3CH1B 3HS0B 3VI4E 4G9DB 4X7EC 3F7VB 5EUKA 1KXVC 2D7PA 2GK0B 1I7TB 5FHBH 3RZCD 1H15B 3TIEA 4P57A 5IFHH 4QT5A 2HMID 1KIRA 4OTXH 5IROA 3T8XA 4JQVA 4NQSB 2VDQL 1D5BB 3EGSB 4DKEH 1CG9B 4PP1D 2PYFA 4GBXB 5I1EH 4CU6A 1TITA 4WTWA 1II4E 3TH4T 2OCFD 3SGEI 1EGJA 3V79C 1ZS8B 4IRSB 4JRXE 2BY0A 3EO0B 2X4PB 3QIBD 2FX9L 5T3XD 1AGFA 5F7KC 1L4IA 4L3ED 2Y25A 3FFDA 3EDDA 1UQSA 1AD0B 2VJXA 4HKBA 2R29H 3UPRB 3BEWB 4RBPH 5CP7B 1IEAA 2Z91B 1AE6L 4OQTH 3J7HA 4KVNH 2D0HA 2F9BT 3HMXL 3LRSA 5HHOE 3TJHD 5IHLB 4R8WL 4FXGB 1ZA6B 3MLSL 2IPTH 3RU8H 1DBBH 2CXGA 4P23A 4NWUH 4PUBL 1RZKL 2ZUSA 2A73B 3BGMB 2B8OT 5J13B 3TA3A 1A4KB 3VGHA 3DSFL 2DWEA 2BJMH 5HHVL 4PJ7A 3M45A 1ULVA 1MOEA 2V7NB 4G9FD 4PY7B 5FHAL 2XFXB 1WZ1L 1Z9LA 4Y4FD 3ZMRA 4XNYH 2C3XA 4X98B 4DQOH 1F90H 2NXZB 1M7DA 4FOMA 4GG6E 4GAYA 2A6KA 1CLYH 3W81A 3KYNB 4JQIH 5D2NC 1NCTA 3MRNB 5E94A 5BZDB 3BP6A 4OZ4B 4JR9H 5AYUL 5FUZL 3CFDA 1BEYL 4XAWL 2E9WA 4F57H 1Q9WA 3C6LB 4YHKL 4KI5F 1ACZA 3WN5C 2N7AA 1HHHB 4M1CD 4KMTH 3QNXB 1GRWA 1MRFL 1NAMB 1G7JB 1RJZB 3BQUD 3DI2B 2ARWA 5CEZH 4R3SA 4AG4L 5IJVB 4XC3H 4HWEH 3TBYA 3K2UH 1CE1H 3R06B 4ZSOE 3CK0H 5HYQA 5ILTH 4ZS6C 4L8BA 2VXVH 4RDQF 4UQ2B 3QDMB 3MRCA 4M61A 2LVEA 2AK4E 1DBAL 2XA8L 1U8QB 1JGVH 3CDFA 5DR5H 3B9KB 4HH8A 3U2SA 4CKVX 1SEBA 1S5HA 3MRLB 4PRNB 4Z9KB 5DK0B 2BCKB 3IFNH 3O41B 1KB5H 1SMAA 4PJCF 1XF5B 5GGRY 1FL5A 3IF1A 4MD0A 3ZT5A 3TCLB 4KROB 3NIDF 5HHQB 3BPNB 4PYGA 4HZLB 5E6IC 3IJYB 3O8XD 5ITBH 3LEVH 5DQDH 3NABL 3T77A 4IRZH 2VN4A 2IANA 3QISA 3HAEA 2W92A 1EK3A 1WF5A 3GBMH 1CE6A 4P48A 4LCYB 4M1GL 3GMRA 1G7MB 1LNUB 3FQTA 3IDIB 4I1NB 2JJWA 1U58B 3D39A 4LBEA 4OD3L 4XH2A 2XZAH 2O5XH 3EHBC 4W68A 2Z8WC 1QPXA 3VXSD 4HKXB 4PREA 5I30H 2Q8BL 4JQXC 5C6WH 2VZ1A 2OK0L 2H1PL 2H6PB 4FQHA 4R8WH 1SM3L 4PRIB 4MA8L 3AXLB 5IESL 3MLRL 4YUEL 1MCJA 4LSDA 4P2RD 1TMCB 2O26U 5T1KA 2L4OA 3FN3A 4GG8B 2NPLX 4I4WA 3JBG7 4CW1B 5HHMB 4Y5VC 3RBSA 4XPBH 3BESR 5JMOC 2E27H 2R23B 3BD5A 4KAQH 4OSUH 5F7FA 3PHSA 1UQSB 1BJ8A 1VGKB 1YEDB 3WKNA 3T65A 3SJVD 1YMMD 4YPGB 3TGXA 1B0WA 5ANMA 3QQNA 5GRVL 5JQHC 1NL0H 4H20L 3D87B 2E7LC 1U8HB 4QNPE 4FQLL 4PLJC 1KGCD 1TJGL 4O58L 3GSRB 1E6JL 2VQTA 4XI5D 3G6JF 4R0LC 1X5FA 2MNUA 4N5EC 5E24E 1KELL 1RD6A 1LK2A 2LU3A 5D7IE 2GSGA 4L29B 3VXSA 1GL4B 3WIFA 4KTEL 3LKNB 2CR3A 4KRMB 3T0WA 4GBXA 1J05A 2XN9D 5F7WC 5FA4A 1CE1L 4RAVA 4E41D 1QA9A 4Y2OA 3SQOL 3U6RA 2CMRH 4KU1A 3GUTA 2V7HA 5EU6D 3P0YL 2FEEL 4JY5H 2UUDH 4JE4B 3VFOB 5E8DL 5EOTA 1BBJA 5ALCL 3GSVA 2FECI 4UNTA 3LEYH 3H7LA 3EOTL 3RZCC 4GW5B 1GOGA 4BQ9A 3S35L 4HFWA 5JPNB 5C0CA 2ICWA 3MRPA 4OFIA 2YMXH 7FABL 1TQBB 4HIHA 4Z6AT 5I2IA 1RU9H 5SX5K 3UTOA 5D6DA 3E6FB 1OSZA 2XTJB 1JNLH 1T0MA 3NCFB 4M8QB 4G6FD 3SOBL 3DMMB 4NC1E 5TF1L 1DANU 4MJIE 1B0RA 3H42H 3VFWB 2HN7B 3D0VA 1IM3A 5I8EB 3WHE1 2XN9A 1AGEB 2NYYD 4Y8DC 2XA8H 1T20B 3UTSD 3IF1B 5FGBA 4LAJH 5BO1H 5CFHA 4BK5A 4JQXA 3FTGB 3VFMA 4DKFH 3JV6B 5EU6A 4CVWA 1P2CA 2AEWA 2BFVH 2D4FA 3QDGE 2CDFA 4OGYH 2H32A 3IJSB 3OKDB 4ODHH 5L0QC 1U3YA 4WUUE 3QWRD 3S34H 2V2XA 3VD7A 2UV3A 5IMOB 1D5IL 4Q0XH 2FLRT 1KENL 3OG4B 2FJHA 4WGWB 1Z0NA 3P9LA 3QIUA 3W5NA 3VI4F 2ZWLT 4ESKA 4PGJA 3LHPL 1NC2D 3STLB 2CSPA 3CMGA 3VFSA 3HI6L 2NXYC 1WBYA 3QUKA 4YHOL 1RJZA 1CF8L 1AQDB 3CGTA 4Z8FH 4HT1H 1V5JA 2X1OA 3MRFA 1AFVH 3G5ZA 2BNQE 1I1CA 2DLFH 1EFXD 4N9OB 1ROWA 3MOQA 3MNWA 5DTFB 3S8WA 4NUGH 1YEIH 3MRLA 4PRNA 1AXIB 3BKJH 5ADOL 4Z7VF 3O4LB 3KWWA 3N0PB 3S36X 3RVTD 2A83A 4K3DL 1BLNA 1O7VA 1CFSB 4DOHE 5IEHA 3KJ4C 4JG0H 1OGAD 5GRWA 3L7FB 5DFTA 1VGKA 4H1LB 4PP2B 2D2OA 3TBWB 1B3JA 1CR9H 2B2XL 4G9FE 1GHFH 5ID1A 1CE6B 2WIIA 1D5MB 3VXUB 5C0IA 4CVZA 2H9GA 2X6MA 2DWDA 1KCUH 3LEYL 2VAJA 4B7IA 1WVZA 3D9AH 4PJ5B 2YPVL 3MA7B 4J12A 1FGVH 3ULVC 2XV6B 1JF1B 1EGJL 3CU7A 4M7LT 1YC8A 4O51A 3MRIB 1I9RH 5EZJB 4YGVB 3U9PL 1VEPA 4LHUB 1I9JL 3THMH 2A1WL 3RAJL 2AKRA 1VEMA 3HPJA 1T0NB 3OJVC 5IR1A 4UTBH 3ARFD 2Y6SC 2VLLB 3EYVA 8FABB 3VWKD 1VFMA 1BM3L 2YXFA 5KSBB 4RIRA 1P4IL 2V5SA 3STZB 3FZUD 1N64L 3BXNB 3RY4A 3FQNA 5M94B 5IKCB 4QCIA 1UENA 3IDGA 4Z0XB 1MCFA 3X11B 5DJ6A 4KRNA 4UU9B 1REIA 3PV7A 4O2CB 4QRSA 1OY3B 3W9DA 1IZJA 5C07B 4L8CA 3L6FB 3NA9L 1T89C 3QPQD 4OB5L 4UB0L 4ODXB 3CVHB 5GS2D 3PXHA 2NLJA 1N5AA 5T3ZH 2NY5H 1G9NC 2Y23A 5C7XL 1UWEH 1HZHH 2NY0B 4KV5E 2HFFA 4Y1AB 5BQ7A 1EEQA 3VD9A 2A6JA 2HLFD 2MOVA 2NX5B 3P9MB 3WNLA 5ANME 2D3VA 3ARUA 2ZOLB 4GKSB 1EERB 2IFGA 1FVCB 4E5XB 1A3RL 3SCMD 1AO7E 3OHXA 4WW2A 4PUBH 1T1XA 1HKLH 4Z7QE 1M7DB 3QWOA 4Y5XB 3DMMC 3ARFA 1MJJA 3VFGL 1Z2KA 3PIQA 3VW3H 2XPGB 4LLMA 4JG0L 5D7KE 3ULVE 5TE7H 1IMHC 3LRGA 4WUUB 3K4DA 1NBYB 3G08B 4ZQKA 1KTLB 1OTTD 3PWUB 1K2DA 4Z0BL 1LEKB 3MLXL 1UYWH 4LGPB 1BFSA 5SWZD 4WEBH 1S3KL 4MB5A 1CT8B 1ZHLA 4OQ1A 1F6AA 3PWLA 1A7PH 4PJ5D 3OPZH 4OFKA 4AH2B 3K8LA 3JTSA 1K4DB 2EKSA 3GBNH 4GAGH 4Q2ZB 4CU7A 5IBUG 4QTIH 3B5HA 4PRID 2GJJA 5IB3A 4KVCH 1YNLL 1MAML 1YNTA 4PV9A 3RVVD 1I9JH 1C5BH 4JO1H 4QXGL 4QRRD 3HI5H 4Y5YA 1YMME 3TO4B 2MMXA 5D7IF 2M2DA 4J23A 4IOIB 1SYSB 4NBZB 1SBBA 3D85A 3CXHK 2NY1C 3L3GA 3O3BB 1U8IA 1S8DB 4WW1A 5C0RL 4BQ6A 2VYRE 4IOFD 1T20A 1J0IA 4D0CA 1CZ8L 5C09A 3KWWB 1AHWA 5D1QA 1RURH 3RIFK 1SBSL 2VZOA 1YEHH 4UTBL 4U0RB 1UJ3C 2W07A 1TJIL 2Z93B 3AS3A 2CDEA 2I26N 5EU3A 1KB5L 2V2WB 4MHHI 4MJIA 4P59L 5C0BB 1B0GB 5DS8A 4CN6A 3UYPA 3MROA 4GQ9L 4XMPH 3CDGA 3BW9B 5E56A 1U92A 5DURD 5TE6L 4NO0D 4ISVB 1IGCH 5C71A 3HZVA 3UCRA 2VXSL 4HUNB 1WZLA 2UWEF 3KHQA 4P2OD 2DBJA 4GRWF 1S7QA 4NZTH 3RWHA 3GGWB 4HIXL 4PB9H 4E41B 4R90L 1H3TA 5I1GL 4KKLD 5HPOA 3IFPA 3I75A 5CEZE 1P1ZB 1I3RA 5FGBC 1F11B 5J57B 2CMRL 3U46B 4LP4A 1BJMA 2XZAL 1P69B 1MRCH 1Y0LB 2EYSA 3QXWA 3VA6A 1VKXB 3RI5F 4APQC 5I1LB 1FNHA 4E0RA 4PGEB 4KI5D 5ENWB 1FYTD 5HYJB 3FT2A 2OR9L 5F71A 3S3SA 3WEXB 4HJ0C 3W2DH 1FE8H 1BPVA 1Q0XL 5LJYH 4OD2A 4OD1L 2QL1A 4DAGH 2I07A 3C08H 4MJID 3FQRB 4AEHL 1MPAL 3HZMB 3QIWC 4NNPH 2WIIB 5C3TA 2LTQC 4M48L 4OZFA 3VDBA 2YD1A 2DMKA 1JVKA 4PJHB 4HGWB 3HE6D 4TRPH 2DQTL 4M02A 1RZJL 2OR7A 1PYWA 4I3RL 4MX7B 5E6IB 4PBVC 3RA7L 4MMZC 2IPKA 3RWEB 4KROC 1HKFA 2WWMC 3VXME 5KSUB 1CYGA 4XCYA 3A67L 1FFNA 1QPPA 1OCWH 3G04B 3NGBB 5D7JD 4HH9B 1CFTB 2C4FT 2FHCA 4YDLC 5TE4H 2W9EL 1NBYA 2JB6A 4IS6B 1NLBH 1KJ2A 3LQAC 3RWGA 3IAPA 3RWDB 4CBPA 1ZLSL 3RVUC 4FA8A 1G9NL 4KQ3L 2WMPA 4QOKD 1MCSA 2KUTA 4LHUG 4X98A 4AJ0A 2QSTA 3O6LL 4X6DE 3CMOL 3L5WB 2EDWA 2MQ0A 3A0OA 1JPSL 5HDBE 5CCKH 3ARQA 1CDYA 1P7HL 2FR4A 1EEUA 3JV4A 4AL8L 3KPSA 3C60C 5ERWB 5K9OA 5DHXB 2LU4A 3AU1B 3HE7C 4KHTH 3HE6A 4H8WC 2IANB 3OXRB 3S5LG 5DD6A 2DLHA 4GS7B 3WIHH 1QFWM 1B90A 3SGDI 1GZQA 1H9VA 4KZDL 4QHNB 3QUXA 1R3JA 5IF0A 1IAIH 1Q9LB 1FNFA 1RZKH 3FB6A 3M8OL 3IFNL 2Q7NA 4JPWH 5CBAA 3L7EA 2IPTL 3FOLB 5EOCH 1S8DA 4PJAE 5C08B 1TETL 4A6YB 43C9A 5HHXH 4ZS7L 2DQCL 5DJ8A 2GITB 2E6QA 4OCYL 5D93C 1CFNB 4W4OC 1WFOA 1S7RB 3MX0A 3S4SB 3WFDL 1RVFL 3OKLB 2DJUA 4X6CB 1XGRA 5B39A 1X4YA 3BD4A 2OXGA 2FSEA 3WHXA 1DQLH 5DRWA 1ZANL 1G6RA 2A0LC 3N85L 5IMLA 1LP9A 2WWKO 1EO7A 4AH2A 1A1OB 1KPVB 2N1KA 5HHNB 4Z7WE 1AGBB 4JVWA 1S7UB 3THML 1U8MB 4M6ML 3F6LA 5E2TL 3LHPH 3PV6B 3DMMA 4YBLC 4A2LA 3PWJB 3HS0A 3F7VA 1HQRA 1BOGB 1BVKA 4IRSC 3BSZH 4TRPL 4D8PB 4POUB 4K8RD 1VKXA 2FIRT 5E0QA 4JANB 2LQRA 5J6HA 3T0AA 3VMNA 3DO7B 4MAYA 4GW4A 3AS2A 2FLBT 1EMTL 4ZUVB 2P45B 5D7JC 3AM8C 1NFDB 1W0YT 2IBBA 2L0DA 2ITCB 4P9HH 3D25B 4RGMB 3VFTB 3FN0H 3RWJB 5L8KB 1U3HC 1A0QL 3L5XL 2YRLA 5IB4B 1RPQA 3LPWA 4LAQH 1T03L 2Z0BA 1PJ9A 4O02L 4JRXB 4S1SL 3FO0L 2DF3A 4L8SB 3CDGB 4IMLB 4K7FA 3OJ2C 5CS7A 1WSST 5GHWH 1MCWM 3QI9A 1FZKB 1LMKA 5ESVB 4HAGA 3S88L 2FDBP 3WXVL 3PUCA 3G5ZB 3VE0A 5KN5A 1IEAB 2Z91A 3RTQB 1A3LL 4PRHD 1YEJH 4OGXL 1D6VH 4MDJB 3V4UH 1PZ5B 3VFPA 1W8NA 5D1XA 1H8OA 4N8CL 5EOCL 4M5YH 4DN3L 3D9AL 3GI8L 4PJCB 1JL8A 4HD9A 4JFZL 1FNLA 2O5XL 4M6AA 3EBAA 5AWNL 2X89D 5JO5B 5EIVA 4S1DD 3P4OB 3FQXA 3MREA 1U42A 3U4EA 4CNIA 3NPZB 3LKSA 4QRRE 1A5FH 2YD4A 4NYLA 3VWKC 4GBXC 4G8EA 1IM3B 2JCCE 5ESAA 2R1XA 3P9WB 1M71B 3HUJB 3SGKA 5I1DA 4Q9RH 3C2AL 4ODWA 4QTIL 5EN2A 1AJ7L 2WUBL 2FO4B 3RX7A 3MA7A 4JFDE 5FCUL 4FTVB 1S9VA 2EYRB 3QUZC 4Z77B 1AGCB 3SY0B 4KAQL 1RIHH 3DARA 4OZIE 1DVFA 5JPMA 2VLKA 5DI8B 4FQCL 3J8F7 2QHLA 1FLTX 3HI1A 5EU6E 3RZCA 4U1MB 2X10A 3H9HA 4Y5XA 5D1XD 1UM6L 2DLIA 4JM2C 2YWZA 3QUKB 4XCCH 5IVZA 3ARBB 4F33B 3Q6FA 2GJ6E 3ZLQC 3EOBA 3FQNB 3V6OC 4G8GA 5E8OA 4L3CA 2FECL 5J1SC 2GCYB 3I6LE 3MGOA 1T03H 3NOIA 3T09A 3H7BB 1IILE 3S3JA 4LF3B 5ECJE 4P4KD 4XBGA 5HVGB 5HHXL 1S9KC 2DL9A 4JRYA 5F7EH 4PJ9C 4GFTB 3L3HB 3I6GB 4RMQA 3WHXB 1YUHB 5CJBA 5KVDL 3L5XH 5I9QC 3HKFA 3KPMA 4LAQL 4FG6C 3T0VA 1WFUA 5AUMA 4WWKB 3MFFB 5MEQA 4WHTB 3LKOA 1KTDB 1CXLA 4LMQE 1I4FB 2D4DA 4LPXA 5BMFL 3EYSH 2FHFA 1CGXA 1VSCA 3VMOA 3UTSE 3ET9F 4I5BB 4KHXH 4PJHE 2FJGB 5EZOH 5FUOL 4QRPB 3KYKH 4PGBA 4H1LH 2GTWB 5HYQB 5EOQL 1U6AH 5D72L 1G6VK 3MLWL 1MFNA 4OIIL 4HUXA 2B1AH 3U82B 4UUJB 3MQIA 1DBML 4ZOAA 5C0BA 1G7QA 3EYOB 4XC1H 3KPOB 2QADC 1RZFH 2IFFH 4I4WB 3IJHB 4HIJA 2DMBA 4CMHB 2P5WE 3VGAC 4P4KA 4PJAA 4GO6B 2IAMC 4HUUB 3B8SA 4Y19E 3QG6B 5MI0B 5IBUB 4NQCB 1ORSB 4NP4H 4XWGL 3RWHB 1XGQB 3TEUA 1KCUL 3IETA 4Z7OF 5I6XC 3EYQD 1A4JA 1T7XA 5DC4B 5DO2D 4HWEL 4ZO9A 1QUNA 1VADB 1TPXC 5JDSA 2BVYA 3UZVB 2BRRL 1L7IL 3MV7B 4DOHB 5I0DA 3RNKB 2YK1H 3CCHB 1CD0A 3RTQC 5IBLC 4BSJA 2R15A 3D85B 4QY8B 4OZHB 5F1NB 4PJDF 2E9BA 1IEHA 4NM4L 3DX9B 1X5JA 4U4BA 3EOAA 2Q7YA 5CSZB 1OGAE 3UJIH 3MCG1 2HVJA 4R4FH 2R2BB 1MHHB 3QEHA 3CK0L 3C5JA 4MD5A 3K74B 3DUHA 3PQYA 5I8OH 4X99A 1T89A 3QPXL 5IFAH 1IC4L 4Z78A 1QRNB 4NN6C 1EFXB 43CAB 1G7LB 5MENB 4PP1C 1QEWA 3LQMA 4GS7C 3KXFB 3DUUB 2VL5B 3O0RL 3TNNA 4CW1A 2A9MH 1BQLL 1MFEH 1T21B 3O2VL 1E4XL 4G6AD 2HRPH 4YR6B 4ZUUB 1WWWX 2ADFH 2NW2B 3VG0H 5E8NB 4HX1B 1AO7A 1LO2L 1ZT4A 2C26A 4ONOA 5CD5D 1FL6B 3H0TB 2ZJSL 4KZEL 3I75B 4N0RA 1HH6A 2X4SB 2V5RA 3MNVA 5JPNA 5E2VH 2AQ3A 4FFYH 1SJEB 1ZLUH 1AP2A 1L0XA 1KLUA 3CSPA 4L4TD 3VXTB 3JZ7A 2YPLB 2FL5A 2OP4L 4HFUH 1R3IL 1HKLL 4C83B 2X4OA 1P4BH 4U1HB 1R3LA 3JWDC 5BV7C 3EJYD 1MHPH 1MWAA 3WDHA 4FXKA 2NNAA 3LD8B 3RWGB 2HFFB 4K71C 2FJFA 1UEYA 3QUYB 1AGDB 3VJ6A 1CIDA 4WHCA 3VH8A 1JTOA 2HKHH 1CL7L 3PQYD 3QCVH 2JIXD 5FEBA 1UCBH 4OUUA 2W1NA 4KJPC 4HGKC 3MRDA 1HE7A 2HLFC 2YS4A 5GZNC 3DRTB 5FGCE 1YMMA 1HNGA 1YZZA 1JPST 1JTPA 1I8LA 4MNQB 5T1LA 4MX7A 1YPZB 4HPOL 5JHLH 2X09A 3EFDL 1AO7D 1QSVA 5IFJB 3MLYH 4KJWD 1WAAF 1I4FA 1XFPA 5FIEA 2QR0B 3HE7B 3LV3A 2F53B 4ZFFB 4X80H 4BQBA 2BERA 5TPWL 4L4TA 2Z8RA 2XXCB 4DKEL 5EZLA 5HYIA 4Y2DD 5H8DA 1DQQA 2PETA 1LHZA 4GBXD 3RIFF 1ZHKB 5CGMA 3WKMH 2F5AL 4LEXH 4PJEE 4PRHE 2PR4L 1S7WA 1MFDL 1QSEA 5DJXA 1MHEA 3OKEB 2WP3O 5I8CB 4AEIH 2B1AL 3CSBA 1I8KA 3HCVB 2VDQH 1HEZB 3FHQA 5EU6B 5TE7L 5EBMB 1EAPA 4NN7C 2AABL 3IU4L 4ETYA 3QPXH 4YHML 1A3LH 1HHGB 1U8OB 2E3VA 4X8JB 2VQ1A 2BVOA 2CO6B 4JG1L 1XIWD 1TNMA 3ROLB 4NO3A 1FH5L 5KTEL 2IH1B 1ZV5A 4TSCH 1JHTA 2XQYG 5HGGS 4GT7A 2Y5EA 4AENB 3REWB 1ORQA 5DUPH 3BP5A 5KW9L 3L3JB 4HQQH 5JW4M 1U92B 3KJ6L 4RGOL 3AVEA 1D9KB 1AQDA 4HWUA 3VXRB 4PRDB 2H3NA 3HPLA 5E1AB 3PL6D 1A7PL 5FM5O 1EJ6A 3T2NL 3W39B 4OQTL 3AC0A 1UXWA 2PYEE 1X5KA 1MAMH 1C5BL 1T7VA 4M00A 4PJFF 2WZPD 4Q9QH 3PE9A 2P8PB 2E6PA 3LIZL 1F58H 1P4BL 2DI9A 4M03A 4NKIL 3M17A