3QQNA

The retinal specific cd147 ig0 domain: from molecular structure to biological activity
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
117
structure length
117
Chain Sequence
MAGFVQAPLSQQRWVGGSVELHCEAVGSPVPEIQWWFEGQGPNDIMSQLWDGARLDRVHIHATYHQHAASTISIDTLVEEDTGTYECRASNDPDRNHLTRAPRVKWVRAQAVVLVLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Basigin
publication title The Retinal Specific CD147 Ig0 Domain: From Molecular Structure to Biological Activity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 25
structure length 117
sequence length 117
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13927 Ig_3 Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qqnA00
3MBED 1Q9WB 4BZ1H 4JFPB 3C8KB 1BJ1J 2XACC 3BQUA 3MYJA 4JZOA 4S10A 3FHQA 3VWKD 1IAOB 4MVBD 2EE3A 2P46B 4NZTL 3DYOA 3PJSB 3SKOB 1PKQB 1MHCA 4LSVL 4PP2A 5F89B 4C4KO 3EJZC 4FQ2H 4LLAA 3O6LH 5GJTH 5FEBA 3I75A 4WFGE 3PE9A 2PF6A 3N50A 3QPQD 2XN9A 1F6AA 2Q86B 3VXRE 2ZCHH 3RIFK 3MRDB 1IILE 4XI5D 5K9QG 4LEXL 1ZT7A 4IMLB 4PJBE 3MBXL 4LQFH 2FD6L 5EZJA 4RRPA 1U8QB 4R4ND 3MROA 1AGDB 4AEIL 1A7QH 3LPFA 2VB5A 2UWEF 3UC0H 2FBJL 1RD6A 3D69B 4H26B 5FKPA 1HOCA 1R6VA 2EDLA 4GMTH 1FNEB 1NAMH 3TN0C 1CFVH 1FNAA 1NGYB 3HZMA 3M8OH 2XXMB 3SHSA 2WUCL 4WUKH 4ETQB 3LS5H 4HX1B 2R23B 4K3GA 1NPUA 5KW9L 5IVXA 3GKWL 5FOBB 3B6SA 5B4MC 5GGTA 2FB4L 2B1HH 3HE6D 1LEGB 1BD2B 2DQHL 2NY3C 4P49A 3V4UH 4PJHA 5HHNA 5GRVK 2JJTC 3SDXF 1QSFD 1AE6L 5D8JL 2YRLA 1T66D 1VFBA 4XC3L 3SKUD 3SDCA 1KJ2H 4OFKA 2X4RB 4DN4L 5IIEA 2P24A 3TGXA 4CU6A 1YNTA 4WI9A 5L0QB 2ICES 3KPPB 1LP9B 4TPRL 2J4WH 5I71B 3IDUA 1EGJA 2FX9L 5F9DC 2NR6C 4PRIA 4MX7B 5E6IC 1OWWA 4GS7B 4H1LH 3VXSE 1T03H 5E6ZA 3O6FB 5IBLD 3D85B 3FOLA 3TZVA 1L7TH 1S7UB 3QDJE 4ZXBD 4U6YB 3NCYP 3SGJA 3KPQB 2YOCA 1T1ZA 2HJFB 4KRPB 4JQVA 4OLXL 4JY6A 4UNTA 5DT1L 3T0AA 1D7FA 4D3CL 5DDHA 3NTCL 1BMGA 3AU1B 4Y5VB 4YBLC 3CDCA 3BEWA 3MGTA 5I1AA 2QHLA 1I85C 5GS0C 3OAZK 1BJMA 4MAYD 2GHWB 1V7NH 1NBZA 4L8CA 2YPVH 3U36B 1EHNA 2BNQD 2HJLB 3NA9L 4UTAH 3WS3A 3OX8B 4HDIA 4KJPD 4YX2L 5ERWB 5LCVL 2OSLA 3OPZL 3MLXL 1MCPL 3VXUA 5C0DA 4K94C 2IALA 3UJTL 3GMMB 4NNXA 4Y8DC 1UYWH 2A77L 4YIQB 1CE6B 2NYYD 4S1DD 5BS0E 1XH3A 2HFGL 4R7DB 3F7PC 4PRHE 5GGRY 3EYVB 5J8OA 2GITB 1J0JA 5IHLB 3BO8B 4RFEB 3BKML 3VFRA 1T5XA 1C08B 1JBJA 1KC5L 2YPKB 4WEMB 4G80A 1OSZB 5HVGB 4M5ZL 3RVVD 3NCEB 2VC2H 2PN5A 5BZDB 1VPOH 1JL8A 3WEXB 1ZT1A 2MMXA 1MRDL 2FEDC 3OHXA 4NHUA 2UYLA 5C07B 1UZ8A 4QHUA 3W5MA 3F7QA 1M7IA 4IS6B 1T0NA 2JLLA 4AT6B 5IESH 1KG0A 1KLFA 1JRHH 4G8EB 4O9HH 4KU1A 1U8OB 4XGZB 4JFYB 1MCNA 2GSGA 1BHGA 1JWMB 3TYGH 5A40E 1UQSB 1YY8A 3HZVA 2YZ1A 5HD8C 3O8XB 5F1OB 4PJ9B 5I2IB 2E6JA 3ABZA 2DI7A 1UZ6E 5E1HB 1OTSC 5JMOC 2EDJA 1ZANL 4UT9L 4NCC2 4GXUM 3ULUD 2CDEA 4KROC 4Y4KD 4RGOH 4KKBC 4JPWH 2P49B 3VJ6B 3P9WB 1RZIB 4ZS6D 1I7RA 1KTLB 1JIBA 4MA3A 2AJ3A 1G0YR 3WFHB 5L2KA 3OB0K 3NFSL 3I50L 5EZIL 3UTPE 4DVBA 2K3TA 4ZUWB 1T7XA 5J1TC 1JFQH 4Q6YA 4Z6AT 4HUXB 1I9RH 2V9RA 1PKQE 2A6IA 3T0EC 4BZ2L 4H25A 5HHPA 4X6CB 3DVGB 3U0TB 1RHHB 2VWEE 3G6JF 1BOGA 1ZHNB 4KK8C 5EO9B 4ZNCD 1AI1L 2EDBA 2NX5D 4LMQI 4K8RD 4MXQD 4FNLH 3ME0A 4NPYA 3KXFE 3I02B 3QUZC 1XEDA 5D5MF 1WTGT 4GBXC 4JHAH 1GSMA 1FCCA 4X7TB 1JF1A 1FORH 2NPLX 1QNZL 1RI8A 1UH3A 1WZMA 2GSIB 5ETUB 5BV7L 4PRPB 2CLVB 1TVHA 2I9LB 2R2CA 1MCKA 3T3ME 4YO0B 3WFEL 1IKFL 5C86A 3OXRB 1DLFL 2VLLB 1WBYB 3AS1A 1NAMB 4ZS7H 2OP4L 3HLAA 4PLOB 5E2UH 4HUUB 4N0YH 4IOSD 3NZHL 2H2PD 1RMFH 3GIZL 2V6HA 4U1GB 1BD2E 3MODH 4MDJB 3ZHDA 3SJVD 4ESKA 4N0UB 5TQ2L 1NCDL 3LRHA 5DJXB 4TNWF 1T1WB 5E8PA 4FFVD 3RZCC 3S88H 2G5BB 4MJIB 5EDXA 1D6EB 1UEYA 3WUZA 1FL3A 4ZO6A 4EDWH 4KJWC 2EYRA 5IF0A 4HPYL 5ABDE 1AGBA 5MEQB 3MRNA 3SDDC 3SE9H 2YRZA 2YD4A 4OLVL 1CTOA 1KJ2B 1X5IA 2D0GA 2GK2A 4BK5A 1LP9E 4IOIA 2WLZA 4IRZH 3L7FB 1WCBB 2VDRL 4FQHA 1F58H 5D7KE 5MERB 5I73B 3UBXI 3QIUB 5EA0H 4N90D 4PGEA 1FFOB 2CGRL 3T0BA 5HHOD 4KQ3L 4XVTH 1GAFL 4BYHA 4GRLC 5B3JF 4H8WL 4E41E 2JJVA 5DD6B 3TO4B 3TBTB 4UTBL 4FZ8L 1MWAL 1BZQK 5DGQA 2XPGB 4H1LB 2DLGA 5DUPL 5TPWH 1Z5LB 1CICA 5F7DA 3TBWA 3O4OC 3FTGA 4NJAL 5JORA 1OAZH 4ZFZA 3O11B 35C8H 1SM3L 1DL7H 1RZ7L 1XR8B 1W0VB 3C9NB 3DXAA 2CIIA 3WIHA 4B7IA 2NXZC 4YFEA 1PG7W 4PJCF 3GJEB 2JB6A 3DX7B 3QEHA 4U1SA 3R1GH 2FIKA 2PXYB 2Y36H 3QO0A 4XP4L 3RWCB 3DMMC 4R7NB 3U4EA 2X1OA 3VGEA 2X42A 3OZ9L 1UVQB 2X05A 3WIFB 1CE1L 2NY1B 4Z95H 3BD4A 1TDQA 1FCGA 1WWCA 3WHXA 1WISA 3IFNL 2QQLL 4ONFH 4K9EH 4YGVB 3MRMB 3HUJB 3HI5H 4WJ5A 1YUHB 2XWBA 4FRWA 1DQDL 2DWEA 2XTLA 5D1QD 5F1NB 4R4FL 2Y5TA 5JUEH 2NXYB 2X9XA 1CBVL 4XAKD 4NGHH 2WWKO 3ARGA 2VLRD 1RJCA 1XIWD 1CLYL 2PTUA 5DJDA 4PJAA 3UYRL 3JVGC 4P4RA 4TN9A 1PKOA 4G9FB 4R0LB 2H2SC 3G5ZA 1P2CB 4CVWA 1QLFB 3PXHA 2XICA 3Q3GA 1T2QH 4WO4C 5C07E 5DMJB 2XKNA 2VN4A 1CXLA 1K9TA 3FJTA 2MFNA 1RUKH 2CUIA 2QADC 3QDMD 1C5BL 4U1MA 3OKKA 1YEGL 1E4KC 4Y4FC 4YNYA 3O2DA 4LSSL 1BQLH 4HSQA 2ADFL 2CMRH 4U6TA 1F42A 5HVHB 5EH1A 3ARDA 1P4BL 1N6QL 4UNVA 1SEQH 1KJVA 5SWSA 4LSDA 4M7LL 4Z78A 1P7QB 5E1AB 3CFEB 2CK0H 5ADOL 4F7TB 5DLMH 5DI8B 2EXYD 3KPMB 4H0IA 3GMQB 5D72L 5CP7A 1EXUA 3OL2A 5E2VL 5D93B 2OLDA 2JB5H 4EKXA 4ZG1A 3HMXL 2AEWA 2PETA 1V3JA 1X5LA 5E4EC 5E99H 3L5XL 1NEUA 1NBVH 4HS6B 4KAQL 3EKCA 4FN0A 5C9JA 5HDQH 1VCAA 3ARRA 2FX7L 5JQ6L 4YK4C 3H8NA 5EUOF 4RMRA 4X6CE 1EHXA 4QWWC 4D9LH 1T04B 4R2GB 2PYEB 1B4RA 3HG1D 4CN6A 4MNQE 4ELMF 3BH8B 3NFPA 3MZTA 4JO3H 1A14L 2WBJB 5K9JL 1P1ZA 3LQZB 4W70A 4LSRH 5FHBL 1MFDH 1G0DA 5L88L 5DRZA 4OCWL 3PXJA 4FQXD 5TE4L 3AREB 1TPXC 3QAZB 1FBIH 4B0MM 4M7JH 4JO4L 1N7MH 7FABH 4O2FA 4YFLF 1N8ZA 1MVUA 4WFGD 4PRPE 1A64A 4OZIB 3L3OA 4TUKH 1K4CB 1MFEL 3RVTC 2RJMA 4U1KB 4N0FB 1IEAA 3C87A 4XPHH 4F9PC 2VDQH 1OQOA 3W0WB 5IFHH 4YPJA 3MRGB 1U0QA 2BOBB 4GAGL 1JJUA 1MHPL 4UIMB 1IKNA 5GIRB 1R5VB 5FECA 1GJIA 2YBRA 4QHMB 5D2NA 2DQCH 2M26A 1L6XA 1WZ1L 4N0UE 3PDOA 3RX5A 3T8XA 4YDLC 4W4OA 4YHLH 5T5NF 3GJFA 4MJIE 5J1SC 3CH1B 1J0KA 1SJEA 1CCZA 3D0VB 5KSBB 1HILB 4HIJA 3K2UL 4YDKL 5T3ZH 4KUZH 3L3JA 1XF3B 2SEBA 4F2MA 5C6PB 4X99A 4PJ8B 1XMWA 2YPLB 3BKCH 5DA4A 5CWSA 5DEFA 1JZ8A 4NO0A 1RULH 4MYWB 5CGYC 5IB4A 2AI0H 3IS0X 1D5XB 3L3HA 3T0VA 5GJSH 2BCKB 2A1WH 3BKYL 1A7PL 3QXDB 5EU5A 5C8JA 1NEZB 1C5DA 3T08A 1YQVH 5MENB 4NJ9L 5EWIL 4XP5H 3QJFA 5HHQB 5E8NB 4XCNB 5HPMA 3GNML 1Z0NA 4PJ5A 4YQXL 3P0YH 3RIAK 2WV3A 2GUOB 4MJ6A 4PGDB 5EU3A 4BFIB 3QDJD 5DJYB 4C56B 1DBBL 1OB1A 2CLZA 4NUJB 2DQGH 4OCRL 2G5RA 3C60D 4BFGA 1CGSH 4Y16B 2NMSA 2P43B 4O4YH 1FNGB 1YMMA 5TH2A 3QWRD 1ND0A 4M6NL 4UB0L 5BV7C 4HK3J 1IM3B 3TT1L 3FQRA 5DHXB 1I9JH 1AP2A 3BP6A 4NFBA 3F12A 5FYKH 5I1HL 3HUJE 2UVEA 4QXWA 3CXDH 1QZ1A 4ZDHA 1C12B 5IHZA 1OPGH 3IFOB 1FAKT 4U7KA 1AO7B 3CU1A 1LEKA 4WRLA 5AWNL 4WV1C 4LHUB 5EOQH 3FZUC 4LPVA 3T0DA 4EDXB 5BS0D 1HHHB 3QH3A 3NZ8B 4KK9D 4G9FE 3SDAA 4JO1L 2XIDA 1VHPA 1YNKH 3MA7A 1T7ZA 3QI9B 5CJ5A 5LVEA 3WXVL 4HC1A 3CLEH 5F9JB 2UUDH 3SE8H 5T1KD 3TA3D 1DUYB 2EH7L 5KVFH 2X4PA 1AH1A 3S35X 3M07A 4X6BA 2P5WA 5H35B 2I9TA 1T5WA 3E0GA 2P1YA 4ZUUB 4KGJA 3D9AH 4ONHA 3VFMA 3VGFA 3NH7H 1JWSA 1W0YT 4NO2B 5CILL 1WV7T 1U93A 1R24B 2I26N 3L5JA 3IGAA 3MRJB 4CW1A 2A74B 4H8WC 2GY7B 4RCAA 1K4DB 3MNVB 3TVMA 3BZEA 2CJUH 1PY9A 3MFFA 4OV5A 3E1F1 3RRQA 1E28A 1EHLH 4WU5B 3OKEA 1DTUA 3T1FA 1AKJB 3P4LA 4TTGA 2GKIA 4J3OC 2EDXA 4UDTA 2WQRA 5C0EB 1KCVH 2IGFH 2R0KL 2V2TA 12E8L 1ZVSA 2VDLL 1F13A 1FL6B 4U2YA 5GGUB 3TESA 1CZ8L 1KPRA 3HI6H 3V5KB 1FSKB 3BZDA 1CQKA 4GUPA 1S8DB 2I25N 3ZKMC 1I3GL 4I2XB 4ODHL 5EOCJ 4KXZH 1TETL 1FZKA 5I1CH 4KV5F 3G5VA 5C0CB 2APWA 4UAOB 3WE6B 1BEYH 2VDPH 2YA0A 5DJAB 4MWFB 5ITFB 4PR5B 2AEPH 1I8IB 4JFOB 4KDTA 1A6UL 2V5TA 4HGKC 4CAGA 1I1AC 5D2LB 4ELKB 3SE3C 5HYFA 3C5SA 4OZIE 4XCEA 4QRQA 3HB3C 3CZFA 1MJJB 2HKFH 3HI1B 4HG4J 2A6KB 2ID5A 1PSKL 4Z7UA 4G42B 5JLZB 3W0WE 4KY1H 3BDYL 4POZD 1IAIM 5I1GH 4L3EA 3RX7A 4QYOA 1CK0H 4XVJL 1LO5A 5JO5A 5A2FA 4KDVA 1YEKL 4GMSL 1NGPL 2W9EL 3B2UC 3DYPA 3FKUS 4HW6A 4JJHA 2Z92A 4U6HA 2DL9A 4WU7B 2XNAA 3MUHL 1Q94B 5C2BH 4FP8H 1IZJA 4S0SD 3HZKA 3WXWL 1JNHA 3QHFH 4MA8H 1H3GA 1P7KA 1QSEB 3VFPB 4RQQA 2CLRB 2B1AH 1T6VN 5FM4A 1BD2D 3LEYH 1T3FB 5KSBE 4XZUA 3MLVL 1Z9MA 3G5XB 5C6TH 4OFDA 2BP3A 1LDSA 2YSSB 3AB0C 5GS0H 4ERSH 3C2AL 2VDKH 2YPLE 3P73B 1RZKL 2YXFA 1S5HA 5BVPL 3VW3L 2R0ZH 2PW2A 3OGCA 2UUDK 1ZT4B 4O2CB 3BIKB 5D1ZC 2OI9C 1WVZA 3QUYA 1PLGH 1JHKH 4OGXH 1IGIH 5EIIA 4K94H 5HY9A 5DJCB 4UIKH 3OXSB 4P2QE 5D7KD 3KPTA 5JNYA 3MXWH 4ONOA 1ZKAA 5MENE 5FF6A 1KFAH 5A16B 4ORGB 3LQMA 5CINH 1QBMH 3HRZA 3NA4A 1J1PL 5I6XC 1J0YA 2VR9A 2EO1A 4K2UL 1QLRA 3FFCD 5FYJH 3O6FD 3DV6A 3NGBC 3WUWG 4N8VG 1B0GB 3MXVH 5KZCD 3MLPA 4C56E 4OT1L 5CJOL 4YHNB 2R69L 4ALAH 4KRPD 2YUXA 3LPGA 4HCRA 3OAUL 2ADGB 1UKQA 1M7DA 5J06A 4JDTL 4N5UA 3HNSL 4XAWH 4OKVA 5K9KA 1U3JA 4RIRB 4XT1C 5JW4M 5BQ7A 3UPAA 4PJEF 1B3JA 4XBPA 5FO9A 3BRDA 1IGTA 1LK3H 2XZAL 2H9GB 5I8CA 1OAXH 1AO7E 3ECBB 3CC5A 2ZG3A 2ZSWB 3H2WA 1FC1A 5AG8A 1AQKH 3QP3A 4GW5A 1BX2A 2GFBA 2R15A 1YPZF 2QBWA 4I8DA 3KYMB 1U8IA 1BVKA 5FYKU 4U6XB 1U91A 1MEXH 5EPMB 3DBXA 3LKOB 1IBGL 2PUQT 3HNTL 4JFZH 3F7VB 2OL3A 3RPKA 4MAUL 2Z93A 1JCKA 1BECA 2XOTA 5T5FH 4M6OL 4JN2B 3GB7B 1AXTH 2QJDA 3FT3B 5IVOA 5LWYL 1R5IB 3GMLA 4XWGL 3LQAL 1KLGB 2X09A 3HAEG 3KPOA 4LRNL 3CDYA 2J6EL 3MRPA 5C07D 1R3KA 5CLTA 1FG2B 2HMIC 3WKML 1PG7L 3RI5F 2DM3A 1KXQE 1AR2A 2YC1B 1KLUA 4J4PA 5IM7B 1CDYA 4XCYB 4J3SA 3I85A 4KKLD 4QCIA 1AHWB 4EN3A 3O8XD 4PJ9D 2FECI 5IKCB 5ID0A 4IRSA 2GJ6A 1S7VB 1YYML 1YEJL 3PDDA 2CDFB 3QNXB 2JELH 1DEEA 5FIEA 3SQBA 1GZQB 4G7YL 1ZA3B 5DWUL 2AJXH 1OGAB 2ITDB 4OZFH 5FUOH 1HWGB 5IOPA 4I2XE 3CFJA 3VD4A 2Z0BA 2KZ1B 3WN5A 4RGNC 3CFBA 4KDWA 3BZFA 5C0CE 1CL7L 1FVCA 1KTRL 3VFTB 4APQD 4I18C 3RY4A 5KSVB 3MRFA 3TYFB 2NY3B 2OJZL 4LAQL 3BD5A 4YWGH 4N8VA 3V4PH 3WUWA 1TZHB 4XPAL 5D2LE 4W6XB 5EU4B 4X4YB 5EC2A 3QEGL 1VFAB 5E94B 4UQ2A 4J3XA 1RJYA 3QUML 4HQQL 1ZGLA 1N5AB 5D1XC 2O5XL 1OP3H 1NAKL 3AGVA 4PY7A 4KZEH 2BVPA 4MLIA 1MFCL 1L9MA 4OF8A 2Y25A 3BP4B 1FDLH 3MLWH 2KQMA 3I6KB 2GAZA 2D9CA 2YD1A 1FO0A 4YHPB 5E6IB 3GMOA 1R5WA 2BNRB 4P23C 4YR6A 4U1LB 1I3RB 2X6MA 4NZTH 3O3EA 3WL9B 3CCHB 1QSEE 1A7NL 4LSVH 3GIVB 4KMQA 1JK8B 3UBXG 3BPCA 1N3NA 1HNFA 4WW2C 5CBAB 1XF5A 5E0QA 5C0BD 2KDGA 2W9DH 5JA9A 1EEYB 2P5EA 4LLWB 1CLZL 3S5LB 3VA2C 1AD9A 2OQJB 3EDFA 5T3ZE 3MCKA 3HC0A 4MJID 4LLUA 1OD9A 4O00A 2VKWA 1IVLA 4XMPL 4LEXH 4PGBA 4NQCA 3MBXH 2FD6H 1WBZB 1EJOL 3HAEA 4AEIH 4Z7NF 4QTHA 3D25B 1JNNH 3ZDYF 1X4YA 2D4FA 2FBJH 4LPCA 1RK1A 2V17L 2QQKL 3ZE2E 4EEEA 3NCBB 5GS1C 2WUCH 1J8HB 1VA9A 4NQXB 5DVOA 1ZTXL 2FZ3B 4JKPL 5KW9H 2F58L 3KG5A 4JVPA 4XP6L 3S96B 1AGEA 3GKWH 3TO4D 2D7QA 2FB4H 4OLUL 3FQUA 5IB5A 3UPRA 1J18A 4DW2L 1RIUL 4ZSOA 2QQNL 3W81A 4PJHF 4OLZL 1EPFA 5JW3L 4NKQB 3LKPB 5KS9F 5D7IF 4ZFGL 4OZGA 5C08B 2LV4A 3STZB 1AE6H 3GSUB 1H0DB 5D8JH 4XC3H 7CGTA 1JHTA 1Q1JL 3V9FA 5FO7A 4JQIL 4HUKB 5MI0B 4MD0B 4Z76B 1QQDB 3GSWB 2ITCA 4OQTL 4LLQA 43CAA 2PXYD 5E03A 4TPRH 2C1PA 4NRYA 1CS6A 3W9DB 3VD7A 2FX9H 3K4AA 5AUMA 2DLEA 3DO7B 5T1LA 3RKDC 1F8TL 3VH8B 3L3DB 3QRGL 3WKNA 4F3FB 2NXYD 4KROB 4P99A 5FUCC 3B43A 4OLXH 4UU9B 2NZ9C 3Q1SL 5DT1H 3I3EA 2DLFH 4R3SA 4S2SA 5DD0L 4D3CH 3NTCH 1MREL 3KDMA 4QT5A 4G9FD 1OP3K 3JZ7A 1JWUA 4LHJB 4JQXC 1AQDA 4WUUB 3SBWC 1KT2B 1TQCC 1RZKC 2HTKC 3KLDA 5MEOB 1KXVC 3BJ91 3NA9H 4AIXA 1KBGL 3T0EB 4QLRA 4WWKC 1CD8A 3CSYB 1V3LA 1FV1B 4YX2H 5LCVH 1CTNA 3OPZH 3MLXH 4WW1B 1MCPH 5C0NC 1U9KA 2FATL 5GGTL 5ICYB 3UBXA 3FCTA 4EN3D 2A77H 1G9ML 4FOMA 2HFGH 5HBBA 1HSAA 3BW9B 3QUZB 1LE5B 2ATKA 3HZYB 3BKMH 1WIPA 1G84A 4X4ZA 4X4XA 1KC5H 1ZMYA 2OTUB 3B5GA 1X44A 4M5ZH 5IK3A 1IFHL 4YHKL 3VI4E 1OGAE 4X5XB 3MCLL 3S36X 3U7WL 2KPNA 4ZAKA 3VXTB 1MRDH 1T83C 4GQ9L 1EGJL 2Q76B 1FLTX 2J88L 4OZFB 4LEOB 4IHOB 5DHVA 4F7EB 3P77A 1MHHA 4YC2B 4X6DB 3V6FA 1G7QA 3DX8B 4XNUL 3SGKA 3MRQB 2PYED 3G08B 1D9KC 4OM1L 5EUKB 1XFPA 2J8OA 5D9SA 4Z0XA 4XPGL 1KIQA 3VWKC 4MVBC 5EIQA 3REWB 3EYOB 4JM2D 1X7QB 5HGDB 1P9MC 2IANA 2IBZY 1BBDL 3DJ9A 1ZANH 1JRHI 4UT9H 4PYGA 4FTVB 4PV9B 4JFXB 3PWVB 3QPQC 3NN8A 1RUAL 4F7CB 2VRAA 3GMRB 2VABA 4B53A 5FM5O 3NFSH 3QQ3A 3I50H 4XI5C 4LCCA 5DEGB 4EUPH 5L2JB 2BNRE 4GRLB 3LQAC 4LLDB 5EZIH 5KSAA 4R4NC 3W0WD 3BD3A 1HZHL 3IF1B 4WFFD 1WC7B 4JLRA 4BZ2H 2P8PB 4QGYA 2D31A 3QUXA 3B5TA 1N26A 2ADJA 2B20A 1RV6X 3FT2A 5E00B 3DUUA 3R0NA 1J0IA 2ZSVA 3O4OB 1QFUL 3OJMB 3ILPB 2VJXA 4RGMC 1AI1H 3JWOL 3GM8A 2YR3A 4NQCD 2NXZB 5B38B 5E8OA 4PJIF 2D3VA 4X98B 5GRUL 5BZWB 3HE6C 2HFEB 2GTWB 5C3TA 1N59B 5E8DL 2V5SA 3RDTD 1QNZH 1KPVA 3UTQB 2GJZA 3WFEH 4PJ8D 1IKFH 1NFDA 4N1CA 3VFUA 1J8HE 1T66C 1DLFH 3IJHA 4NCDA 2OP4H 3QR2A 3PWUA 5JOFA 1U8KA 3V7AE 3NZHH 4K7FB 3U6RB 3GIZH 3VRIB 1WAAF 5D7IB 4QKXB 2FHFA 5F88A 5FYJE 1Y0LB 2AERT 1IZKA 1EUUA 3KNBB 1NCDH 4FXGB 5TQ2H 1G7JA 4FXKA 5EBWA 1HIML 5C08E 2HLAA 5B22A 1QRNB 5IG7B 1T20B 4M5YL 3JV5A 4HPYH 5IBLC 1NLDL 3AM8A 4K3JL 4ZXBC 4FQCH 4C56D 3H0TA 4Y7MA 5ECJE 4WO4B 3HPLA 4OLVH 5DF0A 2EKSA 1V05A 4KUCD 1MCJA 4GFTB 4P4KA 4M93C 2CKBA 4Y16D 3ZDXF 5DUBB 1KF9B 3QQ4A 4GG6B 2BSSA 1RFDL 2VDRH 4K3EL 2F8XC 5F7EL 3FO1A 3KPRA 3VFWA 3GMNB 1UJ3C 2J3SA 4PLJD 4KQ3H 2I24N 1B0RA 1GAFH 4FQJL 2HRLA 4MAYC 4H8WH 1LWRA 1S7WA 3MNWB 3H3KA 2LVEA 5IMOA 1LILA 1MFNA 4Q2ZA 4UTBH 3MV11 4FZ8H 4N9GA 4X5WB 3VFOB 1MWAH 3D39B 3O4LB 4CNIB 5DUPH 1AO7D 4KJPC 2HKHL 1MCHA 2RGSA 4I5BA 4WI4A 4NJAH 4LHUD 1XF4A 1NCUA 4AL8L 1SM3H 1NH6A 4F58L 4JFFD 1RZ7H 2Y9RT 4OF5A 2ARJA 2NYYC 4S1DC 3VWJA 3BWAB 3MRHB 4GXUN 1UJTA 5JIIA 2PO6A 3C8HA 4WUUE 2A2QT 1FYTB 5E4EB 4IOFC 1S9WA 4LLVA 3MQIA 1GGCL 4XP4H 1A6TA 2IH3B 4UBDD 4YK4B 1CE1H 1F3JA 3T0EE 4PJGF 5C0JB 1F11A 4DTGL 2W38A 4PG9A 3IFNH 3VE0B 4XNXL 1MCLA 2QQLH 3WDHA 2X4NA 1XGTA 3DVNA 4PJFA 1UT9A 1ZS8B 4S0TD 5DMKA 3SKJL 3RL1B 1FFPB 3VXRA 1G7LB 2Z9TA 3TEUA 4CU7A 1GGBL 5HYSG 4R4FH 1CBVH 1XGUB 3MV9A 5IT2L 4PJBA 1FFNB 4XWOD 3PDGA 2H6PA 4LP5A 3AS2A 4KJQD 5DMYA 2W65A 4FS0A 3IKCA 1CLYH 3UJJL 3P4MA 3UYRH 5IJKC 1RVFL 4G5ZL 3MGOA 4E42B 4Y2DA 2AK1L 2RHEA 3C6LB 4OI7A 2H45A 3IU4L 4Y4KC 3QBTB 2R2BA 4PB9L 4ZS6C 5IB3B 4V2BA 5MEPA 5DRNA 4LRIA 3P9LB 4X6DE 1C5BH 5HYJB 3B9AA 2AKRB 3DTXA 1AGCB 3K81A 1YEGH 4Q74A 1BZ7B 1I9IL 4JFQB 4NSKA 4PRNA 1BIIB 4LSSH 4E5XB 4YDLB 2ADFH 3LEXB 5C0CD 1BPVA 1CFNA 3VXQB 3X3FL 2XV6B 1P4BH 1N5YL 2VL4A 1CGTA 1QKZL 4DFHA 2EIDA 5JW4R 3WIHL 4PJDB 5ADOH 1S9YB 4FTVE 3TBVA 5LXGL 5D72H 3DVIA 3OG6B 1MJUL 3WNPA 1DLHA 2VZSA 4Y19B 1UENA 4K8RC 4MXQC 1RU9L 5ANMA 4TUOB 5E2VH 4EI5A 2GI7A 3KPNB 4YHYB 3TNNB 4ZO7A 3HMXH 3MRCB 3TO2A 3L5XH 3ZYIA 3EFDL 2BZDA 2EH8L 1Z9OA 1HHJB 4Y5XC 4HULB 1KIRA 2I07B 4P2RA 4WDIB 2FX7H 3UX9B 5JQ6H 4EUPB 5IMKA 3ARFD 1IGJB 2VUYA 4P3DB 2MKWA 1TFHA 2FRGP 1ZXQA 4BSWB 3O3BA 4TULL 2ZP0T 1A14H 5EOTA 1HH6B 5FHBH 4Q58C 3F7YB 1WFTA 4XB7A 1ONQA 5L88H 3WHE1 4OCWH 3HPJB 3NVQA 4JFEA 3OJDA 1QSED 5TE4H 3WLBB 3IDIA 1G9MC 2H2PC 1WWWX 4MB5A 1J05A 1RUPL 3N85L 5E8EB 1ZGLM 1HXYA 1MFEH 4OGAC 3CK0L 1QA9A 2JIXB 4FFVC 4M62L 5T3ZD 1XF2B 5BV7B 1K8IA 2WP3O 4EI6B 5FCUL 4G43B 4N1EA 3HR5A 3B9KA 3TV3L 4KVCL 5CJXA 2IEPA 4PJ7F 1TZGL 5GHWH 3TM6A 3K74B 4ZFFA 3AY4A 4GAGH 1MHPH 4PRHA 4RSVA 2YD8A 1A4KA 2C1OB 3EYFB 3MNZB 1MCQA 5D7IE 5KS9E 3O2DL 3D2UA 1UCBL 5HYSA 1DFBL 4OCYL 4Q6IA 1WZ1H 2ZWLT 2FSEB 3MUGB 3WFCL 1NGZB 2GEEA 1HSBA 4QXGL 1QRNE 2Z35A 5GRXG 5C0AB 4PLKC 4YUEL 2W91A 3MOQA 5LGHL 4JR9L 5TF1L 1G9NL 4QO1A 1UWGL 3K2UH 4YDKH 5BOPA 3ELAT 5IUSA 4ZOAA 2JCCA 1FZOB 2P8LB 4NQVA 4KMTL 3ZT7A 5JW5B 1QEWB 5E56A 4GG6E 4BUHA 2R2HA 1GC1L 5EO0B 4WI8A 4RMUA 4RMWA 1H3PL 5C3LD 2AEQL 5GS3A 2VLJB 3ESVF 2E9JA 3BKYH 2OK0L 3NIDE 3VD3A 4TTDD 1A7PH 3A0OA 1R3HB 5FYKD 3D39E 3O4LE 2GY5A 3RUGB 3BE1L 2DLTA 1H15B 1BGXL 5ICZA 5EWIH 1MWAB 3L7EA 3LN4A 3GNMH 1QO3B 2DQUH 3T65A 3UAJD 1XCTB 4YQXH 3PGDB 4NFDA 3JWOC 5IB2B 2D0HA 4PV8A 5E9DD 3IDGA 1DBBH 5D1QC 1T1YA 3W39B 5HYQB 1FYTE 4OCRH 3TLRA 1GL4B 3N0PB 3IYLW 5JR1L 3THML 1VEPA 1BQUA 1W72L 1XIWC 1NGWA 3PJSA 1CR9L 4M6NH 4HWZA 4UB0H 5F89A 3BUYA 2NTFA 1H8OA 3TT1H 1ERNA 2C7UA 1WBXA 4BELD 4G8IA 5JIKA 5LGJB 2NZIA 4ZUTB 1OD7A 3KXFA 2VAJA 2H3NA 3MR9A 4O58L 2LABA 5DRXB 5AWNH 2PTVA 5CBEB 3ES6B 3WNLA 1U8QA 1A6PA 5F7LB 4Y2DD 4G6AD 4MD5B 2J5LC 4RAUB 1MCDA 4JO1H 1FNEA 4PD4J 4DCQB 3PV6B 3BT2L 3WXVH 1BWWA 5DJ0A 5K9OB 4AM0B 3RFZC 3QXTA 2V7HB 2EH7H 4N5ED 2HWZL 5FOBA 2EXYC 3RPIB 1OGAD 3WLWC 5DC4B 5HYJE 2NY5L 2RIKA 2MTPA 3T2NL 2JJWA 4QHKJ 5DJ6B 2Q7YB 3OKMA 5CILH 2JTDA 5FA3B 4F33A 5F93C 2ARJQ 2H32H 5ENWB 1G1CA 4KMLB 2NY3D 3VG0L 1NGQL 3HCVA 2VLKE 1M71A 3EUUA 4HXAL 4PJDE 3Q6FB 3I9GL 3AB0B 2O5YL 1LP9A 3RHWF 5DXWA 4WW2F 2DQTL 4Y19E 1A9EA 3SO3B 4CVUA 1UXSA 4R4BB 1MLBB 2A73A 2Q8BL 4DZ8A 5BW7A 2GTZA 2R0KH 4FQXC 12E8H 2EDKA 4MX7A 4NQEA 2VDLH 2QQQA 1K8DB 1CZ8H 3EO1A 2FHBA 2WNGA 2VQUA 5EO1B 4E41A 1J1OL 4UDUB 3D85A 1E0OB 1FZJB 4U6YA 4NYLA 1S7QB 3E2HC 4DKFL 4R96A 1I3GH 4ODHH 4WHTA 1TETH 1CGWA 5I6XB 2BNRD 4CBPA 1T22A 1ETZB 1JTOA 1JGDA 1FC2D 4J2XA 3NGBB 3DIFB 1EEQA 2E9BA 5EORL 2PW1A 4Y5VA 2DN7A 1A6UH 4HH8A 5B8CA 5J6GB 3RBSA 1PZ5A 2F19L 4YHZL 4KXZI 1EFXD 3PV7A 4HC1L 2HJLA 1AXSB 1J5OL 5EOCL 4Z7UF 4POYA 5GRVL 3SY0A 1PSKH 1X5HA 1CG9B 3BDYH 3VCLB 1DQQA 1CE6A 4NZRL 4XVJH 1I7TB 4PREB 4R7DA 1M05B 4MJ2A 4Z77A 5CS7A 3V6ZB 1YEKH 5CEXA 4RFEA 2QR0B 1A9BB 4LSUL 4QY8B 2H1PL 1NGPH 2W9EH 4GMSH 4OZ4A 1C08A 3FOMB 2VH5L 3BPNC 2YPKA 1ZA6B 4J3WA 4RAHA 1OSZA 4M4RA 3WXWH 2OR8A 2EDHA 1ZLSL 5C0AE 1EAPA 5TDOB 4D0DB 5JPMB 3MLVH 4M1GL 3I2CL 3UEZA 4J8RB 2IH1A 1WUNT 3LDBC 5C08D 4M1CC 3C2AH 1GRWA 3RVWD 1RZKH 5BVPH 4NKMB 4MJ5B 4NRZB 3VW3H 3PGCB 3BHBB 5KN5B 3DVFA 2VISA 5C09A 2FGZA 3BISA 3H9SE 2VLJE 4HK0A 1A6VH 3C60C 4CRPA 1DJSA 2CRMA 4F80A 4Y1AA 3RUGE 2B39A 1G7HB 3QIBB 4K55A 1JTTA 1J87A 1MAML 3ZL4L 3WIIL 4X9HA 1J1PH 1SQ2N 1MVFA 4K2UH 1LO4L 2MQ0A 2Z31B 4NQUA 3BOVA 1IL1B 3KPSB 3QIWB 5IV2A 4OT1H 5CJOH 3CJJA 2R69H 5JHDA 1LMKA 4OIBA 3RGVA 5ESVB 4ZUWA 4TUJB 3OAUH 5EBMA 1BLNA 4NDMA 4M9PA 2IADB 3PWPB 3DROB 3HNSH 1XGYL 3LY6A 4YDVB 3ZDZF 2F53E 3DVGA 4KK9C 3WFDL 4G9DA 4WUUD 32C2B 4QEGA 4MNQA 1VKXB 1ZHNA 4MNGB 4RGNB 3O9WD 2XWTB 3EO0B 3K3QA 2ED9A 2XZAH 3OKNA 3VD9A 3I02A 4I18B 1URLA 4NQDA 2DWDB 4MZ2A 4ZOBA 4D0CB 4M8QB 3S35L 1SMOA 4CMMB 2EEBA 4GMTL 3T4AB 5F7FA 1NBYA 4PS4L 1KJMB 3BMVA 4L8SC 2HVJA 4LCUB 3SGEH 4PRPA 2Y07L 1CQYA 2R1XB 3ALXA 5DVNA 4TVSa 1IBGH 4MDIB 3HNTH 3CFIC 5D1XB 2VR5A 4MAUH 2B2XL 2IMNA 2J8UF 3DHMA 2QL1A 1NAMA 3FQTB 4GKSA 4OGYL 4M6OH 5LWYH 2Q8AL 4HUUA 3LKSB 2OM5A 3E6FA 5T1MB 1QPPA 2V2WB 1CDUA 3GSXB 4HUWA 4NBYB 4XWGH 1A1MA 1CN4A 2X70B 3EFFA 3OAYK 3SDXA 1GYAA 1GC1C 1JPFB 2XG4A 3QDGD 2J6EH 4P23B 1E27A 5DJXA 5IEKB 1FVDB 1T1WA 3PF2A 3LKNA 4MQSB 4QXTB 4JRXA 3KLSA 1TJIL 3CSBA 1KTDA 3HE7A 1FIGL 4BJLA 3WKMH 1E4XI 1PG7H 2X1QA 1P6AB 4RX4D 3TCLA 3ZLQC 4I48B 1JPGB 1K3IA 3RWGB 2H32B 3TIEB 4U49A 1BFOA 2ZG1A 1L0YA 2VAAB 3PABB 3C6SB 2EYSA 2HJKA 1VADA 4G8FB 1YYMH 1YEJH 3QIUA 4HCRL 3SE4A 2EDYA 1YEDB 1ZSDA 3IXAB 1I8KB 4IMKA 2FR4B 2WK2A 1QHPA 2VWEC 4EOWL 4G7YH 4JFDB 1HQ4B 5DWUH 1CXEA 1DQJB 3PWLA 1LEIA 5DUML 1RJLB 4HV8A 5GS1B 1ZEAL 2QKIB 2VE6B 3ZTJH 4JAMA 1I75A 3K46A 5CIPH 3BP5B 4PRAB 3EDJA 1CL7H 1IAKA 2G2RA 3C9NA 4ZQKA 3MJ7B 3FRUA 1H8NA 2OJZH 4LAQH 4XPAH 1RZ8A 3DX7A 2NNAA 2DQJL 3DNKA 4NNYA 4PYHA 4HIIB 3QEGH 5DVLA 1UB5A 5DMIL 5SWZB 3F6LA 1EO8L 3V2AR 3CGTA 3PL6A 3QUMH 5L6YL 4HQQH 1PGRB 1XZ0A 4PJ7E 4O5LL 4B7LA 1JNJA 2O5XH 1NAKH 5DJ2B 1MFCH 5CJQL 1W2KT 4MXWL 3U46B 1YUHA 5JW4N 3FRPG 4AENA 3T4YB 4Z0BL 1HCVA 5FUZL 1G7PA 4V1DA 4BKLA 2P7TA 1FJ1A 2ZUYA 5J89A 2Z8SA 2NY5C 2DICA 4ZTOL 2UZIL 1J10A 5L0QC 1A7NH 4IEFB 5FCSH 4ZTPL 4JZNB 1KYOJ 2HN7A 1QFWM 1S7RA 1A1NA 4OBRA 5IBTL 5C1MB 3GUTA 1NDGB 1CLZH 4NZJA 4EIZC 1EUTA 2AV7A 3GSQA 4GS7C 3ARUA 4XMPH 3ZKND 4HZLA 1BJ1H 1AY1L 2H2SD 3O6FC 3HN3A 3HNVL 5C09D 1EJOH 4HMEA 2WANA 4QRSB 2YEZA 2DKUA 2QSCL 1R3JA 3LS4H 1NEZG 2V17H 3Q5OA 4WWKB 4MLSA 4ZOCA 4QHLB 1IC1A 2QQKH 3MPCA 5J4MA 1TCRB 3MRRB 2MQ3A 1QHOA 1ZTXH 2X4OA 3L6FB 4JKPH 4F7TA 1SHMA 2F58H 2Z4QA 4XNMA 4XP6H 5CMAA 4IRJB 1M7XA 3GMQA 1H3UA 4HFWA 1KXTB 3CSGA 4DW2H 1WZKA 2QQNH 5INDB 3OQ3B 1K3ZA 4OLZH 3RGVD 5JW3H 3IDYB 4GAFB 4DJMA 4ZFGH 4L9LA 4WNQB 4HS6A 3PWPE 4DZBA 1Q1JH 4L8DB 3X3GL 1T04A 5HDLA 4PGCB 2HLFD 4JQIH 3QXAB 5BJTB 1J9CT 1H3TA 2LE9A 4DVRL 4OQTH 1FYTD 3RNKB 4MNGE 4J23A 4RGNE 3T0WA 5IMLB 5D5MA 2WBJA 2EC9T 4GW1A 1FO0L 2FJHB 3ULUF 5JPNB 3JTSB 4BH7A 3AREA 2DLIA 3G6DL 3SO5A 3OR6B 1OGTB 1D9KB 5E5MB 1I4FA 1F8TH 4BSVB 3G6AB 3U0WL 4MCZA 3WJJC 1QUNA 2AK4B 4GKNA 3D3VA 4ISVA 1TQBB 4ZOEA 2ICWB 3QRGH 2ED8A 2K7PA 3IDJB 4PTUB 3Q1SH 5DD5H 3JBG7 5DD0H 1YECH 4JFHD 1MREH 2B5IC 3ULSB 4KKLC 3FQXA 5E2JA 4Y4HB 4PJ9C 1N6VA 3FRPA 4J1UB 4YPGA 1JGEA 5IHUL 1OAYL 3C6LD 4U7SA 3L5WB 3ZO0A 2X41A 3BDXA 2VXUL 4KGLA 2MPAL 1KBGH 5DD1L 1JZ6A 3NPSB 3L3KB 5IVZA 4KRNA 4YHIB 5HYJD 2FATH 5GGTH 1SJXA 3FFDA 4Z7VF 4RGMB 1RUQL 4NC1C 1XF3A 5J12C 4U7MA 1G9MH 3FN9A 3MREB 4X9BA 4AQ1B 4UZGA 4P2OA 3REVA 3AS0A 5AD0B 2X4UA 2B4CL 3C5ZB 3S37X 4APQC 3VA6A 3CNKA 3QNYA 1ITBB 2WQ8A 4QOKA 5A2KH 4GRWH 3Q48A 4JFDE 1IFHH 2VL5B 4YHKH 4H5SB 1I8LA 2HT2D 1G7MA 1PDKA 3MCLH 1IM9A 4Y19D 3U7WH 3F7RA 1NEZA 4P2QA 1UC6A 4MA1B 2MSPA 1Y6NR 3KHQA 4ORZC 3V4VL 5MENA 4GQ9H 1EGJH 2J88H 1S7SA 5E8NA 2R0WL 4PJCA 3K0WA 5E2WL 4NWUL 3PP4L 4I9WE 5CIPB 1ORSB 5D6DC 4XNUH 4BFIA 3QZWB 5DJYA 3V95A 3SCMA 3FB5A 4OM1H 5HGAB 4U1JB 1NLBL 2H26A 5SWZE 1A6ZB 3WDJA 1BBDH 5J6HB 3LKRB 2Q1EA 5IWLC 3UCRA 4U1GC 3QUMB 4M93B 1J0HA 4L4VA 1TLKA 1U8PB 1C12A 3X11B 4TSAL 1RUAH 1DSFL 4Y5YA 2JIXD 2K9UA 3WNNA 5T5NG 3G04A 1CD1B 1UJ3B 4LCWA 3FB6B 2AAVA 1KACB 4MAYB 3JTTA 1TZIA 3QEQB 5FA4B 3K8MA 1HZHH 3WJLA 2W92A 4F8TA 1LD9B 1H5BA 1RURL 2BNQB 3H42L 4KK5C 2GK0B 2CRYA 2NW2B 1D5ZA 3QI9A 5H2BA 5FUCE 5CD3B 1KCKA 3JWOH 4L4TA 3DRQA 1HHKA 3RTQA 2DYPB 2PCPB 4X8XA 5C0AD 3IETA 3TO4C 5JXED 3GHBL 1EMTL 4D8PB 5GRUH 3RWFA 4NP4L 1HQRB 4FQQB 4YBQD 3SKMB 5C7XL 1BZ9B 5E8DH 1SEQL 3I3DA 1D3CA 4JO2L 4X7DC 2Z8WC 4U1IB 1S9XA 2ILLA 5CZXD 1FRGL 2BMKB 1T1XB 3S3JA 4ZPVA 2IBZX 5FGBA 4UILL 2WLYA 3DSFL 3RJQB 4ETYA 4HZAA 3FO9B 1OTTD 2VLJD 4MHHI 3BESR 2HYMA 3N9GL 5C0EA 3VXOA 2D4DA 4L29B 2G9HA 2VERN 4U05A 5ESAB 2BVUA 4YHOL 5EUOA 3UTTB 1HIMH 4HKXB 2AJVL 5EZLA 3F65A 1MJ7L 5IQ7L 4M5YH 4ELMA 3QCUL 4TRPL 1NLDH 5F1SA 4K3JH 1DQTA 2E7CA 1HEZB 1YJDL 2NXYC 5E95B 4Y4KB 2MWCA 5GRYA 1U3HA 4L8BA 2E7LA 1RFDH 1DE4B 1S7XB 1WFUA 4K3EH 3O41B 4MWFA 2HTLD 2Q6WA 5ITFA 4PR5A 1HI6B 5F7EH 1NANH 5C0FB 1OSPL 4I77L 4R0LC 4JPIA 3ZKMD 4FQJH 5IVNA 5EIVA 1YN6A 3MYJB 4JZOB 4S1RL 2NLJB 2QHRL 1GPOL 3MV8A 2IFFL 4OLEA 2CR3A 4MQ7B 2AK4E 3O3UN 1CDBA 4PP2B 5IROC 3UO1L 3I75B 2W1NA 2HKHH 4P5KA 3CX5K 5E5RB 2XN9B 1F6AB 1F4XL 4MGXA 4WY7L 4AL8H 3MV01 4F58H 3P40A 4QTIL 2NX5B 3ZKXB 4EN3C 3HB3D 3BYYA 1ZT7B 2DIBA 5EZJB 5HVHC 2HT4D 3MROB 1Q94A 4XNQA 1GGCH 2P47B 1CLOL 2HFFA 5I30L 2ERJC 1I1YA 4YH6A 5FKPB 1RIHL 1HOCB 4U33A 4DTGH 3ARBA 2CLRA 3CFKA 3W9EA 3HZMB 1VSCA 3S36L 1DANT 3CZJA 4XNXH 3RZWA 3PHSA 3KJ4C 5D93C 3G5XA 2MQCA 1Q9KA 4OF6A 3SKJH 4FQLL 5IVXB 3CFCL 4WCYL 3B6SB 1GGBH 3I6LE 4LFHD 4PJBF 2WIIA 3ZE0E 5J9PA 1S78D 3GSNL 5IT2H 4Q9QL 1A8JH 1PX4A 5HHNB 3SJVB 1H9VA 3UJJH 1RVFH 4G5ZH 3KYNA 4P9HL 3M17A 2AK1H 4GRWB 4PG2A 4I1NB 2DBLL 2P24B 4JM2C 5D7LD 5IIEB 15C8L 1LE9A 1SYVA 1SY6A 3ZSTA 3QAZC 4XBGB 4KJYA 3UYPA 4PB9H 4LQ1A 4PLNC 4JE4B 5TQ0L 5HGBB 4PRIB 2APFA 3TJEL 1GGTA 1I9IH 1JZ2A 1JP5A 4JGUA 2W59A 1FP5A 3FOLB 3TZVB 3X3FH 2AJZB 2GIYA 3PUCA 1N5YH 4RFOL 1QKZH 3RNQA 1DVFA 1T1ZB 3WIHH 3DGGA 2R4SL 1U8HA 5LXGH 1JE6A 1MJUH 3K1KC 5DDHB 1RU9H 1J7VR 3BEWB 4W68A 3MGTB 5GPRA 1HYSD 2P44B 1JN6A 4FMFA 5MHSD 1NBZB 5HVFB 4L8CB 2MNUA 3EFDH 3QEQE 2EH8H 3RDTC 2E9WA 2OXHA 3WS3B 4HDIB 2BNQE 4NQSA 5ISZA 2EE9A 4PJ8C 2OSLB 3VXUB 2LAAA 5HPOA 2IALB 4TULH 3BMWA 4LPXA 4YXHL 5FDWA 1C5CL 4D0BA 3RWHA 3VFRB 1KUMA 1T5XB 3V0AC 5LAXA 2B4CC 1RUPH 4G80B 4XX1E 1DZBA 3L95B 3N85H 2CDGA 2VLRB 1XIWB 4PPTA 3DHJA 4F37K 1FG2A 2XKUA 3CK0H 4M62H 4TSBL 4C83A 1ZT1B 4ZUSA 4NHUB 5FCUH 2VIRA 4HXBL 2QV2A 4QHUB 3TV3H 4KVCH 1TZGH 1YN7A 4XCYA 1T0NB 1JF5A 5HDOA 3EO9L 4Y16C 1KG0B 3HI6L 2HMID 3O2DH 3B2VL 5JZ7D 1UCBH 4LIQL 1DFBH 4OCYH 3QIBD 4Q9CA 2GSGB 4PRBA 1YY8B 1QLEH 3UTTE 4PLJC 4L4JA 3HZVB 3WFCH 4QXGH 4Z7WB 1AIFA 1ZA3A 2J5LB 1A1OA 2NY0D 1OM3L 4JREC 3TN0A 2ITDA 2Z31D 3MRBA 5LGHH 4JR9H 5TF1H 1G9NH 3QIWD 3KPSD 1UWGH 2CDEB 5CHNA 4K23L 4KMTH 3QNZA 1I7RB 1X5ZA 4MA3B 2AJ3B 3AMKA 1U42A 1GC1H 5KSVA 5L2KB 3TYFA 1H3PH 5AZEL 3PIQA 1CFTA 3S8WA 2FH6A 1IGFL 3P9MA 5F8QC 2AEQH 2JJTA 5I74C 3ZKQD 1VFAA 3VH8G 5E94A 1U92A 2OK0H 1UZ6F 4KY1L 1MIEL 2A6IB 4H25B 1ZWIA 5MP6L 4UBDC 4EZMA 3BE1H 3ARPA 1Z0MA 1N5AA 1BGXH 1BOGB 1IT9L 2VNCA 4OQ1A 4HT1L 2XN9E 3A6CL 4I4WA 4NPYB 1FN4B 2NX5E 4ZFOA 4NKIL 4I0PD 3BP4A 2JJSC 3I6KA 4MA8L 5D1XD 4XMKL 5E6IA 5JR1H 5DGRA 4XWOC 2X89A 4U1LA 3THMH 1TVHB 4KJQC 1W72H 5ICXA 1WITA 3CCHA 1CR9H 1KJ3L 4Z7VE 3E2HB 4IJ3B 5I0DA 3T1WA 5KVDL 2YUZA 3HLAB 5IVXE 5SV4A 2AP2A 3U7AA 1ZAGA 4XC1L 2OQJA 3U9UA 2DJSA 3DSNA 3CX2A 1XGRB 1FSKC 1IGIL 4O58H 3PWJA 1I85A 3GJFH 4XHQA 4UIKL 2BRQA 5F21B 3SJVE 3T3MF 1NCNA 1KFAL 5ITBL 2B0SL 3QULA 3S6CA 5IF0B 2EYRB 4GRWE 4UAOC 3T3PE 2ADIB 1AGBB 3BT2H 1J8HA 3S3PA 3T04D 2YK1L 3BGMA 5BRZA 4LOUD 3WFZA 2FZ3A 1TNMA 4IOIB 4HH9A 2W9LA 4MCYA 2HWZH 5F72S 1D6VL 4FQHB 1YJDC 3BGFC 5JIHA 3MJ9A 1GIGL 1EJ6A 4PGEB 3F6IA 3QXWA 3T2NH 1U8NA 3BPNB 1LHZA 2DMBA 4P3CL 3UTOA 4FFYL 5ACMA 3CMOL 4GKZA 4HBCL 1LDPL 4UI2A 1NMBL 4PJEA 2ORBL 1TTFA 4I9WD 4BUGA 3VG0H 3P0GB 1NGQH 1CICB 3ARFC 3TBWB 43C9A 5EU6A 4HXAH 4Z76A 2QEJA 3FTGB 3V7MA 3H3PL 4ZFZB 3KR3L 3I9GH 3LDBB 4W4NA 2O5YH 5AYQA 2DQTH 3DXAB 2CIIB 5SWZD 1GOHA 2MOVA 1YPZA 5F1IA 2HG5A 4TYUA 2Q8BH 2JB6B 3NOIA 3QEHB 4U1SB 3BUTA 3QO0B 4JFZL 1T7WA 3U4EB 4IIQA 3K7UA 3DRTA 1J1OH 4QF1B 4WGWB 3WHXB 1IGYA 1P6FA 2FL5B 5F6HI 3RIFF 4NZDA 3VXUE 4DKFH 2EDQA 1X6NA 4KVNL 2IPKA 2VITB 4XNZC 3VRJA 2A0LD 2KZWA 4WJ5B 5B38G 1A7OL 2M2DA 5EORH 2Y5TB 5DHYB 4NN5C 4AIOA 1WZLA 4K7PY 25C8L 5J3HC 4ZPTA 3ARGB 3L5IA 2F19H 2VO5A 4XAKE 5DJDB 4PJAB 5MEOA 1QBAA 2VLRE 4YDJB 4HC1H 1J5OH 1IMHC 1EO7A 5EOCH 3T0EA 2XRAL 1YA5A 3G5ZB 3B3IA 3Q3GB 4WW1A 4LSPL 5ICYA 2XKNB 3QDHA 5DFWH 4OFYD 2A9ML 4LLMA 3NACL 1U8JB 3L9RA 4NZRH 3PHQA 3O45B 3BW9A 4WWKD 4LSUH 4GBXA 2H1PH 3HZYA 4U1MB 3OKKB 4GRMA 5DA0B 2VH5H 2OTUA 1I1FA 1T21A 3ULVL 4Z7WE 1ZLSH 1JHLL 4TSCL 1XGPA 4IRJD 3ARDB 4RMSA 3GJFK 3GZKA 4TTDC 1KJVB 1MCFA 5SWSB 4CDHA 4KKAD 4M1GH 4QRRD 3UDWC 3I2CH 4BSJA 1ZHKB 2IPUG 2Q76A 3WO3B 4LEOA 4JEGB 1I8MA 2EIEA 3OJVC 4AIZA 4LLYB 1JI2A 5J7CC 3UAJC 5L2KE 2GT9A 4OFIA 3IVKA 4LK4A 2PO6C 2CR6A 3UTSD 4KI5E 2XT1B 3G08A 1DDHA 1MCSA 4S1QL 1VGEL 1RZJL 4H88L 5C9JB 1JV5A 3OAZH 3RZCA 3ZSSA 5I75B 1DBJL 4WHYG 3EYOA 3D1MC 2AEIT 5HGDA 1I7ZA 4O51A 3DUHA 4PGZA 3SDDA 1MAMH 4L5FL 3NFPB 4GJTB 3WIIH 3RWDA 1MY5A 4FTVA 1QR1A 1P1ZB 2QSTA 1X5FA 2EIBA 5LQBL 1LO4H 5TGBA 5DRZB 3QWOA 2AK4D 4LKXA 3GMRA 4NOFA 1L7IL 3FMGL 3O2VL 3WNOA 4MA7L 4Y88A 5DEGA 3TWCL 3EOAA 4GRLA 3L3OB 4UUJA 4CN4A 4X6CF 2W9DL 4L3CB 1XGYH 4Y2DC 4G6AC 2P8PA 4WTWA 1T80A 4RA3A 5F7KC 2D7NA 1AHWC 4Y4HD 3WFDH 1W72B 5E00A 4TVPD 1IEAB 4G7VL 1ROWA 1OP5H 1CXHA 2J7LA 5I1DA 5FECB 1JNNL 3ESUF 2YBRB 5B38A 4N5EC 3S35H 4HUVA 5BZWA 1V3KA 2FNBA 4PS4H 1KCSL 3T8XB 1P4IL 1BFTA 3AS3A 3DMMA 3GJFB 2Y07H 3PG2A 1SJEB 3I6LD 3C5ZD 3GSVA 1KN2L 3KPLA 1P4LA 3BPLC 1TVBA 2B2XH 3L3JB 5C0IA 3EDKA 2SEBB 1MOEA 4F2MB 4O02L 4OGYH 4X99B 1DBKL 5IB1A 2Q8AH 2ICWI 3SGEI 1IRAY 4NO0B 3U6RA 5KS9A 4Q0XH 1KB5L 3BIAX 5D7IA 5BXFA 1OTUD 2DRUA 2Z91A 3BRGC 3L3HB 3OB0H 1QRKA 3WSQL 4UT7L 1QRNA 3JVGA 1TJIH 5EU5B 3DX9B 5FKAB 2R4RL 5C8JB 1FIGH 4J3VA 4CADA 1C5DB 2V7NA 3HMWL 2RCSL 1JPTL 5D96B 3QJFB 1NC2A 3QG6B 4WO4A 1NUGA 5HGHA 4HG4K 4PJ5B 2N1KA 4LU5L 5JHLL 1F6LL 3DXAE 3W82A 4MJ6B 3LEVL 5EU3B 3FFCB 2R56L 2VXSL 1OB1B 3QXUA 4HCRH 2XQYG 3RHWK 3GMNA 4WWID 5KZCB 4Y4FA 1YMMB 1HHGA 4EOWH 1HXMB 1VGKA 1ND0B 9CGTA 2MJWA 1W8OA 3IJYA 3D39A 5DUMH 4AK1A 3O4LA 2DLFL 1NDMA 1AP2B 1ZEAH 3F12B 4KTDL 2ICEA 2VSCA 3WHE0 3V5HB 4WHDA 2G75B 3V6OA 1FLRL 5CJXC 4ZDHB 5IHZB 3QEQD 3GEWB 1N2RB 1WWBX 3QDAA 1ODAA 3N1FC 2OS7A 1LEKB 5K59F 1CT8A 4EXPX 3DV4A 3V8CA 1AJ7L 1EO5A 2DQJH 3P4OA 3VDBA 1BREA 1NUNB 5I1LA 5DMIH 3QH3B 2DYPD 1CL7I 1EO8H 4MHHG 4OF3A 4X7FC 3RY5A 1UADC 2OJEA 1Q9OA 5L6YH 2Y7QB 4O5LH 1OVZA 1WT5C 3HUJF 2ENSA 3AAZA 2RR3A 4IOFD 4NIKB 3WS6C 5CJQH 1G7LA 1B90A 2EE6A 4MXWH 4P2YA 4Z0BH 4X6BB 3KWWA 2P5WB 5FUZH 2I9TB 3ETBF 1INEL 3RVWC 3P11L 3VFMB 4ONHB 2VN7A 1FFNA 3CX5J 1OP5K 1JWSB 5MI0C 5F3BA 1U93B 4ZTOH 5CSZA 2UZIH 3IGAB 3OBAA 4ZTPH 4F7MA 4E42A 4I3SL 2F54D 5SWSE 4Q9BA 3TVMB 3BZEB 3MFFB 4OV5B 4RA0C 5IBTH 1E28B 2Y72A 4XRCA 3OKEB 3T1FB 3HHRB 3UTTD 1P5VA 3MFGB 4JG0L 1OL0A 3OGOE 5BMFL 2B5IB 5HXMA 5IB3A 1AD0A 3DO3A 1AY1H 2BSTA 2N7BA 3HNVH 4HKBA 1K85A 1BF8A 2X9YA 2V2TB 1AGCA 3DX6A 3FN0L 1BZ7A 1E4WL 1KPRB 2OTWA 3CD4A 5CD5D 4JGMA 1BIIA 2QSCH 4NKDA 4GUPB 4HS3B 3BVNA 4HAGA 1B2WL 2DB8A 4LNRA 2VLKA 1FZKB 5GZOD 1S9YA 3BQUD 3G5VB 5J12B 3O9WC 1P69B 3LD8C 4TUOA 1U8LB 4APQB 5T1DL 3KPNA 3TNNA 1C16A 5GSVA 3MCG1 5HI5D 2XN9D 1WJ3A 3CZFB 4AMKL 4X8JA 2I07A 4WDIA 1JZ5A 3X3GH 1UG9A 3H9YA 1UEMA 2C3WA 2P8MB 2BFVL 4G6ML 5BCAA 4DVRH 1JYWA 1HK6A 2YA1A 4L3EB 4GAYA 4PJIA 4IBLT 1LO5B 4FA8A 1FO0H 1O7VA 3F7YA 2ESVA 3MGAA 4UNUA 3HPJA 2VKXA 2DTML 1BFVL 1UCTA 4U6HB 2Z92B 1T0MB 3G6DH 4MQXD 2XNAB 3Q5TA 2OTPA 3M45A 4OZIF 3BXNA 2IPTL 5AAMA 2WSKA 2WUBH 5DSCA 3HZKB 3I84A 1JNHB 5EC1A 5L8JB 4XP1L 3U0WH 1P7KB 4HKJA 4RQQB 4D9QE 1K2DB 3RWEB 3NCCB 4YC2C 1H3XA 4XBEL 3U7YL 1WAAA 5C0BB 4HUNB 3T77A 3BH9A 1S5HB 4OGAD 2C1OA 3SDCD 1LVEA 2JE8A 2PW2B 1CDIA 4WV1A 5FK9A 5IHUH 2Y5EA 2FSEA 1BP3B 4XMLL 1OAYH 1JUFA 3QEUA 3CPLA 2FYYB 4FQCL 1QTYT 2DKMA 2VXUH 5EIIB 2OZ4A 2O61B 2MPAH 5HY9B 3OR7B 5DD1H 5KSBF 1RZJC 4U3HA 3HRZB 4PRID 1RUQH 4J3TA 4PJ5E 3N1QC 1QLRB 5JW5A 3KVQA 2YD3A 2B4CH 3GRWA 4PLKD 5IR1A 3FFCE 3TZVD 4D94A 1R3LA 3NAAL 4MD4B 1NBQA 2V2XB 3TP4A 1YMME 3H9SA 1K5NB 5DTFA 1M7DB 4MQTB 5F3HB 3E6HB 5JXAL 3JWDL 4OKVB 3O0RL 1NMAL 3UZEA 3V4VH 2AABL 4H0HB 3UXFA 4XBPB 5GGVY 1IGTB 2R0WH 2YWYA 4PBVC 1A6AA 1QO3A 5E2WH 5I8CB 2WWMC 5HSFA 4NWUH 3PP4H 4GW5B 4RFNB 4KUCF 3VXUD 2GFBB 5HVWA 3W11D 3P0VL 2R1YA 4L3AA 1BVKB 4PJGA 4WENB 4F15B 1NLBH 1II4E 2AQ3A 3A67L 3DBXB 4P46A 3AC0A 3BFOA 2IAMA 4DGYL 2F53A 4XXDB 1YC7A 3C09B 1MI5A 1QVOA 4OAWB 5LGJA 1G6RA 3RJDA 5KSUA 4TSAH 2XWJA 4V2CB 1DSFH 2P5WE 3K4DA 1JZ7A 3OF6A 3ZKNC 3DUSA 1I1AA 1INQB 1XR9A 3MRPB 1R3KB 2AXGA 4OCSL 5HDBE 1RURH 3TBSB 5ACZA 3H42H 5T3XD 1HHIA 1KLUB 2JK5A 1G0XA 4AM0A 4XVSL 2X40A 1MHEB 4QCIB 4DAGL 4EN3B 1X5YA 3V0WL 3RAJL 5ID0B 2GJ6B 3QFJA 5M7QA 3GHBH 1EMTH 4IM8A 2PKDA 4NP4H 5C7XH 1JZ3A 5F8RC 4U31A 1DEEB 3RGVC 1MCEA 4JO2H 2ERJB 2EDTA 1KPUA 3NCYS 5K9QI 3HC3H 1KELL 1FRGH 1DP0A 3WLWD 1DUZB 5L2KD 5ENWA 3VFNB 5IOPB 5DHVH 4UILH 3DSFH 4YEEA 2N56A 3RIAF 3CFJB 1V7ML 3KJ4B 4KI5D 5L8KB 4NC1E 2HLFC 4ONGL 1FVCB 1N6UA 3O2WL 5D6CA 2Q3AA 3N9GH 4R4BA 4N8VB 3CUPB 3WUWB 1MLBA 1F02I 4I3RL 3SPVA 2XFXA 5D1ZA 4YHOH 5EC2B 1I7UA 1NCCL 2AJVH 2FGWL 3HMXA 4UQ2B 1MJ7H 3FQNA 5IQ7H 3LRSB 4UDUA 3QCUH 4H0GA 1RJYB 2APVA 4TRPH 4JM2B 3BPOC 3NFNA 1YJDH 1PVHA 1YEIL 4L3EE 5KVEL 3IB4A 2NY4B 3KYOA 3M1BB 4BM7A 3DIFA 2Q7NA 5D2LF 4JHZA 2GAZB 1MUJB 1FO0B 1OSPH 1S9VA 3GMOB 1Y18B 4I77H 3CFDA 1R5WB 1JF6A 4WI7A 3O6KL 4S1RH 4YR6B 1Z9LA 2QHRH 1LO0L 1GPOH 1HYRC 3C6LC 3O3EB 2IFFH 5AEAA 1A22B 4GSDL 3HE7C 5GHWL 2IMMA 1IC5L 1U8MA 3UO1H 1NC4A 3VG9B 4P57A 4PJ7A 1N3NB 4QGTA 1NANI 3OKOB 2P5EB 1F4XH 4WY7H 1UB6B 5C0BE 1OHQA 1AD9B 4QTIH 4CVXA 5J11C 1I7TA 3MCKB 4PREA 4LLUB 2BHYA 4FFZL 3QHTC 1F2XK 2X4TA 3EDEA 1CF8L 4PGBB 1RK0A 4NQCB 5HI3C 1HH9A 3O3AB 3S37L 3O3DA 4QRPA 4QTHB 4IMKC 1ZA6A 3JWNC 1CLOH 5IEHB 5I30H 3RDTB 3GSOA 4P5TA 1RIHH 2DQFA 1RK1B 3U30B 3FQWB 1RJZA 5TDOA 1WK0A 5HYIA 3S36H 2HT2C 5JPMA 4YHYC 1MCRA 3AVEA 4FQLH 3U9PL 3CFCH 4WCYH 1W0WA 3MV7A 1A21A 4QNPE 3UPRB 2XZCH 2VZ3A 4ZSOB 5DZNA 2CIKA 3JUZA 1OLZA 4NRZA 3GSNH 4Q9QH 3PGCA 4NZUL 5KN5A 1CICD 2YD9A 4OZGB 1TMCB 2RAMA 4M1CD 4EVNA 3ZE2F 3DXAD 1OARL 4ZO9A 1G7IA 3N1MC 4P9HH 2DQUL 3IFPA 5FO7B 1ACZA 3VMNA 2NY2B 2DBLH 3DURA 15C8H 1XF1A 1Q72L 5IMMA 4ZYKA 43CAB 4N0RA 4PJXB 2FJFA 5K59E 4NRYB 3LN9A 2ZOKA 5TQ0H 5AUMB 4G8GA 5T1LB 3TJEH 4XB8A 4KFZC 4NKOB 5C0RH 4O2EA 1CFQA 3ROLB 1KB9K 3STLA 1IEBB 1I3UA 4JREB 3PWPA 2D03L 4XNYL 1WIOA 3LSOA 1LO2L 2BHZA 4RFOH 4CDGC 3K4ZA 32C2A 3EYUL 2R4SH 1PZUB 3ARGD 4MNGA 2W60B 1RY7B 1T4KA 3JV4A 3EO0A 4S2SB 5TDNB 2X4SA 4I18A 3KDMB 4QT5B 4JFFB 2HVKA 2DWDA 4AJ0A 5JW4Q 1JWUB 4M8QA 4CMMA 3MA9L 5JXEC 3T4AA 4OD2B 1HINL 5SWQA 4WTXA 4YBQC 5I74B 3EZ8A 2BVEA 4X9FA 3S9DB 2H41A 4BQ6A 5KOVC 1L6ZA 2CH8A 5D7JA 4MDIA 5CZXC 1XCQB 2DF3A 3FCTB 4AZ8A 1QFWI 1PBYA 3N1GC 4YXHH 1TJGL 2XA3A 3VXMA 1UM5L 1C5CH 2ATKB 1OTTC 1CU4L 5A3IC 2FHCA 3ARDD 1DQMH 4N8PA 3RVXD 4X4XB 4B50A 5SWSD 4ODBD 1CGXA 1JPFA 4P23A 5D70L 2K1MA 2O93L 1FNLA 1NQBA 1SY6L 4TSBH 4ZAKB 2BRRL 4JZJC 4XXCC 4OUUA 1QBLL 3QUKB 1U41A 3IDNB 4RWYL 4WW2A 1A3RL 4HXBH 1JPGA 2H32A 2Y06L 1IGML 5DHVB 2EXWD 4NBZB 3QCVL 3P77B 3EO9H 2VAAA 1MHHB 3DI3B 5ID1A 1ZHBA 3C6SA 5C0GA 3V6FB 1G7QB 3B2VH 4LIQH 2HTLC 1YEDA 4JKKA 2PYEE 1EEZA 3VI4F 5D9SB 4Z0XB 4JFDA 1KIQB 2WINA 1DQJA 5CGTA 1OM3H 2VDML 5I8EB 1HNGA 3G5YB 4JRYA 5GISL 4HJGA 2HAZA 2BDNL 4K23H 3IU3A 3BP5A 1BVLA 5AZ2L 4LF3B 3NN8B 1YZZA 4M43H 2JJUA 3BGFB 3MJ7A 5CAYB 3GGWA 2VABB 1JMXA 5AZEH 1IGFH 5JDJA 5KSAB 1U2CA 2HT4C 1MQKL 5KANI 2XXCB 3NCJL 1MIEH 4JLRB 1JVKA 2D31B 3RL2A 5MP6H 1L0QA 2FWOA 4WFFE 1CXKA 2ADJB 3BN9D 3FT2B 3DUUB 3ARFB 2ZSVB 2IJ0C 3P30L 1IT9H 4JANA 2P5EE 4HT1H 4AH2B 3A6CH 3UYOD 4Z8FL 4NKIH 3VI3F 2X4QB 5H94A 2VXTL 1MFBL 4HUMB 5E8OB 1QYGL 4D9QD 4NQCE 1M4KA 4XMKH 5I17B 1BQSA 1S78C 2A9NL 5HJ3A 3GKZA 1MCBA 4PY8J 1FE8L 2CXGA 1NFDB 3VFUB 1KJ3H 1IC4L 4NO0D 5F96L 3SO3C 3EOBB 5KVDH 2VZTA 2K7QA 1NDGA 4XNZB 5DQ9A 5JOFB 3RWJA 5IFAL 1U8KB 1XGQA 4XC1H 3EAKA 4AY0A 2EIZB 4F7PA 1A6VL 4ZSOE 2Z8VC 1VFOA 4NN5B 5CUSL 1OP9A 4ODWB 2NW3A 4JQXA 1EDQA 4QHNA 3SCMC 3FB7B 1CGYA 3SBWA 1NJ9A 1G7JB 4OZGE 2Q87A 4FXKB 5EBWB 2HLAB 3MOBL 4HD9A 3GSNB 5ITBH 2B0SH 3NCFB 4PJ5D 1JYNA 1DCLA 2A6DB 4PBWD 2VDNH 4HHAA 4K3HA 3H0TB 5DC9B 3CLFL 3MUJA 2YK1H 2EKSB 4P4KB 2YRPA 4PJXE 1OW0A 4X7SL 3L6FA 4OTXL 5CEZD 1YMMD 3C08H 3QQ4B 4UV4L 2BSSB 2NTSP 3IDXL 1D6VH 1GVIA 3LRGA 4Y5YC 2XYCA 1GIGH 3FO1B 3VFWB 2ZOLA 3MRKA 2XZZA 1HYSC 5I18H 3TIDB 1B0RB 3CMGA 3ALPA 4WFHD 5GGRB 1F3DJ 1MRCL 1NCTA 1OAQL 1S7WB 3LMJL 4P3CH 4FFYH 5IMOB 4A2LA 3CMOH 3TC9A 4LGRB 4Q2ZB 3NIFE 4N9GB 3WJLC 4HBCH 5IW1A 1LDPH 3MRIA 1NMBH 2EC9U 5GGSA 2ORBH 1KCLA 3X14A 1NFIB 5IW6A 4ZFOL 1T83A 2EEDA 1XF4B 3H3PH 3KR3H 3RNKA 5LBSL 2X7LB 4WVRA 2ARJB 3ARTA 3MLSL 3MO1A 1VERA 3VWJB 4JFFE 3SDAD 4JRWA 3ZT5A 5JPNA 3VGDA 2PO6B 3EHBC 4P5MA 1IQWL 4OSUL 1U2HA 5F7YC 5E9DB 1D9KA 1S9WB 5JDSA 1ADQA 4HWUA 3MBEA 1A6TB 3X13A 3IAGC 4GQPH 3G6AA 5D7JD 3VWKA 2NY6B 1F11B 4OZHB 2J8UA 4TVPL 1P9MA 4PG9B 2P5WD 2X4NB 3DVNB 1X5GA 4KVNH 4PJFB 5DMKB 4C54A 4J12A 1A7OH 2EO9A 4RMQA 5CJ8A 3MJ8B 1RIVL 4JY4B 3MV9B 5DS8A 1SJHA 4HJ0D 4J1UA 25C8H 3TVMD 5JZ7C 2H6PB 2GCYA 2W65B 3IKCB 3QIBC 3P4MB 1V3MA 4X5LA 2B8OT 3MGOB 1B4JH 3WD5L 2XRAH 4Y2DB 3SN6N 1CIUA 2XI9A 2NY0C 2Z31C 4HPOL 4LSPH 3OKDB 1QSVA 3PHOB 5FV2A 3U79A 3EOTL 3MJ9L 2L0DA 3QIWC 1PQZA 3B5HA 2A9MH 3NACH 3PQYA 2R2BB 4HWBA 1HDMA 2H8PA 2E7LC 5DRNB 1WGOA 5IBUG 3DTXB 5L9DH 3HE6A 1CIDA 4EJ1C 4ZNEA 3O6ML 5KVGL 2ED7A 4NSKB 5TDPA 3QA3A 2BC4A 1A7BA 2AVGA 5ALBL 3ULVH 1JHLH 1GZPA 2E8ZA 3HS0A 3NIGE 4TSCH 3MJGX 4H5SA 1QSFA 2FX8L 4PBXA 5TE7L 4PP1D 5F6IC 3BPLB 3RY6C 2DBJA 4UQ3A 3TBVB 1CD9B 1DLHB 4X6DF 5ANMB 4EI5B 2EZ0D 1ZOXA 4I0PC 3WNKA 2AW2A 4JVUA 5I66A 4OB5L 4K7PX 3V5DA 3JV6A 3TO2B 4GG8A 3QCTL 4KKNA 4S1QH 5HGAA 2YD6A 1VGEH 1RZJH 4H88H 4L3ED 1KIRB 2DS4A 4P2RB 4FZEL 1DBJH 5IMKB 3ARBC 3UJIL 1EHAA 4ZXBA 3LKRA 3O3BB 4L5FH 4PD4K 5DYOA 3QUMA 2X9WA 4UT6L 5EOTB 4LAJH 5LQBH 1ONQB 1E4XL 4JFEB 4HIEA 3MLYL 3OJDB 2AXFA 3IDIB 1L7IH 2KQNA 1QR4A 3FMGH 3O2VH 4QRTB 2YD7A 1IC7L 2BNUB 4MA7H 3TWCH 1J05B 4NHCL 3SKNA 4K71C 4MAYA 4JN1L 5CEYA 4HS8L 1HXYB 1EFXB 1LD9A 1NFDE 3PGFL 2ZUTA 2BSRA 1K8IB 5ACLA 2IC2A 1NSNL 1SBSL 1UM4L 2GK0A 3WV0A 5I1JL 4G7VH 1PFCA 2APBA 3HR5B 3QUYD 4P2CG 2EYTA 2FO4A 5GSRB 5IJVA 5H37G 3KYAA 4ZFFB 4XTRC 4LOUC 4PRHB 1A4KB 1PEWA 3BEVA 3D2UB 3LS4L 4YE4L 4D8PA 5HYSB 4KK5D 4Q6IB 1XAUA 4FQQA 1BZ9A 4NM8L 1KCSH 1P4IH 3ZE1E 5DVKA 5EN2B 3GMPA 3V8OA 3INUL 2BMKA 1T1XA 1KN2H 4CMHC 3VFVA 1DVFC 4HGMA 2IQAA 5B39G 3R8QA 2JCCB 4NQVB 4O02H 1DBKH 4MB3A 5HHVL 2F74A 3UZQA 2R2HB 4M3KB 3TNMB 2FJGA 2EICA 2F5AL 1KB5H 3IXTB 2AXHA 4DUWA 3BRFA 1U58A 2D7MA 5KVMC 3WSQH 4UT7H 5IJKA 5FYLL 4ZUVA 2R4RH 3L3GB 3BSZH 4Z7QF 5IGXL 2GJJA 3HMWH 2PYFA 5FYKE 2RCSH 3UTZA 1JPTH 3L7EB 1MCWM 3LN4B 4QRUA 3U2SA 3ZYOA 1IQDA 3RVUD 5K93A 4GG6F 4LU5H 3T65B 5JHLH 1EBPA 4Y4KA 1O7SA 4NBXB 1BQHG 3LEVH 2A0LC 2R56H 2V9QA 5DQDL 2VXSH 3I6GA 2OR7A 4PV8B 1KNOA 1HI6A 4ACPA 5C0FA 4JGJA 5E9DE 1Q0XH 3NIDF 2NLJA 4U6VL 5EBLA 1F3RB 1NGWB 5F7WC 4KK6D 3LH2L 4MQ7A 3TT3L 5DD5L 4OZHE 2BVQB 4HWZB 3BUYB 2NTFB 2C7UB 1YECL 5E6YA 4KTDH 1WBXB 4PJFE 4G8IB 3BAEL 5DD3L 1FLRH 4Y0GA 2AS5M 3KXFB 1L0XA 4DK3A 3O9WB 2NX5A 2H3NB 3UPCA 1NCWL 3LD8B 2J12B 3MR9B 3MV9E 1X5JA 4BQCA 3FO2A 3VXPA 4YHML 1AJ7H 4J4PD 1DANU 2W0FA 3VGHA 4KTYA 1A5FH 3C8DA 2ZJSL 3GSRB 1MLCA 2YUWA 4Y5XA 1WTLA 4IRSD 4Z7VA 2GJ6D 4IRJC 1ED3B 5DJ0B 4FQ1H 2P45B 3PQYD 3BZ4B 4JM4L 3H9ZA 3T2QA 4KKCC 4KKAC 2COQA 3GI9L 3IDYC 4YZFF 3ZHLA 5DMGD 4GOSA 5D71L 1INEH 3ZTNL 4NNPL 3VD5A 3P11H 4KRMB 2C3VA 2R29H 2LVCA 4A6YA 3OKMB 3SJVA 3QDGB 4LIQE 3ARYA 4F33B 2E7BA 3E3QE 4LKCB 3GK8L 4I3SH 3HCVB 4HIHA 3B9EA 1M71B 5GGQL 1FVEA 4HKZB 5B39A 1BF2A 2XTJD 2PNDA 4JG0H 4XBGA 1A9EB 8FABA 4RAVA 5ANME 4F8QA 5BMFH 1UXSB 5SV3A 2A73B 5DJ8A 4DZ8B 2GTZB 5A1AA 5HGBA 4NQEB 1TQBC 2WZPD 3FN0H 5IQ9B 5F97E 3EO1B 1E4WH 5CSGA 1TIUA 5HHOA 2ZCLL 4E41B 3DLQR 4P2RE 2NY4D 3QQ9D 1B2WH 2AJZA 4NYLB 3CIQA 4PJDF 4R96B 1A7RL 4M7LT 3FN3A 4WHTB 1IJ9A 3VI3E 3BGAA 4Y4HC 1T22B 1JGDB 3CH8A 5DR5L 3TH2T 4JFEE 2PW1B 4ODUA 2DM2A 3CDGB 5J56B 1BQHA 5T1DH 1VACB 5B8CB 4KRLB 1D5MA 3NPSC 1PZ5B 1YMHB 2P5ED 2VXQL 3EJYD 4AMKH 5EFIA 3SY0B 4MB4A 2BFVH 4G6MH 4U0QB 3C5ZC 4TQEL 4JDZB 4NT6A 1RQ5A 5DC0A 1DQQB 4PGJA 3EYSL 3UP1A 1KB9J 1ZHLB 3RWIA 5L8LB 4Z77B 5CEXB 3LVEA 2DTMH 3SOBL 4U0RB 2VZUA 1BFVH 4OZ4B 4G6KL 5D1QA 1S7TA 2EDFA 4B5EA 5LJYH 1UWXH 8CGTA 2CPCA 1NCAL 2IPTH 4MA1C 5ESQB 1OTUC 3PWNA 3L95A 1ORQA 1YDPA 2VLRA 1EAPB 3KS0J 1XIWA 4XP1H 3ZYJA 5C2UB 4KH2A 5T3XL 4S1SL 3SDYL 3PP3H 1OWRM 2CUMA 2IH1B 4XBEH 2G60L 2JCCE 3U7YH 4NO5A 2RFXA 3HC4L 1SVCP 3TFKD 2R2EA 3S4SG 2NY2D 3QDMA 3VXNA 2BSED 4PRDB 4XMLH 4I13B 2VISB 2RQ8A 5C09B 5FB8B 2E27L 4MNHA 1KB5B 4HK0B 4M61B 3RX8A 4IIQC 5E2TL 1CFSA 4ODSL 1IAIL 4Z7WA 3AXLA 4PTTA 4Y1AB 1EH9A 3UMTA 4RZCB 4YGAB 1A3LL 3E8UL 2OBGA 4X6EB 5I16A 3EIFA 5T1LD 1U95A 3VFSB 1A2YA 1J11A 4OCNC 4FMKA 5IV2B 3F8UB 1NGXA 3NAAH 4YAQA 5JHDB 2YUVA 3RGVB 4BH8A 4LBEB 5EBMB 1BLNB 3AUVA 2Q20A 3CVHA 4NDMB 2M1KA 4Z5RA 3G9VA 1Q9LA 1QBBA 3RUGF 1X5AA 3JWDH 5J1AA 3MACL 5JXAH 3O0RH 4S11A 2DI9A 1NMAH 4G9DB 5SX5H 2VLMD 4WFED 4MNQB 2AABH 2A6JA 2WW8A 1ZLVH 1KYOK 2WWKT 3HG1A 4HMDA 2O26U 2UZYB 3OKNB 1EVUA 1BBJA 1FN4A 3PNWA 5I9QB 4NQDB 5TE6L 1DN0A 1KEML 4CVZA 3QPXL 2UWEB 1NBYB 4FQXA 1C1EL 3P0VH 2HVJB 3TBYA 3A67H 5GQBA 1JZ4A 1X6LA 4DGYH 3BPOB 2IG2L 3FO0L 2EDWA 4HLZH 4K3DH 1AGFA 4GKSB 1FZMB 4D9RD 1MAJA 4OLWL 1YEFL 3E6FB 1T89A 1ULVA 4HUWB 1U6AL 1A1MB 3IDMA 1XGRA 4ZAKD 3EFFB 2OZ4L 3SDXB 1YEHL 1E27B 5BVJA 3QDGE 5GRJL 1CDGA 3WNMA 3LKNB 4JRXB 4OCSH 5KG9A 5CD5C 1KTDB 3HE7B 3L3IA 5CP3A 1GH7A 5TF0A 3ULVE 1CFBA 3TCLB 1UWXK 2ADIA 3QFDA 4HWNA 3GRWL 4X6FA 1X9QA 4XVSH 3BWUC 5FHAH 3A6OA 4DAGH 3IFLL 1BFOB 1IGCL 5KANG 5GZOC 5J11B 3BQUC 5IW3A 3V0WH 2EYSB 2HJKB 3RAJH 4NN7B 4RMVA 2CXKA 1VADB 3PP3K 2Y6SD 1UFUA 2IAND 3ARWA 4NWTL 1ZSDB 4NQEE 2WIMA 4GAJL 3S4SA 4R26H 4GKOA 2DIJA 1SYSA 1L4IA 2X1WL 1M6OA 5HI5C 3PWLB 1LEIB 1KELH 4M03A 3CXHJ 4HV8B 3ZKXC 1V7MH 5FV1L 4JAMB 4ONGH 2FEEL 5FXCH 5KSAD 3IJSB 1IAKB 4LCYA 2G2RB 4F9LA 3B83A 4ZQKB 3O2WH 3FRUB 1EBAA 2XA8L 4U1NA 3VXSA 3QUXD 1F45A 2PR4L 1DBML 1RZ8B 4I3RH 5E4IA 3FHAA 1P5UA 2NNAB 2QSQA 3D0LA 3QDJA 4NNYB 2E8YA 4JKLA 4MQXC 1NCCH 3C60A 3MRLA 1UB5B 2FGWH 2BY2A 3PL6B 4QF1A 5GZND 1CGVA 1MPAL 1B6DA 3QWRA 1XZ0B 2FL5A 3R06A 5DK3A 2VZOA 1G6RL 2VITA 1YEIH 1G1YA 5C70A 5KVEH 4MXVE 3QO1A 2ARWA 1JGUL 5F1KC 3IS1X 3J8F7 4AENB 5SX5K 2ZUQC 4NRXA 5DHYA 1G7PB 4LNVA 2J8HA 4V1DB 1ZLVK 4BKLB 3K1DA 3SDCC 4CJ1A 2P7TB 1FJ1B 2XQBL 4HIXL 4JJ5B 2NY7L 3MC0A 3O6KH 5L7XL 1MNUL 1LO0H 4YDJA 4GSDH 2HN7B 2R8SL 1IC5H 5BS0A 4AEHL 1S7RB 1A1NB 2R1WB 3ARZA 1A6WL 5J3HD 3GUTB 5KTEL 1JYVA 1TNNA 3EGSA 5DJZB 5F9WC 4RDQF 1HCFX 2AV7B 1U8JA 2W0LA 1LK2A 3GSQB 4J6RL 5T1KA 4HGWA 1UA6L 1QLEL 2VQ1A 3TA3A 2C3GA 4FFZH 3O45A 3NCMA 3GFUA 4HZLB 4YXKL 1FAIL 1CF8H 2BOCA 2DQDL 1A02N 1KSRA 3TZVC 3S37H 1B88A 3SGJC 3P4NA 5C09E 4Z7QE 4TNWK 2BJML 2IWGA 2YEZB 2UZXB 1J0ZA 4P4KD 4L8SA 3LCYA 4DWHA 1AC0A 1TITA 1R3JB 3TPUA 4JQVC 4HWEL 1OAUL 4Y1AE 5IFJB 1LNUA 1MELA 3KPRD 1KEGL 3V6OC 2X4OB 1ZHKA 2Z4QB 5CMAB 4XNMB 3U9PH 1UXWA 4LLYA 4HFWB 1KV3A 2RB8A 4NZUH 3MMEA 5JHDE 1HN1A 3LKQA 4XCFL 4L9LB 4U1HB 3DPBA 3W11C 3U1SL 4DZBB 1OARH 3U82B 2A38A 3G6JB 4JCMA 3VWJD 4JZJB 3VGAB 2PO6D 1BVZA 1Q72H 3MLZL 3QT2A 3H6JA 4X7EC 1KOAA 5DK0A 5D5MB 1Q9WA 4GW1B 4JFPA 4OCXL 3C8KA 4NQDE 1IAOA 4BH7B 2NY6D 2C4XA 2DOCA 2UWEE 3R0MA 1ES0B 1MIML 3SKOA 1PKQA 2AJUL 2XY1A 1I4FB 3B8YA 3VXRD 4MCZB 5DK2B 4GKNB 3D3VB 4ISVB 2D03H 2Q86A 4L3CA 4XNYH 1EAJA