3QR2A

Wild type cd147 ig0 domain
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
117
structure length
117
Chain Sequence
b'MAGFVQAPLSQQRWVGGSVELHCEAVGSPVPEIQWWFEGQGPNDICSQLWDGARLDRVHIHATYHQHAASTISIDTLVEEDTGTYECRASNDPDRNHLTRAPRVKWVRAQAVVLVLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Basigin
publication title The Retinal Specific CD147 Ig0 Domain: From Molecular Structure to Biological Activity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 25
structure length 117
sequence length 117
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13927 Ig_3 Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qr2A00
4FFVD 5KG9A 2Q6WA 1A4KB 2Z31D 3CSYA 4PPTA 3F65A 5I15H 3LQMA 3CXHJ 5BRZA 1YDPB 4X6BB 1DQLL 5F1KC 2F54D 4O5LL 4P0DA 3WD5H 2E9JA 3KPPA 4KI5F 4TYUA 1DUYA 5EO1B 4X99A 2FZ3B 3QWRD 5JNYA 1XF5A 1NPUA 4PYGA 4XP6H 4AIXA 4JQIH 3WDJA 1I1YA 1FBIH 4M4RA 4AIZB 4RZCB 4YXKL 3CLFH 1NFDF 4XPHL 1BQHG 3UTPD 4MA7L 3FAXA 4E0RB 3UO1H 1BQHB 2CSPA 3L3GA 1M05B 4PJGA 2J12B 5J4MA 3GO1H 1KLGA 4X98B 4Y1AD 5E24E 3VCLB 3OX8A 3F7VB 4HZLB 5JA9A 1XF3A 3D5OF 1U8NB 1MRFH 2YPKA 3BEVA 5EOQH 3WLBB 5DF0A 2W9DH 2AXGB 1UFUA 4R4BA 3NN8A 4XCYA 5F97E 4LFHG 5IVNA 5FYKE 3GO1L 3SQBA 4LSSL 4KJPC 3S36H 4NQXA 5IMMA 1MWAA 2HAZA 5JW5B 1IKNA 3L1OH 4YGAB 2XICA 4KMTH 3BSZH 2FNBA 4Y16C 3SOBL 1S78C 5JW3H 3BW9A 4BYHA 4DJMA 3BQUD 5ADPH 4PJEB 1YEKL 3QISA 5DMGC 3D39E 5FKPA 3BZ4B 3K8MA 2OR9H 4FXKA 3LKRB 3ROOA 4ZFGL 5GGUA 3QZWA 4KMTL 5HDQH 3QNZB 1VACB 1Z3GL 2J6EL 2WIMA 3PHQA 5DJ2A 5I76A 5EO9B 5EB9A 1RK1B 4K7PL 5LVEA 1TJGL 4BSWB 2KKQA 3AGVA 5FO7B 3MYJB 3DYMA 3SDAC 1HOCB 2B4CH 4XB7A 4QCIA 2PXYC 4I48B 5C0IB 3STLA 2BMKA 2P4AB 4JDVB 4LAQL 4YBLC 4HGMA 4OGYH 5KSBA 4JRYA 2XZAH 1EVTC 3FRPG 4RMSA 5A2JH 2CXGA 3LPGA 5A43C 5BVJB 2AV7A 1CXEA 3EZ8A 4Y4FC 4G6FB 4LVNC 35C8H 2WNGA 3DX6A 2DOCA 2NY5L 3CH8A 2IQAB 2VUYA 3B9KD 2ATKB 5DMYA 2XWBA 4PV9B 3ARRA 3VFPB 4ZG1A 1HK6A 1I9IH 3F8UB 1RIHH 4NZRH 4CVXB 4UI2A 4P3DB 1KTLB 35C8L 3STZB 4HS3A 4Q9QL 5I1CL 1JFQH 4LMQE 5BOZG 4Y4HB 2G5BB 2A0LD 1I7ZB 2MWCA 2ITCA 1Q0YL 4NGHH 3RZCB 4GRWF 4TSCH 5H35A 2M2DA 2ARJA 4GLRH 3BIBX 5EFIA 2RHEA 2EE6A 1ZT7A 1JFQL 4Q7DA 3EZJB 2CLRA 1KEGH 3FT3B 1AR1C 2QADB 3KPMA 3PQYA 4JE4B 4TTDC 3V4UH 4PG9B 1F2XK 4NJAH 5ITFA 1TZIB 3D18A 1MNUL 4NN5C 3RZCD 4L4TD 4DEPC 2P5EB 4JZNA 2W65B 3PHSA 4YBQC 1W0WA 4O58H 1INEL 3V4UL 4Y5XA 2VERN 3EDFA 4C56D 2QADD 1IE5A 4N0FA 3MV11 4OI7A 5T1LA 3DIFB 5ICXB 3IJSA 4LVHB 4L3CA 4OSUH 3UYRL 4ZSOA 2P5ED 2OXGA 1EUTA 2EDNA 5B38G 5ANME 4MQXD 5B38B 5K59E 4RGMC 4GAGH 5FCUL 4C4KO 1CYGA 4HC1L 1ZHBA 4XP9H 1SVCP 3BP4B 4JKWA 3PWNB 5CEXA 2YN5A 3DVGB 1GOGA 2DQJH 4RNRA 2AV1A 2I24N 1LEKA 4JKMA 1R3KA 1T3FB 4GAGL 2D4FA 3NZHH 5DK3A 2F53E 2N4IA 4BH7A 3H7BB 3S35X 4LKXB 4TTGA 1NCDH 2DQJL 3NFNA 2PYEA 4ZYKB 1RULL 3SJVB 5E2VL 4Q58C 3QPQD 2FH8A 2YD2A 3KPOB 3RKPA 3U36B 4F8TA 1OAKL 3JWOH 1F58H 3HNTL 4JREC 2WSKA 4AK1A 1QFWM 1ZHLA 1KPUA 4FXGB 1H5BB 3LKQA 4JO4L 3BKJH 1HNFA 4UT7L 5IK3A 3HE6A 3QQ3B 1AHWB 1CXIA 3DRQA 4OM1L 4KKNA 3O3DB 4ETQA 2IMNA 2FJGB 4XI5D 3IDIB 1FYTB 4XHQA 1MH5A 1CD9B 4UBDC 4WI6A 4J8RB 4Z5RB 5KBNC 3VD3A 1AGDA 4U6VL 4EQ2A 4RMVA 5TE4L 1BHGA 4OZHB 1MCHA 5KANI 1TQBC 4B53A 1GGCL 3BQUC 4POUB 5GS0H 4OT1L 1F3JB 1FYTD 5EULV 4PD4K 5MENB 1CE6A 1IC4L 1BZ9A 2P47B 3WIHL 4TUJA 3TH3T 4F57L 3OKEA 1O0VA 1VGEH 4LSTL 4QLRA 1J5OL 5E8OB 4WV1A 1OLZA 4XP1L 3VD9A 3LD8B 2IMMA 3P4OB 5EU5B 1F3DJ 3MTRA 2X1XR 2DM2A 2NY1D 3QI9C 1VGEL 2VAAB 1EGJH 4JEGB 1A1OB 4GG6F 4DKFH 5L2KE 1Z5LB 2OS7A 5F9OL 2J3SA 4P9HH 1T20A 3B9KC 2Q1EA 5CGYD 4Z7VA 1AGEA 4MA8L 4QRRA 3LN5A 3WUWG 4A6YH 2B2XH 3QIWD 4NNXA 2BNRA 3WUWB 2NCMA 5TGBA 4BQ9A 3NCEB 3SN6N 4OGXH 3QUXB 1G7MA 2CK2A 4LLWA 3GK8L 1P7QD 1QEWA 5HYJE 2A0LC 1A22B 3H9HB 5DC9B 4A6YL 4ZUTA 4UMGA 5CLWA 1KCUH 1J8KA 4CDGC 5CWSA 3V6FB 1ZT1B 2V5SA 3BUYA 5JOFA 5C8JB 5D1ZA 4U1KA 1BVKB 1AKJA 3WO3B 1KCRH 5FHBH 2R23A 1EO7A 3KPSD 4BFGA 5EZIL 3BPLC 2ZPKH 4UIMA 5MENE 3BPCA 2XKUA 3I6GA 1KENL 4N9OB 3B9DA 5ESVA 3U46B 3LRGA 3BRGC 3O3EB 4Q0XH 5FHBL 2ZUUA 4XVSL 4NRXB 4LGSB 1QRNE 4OFYD 1YJDL 2AXHA 4EI6B 4GG8A 1WC7A 2M26A 3P11L 4URTB 4PB0L 2PW2B 4Q0XL 5H2BA 2Q6WB 4P5MB 2BOBA 2NY6D 3ROLB 3AU1B 5BRZB 5M95B 5EBMA 4XWGH 4KQ3L 3OR6B 3EO1B 4P2OD 5JXED 1OPGH 4G6ML 1P7HL 2I9TB 2APBA 3OKKB 4L9LA 1OP9A 5KN5A 1U41A 2C9AA 3GJEB 3M45A 4W81A 1KCVL 5F6IC 1VEMA 3MRPA 3TBSA 2R1WA 1OPGL 1MJUL 1RURL 1X5FA 1DUZA 5BRZD 4KTEL 3VRLF 1A3RH 2R2HA 5FYLH 4OIIL 5HYIA 5CZVL 4HKZA 5C3TA 4JPKL 1V3KA 3MC0A 3OGCA 4PJGB 4PJFE 4QTHA 5I8KH 2GK2A 1F42A 4UAOC 3QHZH 3FB8A 3OX8B 1UZ6F 5FYLL 2PTTA 2YPKB 3HZYA 3K46A 1B0GB 3X11A 3QPQC 5GSRA 3MMEA 1MWAB 3ZSSA 2DICA 3ZDXF 4AENA 1GL4B 4PRNA 3FQNB 5CEZD 4CN1A 4NBYB 3BW9B 1VFUA 3D85B 2HVKA 3NCMA 4XAKE 4FXKB 5DYOA 3TPKA 5D71L 1F4XL 1MEXH 3MCG1 2ESVB 1ZE3C 1YNKH 3T0EB 3VXTA 4PJDA 1H3TA 1U58A 4PY7B 4RAHA 3HUJE 3CZJA 4HUWB 1MQKH 4EDWH 5FKAB 3RNKA 4OZ4A 4NQSA 1P84J 5I71B 5T3XD 3HZVA 3IDXH 3GSOB 5FK9A 3WN5C 4Q2ZB 2E27H 2ESVD 4NZTL 4PJ7E 5KSBB 5GISH 1BIHA 5BJTA 4X4XA 3VD5A 1U8PA 4U7MA 4TUKH 3QCVL 3O2VH 2P8PA 2NXYD 3DX6B 4RX4A 4U6XA 1D7FA 3N0PB 2DLFH 3AY4A 1N4XH 4FQIL 5GISL 3BP7A 3PGDA 2XWBB 5EUOF 5D8JL 4EQ3A 4U33A 4A2LA 2XY2A 4N9GA 4JRYD 4I3SL 3T77A 2NY1C 4HH8A 5ADOH 1CQYA 3MLUH 3FT2A 3C60A 1CD1A 1KJ2L 1FLRL 5CGYC 1OGTA 3QIWC 2E6QA 4JO3L 5L7XL 4NC0B 5ADOL 3DGGA 2ARJB 2XWJA 3TJHD 1GAFH 1ADQH 2IH1B 5FYKU 3WJLC 2YD1A 1RZ7H 3UJJH 1JUFA 2VYRE 4APQA 1J0KA 4X6FB 4M7ZB 1A0QH 2C3GA 5CJXA 3D18B 4NHUA 1KIPA 5DUMH 4JZNB 5C0CB 4CUCA 5IV2B 1RZ7L 3RDTA 4OM0H 3RIFK 2R9HC 3E2HB 1EEYB 3U7WL 3X3GH 5ESAA 5EU6A 3CK0H 3IS0X 3CZFA 3HMXL 3FFCA 2J1KA 1S7QB 2VXQL 1LK3H 5DA0B 1FO0A 3PQYD 1J7VR 1P9MA 5DUML 1EJ6A 2QSCL 5I8EB 1LP9A 1GGBL 5I2IA 3O4LE 4PRHA 4L3CB 4ZSOB 5DRNA 5C0CD 3DO7A 4OQTA 5I1LB 5DHYA 3MODH 5FGBA 2QV2A 1NUNB 1UB5A 4R4NC 4RGNB 4P5KB 3VXMB 1RU9H 3U7AA 1FV1A 1NCWH 1ZHBB 1ZWIB 1AGFB 3I6KB 2P5WE 5IFAL 2Z8WC 4OD3H 2NY6C 3MODL 3LIZH 4M8VA 2AV1B 4NWUL 4P2OC 5JXEC 3PL6A 2OQJB 1KXTB 1I3VA 4UQ3B 3HLAB 4HBCL 1MCLA 5KJRH 2ZP0T 4U1GB 5HYFA 1JNLH 2BFVH 2CKNA 4RGND 4XNZC 4ONOA 5BZDA 1CGTA 4YDIH 5IHZB 4K3EH 3RVTC 4LMQI 4OAWA 1QBAA 2CPCA 5DTFA 1S9KC 2FYYA 2ICWJ 1CLOL 1CDIA 3KXFE 4YDIL 4JY5L 4K3EL 2BVOA 3F6IA 1ZHLB 3QFDA 4Z77B 2WBJB 4KI5E 4PY8J 2DKSA 4C59B 4F37K 3VXQB 3B3IA 5GZND 5ALCH 5IK3B 3B83A 3O11A 2PYED 2NW2A 1CF8H 1ROWA 5EZOH 3ET9F 3ZHKA 3OB8A 4NKMB 1JGVH 1NGXA 1PKQE 4S1SL 4G5ZH 1NL0H 1RUAL 3NACH 2HT3D 1NFDE 1LD9B 3KYKL 4NC1E 5E08L 5E8PB 2VIRB 4PJXA 3HE6D 1KB9K 5AWNH 3DV6B 1JGVL 3WKMH 1NL0L 3NACL 1WTGT 5BOPA 3JTTA 2BRRL 1K4CA 2Z8VC 3IDJB 4PP1D 1U8HB 1WZ1H 1T1WB 1CE6B 1BZ9B 1IC7L 2YD4A 5IUSA 4QRQA 1DLFL 4X9IA 1IKNC 1C16B 4OZGA 1F5WA 1UC6A 5JIKA 1Y0LB 3TLRA 1JYWA 4JHWH 1FFPA 3X17A 4GRWB 1P4IH 1NDGB 3MRFB 3UJTH 2HN7A 5E8NB 4WCYH 1YYLH 4JFXB 5D93C 5FB8A 5I1EL 1HNGA 4FQLH 4JHWL 1NMCB 4HWZA 2RJMA 1AXTH 3UJTL 1GZPB 1BOGA 4U0RC 2IC2A 2NXYC 3D25B 2DLGA 5C0AB 1VFOA 3D6GA 1AGEB 4GAFB 1I3GL 3LN5B 4YHLH 4I3RL 5C07B 2A6IA 3T09A 1T5WA 5EPMA 4NP4L 3MA9L 5AAWA 5CSGA 4JZOB 1YMME 1R3JA 5IKCA 3HG1E 2HWZL 2XKNA 4PD4J 3OBAA 2FIRT 2H32H 4JAMA 5FOJA 4ZUSA 1T21B 4LRNL 4K8RC 4PRBA 4QRRD 3VU2A 1R3LA 1S7RA 4YUEH 2BNRD 4M5ZH 1PDKA 2YD5A 2OZ4A 1KJVA 2XZZA 4XPFL 2R23B 1N7ML 5ACLA 4ONGH 1HQ4B 3WXWL 4DZ8B 5AG8A 1X5JA 3O3BB 5LCVH 4MB4A 1J0IA 3I3EA 3BPOC 1JTPA 3AS1A 5JIHA 2W91A 3GSWA 4NO0A 1NJ9A 4OUOA 3C6SB 4Z7UE 4ONGL 5D1ZD 3QPXL 4GRWE 1AKJD 5T1DH 1MPAL 1ES0A 1KXQE 3E0GA 5LCVL 4X83A 2ZJSL 1WAAF 2FIKB 3DXAA 3KLAB 1RVFH 1NBYB 4R0LB 4AH2A 3PNWB 5EBMB 4R26L 5TDNB 1E6OH 4BK4A 4BFBD 5HI4C 1I7RA 3N9GH 3VD7A 4KVNL 1HH9A 1BF2A 1W72H 4Y5XC 1OTUD 1EAPB 4IRJA 2X1PA 1A3LH 1L0YA 1YN6A 1C8PA 3MRPB 2YK1H 3QUMB 4OF7A 4QXTA 3TBSB 2VLKE 4F9PA 3EAKA 5I1DA 1DUZB 1G7HA 3PP3H 43CAA 1N26A 2L7UA 2R2EB 1YC7A 4XVTL 5JUEH 4LOUD 3BHBB 3MR9A 5MHSD 1P53A 1GZQA 3N85L 4RGNC 4TVPH 5J11B 4M7KH 1QYGH 3ZYZA 3FB8B 3GZKA 2NY3B 5B3NA 3QUYA 1A21A 3HZYB 2WWKO 4NQDA 1CZ8L 4M1DH 1KUMA 4ONHB 3X13A 3RBGA 5I66A 3RA7L 4AT6B 4V2BA 3UTZA 5C0FB 3INUL 4U1GC 1OQOA 1RHFA 4YDLB 1OB1A 4DKEH 2X4SB 3BKML 5IWLA 3I2CL 1NLBL 3QXAA 5C0BB 1FORL 4AENB 2FJFA 1CU4H 1T1ZA 4TUOA 3M17A 5IJKA 4FTVE 1KN2H 1IJ9A 4M6NH 4PRAA 3GNMH 4DKEL 2HT3C 4BZ2H 3A67H 1ZA3A 5GRUL 4F58H 3SO5A 5GJSL 2IQ9L 4QRUB 1G0YR 4UINH 3TGXA 1NCUA 5DGQA 2UV3A 5C0BD 4GG6B 2J8UA 3HE6C 4NFCA 1XGUB 3GNML 3Q5YA 1QSFB 3O6KH 2FX9H 5JHDE 3ZKQD 3RWGA 4NQSB 3BXNA 2MCG1 5EBGA 5DJ0A 4PP1C 5FK9B 3GBML 3U4BL 3EJZD 4QRPE 3TT3H 3EJJX 1BFVL 3HPJA 1PLGL 5KTEH 5ANMA 2GAZB 4GRLA 3H9SB 3J8F7 2MSPA 4OCYH 4ZUWB 3D0LA 3K80A 1QSFD 3PP3K 5TFSL 4U6XB 4ZUVB 1RIVH 1S3KH 1FH5H 1GC1C 3H0TB 2NW3A 3BP7B 3PGDB 4MQTB 5DFVD 2FX8H 1F4HA 3H9SD 1GXEA 3B43A 3DUSA 4WWKB 2F53A 1QHPA 4F33B 3GHEL 4HK3J 4S1DD 5SWSE 5ISZE 2ENSA 5CCKH 1VDGA 2PW1A 4M9OA 2W0FB 4RFOL 4RX4D 5HVHC 5T1MA 1EHNA 4WV1C 3QUZA 2LU7A 1BREA 4ZXBA 3GM0A 2UUDH 1L6ZA 2XWJB 3Q6GL 1C1EH 4X6DB 4OGZA 1JUFB 4APQB 2YWZA 4KJYA 3QJFA 1BP3B 1G84A 3OKOA 1DBML 3C60D 1S9YA 4OLZL 4XNMB 5K9JH 2VXSH 3AAZB 3T1WA 3MXVH 1KIPB 4GG6E 1C1EL 4KUZL 3VFOB 4EI5C 5IW3A 2EH7H 5E7BA 1FGNH 1FFOA 3UP1A 5KVFL 4APQD 2DWDA 2XIDA 3F7YB 2VXSL 1FO0B 3MXVL 1IM3A 3FO2B 4NT6A 3GKWL 2Y1VA 2EXYD 3MZTA 3N1MC 1DBBL 4X6CF 4LIQH 3DO7B 2VMFA 4R7NA 1Q8MA 1FGNL 2X7LB 3RDTD 5D1ZC 4JN1H 5EU6D 1UB5B 1INQA 1UH2A 3FFCD 1SEBA 3C5SA 3ORJA 2V2XB 4X80L 1OSPH 1RUKH 2X4QB 5DEGA 3AVEA 5DT1H 2HT4D 3M1BA 2YUXA 4PRHD 1FAKT 1Q72H 2BVPA 4K3GA 1B9ZA 3JVGC 3PL6B 4MX7A 1AE6L 2VDNL 3GHBL 4DVRL 3IFNL 1TVBA 2R4RH 2H1PH 1OSPL 1RUKL 4HHAA 4HJGB 1K8DB 4YZFE 1OTUC 1X5XA 4OLXL 1ZGLP 1SY6A 3AC0A 2BSSB 4X6EB 1UEYA 1IGIH 3TJEL 5HPMB 1XF1A 2F5BH 4FNLH 4AQOA 1FG9C 4UIKL 4WFGE 5MERB 4WW2B 3OAUH 4HIEA 5EU3A 3H42H 3PL6D 3WNPA 2PKDA 4ZFOA 4LRIA 4L9LC 2J88H 4P2CG 4P3WA 2UUDK 1UJTA 3S7GA 1NAKL 3UTQB 4DGIH 1IGIL 4AM0B 3D9AH 2RB8A 5DJAB 1WVZA 1K5NA 3L3IA 3OAUL 2NW2B 3SKMA 4K7FB 1KB5A 3FQRA 4PG2A 5HYJA 4Z0BL 3EIFA 4OD2A 1FNSH 1NGXB 1HHJA 1U3HB 3VG9C 2H3NA 5IHUH 3LZFL 3VRLE 1WF5A 4P59L 2ZNWA 3IS1X 1I9RH 3TPUB 4JPVH 4D0BA 5C9JB 4D9LL 1TFHA 1UZ6E 1U3HD 4NUGH 3TNMA 4NN6B 4GRMA 1ZTXH 4XCFL 3I9GL 4QRQB 1SM3H 2A6DB 4OZGB 1QRNA 5BV7C 1AXSB 4NKDA 2P1YA 4M8QA 1I9EA 5F3HA 1UB6A 3FKUS 1EHLL 3LQZB 4JM2A 2NTSP 1LO3H 3LSOA 4WRLA 3ZDXE 4JFYB 3GIZH 2HN7B 3QEGH 5D7KE 1JWMA 2WUCH 2HKHL 2OTWB 4MS8C 2DMBA 3REVA 1LE5B 5GGRA 1YNTB 1G0XA 2YXFA 4HWZB 2DBLL 3R1GH 2HVJB 3ALXA 1LHZA 4PTUA 3UBXA 4XC1H 4RFNC 3T4AA 2YA1A 4PREA 4JG1L 5IVZA 4H1LA 1XEDA 2A6IB 5DFVC 2D7OA 1T5WB 2OSLA 5EPMB 2O26U 4UDTA 4MWFA 3UC0L 5GSVA 3QNXB 5DD3L 2NY7L 2VLME 2EEAA 3L95A 4PJFA 2VH5H 3SKUD 3D87B 1UXWA 2X1WL 5FYLE 1MCNA 1XH3A 3DWTA 1U2CA 3OHXA 3AY4C 1UWEL 4PRBB 3ULVC 2W59A 3EYUL 3GJFB 4X7FC 2Z92A 1EO8L 2FJHA 2ZKHL 3AS2A 15C8L 1T5XB 3VDAA 1KJ2B 5EUOE 4D0DB 3KJ6H 1KC5H 4M7JH 3C60C 2YPVL 1RZJC 3FL7A 3CGTA 2VL5A 3OKNA 1NBZA 4U6TA 3LKPA 4IDJL 4UOW0 2X4RA 4P5TA 1KC5L 3BFOA 3KDMA 5FYKD 1JYXA 3IB4A 1ES0B 5L0QB 3RX7A 1MUJB 3SHSA 1KPVA 3ECBA 1GRWA 4QRTA 1YYML 5JPMB 4S1QH 2EXYC 2Y7QA 5CJXC 3UDWA 2BY0A 4OQ1A 4U6HA 4LSQL 4G9DB 4XNYH 5CJ5A 4NDMA 4NO0D 3RDTC 4XNUL 4HF5L 1ZVSA 4WI9A 2FO4A 2IBBA 5GQBA 3HCVA 1RPQA 4PJ7A 3WV0A 1P9MC 2E9WA 5I1AB 4YO0A 1PBYA 1W0VA 2EDTA 2HT4C 3DXAD 4MJ6A 3VE0A 4FFYL 4LCIH 43CAB 3BKYH 4M43H 4ZPVB 5J6HA 5FGBC 4CAGA 4KGJA 1J1PH 3MRMB 5KSAA 1C5BL 1TJIH 1UH3A 4OZIA 4HCRA 1DBAL 4MNGE 4KUCD 4IRJD 4M62H 3NIGF 1T0NA 3QUYB 4M43L 2VXTH 4NQDB 2R4SH 1T0PB 5D4QA 2V2WA 2XA3A 4XXDB 3T3PF 2DQCL 1T04A 1TJIL 4V2CB 2CKBL 4L8CB 2X2YA 1A6VL 5M7QA 1U92B 4G6AD 1U8QB 1QBLL 2FRGP 5C0NC 2FJFB 3QG6B 1JPFA 1J8HE 3QUYD 4ODHH 4NQDD 4JFQA 4YC2C 1WFTA 4RCAA 3PWJA 1E28B 3HAEG 3R8QA 3OKLA 1ZA3B 5LXGL 3HAEB 2J8UB 3DNKA 4JFDE 5E8EA 4G6KL 4WUKH 4QF1A 3RWGB 4H8WC 3MPCA 2YZ8A 3O4LA 2R56H 1H3GA 2VXVL 1PY4A 4HUNB 1K8IB 1UM5L 4BH8A 4ZS6D 4OCMC 1WZLA 1D5IL 3D0LB 1CFNB 3HI1A 2OL3L 3UX9B 1SMAA 2H45A 4MXWH 4AYFA 2DJ4A 2Y07H 2P5WA 2AKRB 3KPNA 4DCQA 4U4BA 5FDWB 3O2WL 2K7PA 5BZWB 2Y36H 2JTDA 4RMWA 4YBHA 1XIWC 3MCLL 4GRLD 5DQDL 4Y2DA 4OV5A 4E41E 2VOTA 3IDUA 1BD2A 2AJSL 2PW1B 2GJZA 2ID5A 3TBTA 3QUZB 1OWWA 1P69B 2J8HA 3MRDA 4L1DA 3W81A 2B5IC 3SDDB 3TO4A 1XGTB 5F7HA 4N90E 1Z9MA 2BSRB 4O2FA 5IEKA 5DVKA 3RTQA 5CKGA 4ZO6A 5TF1H 3MX0A 4JCLA 4RBPH 4FABL 1KEML 2UZYB 2ICEA 5HHXH 1PG7X 3QUZD 1P4LA 4ZXBD 1NGWA 5F96H 5EA0H 3BH9B 3VJ6A 1PKQA 4UNTA 4CMHB 4I9WE 3G5VB 4DGVH 2X1QA 2DWDB 3GSXA 4YQXL 3LVEA 1G9ML 1KJMB 5IW6A 4M9PA 3MRCA 3SGEI 1NAMH 4OCSH 3VGHA 4LQFL 1JF6A 4GKOA 1I1AA 1V8HA 4X9HA 1X5KA 2CRYA 3TYGL 4LASL 5SWZE 3UTSA 2N56A 3MRLA 5T33H 5A2KH 1T1YB 5F44A 5HHMB 3QSKB 5EORH 2A1WL 3M1BB 1FRGH 3SE4A 5EZJA 4ZTOH 3V4VL 2EXWD 2QEJA 5ACZB 4C4KT 3KPQA 1EEZB 4PRDA 4WNQB 1CTOA 4DQOL 3X3FH 2ZUQB 4NJ9L 4ODWA 4HMDA 5EORL 4WI8A 3NZ8B 4N1CA 5L0QC 3D3VA 1LILA 2UY7A 3S35H 2XV6B 1QSEE 3VDBA 2XRAL 4DTGL 1WAAE 4IRSB 1FZOA 1E4KA 5I1GL 5EU3B 4UQ2A 4LF3A 5FEBA 4NQVA 1MFDL 4IJ3C 3MBXL 3RNQA 1U8LA 1K6QH 1WFUA 2AQ1A 3HI5H 2C7UB 2XQBH 3QYCA 5E5UB 5DD1L 1U91A 3MLWL 4IRJC 1KTKE 1JWUA 4FZEL 4F9PC 2YZ1A 2NPLX 4RBPK 3ZHLA 1IMHC 4G7YL 1KB5B 4YEEA 5C6TH 1FJ1A 4OCLC 2WLZA 1IGCH 5F7EL 4V1DE 2CGRL 3OXRA 5INCB 1MJ7L 1QFWH 2H3NB 1N5YL 4HZAA 3MA7A 3ZKSD 4W6YB 4LLAA 1FIGH 4HXBH 2RFXB 5KOMC 3QXDA 4K94L 5LWYH 1BJ8A 5E8DL 1QFWL 3FB6A 5D72H 4D0BB 3TBYA 3ULUD 4XPTH 5HHME 4LDLB 3VXRA 2OJZH 4U7SA 2FD6H 4HXBL 2YRPA 12E8H 1ZGLA 4KRPB 5DRZB 4Z7UA 5IWLC 5L2JB 4PGBA 3LH2H 1U8IA 2X10A 4M8QB 1YEJH 2YD6A 1WEJL 1B90A 4MJIE 4C83A 5IJKC 3LSOB 2ERJC 2LTQB 1UWGH 1N3NB 1QNZL 1JWMB 5IIEA 4MXQD 4RA0C 1YEJL 3SKNB 1DL7L 4I8DA 2DMKA 4GXVL 3P73A 1TNNA 3B9VA 4GXUM 4ZS6C 1QRND 5IROA 2ICWA 5I18L 1KNOA 5IG7A 4JM2D 1I3RB 4PTUB 3UBXB 4ESKA 2GQHA 4PREB 2VLKA 3K81A 4B0MM 3RY4A 1DE4B 5AUMA 4U1IB 3WDHA 1JGLH 4UDTB 1KACB 4GRLC 5GSVB 5EC2A 2ED8A 3NTCL 2BVQA 4MHHI 4BKLB 4GUPA 4NFDA 5D9SB 4P46A 2MKLC 2A9MH 4M4PA 5ERWA 4D9QD 3OKDA 5JW4R 1XH3B 4WU5A 3JWDL 3G9VA 1JGLL 4NO3A 4HLZH 1U8OA 2FSEB 2VDPH 3S96B 1N2RA 4TVPE 1ACYH 2D9CA 4PUBL 3SKOA 4D9RD 5HHVH 2BZDA 1JHLL 5BQ7A 2WM0A 4G8IB 4CJ1A 3JV4A 4ELMF 1EFXA 4ZTPL 1PSKL 2P48B 3V79C 5SV4A 5CP3H 4ZXBC 4N0UE 1UM6L 1E4WH 5FA3B 1I8LA 2JELH 4PFEA 2VL5B 1XMWA 1NBZB 5C0RH 4P5TB 3KDMB 4ZAKA 1NKOA 4JY6B 1A3QA 3SCMB 4GKZA 3PWPE 3ECBB 1IEBA 3PWVA 3QHTC 4FQJL 5DVNA 4GSDL 1H3UA 1S7VA 3NFPB 3GM8A 2X4PA 1VKXB 4MA1B 3CX5K 1RAMA 2G2RB 5JHDA 1EIBA 5DUBB 2AJYH 2VISA 2YSSB 3KS0J 1ZVSB 2ZZUT 3HFMH 4LU5H 4XAKD 1MY5A 4CMHC 2ZUWA 4P5TD 1CBVL 4UTBH 2C26A 2O93L 2FO4B 5CUSH 4NRYA 3S34H 1K4DB 5FECB 4MJ6B 3VE0B 3MSPA 1XCTB 2EXWC 3GSRB 2I07B 3CVIH 5E0QA 2DQFA 1I8MA 4X6CE 1CGXA 2BVUA 2GITA 4KY1H 4XC3H 2HFEA 3IDNB 1RUML 3FOMB 1T0NB 4ZQKB 3L5HA 2XKSA 5J6GB 3MLRL 3FB7A 4KY1L 5F6HI 5DRXA 2R2BA 4JO1L 2ZG3A 3EOBB 2MPAH 3NAAH 5KSAD 4LEXH 4PGEA 1DQML 2VAJA 1WIUA 4LEOA 2JB5H 3DMMA 3C8DA 3G5YA 1JPFB 1OAXL 4GBXB 1N59B 5C70A 3WS6A 5LAXB 1YEGL 4LRIC 1RJCA 2GSGB 5E6YA 2NR6D 3HS0A 5DURD 4K07A 3LAFA 3BGFC 1H3XA 4M48H 2ARJQ 4FZ8H 4CADA 4PG2C 4FQQA 4CU6A 5TDOB 4QF1B 4AY0A 1KG0A 3BEWB 4Q9BA 3EDJA 3IFOB 2ZUVA 4HWBH 3VFVB 1EFQA 3LY6A 4M48L 2ADJA 3WFHB 3VXPB 3E3QE 1IQDB 1BF8A 2YMXL 4LIQE 4UT9H 1OAQH 1XR8A 2VTFA 3FQXB 1N0LA 2MJWA 3ZE2F 3V7AE 3KPNB 5AD0B 4DCQB 3NH7H 4MLSA 5EOCH 3VFNA 3O4LD 4MXQC 3NFSH 1VFBA 1MELA 4XCEA 4HSQA 4M61A 2QQLH 3BP6A 1G7IB 3QO0A 5CJOH 2DD8H 1F02I 1IT9L 1IGML 2VABA 1LO4L 4JM2C 4ODSH 3GSNL 1BD2B 5C7XH 3TBTB 4J3VA 1JWSA 1NUFA 3OZ9H 5A16B 3W0WA 4DAGH 1G7LA 1ZLSL 3TO4B 5ECJE 5I8CA 2ARWA 1QZ1A 3AB0B 4MB3A 3BDXA 1DN0A 1EGJA 5IEKB 3RTQB 2CIIA 1BD2D 3MRQA 1Q9OB 2HKFH 1QLEH 2ICEB 2PO6A 4MAYC 4A6YA 3RP1A 1NGWB 4QRSA 2IBGA 3VJ6B 5JDSB 1FL5B 3TO4D 1KYOK 3MNZB 1A1MB 2HJKB 1CIUA 3UTTB 5J13B 2X4TA 2IG2L 4PGJA 3RTQD 1A6TB 4OB5H 3GMPB 4EN3A 3G9AB 2GY5A 3MRCB 3RRQA 4G80A 2YUZA 4JDTL 4GFTB 3DSNA 1FG2B 1JZ2A 4L9DA 5FHAL 2AJ3B 4O51B 3JV5A 4HDIA 3U6RB 1ZANL 4JFFA 3IU3A 3F6LA 3QCTL 3L3OA 1FSKB 1WGOA 4XP5L 5EZJB 1MCPL 4AL8H 1FFQA 1A6AA 5C0DB 4OF0A 4K71B 3GMRA 5ICYB 5LJYH 1AO7B 2GW5A 1CIDA 4M6MH 4PRDB 3EYVA 3U0PA 4KZDL 2OR7A 4P5TC 1QRKA 1I1AD 3EGSB 4ODXB 1EA9C 3O4OB 2B1AL 3UTSD 5L8JB 3TA3B 4AL8L 2AJXH 1HN1A 3PXJA 4I0KA 4OLUH 1VPOH 1TCRA 4PJAF 5FIEA 3U4EB 4M6ML 2BHYA 4XCNA 4FQ1L 4NQVB 3U9PH 2OM5A 1A14L 2OK0H 5C2UB 3SPVA 5TQ0L 3RNQB 1U8LB 1ZHKB 3GUTA 3PJSA 1XGPA 2OTUB 3K1KC 1VPOL 5GRJH 3RUGF 3D3VD 3RIAF 1U91B 1CWVA 4FP8H 3T08A 5CD5D 2ZWLT 1RY7B 5GGRY 1N64H 2P24B 1FJ1B 4OUUA 1EUUA 5GRJL 1F8TL 4CGTA 5KSAC 4KTYA 1MIEH 3L7EA 4JCMA 3QXDB 2P7TA 4JDZA 2E7LA 2ZSWB 3QA3B 2ZNXA 4MAUH 3GFUA 3S4SA 4N8PA 3RWFA 1P4BH 3NIGE 2DQUL 4JY4A 1IC1A 1EMTH 1MIEL 3T2QA 4HLJA 2NR6C 3REWA 1ZGLB 3T3PE 5E2WH 2QHRL 3HC3L 3QDGB 2ZOKA 4OTXL 3MRNB 4JG0L 4K7PX 4BFIA 3G6JE 3I3DA 4GS7B 2M1KA 3G04A 3QEHB 5IFJA 4HKBB 4UU9A 4IMKA 2EYSA 1RJYB 1QFUH 4XVUD 5DVOA 5I6XC 5IB2A 1TQCB 4LCUB 4DKAA 1JPSL 3VXRD 5LBSH 4PJ5B 5IIEB 5DFTA 1CL7L 3UZVB 5D7IF 3QDGD 4OBRA 4I0CC 3P73B 3H3KA 3P9MB 2EYRA 4KPHL 4KK9D 4NIKB 4NPYB 5HYSG 4J3XA 5EIVA 5HYSB 1KNOB 1MCDA 3T1FA 2V2TA 3G08B 2LFGA 2OI9B 2ADIA 4LHUG 4GMTH 3NCYS 4ODVH 3KYOA 5I73C 1A5FL 4KHTH 4PBXA 1C5DA 5IB5A 1EX0A 5EC2B 1TZHA 2BVQB 3C87A 2KQMA 5JTWA 4P4KB 2VR5A 3OTTA 4GMTL 4I2XA 4MNGA 3OKDB 1REIA 2WQRA 2VLKD 3GI8H 3RWEA 2JJVA 4UUJB 4MA3B 1A6WL 1N2RB 3SKOB 1FVDA 4CVZA 3L3HB 4LCYB 4Y2DC 5T3ZL 1G9NC 2ZCLL 5MI0C 4AMKL 3CFBA 5BQ7B 4QGTA 1CGWA 5FM5M 1KFAL 2QQNH 1NUDA 4P46D 4F7MB 2DTSA 1KELL 1Q9LA 3C8HA 1J8HA 1KIQA 3MNVB 3MRKB 4MD5A 4KVCH 3UTOA 1ADQA 4Z7WB 3TO4C 2JE8A 4TVSa 4WFEE 1JGDA 1GGTA 4PP2A 1F6AB 3QJHA 2XZCH 4TNVK 3SKJH 3RTQC 2FATH 4JFZH 4PJ5E 3MJGX 1EFXD 4PJ8A 4JFDA 2X4PB 2R1XB 2VISB 1Z6JT 3RL2B 2XZCL 3Q48A 4GO6B 3SKJL 5J0BA 1OT1A 3MOAH 4ZAKD 1PD6A 1SJEB 2F15A 4OV6F 4NC1C 1BBDH 4H5SA 4NRYB 3WHXB 5JQ6H 5D7SH 1L4IA 3AMKA 4RFEA 5I9QB 3H3BC 1JHKH 3SDCA 5F1IB 2YEZB 1YEEL 1V7NL 4ZPTB 5IB1A 5JHDD 5DUPH 3D69B 1MCFA 1I1AC 1J87A 4TQEL 5JQ6L 2R0LL 1MF2H 4M6OH 4R96A 1NCAH 2EDQA 4K9EC 1IAKA 4E41A 3AROA 3SE4C 1NFIB 5EC1B 2CUIA 1RMFH 5DUPL 2I26N 3CU7A 5KVEH 1OCWH 2APFA 5T5NF 3TVMA 3FB7B 4LARH 3HNVL 1HXYA 4M6OL 5DRXB 5GRVK 5E6IA 4U1JA 3NA9H 2WWKT 4JJHA 5EIIB 9CGTA 3P0GB 4MD4A 3MRIA 4TNWF 1E0OB 4PGEB 4LEOB 3BP5B 4NKIL 4HPOH 4ZFZA 5FO9B 1IM9B 1LGVA 3G5YB 3B4NA 5D5MF 4XMKL 3KLDA 1JNNH 5AYUL 1E4KC 4TNWK 1AD9A 1IQWH 2A6KB 3EYSL 4XPAL 3I50L 4H88H 5JLZB 3WUZA 3CUPA 1ZAGA 3EBAA 4X8XA 1U8KA 3O41A 3DMMD 5GS2H 1IM9D 5DJ6A 2IFGA 4Q6IA 1KCLA 3FO0L 3P9LB 1S7XA 1IQWL 4FQQB 2K9UA 2OMBA 4HFUL 3MFFB 1JJUA 1CICB 3DX9B 1G6RB 1HKLH 3K4AA 1D6EA 1QFPA 3WFEH 5I74C 2HH0L 3FQWA 3HC4L 3BWUC 2Q8AL 4JJ5B 3BDBA 1MCOH 4KRMB 2X44D 3QQ4A 3ULVH 1XR8B 3CCHB 3ARVA 4LP4A 4XVUC 4ZDHA 4QYOA 2EC9T 5CIPB 5K9OA 3X12A 4BFEA 3O0RL 1WBYA 2ORBH 4LHQB 3C6LC 3C08L 5TF0A 2UWEA 1VFBB 4AEHL 5K9QG 2EE9A 3H6JA 3RWDB 4KK9C 2VKXA 4HFWB 2B0SH 3VXUB 1FZJA 4QHLA 3WO4B 5D2NB 2VABB 5GS0D 1QSEA 3LKOB 3U9UA 2D3VA 2MFNA 4O2EA 1AFVH 2BY3A 1RK0A 2YBRA 3W0WB 2B0SL 4YXHH 3NCBB 3ZT7A 3WE6A 1MRCH 5IROC 3GI9H 5ID0B 4HWNA 4BZYA 1I1CA 5CJBA 2NXZD 2HRLA 4HGWA 2B4CC 2PTVA 3QWOA 1YEIL 1MY7A 2FX7L 2NY5C 4QRSB 1ZA6A 3W0WD 1PYWA 2EDJA 2WBKA 1OAYH 1BLNB 1E4JA 5E9DE 3VXSA 5FGCB 2IANA 1A6ZB 2UZIH 4JHZA 4XPBH 5BO1L 1RUPH 4P46C 2H32A 4LLQB 2WK2A 5HYEA 5K9KA 4KKBD 3F58H 4G80B 3RWIA 4WJ5A 1M71B 4XPBL 4WGVB 2DM3A 3BKCH 2Z4QB 1Z0MA 1FN4A 1FZMB 3ZTNH 1PFCA 3F58L 1P5UA 4EN3D 2GFBB 3KJ4B 4U31A 2Q76A 1NGYA 3ABZA 3GMRB 3VXUE 4JKPL 4R3SA 4ELME 2ADFH 2X9YA 5D2NE 3U0PB 3EKCA 1OSZA 1X5AA 3R06A 43C9B 4M7LH 4MCYA 4G9FE 4ZAKC 5IMLA 4XMPH 1MCWW 2DWEA 4JFFD 4CL7A 3DSFH 2FR4B 1RHHA 3FTGA 1UQSB 5JO5A 3RGVB 5DO2D 1KYOJ 3M8OH 4G8GE 2AEQL 5L88H 5JW4N 4NQEB 3SPVB 5E2UL 1N5AB 1JMZA 5IOPA 3HZKA 5ELIA 5FUZL 1W72A 4P49A 5HDBF 5HGAA 4XZUA 1OP5H 4GKSA 3WYRA 1Q9WB 5HVGB 3KPRB 3IDYB 1T2QH 2LAGB 3CMOL 1MI5E 3ARQA 3MV8E 5F7LB 1ZT4B 4OUUB 4GAJH 1NCCH 5JQHC 5ETUB 2X4OB 2F8OA 3BE1H 3OMZA 5HGDA 5EOCJ 1DFBH 3WIFA 4JVWA 4G6JH 1LO5B 1XGRA 2P7TB 3EYFA 4LGPB 3GEWB 4JPIB 1Q9KA 5IR1A 1L6XA 1NEZG 4N0YL 2BDNH 1NEZB 5FYLD 2GJJA 4IIQC 1V05A 2WP3O 2QSQA 4JRXB 2R29L 1DFBL 1MVFA 1TCMA 4FHBD 2AK4B 1QHOA 4G6JL 1F90L 4KK6C 1PKOA 1R3IL 4NUJA 1NANI 1T4KB 4KDTC 3DMMC 3LS4L 3G04B 2B7DT 3W5MA 3PWPA 4UV4L 2EYSB 3MRBA 5HBBA 3HTLX 2IF7A 1A6PA 3WS6C 3U1SL 3K2UH 1I8IA 3BIKA 1G6VK 3DPBA 3JWOC 4Y89A 2O61B 1TPXC 2X09A 2DL2A 4P4RB 5A40E 2W92A 2APWA 5D96B 1Q1JH 3GBNH 2FHBA 1IFHH 1LO2L 5EBLA 5HHOB 1S8DB 3NCJH 5J1SC 1J88A 3K2UL 1MHCA 2H2PD 1ERNA 1BAFH 3MLSH 4M1GH 2C3WA 1Q1JL 4AZ8A 4L4VB 2BXYA 4HX1A 3ZT5A 4Q9RH 1WWBX 5IB5B 3RHWF 3O2DH 1TZHB 1CVSC 2PF6A 4YDJA 2X70B 1OP5K 3RX8A 4I2XB 2VLJA 2QQKH 2KQNA 3DETD 4M1GL 5GS0C 4TOYL 1DQDH 3ARTA 4JFOB 2JCCA 2ZOLB 4Q9RL 3RWEB 1RZIB 4L4VD 3WHE0 4B41A 3QEQB 2CLZB 4ZO8A 3ZE2E 4NQTA 4ONFL 4CVZB 2X40A 3GSNB 5B22A 4PGCB 5J9PB 5KSUA 4ORGA 2VQ1B 3CFBB 1D5MA 3FFDA 3RI5F 4HWEL 4JRXE 3LRSB 4XTRD 3SDYL 3G5XA 2NXZC 4Y88A 4GW1B 1DQTA 3OJDB 1OQXA 3RI5K 1L7IH 1OT2A 5A1AA 2EH8H 5F72S 4PP2B 2CR6A 1I4FA 1ZSDA 1UZ8B 4LLUA 1T0MB 4P9HC 3V4PH 4PJ8B 4LSPL 4I5BA 3MQIA 4R8WH 2PO6C 4KV5F 1J8HD 3IJHA 5HHOE 1IEAB 1ND0B 2CO7B 3NGBB 2GT9A 3UPAA 3MV01 5I1JH 4X7EC 2EDWA 1QBML 5LKNA 3WJJA 1CFSB 5L8LB 2A2QT 3N1PC 3V4PL 4EDXA 3A6BH 3WXVH 3MV7E 4H5SB 4GW4B 5MP6L 3CFJB 3OXSA 5DJCA 4EN3C 4WY7H 3JTSB 4PJ8D 3WIIH 4JFDD 1JZ6A 3SDCB 4HIIB 5F93C 1VEOA 2XN9B 5KVGH 4X0KA 2NY2C 1RJZB 4NN7C 4UTAH 4R90H 1DJSA 2V7NB 4QKXB 4HK0A 3P3YA 1AQKH 3WIIL 1F13A 1U0QA 2I60L 3QEQE 3MUJA 1HHHB 1UJ3B 2FGWL 2YPLB 1X5LA 3SDCD 1ULVA 5IJVB 1IL1B 3TVMB 1A7RH 1HXYB 1EXUA 2ATPA 2CMRH 2VE6B 1VHPA 4HBQA 4MD4B 3CXDL 4MGXA 3T0VA 1FDLL 1UENA 3QDHA 3E8UH 3TIEA 1BX2A 4JFEE 1I8KB 4N5ED 1A1NB 5C08B 1QTYT 3S88H 1AGCB 4LDEB 3PABB 3HZMA 1U95A 1MHEA 1HZHL 5SX4I 1PZ5B 3TVMD 4PJAE 4BSVA 5E6ID 5GGTL 5D7IB 1DBJL 3E8UL 1JPGA 3CVHH 3SGDI 5JOPD 4LSRH 3P77B 1U8KB 4IMLB 5IFHH 4Q6IB 1WJ3A 3RUGE 5INDB 2DQTH 4QXGL 1ED3A 4OCWL 5DMJB 1EDQA 2IFFH 4HD9A 4IS6A 1MRDL 1QLRB 4JVPA 4GT7A 1C12A 5JXAH 1MFAL 2G9HA 4Y5VB 1A7PH 3K2MC 4I9WD 1HSBA 1JZ3A 1YUHB 3SDXB 4L3EE 4F7PB 4H0IA 3SQOH 4ZDHB 3T0XA 5KS9F 4XPGL 3BZEB 2UWEB 3Q1SH 5D6CB 2YPLE 1KTRL 3UPRA 1WISA 4KTDH 2VDOL 1WUNT 4ZO7A 7FABL 3GSQB 4PJEF 2CDGB 4U0QB 1TETL 3U9UB 4JR9L 5D70H 3Q1SL 2NNAA 3QUKA 1RK0B 4NQUA 3HRZB 3WE6B 2DYPB 5D2LF 3DETC 2X5PA 5D7IE 4KAQL 1R6VA 3PDOB 2VNCA 4E9LA 4ENED 4F7CA 1MLCB 1BQSA 5ALBL 2EYTB 3TIDA 4WFFE 5KW9L 1PG7H 4JPWH 1WT5A 2V5YA 2RR3A 3ARFB 2MKWA 2YKLL 3DRTA 1ZHNA 3CLEL 3FJTA 4X5XB 5EO0A 2DTMH 2BOCA 3MGTA 3ETBF 3GMQA 4XTRC 5F1NA 3VXNA 3RPKA 1A2YB 2W0KA 1PG7L 3CJJA 5EZLA 1MHPL 1CLYH 1D5ZB 4LPUA 2H8PB 4I0PA 1OM3H 1MFCH 2AJUH 1LEGA 2GUOB 1N6UA 2DTML 5ESQB 3S97C 4KQ4H 3QO1A 4PLKD 2XTJE 1X5GA 3H3PH 1UADC 3MUGA 2YC1A 3DARA 2A77H 5CILH 3VXSD 2CK0L 2IAND 4WO4A 1FN4B 1TDQA 4S0SD 3GMNA 2XY1A 4UILH 4QNPF 3C8KB 3G6JA 2J4WL 1R5IB 1T66C 4LK4A 3QDJE 1NGYB 3IRZA 3RVXD 4MXVF 1QPPA 1MFEH 1YZZA 3G5ZB 5F8RC 5I1KH 1OSZB 4O4YH 3BPNC 3DGCR 4Z8FL 3CC5A 1J05A 1UACL 1BVLA 1YN7B 5E00A 4S1RL 5D5MB 3PG2A 2HRPH 4PJ8C 5JO5B 5FYJH 3VWKC 4OFVA 4YHPA 5IBLD 1B6DA 3V6ZA 3OKMA 5E1HB 1CG9A 1NGPL 3HZKB 3U79A 4HH9B 5HGAB 4QWWD 1D5BB 1MREH 2D4DA 4O2CA 2RCSH 4L8SC 3IVKA 2LE9A 1UCTA 5F7DB 4M93C 4LLDA 2GCYA 5D1QA 5FA4A 3P4MA 4L8BB 1SBSH 4P3CH 3QT2A 4ERSH 5HGDB 3RL1A 3VFGL 1WLHA 3O9WB 1Q9KB 1FGVL 4NNPL 4FN0A 1QFWI 5BXFB 5AZEL 4OJFL 5DQJB 4X4MA 3TV3H 5E6IC 4H25A 3V0WH 4FQXB 4ALAH 4X7SL 5DK2A 4TVPD 5GGVH 5HVWA 5IGXH 3QAZB 1OVZA 2GI7A 3RWCB 4PJBA 1QQDA 3TC9A 4YHIA 2X4UA 5CJ8A 4AEIH 5CZXD 3SEPA 2YOCA 1I8IB 3BZFA 1HEZB 3QI9A 4CVUA 3LCYA 1H9VA 4XBEH 3WEXB 1M7DB 3DURB 2R0WH 5CP7B 3DROA 5IVXF 4AEIL 2SEBB 3U30B 5CMAA 1OF2A 4IHOB 5GS3A 3ZDYF 5IBTL 1MHCB 5FOBB 3IGAA 3TCXA 5IQ9B 4E5XB 5F71A 1R5VB 1YEHH 4PTTB 1R3HA 5F7KC 3RJDA 3QRGH 3MV9E 2WUBL 4OZHF 3AS0A 5IT2H 5TPWL 5HHNB 2EEDA 2VLJB 3OL2A 4U6YB 1MIMH 1AR2A 4XVJL 4XX1G 4FMFA 3NABL 4DOHE 4DWHA 1XZ0A 3VW3L 1JPTH 4HKXA 2JCCB 1K2DB 5I30H 5JORA 1BM3H 2FB4L 1BEYH 3X14A 5GGQH 4WHTA 3DI2B 2GJ6E 4J3OC 4N68A 1F4YL 2HFGH 4UT6H 5CSZA 1GGIH 3RPIB 5B3JF 2VLJD 5B4MD 4NHCL 1CQKA 4P2YA 2V5RA 3U0WH 1R0AH 3WLWD 2RQ8A 1K3ZA 3TN0C 2XNAB 4UT6L 4YX2H 1S5HA 4MJ5B 4XH2A 5BVPL 4XBGA 1I7TA 5C6WH 2E7CA 5J1AB 2KUTA 1I4FB 1XCQA 4I5BB 1DCLA 1HCVA 2GY7B 4HQQH 4PJCF 5JOEA 2X41A 2X9XA 1IAIL 2IPKB 1IARB 3T0DA 1DEEA 2GT9B 5CJQL 5B21A 5HPOA 1T22B 5I16A 4BZ1H 2VLRA 4OLWL 1XGQA 5CLTA 2Q7YB 3AXLA 5F9AC 5EWIL 4HQQL 4HULB 1S7UB 4YK4B 5DJCB 4EBQH 4HMEA 1NAMA 3RVXC 2VQUA 3SO3C 1NBQA 1B2WH 1JF1B 2C4FU 1J18A 4X0KB 4NYLA 3QH3B 1G7JB 1WSST 2V6HA 1EO5A 2V17H 2JIXA 4N8VA 2F19H 3EOYG 6CGTA 1YPZF 1QFHA 2BNQA 2QTEA 3EOAA 4U05A 4W68A 5LGKA 5CEZL 1ITBB 3GMLA 2VITB 3CFCL 2D31A 5IBLC 3CH1A 3LHPL 2VC2H 1J0JA 1CFTA 4Y16B 1FE8L 2ZG1A 1QKZH 1YQVL 2P44B 1MWAL 1XR9A 2JK5A 4QWWC 1YNLH 4OLYH 1F4WH 2AEPH 2Y6SC 3C2AH 1JIBA 1BX2B 2HLAB 5DSCB 4D2NA 3L5JA 1NSNH 8FABA 3EOTL 4WEBL 3JXAA 5I1IH 1JGEA 4WUUE 2A74A 3BYYA 3T2NH 5T3XL 2CDFA 3FMGH 4HPYL 1F4WL 3QG7H 1U93B 3C2AL 1MLBB 1IGYB 1S78D 2XG4A 1RFDH 4NQCE 3MLXH 1NSNL 3MRHA 2NLJB 5C0EB 3SDAB 3VA6A 1A7QL 1YEDB 5EBWA 5HDBE 3RU8H 6FABH 4QHNB 5D7LB 1A7BA 4MNQE 2A9NH 4G8FA 2BCKA 4YBLB 1FFNA 4TRPH 5JIIA 3W2DL 1Q38A 1JV5B 2QR0A 1MCJA 1DDHB 3V5HA 1SJHA 5IHBA 4PJGF 5CGTA 4AG4L 2HJLA 1U42A 5JZ7D 4MCZB 4Y4FB 4MVBD 2W0LA 2Z8RA 2VZOA 4LVNB 2N7AA 4YHOH 5DJDB 3SDAD 5ICZA 3DV4A 1QD0A 3RY6A 2I5YH 1A4JB 4PJIA 1RZFH 5D7LD 3DYOA 4MSWA 3V8CA 3PGFH 1RSFA 4RAVA 4ODUB 2JJUA 3K3QA 4HJ0C 4R2GD 1E4XL 4YHOL 3ZE1F 4KDWA 5BS0E 4EXKA 2PN5A 3F7RA 4X7TB 4RWYH 4G9FA 2D7NA 3WL9A 1J1XL 1HHKA 2D7TH 2A6JA 3MRRB 3GB7B 4GJTB 3KLSA 4PRPE 4EIGB 1QO3B 4KKLD 1H8OA 4LL9A 4DW2L 4K3DH 2VLLA 4G8GA 1JTTA 4IOFC 2PNDA 2QKIA 1PW3A 4LPTA 3ZKXC 1WBZA 4MNHB 4NN5B 1INDH 2VDKH 1BPVA 3T65A 2FO1A 4F7CB 1D5XA 1G0DA 1QUNA 1T1XB 2CDEB 4Z95H 3U48A 5F89B 4WI4A 4ODTL 1JGUH 2CLVA 5KSBF 3MV8A 1BQLH 2HJFA 3DRTB 4TTDD 5F7UA 3FB5A 1FPTH 4QOKB 1A6UH 3AS3A 5LGJA 5CBEA 4J3SA 3L6FB 4Z95L 5B4MC 1GHFH 3QCUH 3VH8A 4YBQD 1IAOA 1BQLL 4ZD3L 3WLWC 4NM8L 4HT1H 2GTWA 5CINL 4RGMB 1ZLVH 4I0PB 3KLHD 1KJ3L 1EZVY 3RX5A 1CFQB 1I3UA 3VFTA 1WCBA 3P4LA 1FCGA 3BAEL 1RJLA 3WFCL 2W38A 4X9BA 1ORSB 2F54B 5L9DL 1IKFL 1DQLH 3DX7A 5CP3A 4YHNA 4O5LH 3PHOA 4CU8A 4I0PD 1VFAA 2GSIA 5CHNB 1JVKA 3MZGB 3TO2A 3CC5B 3MRGB 2MNUA 4U1SB 1J05B 4JKLA 4WO4D 4DZBA 1BVLB 5E00B 1M6OA 3U2SB 3P9WB 1HI6A 1JRHH 4YXKH 4JM4L 1YY8A 4JREB 4XPHH 1EBAA 4MA7H 2WINA 1CFVL 5IMKB 2XA8L 4Y1AB 3OKMB 1HSAA 2IH3B 4KV5E 3WJJC 1PY9A 4PR5B 3TZVA 1JRHL 3VRIA 1MJ8L 2CUMA 1I7UA 4YK4C 4KZEL 4O2CB 3MUY1 3W39B 4RMRA 4LLDB 2FH6A 4DN3L 3NCCB 1ZGLM 2IALA 3QDMA 2ADGB 4KK8D 3F5WA 3BJLA 2FDBP 4LSSH 4P57B 4S2SB 4X4YA 1IBGL 3AREC 3CAFA 5CBAB 5FM8A 4NWTH 5H94A 3OPZL 4P2QB 1RUQH 1TQBB 5EN2A 3BQUB 3RL1B 3SOBH 1AH1A 3P0VL 5KS9B 5C9KA 1YEKH 4UBDD 4L29B 5D1QD 4E42B 2F8XC 5DC0A 1P2CB 4ZFGH 4NWTL 1ZLVK 1GC1L 4GRWH 2PYFA 1VGKB 1RUQL 2O5YL 4QY8A 4S0TD 4EUPH 1Z3GH 2CQVA 2J6EH 4JLRA 4ZS7L 3KPTA 1QVOB 2HTKC 4P2QD 3I02A 3NA4A 1LE9A 2BC4A 4K7PH 3QXTA 2IPTH 3ELAT 1TJGH 2C1OA 1QQDB 2Z35B 5C0GA 1WWWX 4MB5A 4YHIB 2X4UB 4L8DB 3Q6FA 1HIMH 5J12B 3IF1A 3SE3A 4LAQH 3VFRA 3W9EA 3GMMA 3QI9B 3UTPE 5GJTL 2VL4A 5JZ7C 2IPTL 4UDUB 4MVBC 1BOYA 5D2LB 5EU7E 4DK6A 3DROB 4Y1AE 1PGRB 1J0YA 1HIML 3B9KB 2FLRT 4PBVC 3MV7A 2XPGA 3DHMA 2NY5H 1MAML 3V9FA 5FF6B 4G7VL 5MEOB 4R2GC 3VFWB 3QI9D 5GS1A 2F58L 4HWBA 3FO9B 5IESL 3WFBH 4XGZA 4HXAL 4OFDA 4UB0L 2BJML 4GXUN 4Q9QH 1F11B 5I1CH 4YGVB 2Z91B 1Q0YH 4GH7B 4KKLC 3WNKA 1AQDA 3I6LD 1KIRB 3CFDB 3WFBL 2E7HA 3NPZB 3TT1L 3BPLB 1UCBH 3BGMA 2DIJA 1N6QL 4OKVA 4Y5YA 1DQJB 4PV8B 4L4TB 5HJ3A 3MO1B 5I0ZA 5IP4A 3EHBD 4JFEA 1MNUH 3LRHA 3WS3B 5SWQA 4PJEE 3G6AA 1MCEA 2D0FA 3MUZ1 5DMKA 4CMMA 1UCBL 5DEFB 4QGYA 5KAQG 4C56B 1INEH 4PJAA 2QBWA 1IGTA 4JANA 4XH2B 1C5CL 4QT5A 3IDMB 3SGEH 4Z7VF 4YE4L 1XCQB 2GK0A 3UYRH 3RUGA 3TWCL 4CNIB 5D2LE 3QUMH 3LKNB 1WT5C 1CDHA 5EDXA 1CXFA 4X5WA 3KLHC 1DEEB 2E3VA 3CDYA 5F6IB 3VWJA 4DN4L 3N1QC 2VLRB 5FCUH 1EPFA 4OLVH 1DVFA 4HC1H 4MD0A 3AXLB 2ICES 3NPSC 3QUML 4YDVA 5FDYA 2IAMA 4Z7NF 5C3LD 2YUWA 3VFSA 4I0PC 4OLVL 5DRWA 1D3CA 5D1XA 4UAOB 1ONQB 1X5IA 4OZFH 2VLRD 4R4FH 3T8XB 4WO4C 1HILB 2BNQB 3EOAB 1QR1B 1RULH 4F15C 2D7PA 5DR5L 2BNUA 4H20L 5HGBA 5E2VH 4QNPE 4R4FL 1OAKH 4L4TE 4X7DC 1G9EA 5EUKA 2OP4L 1CFTB 3CFEA 3HNTH 3PE9A 1WWCA 1CDCA 5FUCE 3CIQA 4JO4H 1N8ZA 2BNQD 4UT7H 5DJ8B 5BV7L 4C56E 5E1AB 4OM1H 2Y25A 3DI3B 8FABB 3ILPB 1X7QA 1JGEB 4UV7L 4KK8C 2P5EE 3RWHB 2CDFB 1MVUB 1KTDA 4Z0XB 3ZO0A 3FRUB 4U6VH 4ZOCA 1F3RB 3C5JB 1A7OL 5TE4H 5IVXB 2DJSA 2NX5A 3VFMB 3BJ91 2VDQL 4JZJA 1X3DA 1GGCH 4XBPB 5HHQA 3WN5B 3CPLA 4OT1H 4C54A 5D1QC 4IOIA 4ZFFB 2QR0B 4HJJH 5E99L 1JZ4A 1IC4H 3KHQA 3VFUA 3WIHH 3PWUA 4U2ZA 4RAUA 4F57H 3V52L 1JHTA 5TQ2L 3DV4B 4YPGB 4Y4KA 1YQ2A 4RISL 1G1YA 4PJIB 4HJJL 4LSTH 1VA9A 4MSWB 3RAJH 1J5OH 1HE7A 3FZUD 4XP1H 3ZKND 3QDJA 2NY1B 4I77L 4M3KB 3BDYH 1HCFX 4Y19B 5IM7A 4RQQB 3RAJL 4NC2B 1HHKB 5F9OH 2AP2A 3QIWB 1PJ9A 4RRPG 5J12C 3ZDZF 2ZCKL 3BDYL 5KSVA 4MA8H 3SJVE 1RZJL 2X4NB 4S11A 2YR3A 2XWTB 4WFHD 5BMFL 4Y19D 5C09A 4MJ2A 1P7QB 1HDMB 1WTLA 3QIUA 3GDBA 5E56A 3T3MF 4G9FD 4LKCA 1WBZB 5DVMA 3GK8H 5FYJE 1AY1L 4MDIB 2IGFL 4NSKA 3FQTB 4HV8A 3ZE0F 3T65B 3OG4B 3FAWA 4PJCB 4PJHB 5IVXE 4EI5A 5TE7L 3L3KB 3I75A 3KPSB 2CIKA 4G8GD 1NC4A 1FYTE 1TJHL 3O3AA 2HJFB 2K1MA 1QLFA 5EZIH 1I1FB 1JN6A 1BZ7A 1A7NH 1FO0L 4OZHE 2ZSVA 1Q0XL 1KENH 3EHBC 2R9HD 4J6RL 1FVCA 2GTWB 3ARGA 4OQTL 4XVSH 4D0CB 1I1RA 2EIZA 3MV8D 3L5WA 3THMH 3L5IA 3VFTB 1YJDH 5FUOL 1YPZB 1A7NL 4M5YH 3P11H 2NY6B 4LBEB 2LQRA 4PB0H 2FEEL 2E7MA 5KOVC 2AERT 3JVGA 4P2OB 1ORQA 2EDBA 3P4NB 3CDGB 4DKDC 5ENWA 4KQ3H 5B3JE 5I19L 3THML 3BWAA 3F12A 4G6MH 4YHNB 4X6DF 3Q3GA 2WIIB 4R4ND 1VFAB 2GSIB 4XNZB 1GIGL 4M5YL 32C2A 2R1YA 5KG9B 1EERB 1KCVH 1H0DA 3CSYB 4FFZL 4ELKA 4WI5A 3PXHA 2F5AL 1WCQA 4G42A 4DZBB 1I9JL 5HYQA 1MJUH 1RURH 2LVEA 3KPPB 1DUYB 3L3DA 4KTEH 4X99B 4OIIH 1Z2KA 1FIEA 5CZVH 5JNYB 1XF2A 4YIQA 2WINB 2KZ1B 1XF5B 4JPKH 1HSAB 2ZUSA 5ITBL 3BVNA 4PJCE 4LCWA 5DQ9A 3RVTD 2BHUA 2VDRL 3MV9A 1I1YB 1WQVT 3B2VL 2ED9A 1GPOL 1DBKL 2VDML 1A9EA 3L3GB 3LV3A 4H8WL 4QTIH 1KLGB 4WU7A 3OAZH 5DJZA 4X4YB 1XF3B 2AXJA 2DQGL 4AQ1B 4QHKI 3BEVB 1CVRA 3TZVD 1HH6A 3IJYA 2C4FT 5EN2B 1J1OL 2JF1A 3IAPA 4R4BB 3NN8B 2YHGA 4XCYB 1YPZE 4QTIL 5FO8A 4NQXB 3QDMD 5IMMB 1IC5L 1BJMA 5D71H 4I18A 1F4XH 2AJZA 3S3JA 2PYFB 5C86A 1S9WA 4JLRB 5C71A 4XMLH 2BC4B 2Y4SA 2WP3T 3PUCA 5FKPB 5DD5L 3QZWG 4WW2F 2BP3A 1MAKA 5D93B 3ROOB 1SYSA 5GGUB 3VMOA 3QZWB 3MCKA 5BRZE 3PHQB 4FQ2H 5DJ2B 5I76B 2H26A 3W9EB 3U7YL 2BY2A 4XMLL 4NZTH 2ZCHL 2UVFA 1U3YA 4U0RB 2NXYB 3WNLA 2R0ZL 2R0KL 3QCVH 4QCIB 4BUGA 4FQ2L 1E6JL 3STLB 2BMKB 3FZUC 3HE7A 3ZKNC 4FQIH 4JRYB 5D8JH 4LLVA 2DBJA 3DBXA 4I3SH 2AV7B 1VERA 5E5MA 1WICA 3B6SA 4PJGE 1G7PA 3GJFH 4P9ML 1F6LL 3RY6C 1OGAA 4LCCC 5KVDH 5J57B 3VXOA 1ZS8A 2DAVA 3MV7D 1KJ2H 4U3HA 1FLRH 4OLEA 4HMCA 3CFKA 1AQDB 4JO3H 5L7XH 2O5ZH 2F74A 3G6DL 3P30L 3OAZK 4NCC1 4OZGF 1BWMA 2VZTA 4HS3B 5D7JC 2OZ4L 5F88A 5KVDL 3BGMB 5FYKL 4OKVB 3DTXA 2ITCB 3SY0A 3KWWA 4LSUL 4KHXL 3BPOB 4K8RD 3ZE1E 5H35B 4YDKH 1J86A 2O5ZL 1GOHA 3WSQH 1TVHA 5SWQB 5EFIB 1AP2A 4RGOL 1ZT7B 2EKJA 3E6FA 1H15A 4WUUA 1BJ1H 2A73A 2CLRB 3U7WH 3KPMB 3PQYB 1IGTB 3W11D 3HMXH 2ESVE 3BISA 2VXQH 5ITFB 4YDKL 1FCCA 2FL5A 3QFJA 3T0EE 3WSQL 4C55A 1U36A 5GGSA 2QSCH 1GGBH 4JFED 1FAIL 1W0WB 3JV0A 3O6ML 4MNQA 1ZEAL 3JWDC 1NKRA 3H8NA 4Y5XB 1BIIA 3LEYL 4N0FB 4YHML 4OIAA 4PYHA 3E6HA 3IFPA 5T1LB 5KSBE 3ME0A 3IJSB 5JW4Q 5IFAH 4BM7A 1OAUL 3IETA 3OB0H 2MQ0A 2YD3A 4WENB 1QSVA 4NWUH 5HI4D 2CUHA 4JB9H 3C5ZA 3RVVD 1J9CT 4P2RA 5DRWB 4HBCH 5TH2A 3VWJD 1KULA 5IQ7L 5T1LD 4PRIA 4MDJA 2A38A 5CEXB 5IB3A 3GJFK 4HKJA 3PIQA 5BS0A 4RNRB 5JW4M 4HAFA 4JB9L 3K7UA 1LEKB 2Z93A 2IADA 1R3KB 2IAMD 4WVRA 3V5DA 2BNUB 5HGBB 4BH7B 1HINL 4K23L 5GRXG 1CLOH 5EUKB 4BQ6A 2NY4C 3CFEB 4JY5H 2DMCA 3NFNB 2LABA 2PYEB 2XXMB 2EDLA 4MQ7A 4OCNC 4QXUL 5A3ID 3HAEH 2EIDA 1MJJA 3PQYE 1S7SA 1PQZA 4JRWA 5DLML 3SE9L 4S1SH 1RUAH 1KPUB 3LKQB 5C0CE 5DS8A 1IEHA 3HE6B 3KYKH 4KUCF 1BFTA 1FNHA 2EIBA 3DRQB 3TZVC 5E08H 4ETQB 5DMIL 1MH5B 5HHQB 3GSVA 3CPLB 5C2BL 2BRRH 3IT8D 1AGDB 4HUXA 1KLUA 4ZSOE 5DZNA 1IC7H 3F7QA 4KROD 4WFFD 4JO2H 4YWGL 1DLFH 4TULL 4J12A 3D0VA 1H8SA 4QHUA 4RGNE 2NX5D 4NKQB 3VXME 1VESA 1CGVA 4Y4KB 1LVEA 3OB0K 1JYVA 3OSKA 1QSZA 3B5HA 1XIWA 4JO2L 1O5DT 3IXAA 4TUJB 5I1EH 3QNYA 3FN0L 3LEXA 5IM7B 1BGXL 3OKEB 1O7VA 1BBJA 5FGRA 1AC0A 1T7WA 5HVHB 3LS5L 2VSCA 4WV1B 4Y4KD 5IHLB 1JK8A 3BO8A 2PYEE 5KSVB 3SE3C 3MJ6A 1I3GH 3QDJD 2HG5A 4I3RH 2W60A 1NCTA 4U2YA 1UKQA 4NP4H 5KZCD 2X6MA 4NBZB 3MA9H 5C09B 2WQ8A 4L4JA 2J8UF 2IBZX 2HWZH 1LEIA 1T20B 5L6YL 4Z7VB 3HMWL 4NSKB 4HV8B 4QRRB 3W9DA 4NNXB 2BNRB 4LRNH 1ETZA 3VGEA 4WTZA 4EI5B 5TGBB 3UJIH 5ID1A 3CSBA 5GS1C 4OFIA 2KDGA 1G7MB 5C09D 4LLWB 1Q94A 4ISVA 4XPFH 1QEWB 5GZOD 1N7MH 3WFDL 3QIUD 3O2DA 3QIBA 4ZUTB 2H9GA 3S9DB 1JN6B 3IKCA 3WXWH 5CWSB 3EW3B 1OAZL 4EVNA 3FHQA 2ZSVB 1C08A 3UJIL 3BUYB 5JOFB 3MLTA 4EEEA 4EI5D 2IJ0C 2PUQT 4U1KB 5D1ZB 1AKJB 1W0YT 2VXUL 4O02L 2Z31A 2EIZB 3QPXH 4UIMB 3L5WB 1CLCA 5E2TL 3BPCB 3W11C 1JNJA 1MPAH 4Y5YC 3I6GB 3GMOA 3GIVA 2ZJSH 5ESVB 1EJOL 4I4WA 5EIQA 3V2AR 1ORQB 5IMOA 3D39A 5M94B 1FNGA 2DRUA 4R26H 1A4KA 2DI7A 3ARGD 1YDPA 3QR2A 4GG8B 1WC7B 4KVNH 4X6BA 5H2BB 1H0DB 4ELKB 1TIUA 2DDQL 2BOBB 1SY6L 2FZ3A 4G42B 4HUUA 4L9LB 3VI3F 5KN5B 4XVTH 1T80A 3RVVC 5C0AE 4Z7VE 2PR4L 4AIZA 4QRRE 1A64A 3VWJC 2NQCA 3N85H 5C07E 2BNRE 3BVNB 5DQ9B 3A6OA 3ULUH 3EO9H 2DQEH 2R1WB 5TE6L 1DVFC 4E0RA 1BQHA 3KYAA 3LQAH 4HEPG 2R2HB 5FYJU 4LPVA 2IAMC 5DD6A 1CZ8H 4X98A 4HKZB 1KB5L 1JTOA 3VCLA 3VG9B 3F7VA 1A9EB 2X05A 3QULA 2CRIA 1U8NA 3OGCB 3ULUL 3EO9L 3RA7H 4QTHB 2DQEL 4Z7NE 3WLBA 3INUH 1DQQA 4WU7B 5D1XC 3LQAL 4LCWD 2AXGA 1CLZL 4FRWA 3ZL4L 2PTTB 3BKMH 2D7QA 3I2CH 1NLBH 1FORH 3MYZA 3X11B 5A3IC 1NCBL 4JKKA 5JW5A 5AG9A 5GSRB 2G5RA 2AAVA 5FO8B 3MMEB 1SEQH 5BV7B 5GRUH 4HS8L 4PRNB 5GJSH 2IQ9H 2J8OA 3LKRA 3EDEA 2OR8A 2ENYA 1JBJA 1VACA 2HVKB 5DYOB 2C3XA 1SEQL 1V7ML 1SHMA 1RK1A 3MCKB 4BSWA 4MZ3A 3GBMH 3U4BH 1DANU 5FO7A 3VXTB 3MYJA 4KROC 4PJDB 1BFVH 2APXA 1PLGH 1U58B 1HOCA 3U83A 2CRZA 3CVHA 4I48A 5MHSE 4JDVA 5KANG 2AJVL 4RFNB 1YC8A 4OZ4B 3RNKB 4JZJC 1W2KT 1ZVYA 3HZVB 3ULUF 5TFSH 2OMNA 3FRPA 4PS4L 5BVJA 3ARUA 4MS8D 5BJTB 4X4XB 1U8PB 1KSRA 4XXCA 2ATKA 5E5MB 5AZ2L 3LKSA 2XTJC 4PV9A 1OHQA 2P8PB 2XZQL 3GHEH 3A6CL 4N8CL 1G7PB 3VFPA 5GS2D 2APTA 4Y4KC 1OGAB 3VXOB 4CVXA 4RFOH 5GHWH 1KTLA 3STZA 2DQDL 2H6PA 4N9GB 4LVOB 4DUWA 3P0YL 1HYSD 4W6XB 3T77B 4Y4HA 2G5BA 3S37X 1I7ZA 4XP4H 3Q6GH 1UA6L 4WHDA 4LPXA 3PDDA 3FT2B 5F88B 3C60B 4ORZC 3DTXB 1CD1B 5GHWL 4JM2F 2VQTA 3B5TA 4BA8A 1C7TA 1OGAD 2J5LC 1DBMH 5C0BE 3K0WA 1OGTB 1URLA 4OLZH 3ULVD 3FT4A 1NMBL 4XP4L 3DGGB 1XGYL 3FT3A 4L5FL 1TVHB 4KUZH 4TPRL 5J56B 2DLIA 5F8QC 3E6FB 1CDGA 4HW6A 1H15B 1SYVA 1RV6X 1TZIA 2EDXA 1F3DH 3ZDZE 5GZOC 3ISWA 2W65A 3QIUC 3HKFA 2AGJL 5KVFH 1J10A 4EZMA 4NHUB 4JVUA 3GKWH 3MBEA 3T3ME 3RDTB 1DBBH 1FNEA 5ESAB 1QSFE 5EU6B 3AMLA 3DIFA 5ICXA 3ZE0E 3CZFB 3FFCB 1IAII 4WUUD 1BIIB 1FC2D 1Y18A 5F1OB 3SE8L 3E6HB 3IFPB 1LP9B 5F6HJ 4X80H 2Q8BL 3QFJD 3H9SE 5I2IB 1KCSH 4PRHB 4Y8AA 2OTPA 5DRNB 2D0GA 4CRPA 4OFPA 5TDPA 5HI5C 5DHYB 4N0CD 1MCQA 2Q86A 5IBUG 3ARGC 2B20A 1AE6H 2VDNH 3GHBH 3PWNA 4DVRH 3IFNH 1LK2A 3DVGA 5IBUB 3UAJD 2VR9A 1FV1B 1KCSL 4JFPA 4OLXH 4PRIB 1YEFL 1F45A 4HKJB 3PIQB 1OTTD 3H7BA 3TH2T 3TJEH 4LKXA 5JR1L 4UIKH 3V5DB 3C5ZD 3VA2C 4P2RD 4ZYKA 3SJVA 1NAKH 4WHYG 4ZOBA 5BZDB 4N1HB 4PRID 3KPOA 4KWUA 4X6DE 1FC1A 1MFBL 3MLVL 4OAWB 5L2KA 5F9WB 5DTFB 5FV2A 2FYYB 2EZ0D 4YC2B 2R8SH 3MOBL 4FXGA 3VGBA 1H5BA 1S7SB 4Z0BH 1FL6A 3QQ3A 5E4EC 1FL3A 3UXFA 5DWUL 2BVOB 1AHWA 3QFDB 2ZUYA 4CN6A 3O3DA 3LZFH 1NMAL 4P59H 3B3IB 4PJ7F 2BSTA 3O11B 2R8SL 5C0ND 3LB6D 5EU6E 4PGDA 1C7SA 1KGCD 4Z5RA 4YXLL 4M7LT 3HR6A 4XWOC 4ZUUA 3GSVB 4D9LH 1OARL 4MQSB 1ZOXA 4PRHE 1CR9L 3PDGA 4OZIF 4X9FA 4XCFH 4PJXB 3I9GH 1F3JA 1NANH 3VGDA 5MENA 3ZYIA 4QHUB 4H0HB 1EHLH 1XAUA 1UYWL 4IRZL 3JTTB 4HS6A 1SVZA 1K4CB 1R5WA 1XIWB 4I18C 2HKHH 4CDHA 1KBGL 1WV7T 1E4XI 5E8OA 1H3PH 3VG0H 1BBJB 2DBLH 1FFPB 5GRZA 1G9NL 5EU5A 4TN9A 1Z9SA 4YAQA 1JK8B 2UZXB 2VAAA 5FB8B 2H2SD 1A1OA 2B5IB 1XIWD 4XAWL 4DUXA 4JG1H 2PETA 1H3PL 2HG5B 3VG0L 5ILTH 3DHJA 3UC0H 5DD3H 2NY7H 1BOGB 4AJ0A 1F97A 2W9LA 3HN3A 4K2UH 4MAYA 3W9DB 3ZMRA 1KB9J 5ILTL 4JHAH 2R15A 3QUXA 3HE7C 1FNFA 1UWEH 1HYSC 1OTSD 5ID1B 1EVUA 3EYUH 3H9HA 5IKCB 1R3JB 4KXZI 4YFDB 1EO8H 2XKNB 2ZKHH 4ISVB 4K2UL 15C8H 4YNYA 2WAHA 4JAMB 4ZUSB 2H9GB 3Q0HA 3AM8C 4JHAL 3BI9X 1BVKA 1M7IA 1EV2E 4OFYA 3EFDL 1CGSH 1C08B 1R3LB 1S7RB 2YPVH 5A2IH 4LVOC 1KJVB 3K4DA 25C8L 3LEVH 1CDJA 2DS4A 1XF4A 4IDJH 3U46A 1UM4L 3O3EA 1AJ7L 1D6VL 1LDPL 1CGSL 4WDIA 3QIBD 4NRXA 4NRZA 5JHLL 4OZGE 1YYMH 4I4WB 4JGMA 4K9EL 3GSWB 1OW0A 2AK1L 4NO0B 1NJ9B 5HGHA 4EI6A 5IMOB 3D39B 4LSQH 4WI2A 3B9EA 3D1MC 3LEVL 4OCRL 2PW2A 4XNUH 4HF5H 4HAGA 4P5MA 4YFLF 4XNXL 3ROLA 3AU1A 4NKOA 5SX5H 3V6OE 3ES6A 4Z6AT 3OR6A 3EO1A 1SQ2N 2I9TA 3DXAB 3OKKA 3IFLH 3IKKA 4AH2B 3HUJA 2EDEA 3GJEA 3QEUA 3LDBC 5F21B 2NY0D 4P99A 4HUUB 1F2QA 4FFYH 4F9LA 4Z7QF 2VZ1A 5I15L 3D39D 4IJ3B 4N0CC 1I7RB 1H8NA 1HH9B 3VGFA 2RGSA 1K3IA 3WD5L 3ZSTA 3UAJC 4IRJB 3IFLL 1C5BH 3SGKC 1YN6B 4QXTB 2L4OA 2KH2B 1DBAH 5I1DB 1G7HB 1JRHI 1OTTC 4XP6L 5DD6B 4JQIL 1OOAA 1P84K 1FBIL 3HRPA 3MR9B 4J3UA 4P23C 1GZQB 3QULB 3CLFL 2DQCH 3C5ZC 2CKBH 1A6VH 1DR9A 1HHIA 4CJ0A 3CX2A 1DQQB 2OLDA 1B0GA 3UO1L 2C3HA 2DIAA 2EDKA 1QBLH 3ZLQC 2EZ0C 3VGAC 1MRFL 3X13B 5I66B 5EOQL 4W4OA 3UTZB 5SX4H 2W9DL 3FQNA 1OB1B 2Z0BA 2VWEC 3QXAB 3D85A 3SGDH 5LXGH 3N50A 3N06B 3S36L 3LB6C 3A0OA 1T1ZB 4NM4H 4TUOB 5F9WC 3M17B 3L1OL 3BSZL 4LFHD 2ESVA 2ERJB 4G6KH 5I75B 4PRAB 5JW3L 3T0EA 3DXAE 5ADPL 4PY7A 4HUWA 2OR9L 4NM4L 2VXVH 5FKAA 5SX5K 3WCYA 5HDQL 5H37G 3CVHB 1UM5H 4LLYA 3GSOA 3BYTA 1D5IH 3TFKD 4Q2ZA 3BXNB 2OL3H 3MNWA 4Y7MA 5LGHH 4DGYH 5DJ0B 4OF3A 3HPJB 3O2WH 2B4CL 5ANMB 2DF3A 4GRLB 1B0WA 5GGSY 5EOTA 3MCLH 3R0NA 4OGYL 5DQDH 5LGHL 4DGYL 2XZAL 3LKSB 3BMWA 5CD3A 2WMPA 1TITA 2AJSH 5F1SA 5H8DA 2NW3B 1MHHA 3O8XC 2H2SC 4NQDE 2H6PB 4G6FD 3UMTA 1LWRA 3DUSB 1WFNA 3OKYA 2F53B 3UPCA 4Z7UF 1CGUA 1I9IL 1RIHL 1X9QA 4NZRL 1ZLWH 1IZKA 5T1MB 2IH1A 3MACH 1NUGA 1JE6A 4FABH 1OL0A 4ZXBB 1KEMH 2KBGA 7CGTA 3FT4B 3O6LH 4X6FA 4NGHL 1OTSC 4H26A 4TSCL 4Y4HD 3KXFA 2F53D 1SYVB 3PWLA 4KJYB 3QJFB 3MACL 5C0CA 5IV2A 1KCKA 3OKOB 2EKSA 4J23A 1S9YB 1EEYA 4YQXH 1KEGL 1G9MH 3O6LL 3B8YA 2J8UE 3MBEB 4NJAL 1S7QA 5HGGS 2AXFA 4MZ2A 4LDOB 4RMQA 1FNEB 1AIFA 2KPNA 5I8EA 4LQFH 1FFOB 1NFDA 3BRFA 2Y06H 1Y18B 4O58L 1IM3B 3TYGH 4LASH 4NT6B 5I1LA 3QIBC 4K3JH 2A1WH 1ZLUH 4POZD 3MBED 4R7NB 5TDPB 4P5KA 3T4YA 3VXMA 3M07A 4FFVC 3V4VH 2Y06L 1ZWIA 1AGFA 4OSUL 3I6KA 4XCCH 1INQB 2Z31C 2Q86B 3V6BR 1SEBB 3C5SB 1LK2B 4DQOH 3KYNA 4NJ9H 4K3JL 5DEGB 1QACA 4JFPB 3CD4A 2OQJA 2C1PA 4UQ3A 3HLAA 2BVPB 4XP9L 2NY0C 4XCCL 4MX7B 2XRAH 4DTGH 1T7ZA 1TVBB 5IHZA 5I1GH 4HHAB 1MFDH 4Z7WF 2VSDA 3UYPA 3MBXH 3NZHL 4UZGA 5DD1H 3MLWH 2YS4A 1JMXA 1ZLWK 5L2KB 1KF9B 1NCDL 3D2UA 4FA8A 4FZEH 5EU7C 4HIEB 4Z77A 4G7YH 4ZFOB 2WBJA 2DM7A 4FQPA 3VXQA 1FL6B 5F7EH 1FL3B 2CGRH 1MJ7H 1N5YH 3VI3E 3JWOL 2DQIH 3SJVD 4AEFA 1A8JH 3BGFB 1F58L 1YMMA 3MLZH 4NKMA 1K5NB 5FFLA 2BSTB 3HG1A 1G6RH 3L3IB 4Z76A 3SKMB 1J12A 3FQRB 5L2KD 2DKUA 4PGDB 5HYJB 4K94H 3BKJL 2P49B 1LD9A 4JFHE 4OD2B 5E8DH 1HHJB 2FHCA 5FYJD 3ALWA 4ZUUB 5E8PA 2VIRA 2DQIL 3DV6A 3MLZL 1EEQA 1G6RL 3BX7C 2YWYA 1MCWM 3AFLA 5CIPH 1PAMA 3IDJA 4W70A 4WGWB 1U8HA 1T1WA 5HYJD 2BXZA 3K8KA 1WEJH 1ZLUK 4PJ9A 1C16A 4OF6A 1XFPA 4HS6B 3TNMB 3GRWH 2AS5M 5GS0L 3C6LA 1R5WB 3L9RA 1Y0LA 2YD8A 1QNZH 4GRMB 4WWID 2IPUK 1QRNB 3ESVF 4NKDB 1NDGA 5J06A 3MRFA 5F3HB 5E8NA 4EUPA 1UB6B 1DL7H 2J6EA 4GXVH 4LHJB 1U6AH 4JFXA 4CVWA 4JM2B 5MEND 3TFKC 2X42A 5I18H 3GRWL 3OF6A 2EDFA 5I75C 4YAQB 3QXUA 2VRAA 2LV4A 3REVB 1GZPA 3KR3H 5GGRB 1P7KA 1U6AL 4WI7A 3D25A 5BW7A 5C0AA 5DXWA 3RFZC 3UBXG 1IVLA 3NTCH 5C07A 3T4AB 1DANT 3ZTJH 1EGJL 4H1LG 4LSVH 4DKFL 3KR3L 4MAYB 4JZOA 1ACZA 5IVZB 4CBPA 4H1LB 3GBLA 3JWDH 2OSLB 4P9HL 4R6UA 4MWFB 5J7CC 3ULUE 2B2XL 4PUBH 1T21A 3L95B 4NZDA 4XXCC 1IGFH 4PJFB 2VN4A 4JQXA 4YNYB 4LSVL 1UXWB 3VDCA 1JHLH 5KVMC 4OGXL 3OHXB 1M7IB 4MAYD 4TSBH 1U3JA 4R9HA 4ZTPH 1PSKH 3QUXD 1KCUL 1HQ4A 2Z92B 4U1MA 3BD3A 1IGFL 1IAMA 2FJHB 4Y4HC 1UM6H 4JQVC 4DZ8A 4PIRF 3O3BA 3RZCC 1XF4B 4ZOAA 1RZKH 1IAIM 2ZUTA 1KCRL 3FOLA 4YZFF 2MHAA 4Q6YA 4TSBL 4WDIB 5FUCC 4NRZB 2ZPKL 3C6SA 4FQJH 2HMID 1PEZA 4GSDH 1JZ5A 4NZJA 1KV3A 1CXHA 2FEEI 4FTVA 5HGHB 4AIOA 1S7WA 3IXTA 1XT5A 2QADC 3OKNB 3LKPB 2X4RB 2FIKA 1RZKL 3KLAA 1NBYA 5ACMA 1YECH 4R0LA 1CBVH 3PNWA 4NKOB 1KPVB 3ES6B 4QRTB 5TDNA 2FBJH 4OF8A 2Y7QB 2EO9A 2G75A 4U6HB 4MQXC 3HUJB 4POZC 3MBEC 3QEUB 1BFSA 4NDMB 4MJ4A 1EAPA 1YECL 2XT1B 4D9QE 3FONA 4XWGL 3QUMA 4QRPA 2FBJL 5E5RB 4WIQA 1LDSA 3HCVB 4LVHC 4PJ7B 3CSPA 2R2EA 4FXLA 4YO0B 4D9RE 1W0VB 2J2ZA 3BHBA 2IEPA 3ZYOA 1RUMH 4HC1A 3TCLA 1KN4H 2JJWA 5J6HB 1A3RL 3MLRH 5KSAB 4OZIB 4JO1H 1HHIB 5CKAA 4KI1A 2XQYG 4OZFA 4ONHA 1GGYA 1KN4L 1DQMH 4AT6A 5SWSA 5I8KL 5ISZA 2V2WB 5C0FA 3QHZL 4PLJD 3FCTA 2HA1A 1T04B 1OAXH 2X4SA 2KL6A 2J7LA 4IIQA 5C0BA 5DURB <