3QR2A

Wild type cd147 ig0 domain
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
117
structure length
117
Chain Sequence
MAGFVQAPLSQQRWVGGSVELHCEAVGSPVPEIQWWFEGQGPNDICSQLWDGARLDRVHIHATYHQHAASTISIDTLVEEDTGTYECRASNDPDRNHLTRAPRVKWVRAQAVVLVLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Basigin
publication title The Retinal Specific CD147 Ig0 Domain: From Molecular Structure to Biological Activity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 25
structure length 117
sequence length 117
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13927 Ig_3 Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qr2A00
4KU1A 2C3HA 3I6LE 1F58L 2GTZA 3WEXB 3SDDB 4ZNEE 4JZJA 4KUCF 3BEWA 3V6FB 4QXUH 2P8LB 2P5WD 4P3CH 1ZTXH 1MEXH 1G1CA 5IW3A 1JV5A 1LDPH 1T04A 4K2UL 1P69B 3BIBX 1J1XL 3AREB 3L5XL 1T6VN 3MPCA 4CVWA 1WWWX 1KPRB 3VFNA 1E6OL 3SY0B 1PFCA 4F57L 4E41E 5CAYB 4KVCL 1KFAL 1YEKL 3IDMA 2H9GB 3DV4A 5ISZE 1ZT4A 2Z31C 2FATH 5J89A 5DD0L 3MTRA 4HHAA 1T3FB 4PJDA 3BWUC 3VWJA 4BH8B 4D8PB 2BZDA 4KJQD 3LPFA 5I74B 1NEZG 2CXKA 4RIRA 3L3HB 4OQTH 1NC4D 1YPZB 2VUOA 3CAFA 1EFXA 1LEIB 4RBPK 1NFDF 5I1HL 5K59F 1RIUH 5D71L 3CSYA 1N8ZA 5DSCA 5IK3B 3ZDXE 4GAYB 5T3XH 5C09B 4OFDA 3AB0C 1QFUH 5CJOH 1T5XB 2A6KA 1BF8A 2VNCA 2R1XB 4C4KT 3WFBL 2NCMA 1J87A 3V2AR 4HV8B 5D1XA 4JM2D 5FK9B 5ESAA 1PVHA 2VXVL 1U6AH 2GHWB 1LO2H 1RK0B 2H3NA 2XWTB 1OLZA 5DGQA 2ADGA 1NC2B 3FKUS 3QBTB 3P30L 5E5RB 2Z8VC 1BPVA 1ZVYA 1MIMH 1PYWB 2CRMA 4AENA 2CLZA 3X12A 5B39G 3JV0A 2F74B 1X5YA 4LPXA 4LPWA 4NQSB 2GTWA 1R3JA 3LY6A 1J18A 4GKSB 1OSZA 3GMPB 4FQLH 1I7ZA 3HTLX 4U3CA 5IFAH 1J11A 2HFEB 1Q1JL 2Z31B 4JZOA 3VD4A 1FHGA 3TYGL 3L5IA 4PJHF 2NW2B 4GH7B 1ONQA 3O0RH 25C8L 3TVMC 4RFEA 5GRUH 2BK8A 3EYOB 3JV6B 1RK1B 5EZJA 3L7FA 4WFGD 5DHVA 5IKCB 3IDJA 4ENEC 3MV9E 4TVPD 1CLCA 5GZOC 1BFSA 4JDTH 1P9MC 1A6WL 3I6LD 1JPGA 1UKTA 1IC7L 1T80A 3MLSL 4PTTA 3HN3A 4OI9A 1S8DB 5BOZG 1P4IL 2XQYG 1FH5H 5JHLH 3L95A 4Q6YA 4NBZB 3MSPA 1BOGA 2E27H 4P5TD 2QHRH 3HRPA 4N0CC 3V7MA 4JB9L 3W39A 4E41D 2B2XL 4U1GC 1G7PB 3BT2L 2D3VA 4JGJA 3SGKC 5C0IA 3MRMA 5FO7A 5HDOA 4MD5A 3V0WL 4OI7A 1CXEA 3I2CL 2PW1B 1AGFA 5KSBB 3CLEH 3DRQA 1QLRA 4LSVL 4L8DA 1CGVA 1QBBA 1OW0A 3VWKA 4EXKA 2EKJA 1EVUA 1JGDB 4KI5E 2VZVA 3JWDL 1KCUL 2W9EL 3NFPA 1VFAA 3ZKSD 5DJ0B 2FECL 4MAUL 2PYEB 3A6CL 4JHWH 4KHXH 4X9HA 4CN4A 1TDQA 3GSXA 5FGBA 4QF1A 4MQTB 4NCDA 3RUGB 3WMSA 5DC4B 3TVMB 4NBXB 4F7MB 3W9DB 3N9GH 4EUPA 3KPSB 1H0DA 3MJ8A 4JFQB 5FO9A 1TXKA 4PP2B 2IANB 4ZD3L 4QRRE 1AI1H 3CZJA 2Z91B 1E28A 4LSPL 2OL3A 3BKCL 1IKNC 2HLAB 3N1QC 1DUYA 4PS4L 4OKDA 1R0AH 4KAQH 1QA9B 1CD1B 3O6FC 1FDLL 3QDHA 2NTFB 4LSTH 2ESVA 3VWJC 4EN3A 2EIZA 1RIHL 4F7CA 4MMZC 3OR7A 4OF8A 2PXYD 1C7SA 1EVTC 3FAXA 4XGZA 4FMKA 5GGUA 4U1GB 2Z92A 4H0IA 3HAEB 1AFVL 5GGSY 4I5BB 4DKEH 4LPCA 3MROB 3K46A 3NCFB 2XTJE 1F45A 3PP3K 2VDPL 4M61B 1CDIA 4EEEA 4FQXA 3ZKMC 3RVTD 4FFYL 4WU5B 4Z7WA 1U2HA 2ZUXA 1WVZA 1TJHH 3MRBB 5KOMC 1KJ2L 2YD3A 3H9ZA 1ORQB 3VXNA 1QD0A 1X5FA 3MV9D 4NUGL 3GHBL 4GBXB 2X9XA 1ZANH 2BC4B 5DI8B 2WW8A 1MFBL 3DI3B 5JW4Q 2B4CC 1XGUB 1JJUA 3WYRA 1XGQA 1XR8B 4WCYH 4QHLA 1FO0A 2AI0H 5EG6C 4MDIB 2OJZH 3C5SA 1KT2A 3LS5H 2AJSH 4OBRA 4RX4D 1CZ8H 5FDWB 3HZYB 5HGBA 3DX7A 1H3PH 1HHGB 2P47B 3S35H 4ZTOH 3IDNB 4X9IA 1DQML 4XP5H 4J8RA 3DURA 5HHPA 5LVEA 1BD2B 3A6BL 3BUYB 5DTFB 4XP4H 1FIGH 4UTAL 3FQRA 5IJVB 3QDAA 2R2EA 3O6FB 3FQWB 4M7JL 1KULA 1VADA 5IB5B 3WKMH 5TDOA 3LKNB 2V7NA 2BHYA 1T5WA 4WV1A 3VFSA 3QUXC 3BQUA 4TTDC 5JTWA 1FNGB 2VMFA 4KI5D 2EDKA 4KHTL 2CPCA 4OCRH 1U92A 3O3DB 3P9MB 1I3UA 2D31B 2X1PA 3ME0A 1F6FB 1HSBB 1XMWA 4NQXB 3ZYOA 5C0FA 5JIKA 2HTKC 5J3HD 3RY5A 1CFNA 1O7SA 1KCRL 4LARH 4QRRD 1E4KA 2FYYA 4GAFB 1MCBA 4N0UA 3TA3D 1WJ3A 4QRPA 4XCNB 2EC9T 3RAJL 2F8VA 3SDCA 2AJUH 2QR0B 4FQQB 4LHUD 5JZ7C 1YY9D 3KPMB 1DQDL 5C0RH 1VEPA 3BOVA 5TDPB 3CC5B 1NSNL 3L3KA 5GS0D 3IKCB 3QQ3B 1UM6H 5FECA 1J7VR 3VH8A 2YD6A 2CD0A 2APTA 3GIZH 3OJ2C 5D72L 4P4KD 4FRWA 3U0PB 4F80A 2HJLA 4LEOB 3S37X 2FR4A 3HZVB 3WCYA 3OPZL 2W0FA 2XTJD 3SDXF 1JBJA 3MLYL 5GIRB 3V4VL 5F7WC 2DLTA 3IDGA 4AM0B 3UBXA 5DEGA 5LGHH 3QUXB 4LKXB 1T83A 3U46B 4P9HH 2NY1B 2CLRB 3WIIL 1U42A 4G43A 1D5BA 1MUJA 2HT2D 2XY2A 4G7YH 1KSRA 1BGXH 1MI5A 4ZUTB 2OYPA 4ZFFA 3LEVH 1EEQA 1ZT1B 3B2VL 2X4SB 4I8DA 2BXZA 4P2QB 5HPOA 3GUTB 1ZA3A 2BNQA 2B8OT 5D2NE 1F42A 4I3SH 3I75A 2V5SA 1GOHA 1U58B 3Q6FA 4CW1A 5C9KA 5JO5B 3PXJA 3DGCR 3MRJB 5DUML 3IJYB 2H8PA 5EFIB 2YPKA 4U6VL 2NY4C 3TN0A 2EDDA 1MCDA 1UJ3C 3HE7A 3MXWL 5E03A 1HKLL 4RGND 3ARDD 3WNMA 4BFIA 4HJGB 2X09A 4Z7OE 4D9LH 3ZO0A 2DQTL 2YA2A 4ZO9A 3JV4B 5C08E 1Q8MA 4OFPA 3G6DH 4IS6A 1WC7A 2KKQA 1RZ8B 5IQ7H 3LVEA 1J8HD 3BP6B 4K23H 4JFYA 5DA4A 5ADOH 4G6MH 4WUUB 4C56E 3LKPA 5B3JF 4CU8A 1GGIH 3QAZC 4U1LB 5I8EA 3WNLA 1NEUA 3RX7A 1BQLL 5TH2A 5AWNL 1OARH 3EYVB 4H8WL 1CGTA 3FT2B 3MLVH 4P57B 3Q6GH 1MJUL 5E99H 4KJQC 4KQ3L 1EBPA 5EUOF 2OS7A 1LO5A 3ALWA 5F93C 1OTUD 2OZ4A 1MCPH 5F97E 4K3EL 5I8CA 1DBJH 4QO1A 4U6HA 1OAQL 1DEEB 5EIVA 4OV5B 5BS0E 2EZ0D 3OBAA 2P1YA 1PKOA 3E8UL 3S36X 4XNZC 3QUKA 4NHUB 2NY4B 3MR9B 1UJ3B 3BP5A 5KN5A 3WUWB 4OZFB 4IEFB 4RA3A 4KDTA 3V5KB 5FHBH 3OAYK 2QLVB 2YK1H 3F12A 4JM2C 4XVJL 1BAFL 3UMTA 3LIZL 3NIGF 4UNTA 5F7HA 5DT1H 1NAMH 2ZCKL 4X8JA 2A6JA 4UU9B 1S7UB 4Z77A 2PW2B 3CIQA 2P5WB 4WTZG 3G6JF 1I8LC 1JZ8A 3MRIB 2QKIB 1R5VB 2X1QA 3KXFA 4YEEA 5JNYB 3VFRA 3BH9A 4OLVH 3ULSA 3PGFL 3CPLA 1BQHB 5EBMB 1J0KA 4XMPH 1KYOJ 4X0KA 5C0DA 4FXLA 1YMHB 4M43L 1KIRA 3T0WA 5E1AA 3WNKA 2YRPA 5D1QD 5HGBB 5C71A 2DTMH 4MCYA 5IVXB 2I07A 3CFDB 1X5AA 1NC4B 4F7TB 5J1AB 4DGIL 3IU4H 4J3SA 3T2OA 2NX5E 1DANU 2FX9H 2Q87A 2RHEA 4RDQG 1A1MA 1KNOA 1YJDC 2J6EL 1R3HB 5C08D 2V7NB 3EGSB 1KCVH 4XNZB 5INDA 5JXAH 1T83C 2DQFA 3CXHJ 1CT8B 1WBXB 2M1KA 1X5XA 4KK8D 3QIUA 4YR6A 2E6PA 4IMLB 3TA3A 4JM2B 1YQVH 4C56D 5IBTH 1MCJA 4R4FL 3MGAA 4IRSD 4P5TC 4LQFL 5KVFH 4K8RD 2Q6WA 4JQVC 4WHDA 1EO7A 1WAAA 4NKMA 2YC1A 1ZVSB 4JFEA 1ADQA 1D5ZA 3TPUB 3V7AE 1IGFL 3VGDA 2ED8A 1XF3B 4A6YB 1I85A 3NAAL 4KKCD 2R39A 3V6OE 1J1PL 2Z93B 2OLDA 4KZEL 1KG0B 5J6GA 2BP3A 3ULVD 4NWUL 1L6ZA 4P2YA 1OGTB 4OM0H 1DUZA 5BS0D 3CH8A 4NWTL 2APVA 4N8VB 3MOQA 3IDIB 3O9WD 3RX8A 1BEYH 3U1SL 4L3EE 1FCCA 4PJ8D 5IMMA 1LHZA 2XWJB 4XPAH 2PTTB 4DKFH 2D03L 5DUBB 5I15L 1OAKL 5BV7H 4HK3N 4LKCB 1KC5H 2QSCH 5TGBA 4XAWH 3QDJE 2E9WA 3OKDA 3DX8A 2I9LA 1YNKL 2SEBA 1R3IH 1CE6B 4X7SH 4AEIL 5E9DA 4B0MM 1OP5H 1EJOH 4HMDA 5I1JH 4P5TB 2P5EA 1IARB 1ZA6A 2PXYC 3Q0HA 5JOFA 1CVSC 5CUSL 4E41B 1SYVB 2ERJC 5FYLL 4Q9CA 1S7QA 1V7MH 5ISZB 5I18L 2PCPA 2JCCF 3NFNA 4NM4L 3FQTB 3O3AA 3SE8L 2VH5H 3ELAT 4L5FH 2PO6A 4G7VL 4P3DA 3RVTC 4U6XA 1MFEH 5D5MA 2FSEA 2NX5D 2XT1B 4G42A 4HSQA 1J8HA 5DRNA 4FFWD 4BH7B 4H25B 4DCQB 1FL3B 4GMTH 4KDTC 4Z7UA 1L7IH 1MAMH 1U3ZA 4DVRL 5LQBH 1MRDH 4MS8D 4R0LA 3D3VA 1LILA 4PJIE 1B6DA 4XTRD 1P7KB 1DL7H 1ODAA 5EBGA 1FFOA 4LSDA 4X6EA 1JI1A 5I19H 2I9TB 2F5AL 5EUKB 1NGQH 5FB8B 1C08B 1LP9E 2BNUA 2DYPA 4MA3A 5HGGS 5I16A 3AS2A 3W11D 4PJAA 4QHKJ 4M62L 5A2FA 4KFZC 3R0NA 3X14A 4OV6F 4M1CD 4XMLH 1RIVH 1NLBL 4MAYD 3NIDF 4LDEB 2FO1A 2DLIA 3U6RA 5F3BB 1FORH 4C58B 2A77H 1G7MB 2PXYB 3ZE2E 3HNTH 4KI5C 2ERJB 2YA1A 3WV0A 1FIEA 3ARFA 4Y88A 3NCEB 3MFFA 4HXBH 3P40A 4DKDC 1GGBL 1PEWA 4X6DA 2BDNL 3BWAB 2NY7L 2X2YA 2HKFH 5GGRA 4PYGA 1URLA 5DVNA 5I1KL 4XXDB 2JF1A 2V2TA 2HVJB 4L3ED 5J3HC 4L8SA 3VFMA 3SDYL 4KPHL 5ALBL 4QRUA 4ERSL 2GK0A 4UILH 1YEFL 4WHCA 3MV9B 2DQHL 1XGPA 4PY8J 5FUZH 2V5RA 2VKXA 3TA3C 4G9DA 1M7DB 3MXVH 3QFDA 2WWMD 3VXOB 5D7LD 3QDJD 2A6JB 2E7LC 1YY9C 3MA7B 1HHIA 3CFCH 4OZGE 5C0GB 1KJ3L 5H94B 2DL9A 4JM4L 1PAMA 2MQ3A 4PJFE 1OTTD 3L3JA 5EU6D 3WFHA 1N7MH 5FOBA 2A9ML 2B1HL 4P4KC 2HN7A 4OLZH 4UIKL 1GVIA 1YECL 4FFZL 1S5IH 4PJEA 1A6VH 5IV2A 2DQEL 4OJFH 4LNVA 2UYLB 5E8PA 3WLBB 2XTJC 3BKYH 1I1FA 3FTGA 3QUMH 4MWFB 4JQXA 4XAKE 2FH6A 5BW7A 4HWEH 3Q5YA 3UTTE 5LGKA 1NLDH 1C5CH 4I1NB 4BK4A 1SJHA 4BZ1H 1P4BH 2P8PA 3MLTB 3QJHA 2HT2C 1KNOB 1M7IB 1Z6JT 1NBVL 2VIRA 1XIWD 3ARBD 1S5HB 2AGJH 1B2WH 3WHE1 1QFWL 2KQMA 4MA7L 4XBPB 5EZLB 5D7SL 3ZTNH 5CFHA 2BOBB 3ZMRA 1Q72H 5IQ9A 3BIAX 1LE5B 4J12A 4QRRB 1RZGA 3CDCA 2F53A 4YE4H 3B8SA 3TA3B 32C2A 4AMKL 3K8KA 4NZRH 1Q94A 4K3HA 5F7YC 1PSKL 1YC8A 4KK5D 4BKLA 4F15C 1XR9A 4LHUB 3ARDC 2IQ9H 2DDQH 3UPCA 3QEGH 3P0VL 1Q9KA 4JLRA 5CGMA 2O5YL 4N1HB 4R7NB 1O5DT 4WDIA 5DA0B 2IPTH 1A6UL 4MNQE 3OJVC 1P5VA 4P4KB 3BGMB 3MUJA 4BYHA 3ZSSA 4LCUA 4JPKL 3AAZA 5GJSH 3S5LB 4O9HL 3TT1L 5ALCL 1A3LH 2EDOA 3U2SB 1N59A 4OUUB 3MCLH 4TUKL 2A83A 4G8FA 3SKNA 5H35A 2PR4H 2YRZA 2OX5A 2VL4A 5KTEH 4KVNL 3ZHKA 3DO3A 3ROOB 3PV7A 1IGYA 1WZLA 4EBQL 2HVKA 3PGDB 2C4FT 5JORB 2DM7A 4PREA 2CKBB 2W9DL 1JMXA 1QKZH 2WINA 1OTUC 3GSVB 1U8KB 2VYRE 3IGAB 5J7CC 1U3HA 5D70H 2HFFA 4JAMA 1Q9WB 3MUGA 3ES6A 1C5BH 4QYOB 5E8DH 3L5WB 3N85H 3FB6A 4LVOC 1T1XA 2EZ0C 3OKLB 1KTRL 4U1SA 1XFPA 3QHZH 3QIWA 1KGCE 2AJXH 3BH8A 4LLYA 3GSWB 2D7TL 3VDCA 3NGBC 4F15B 3ARDB 4PRDB 4YDVB 4ZSOA 2CMRL 2ARJQ 4ZTPL 2MHAB 5D2LA 4QTHA 3PDGA 5CP3H 4MJ5A 4XAKD 3S6CA 3DXAE 5IB1A 1E4JA 2J88L 3VRJA 3UTTD 1JZ5A 1QBML 3TP4A 3ARUA 2EIBA 4MQXC 4LRNH 4EI6B 2EDLA 4YHPB 1CICA 3MNWB 3U82B 1OGAD 4YUEH 1A21A 1ZS8A 2APFA 4TVSa 1NMBL 4ZMAT 4MNHA 5KS9A 5KAQG 1YPZF 3GMRB 1D6EB 4XNMB 3FT4A 5D2NC 3TJHC 2J4WH 4POUB 3DSNA 1A2YA 1F6AB 4M7ZC 1FNEB 3PXHA 1QLFA 5L6YH 2NNAA 3INUH 5D1QC 4WW2A 2Y06L 1IQWL 5C2BL 2XY1A 2RFXB 1YEEH 2VLJE 5I1AA 4UIMA 2BVPA 5B39A 3T0EE 4PPTA 5F9WC 2EDYA 5FHAL 5MEPA 1MY7A 3C08L 2IGFL 4JDZA 1RUPL 2VLKE 1MRFL 4UOW0 1DQTA 4JY6B 4OLYL 4Z7VE 3LMJH 4LVOB 3D39E 5I8OL 3GRWA 3VMNA 3NCJL 4K9EC 1U8PA 5C8JA 3MV7D 4LSRL 4ZFOL 1OAZL 4LCCA 3NGBB 3D18B 5AYUH 4KK8C 4WEBH 1B4JH 1ZLUH 2BY2A 2X4TA 2WP3O 2OSLA 3SBWA 5IESH 4IRSC 4RAHA 1CGXA 5GHWH 1MCOL 1A5FL 3LSOA 1WEJL 2DJ4A 3I9GL 3QCUH 5HYQB 5D7LA 4K8RC 4Y4HA 1CBVH 4BSWA 1CLOH 4HUUA 1AQDB 3GMLB 3LV3A 3RTQB 1HDMA 1D9KD 2ZPKH 5J12B 4GKOA 4HKZA 5E56A 3MQIA 3H3PH 4MJID 5EU6A 5L88H 2ZSVA 1GC1C 2EEBA 1QSZA 1ZGLP 4U1KA 5BO1L 1UYWL 5T5NF 3EYUH 4KKCC 1DVFA 4KXZH 5D2NB 4M7ZB 2DWDA 3AMLA 2EDTA 1Z3GL 5D1QB 4NO5A 5FA4A 3DROA 4NZUL 3GB7B 4NRYA 1IAIH 4QXWA 3O9WC 2HH0L 1KGCD 4M48H 5F9WB 4PJ8C 4FQJH 3Q1SL 1M71B 5DO2D 3QZWG 2DJUA 5KVDL 4NQDE 3ARBA 3QISA 5C08B 3OJDB 4JPVL 4K7PX 1JPTL 1KCSH 2ZCLL 4R2GD 3WJLC 4JPWL 1VGKA 1TETH 5JHDA 1MOEA 5DS8A 4PV9B 4ZUUA 4PY7A 2DQDH 1J0JA 3L1OL 1GGUA 1RZKL 4C56B 5KSBF 4L4TE 2OI9C 5TE4L 4IRSB 2RCSL 3FRPA 5E7BA 1BBDL 3RL2A 3VI4F 5I76A 3VFGH 3OHXA 3QNXB 1ZE3C 2OP4L 3GSRB 3RZCD 5KSAD 3GBNL 2VABA 1I3RA 2DI8A 2OR8A 1T1WB 3STZB 1DBAL 2E6QA 4I3RL 3RUGF 1GC1H 2GITA 2VLJD 5CLTA 3TIDB 3T0ED 3GMOA 3OJMB 4FFWC 4H5SA 4M3KB 3EFFB 2HFGL 4YDJB 2VLKD 2OJEA 4O51A 1MPAL 5DRWB 3NFSH 1JGEA 1MJ8L 3D39D 5ESQA 5BS0B 4K3DL 4MS8C 4Y16D 1V5JA 2ATKB 5E8NB 3O9WB 5A3ID 2KH2B 4R8WL 4XTRC 1IT9H 4PJ8B 1I9IL 3D85D 3M1BB 1YNLH 2C5DC 1WCQA 4BM7A 1CL7H 4RBPH 2FD6L 4RNRA 3VXPB 2AQ2A 2JELH 3DUHA 3W11C 4RQQA 3F7YB 4LGSB 4JHZA 4N0FA 1OPGH 4M1CC 3OR6A 4LCWA 4MAYC 5SWSD 3O6KH 4OZGA 1EGJA 2LU4A 2X44D 2Y5TB 4WW2C 5DUPL 1JFQL 2VDQH 2VXQH 1AD0A 1XF2B 2CDFA 4FMFA 2BSED 4HT1L 4G8IA 5EC2B 1AR2A 3V6OC 1WZMA 5IEHA 4F9LC 5TQ2H 1IAMA 1UCBH 1WT5A 2AXFB 3B6SA 2LVEA 2VDKL 4G6AD 2YZ8A 1GHFH 1N6VA 2IQAA 4HWBA 4S1QL 4V1DE 3EW3B 2VXTH 5C0BE 2NX5B 1TQBB 3BW9A 5CP7A 1OGAA 2QSVA 4P4RB 2XIDA 5K93A 4EVNB 3TBTB 2R1WB 4NQDD 4Q9RL 4K94C 4UTBL 2DAVA 1NGZA 1E4XI 4HH9B 3ARGA 2WWMC 4MA8L 3JWOL 5CGTA 5IB4A 3HI6L 4PJ7A 3WJJA 3P4NB 5EU3A 3WKNA 5CKAA 1A4KA 2H32B 4OT1L 1UACH 4MGXA 2H32H 3QNZB 4I4WA 3FQNB 3U4EA 2COQA 4Y1AE 1VGEL 4X6FB 4GOSA 1OTTC 1FG9C 3K2UH 4DQOH 1D5XA 3VA2C 2J8UA 4MXWH 4WO4B 1ZEAH 5F7LB 4MAYB 3QUZD 1DP0A 1MHCA 1QLFB 4N90E 5T5FH 3VA6A 1LE9A 2DMKA 2NNAB 1FAIL 4RWYL 2ZZUT 2KZ1B 3NA9L 3MV7A 1MCWW 3REWB 2MCPL 5FV1L 4UQ3B 1IM3A 3HNSL 1UGNA 1OAUH 4QXUL 1AIFA 2XPGA 4RMSA 4WEMB 1RJYA 4P3CL 3CFIC 1XIWC 1H3UA 5CZXD 4OZHE 1A7PH 4PB9H 2YD8A 4R9HA 1FC2D 4L3EB 2DMCA 5DK0A 3KYOB 2JJVA 2UV3A 1L0XA 2VLME 1FFPA 3O3EB 2FATL 3RI5F 3QG6B 4MJIA 4APQA 1NBYA 4PBXA 1T1ZB 5FUOH 4KK5C 1Y6KR 4OQTL 5HHOA 2DOCA 3LHPH 1MJJA 3QDJB 2Z35B 2Y36L 3QJFB 1FJ1A 3LRHA 4IIQC 3DTXA 1XGRB 3VGEA 1V8HA 5BXFB 1RIUL 1S3KH 1CXKA 2VDNL 1YDPA 4C54A 2GKIA 5IFJB 4YHNA 3W9EA 5T3XL 1HYRC 5SX4H 4AZ8A 3QEQE 1OSPL 2D7NA 4HIIB 5CJOL 3UO1H 5FF6A 1CYGA 3K4ZA 5ID1B 4MNGA 2BJMH 1D5MA 1X7QB 1NL0H 2FWOA 3DROB 3M8OH 1U6AL 4NDMA 1KYOK 1LO2L 3P77A 1ITBB 4V1DD 1HI6B 5C0BD 1TVBB 2BY1A 3CDGB 4W4OA 5F1IA 5B38G 3ECBB 5GQBA 3MUY1 4P5KA 1MIML 4YHIA 3BZFA 1XIWB 2Y5EA 4CADB 4PJIB 1EK3A 1FL5B 3PP3H 1FFNB 4XP6H 3QQ4A 3L3DB 2HG5B 4NNXA 4XMKH 5KSAA 3RPIA 3IVKB 4ZODA 4QT5A 4LIQH 4ZOAA 5IFAL 3MLRL 5FAAA 5IBUB 2IADB 4P5MB 2C7UA 2YWYA 5AZ2H 3CVHA 4Y1AD 1LP9B 4Y7MA 3FO2B 3CXHK 3F7QA 1JF6A 5GRUL 5IJKC 1N0XL 1FNSH 2Y4SA 1AGCA 1OP3K 4IIQB 3EDEA 2FEDD 2VLKA 2R23B 3IF1B 1U2CA 3PQYA 4IMKA 4N90D 3JSSA 5AD0B 2VC2H 1EX0A 1PLGL 4JVWA 3E1F1 5F7DB 4PRPA 3FB8B 4Y16A 2V9RA 3BP7A 4JDTL 4P23D 1FVCB 4OLUH 1AGBB 3IFLH 3MREB 1SBSH 1EZVY 3HI5H 1XGTA 1FH5L 5FGSA 4XNUH 3RBGA 5JHLL 2W65B 3MX0A 5CD3A 5I1GH 2EE2A 4BQBA 2E27L 4HCRH 2NXYD 2QHRL 4PB0H 5SWSA 3MLPA 2G5RA 2VLMD 4NRZB 5CSZA 2AKRA 1IAOB 1NMAH 1BFTA 4HUMB 4M9PA 3EO9H 3CLEL 2CO6B 3MZGB 4KY1H 4WTZA 1A9BA 3B8YA 1Z5LB 2DLHA 4EIZC 1H3GA 1R24A 1H8OA 4KHXL 4DN3H 4PJFB 4W81A 4KTEH 4MMXC 1KPUA 3KAAA 2R0KH 3RY6C 4F9PC 3QEQD 2VXSH 2A6IA 1U3YA 3E6HA 3D25B 1XH3A 1TZIB 5I1LB 3QH3A 1AI1L 5EOTA 3CSGA 5A1AA 4ZPTA 4U1NB 3L9RA 3M07A 4PJBE 4JJ5A 2X4QB 3UTTB 4D0DA 5IW1A 1BQUA 3CLFH 4OLWH 3V52H 1R0AL 3S97C 4KAQL 1D9KC 1CGSH 1VESA 3U0TA 3DBXA 2YPLE 3C5ZA 4GG8B 5J56B 4Y5VC 5IVXF 2DKMA 5JW4M 3GSNB 4M5YL 2GFBB 2PYFA 4HK0A 4N0YL 4JQIH 2BVOA 4PIRF 3WLWD 3GSNH 1E4WL 1HE7A 5GGVH 5T1LA 2IMMA 3AXLB 5HDQH 4GLRH 4DKEL 3HS0B 5F6HJ 4UQ2B 3U4EB 4YIQB 3BAEH 1A02N 4ZNCD 1M05B 2PF6A 5DC0A 1J5OH 3K1KC 1TJHL 1B6UA 2IFGA 4ELME 3ZE1F 2ZOLB 5DFTA 5DO2C 1U8OB 2PETA 4JM2F 1CFBA 4YGAB 3Q5OA 3CFBA 4E42B 5IVNA 4MNQB 1BECA 5ECJE 4LLDA 3IETB 2G5BA 5GGSA 4R2GC 4HH8A 3E3QE 2AI0L 4NO0B 4W4OC 3SKOA 5I30H 1KXQE 5DEFA 5B4MD 3LS5L 1CZ8L 4I77H 5C92A 5A16A 4L8CB 4XP5L 3BVNA 3Q48A 3RZCC 4XP4L 2MNUA 3EOAB 3PWVB 1U91A 1D9KB 5DURD 2UY6A 1XCQB 4X4XA 1VFMA 2PKDA 4UINH 4Y5VB 1KLUA 3MBEA 4PRAA 1X5LA 3S9DB 3LEXB 3T0EC 1YC7A 3IFPB 4JFDA 1S9XA 4OCRL 5FXCH 3DPBA 4IMKC 4KH2A 3TESA 3RP1A 3F58H 4YK4C 4Y16C 3DVNB 3BXNA 5A3IC 5ABDE 5F88B 4DEPC 5F89B 1BIIA 5D7IE 5T1KA 3QA3B 1QR1B 3VD9A 3QRGH 4LARL 5F44A 1KIQB 5J6HA 4FG6D 2CRZA 1IZJA 4XX1G 5IFHH 1OHQA 4PLKD 3DXAB 2EO1A 5EC1A 3FRUB 5HYSA 2YWZA 4R2GB 2AJUL 3ULUL 4EJ1C 3KDMA 1JYVA 1NKOA 1U8MA 2FIKA 4S1RL 5C0RL 3P0YH 1UADC 4NKOA 5FCUL 3GI9H 1UEMA 2WMPA 2YPLD 2OXGA 3DSFL 1UM6L 3AMKA 2CDGB 5EU4B 4XWGH 1TJIH 3OAYH 2ID5A 1HH9B 3KPRD 3RZCB 2NMSA 5IHUH 1HHKB 5JMRA 1AD9B 3KJ6H 1BWWA 2V7HA 1J0YA 3RNKA 3ZDXF 2C7UB 4G6AC 1S7SA 1SVCP 4EXPX 4P23A 5IMKA 5E8OA 1LO0H 4PV8A 2AXGA 1GOGA 2VLJB 5LGHL 3DYOA 3T0EB 1S9VB 1LDSA 4P9HL 2VLKB 1MQKL 4JZNB 4Z7VB 5GRJH 2D0GA 4X5XA 4G7YL 3D39B 4X5WA 4YK4B 1BGXL 1VFBB 3VFUA 4ONHA 5DJDA 3LEVL 2PTUA 5DJ6A 3TNNA 3G04B 3V6ZB 1BVLA 4OFKA 3D85B 4DEPB 5AG8A 4XVUD 4I3SL 4NNYB 1DQJB 3BHBA 3I50H 5EBWA 5CJ8A 4DK6A 1P4LA 1MELA 4HFWA 3DHJA 5SV4A 2ATPA 1BBJB 1TVHB 2EE9A 4YDLC 1I7UA 1ZXQA 3AS1A 1UH3A 3QUZC 4LBEB 4D9LL 4ODXA 1HQ4B 1YYLH 4QRTB 3PDOB 4NQCE 1K8DA 1UXSB 3OKNB 3G6DL 4CKVX 4RAUB 3T0AA 5HVGB 5IQ7L 3ILPB 4XZUB 1T22B 5CJQH 4YGVB 4K23L 3CFEB 1JHLH 5ADOL 1OB1A 4G6ML 1QSEE 5CZXC 1RJZA 1EAPA 1I3VA 1GGIL 1QRKA 3ARWA 4Y4FB 1OARL 5E2JA 1IKFH 4HK3J 4YAQA 1IJ9A 4WHYH 5ID0B 4G8EB 1ZLWH 5I75C 3MLVL 1HILA 4HIJA 1GXEA 4MJ6A 2GI7A 4PJCA 5E99L 4CVZA 4NQDB 4JANB 1OOAA 3VFWB 1FO0H 1VB9A 1WIOA 4Y5YA 2NQCA 2VR5A 3BD3A 4XVSH 2IBBA 1Z0MA 2Q1EA 3U7WH 2LVCA 5HJ3B 1MCPL 3S8WA 5DK2A 1DBJL 5IVOA 3LKOA 3BEVA 1UXWA 4HIEB 3TO4D 5ESVA 3WXVH 4KJYA 2WUCH 2AV1B 4L4TB 4U31A 4F2MA 1KJ2A 2EEAA 3D0LB 2DLFH 5HXMA 3OKOB 4YDLB 3HZKA 2F54E 2VLLA 2E7HA 4GW1B 1T20B 4Z0BH 4KI5F 7CGTA 4WW1A 3QUZB 2JJTC 3REVA 5C0CA 4M03A 1MCQA 5FHBL 4LMQI 1JNLH 1R5WA 2YK1L 5DT1L 1NAML 1S7TA 1KN2H 1XF4A 3VI3E 5IF0A 3ET9F 3UDWC 4I0CC 3L5XH 4E5XA 2X70B 3V6BR 4N1EA 2BFVL 1U9KA 4WI5A 1RJLB 2L0DA 5H2BA 5FYLE 4KVCH 1KFAH 1AXTH 1QQDA 4JFXA 4OD3H 3DVIA 3L7EA 4XMPL 1UQSA 1JHTA 4FXGA 3LS4H 5I75B 4KUZH 4OQ1A 3DOSA 3FOMA 2J2ZA 2J3SA 4JKPH 3RDTA 3CFJA 1ZMYA 4OM1H 1FVDA 1QLEL 3IU4L 4XPBH 5I1HH 4IRJA 2G60H 1CFVH 3H7BB 3UP1A 2FX9L 2FEDC 4HUXB 4U05A 4YDIL 4LAJH 4C4KO 1SJVA 3W0WA 1J0ZA 2VSCA 3VFTA 5IHZA 1NDGB 1PX3A 4NQCD 1OAXH 1K4DB 2HFTA 4P23C 1WK0A 3FJTA 4G3YH 4FQPA 5DJAB 5DMJB 5JXAL 3MACH 3WFBH 4LLWB 1JCKA 2VQUA 4ZFZA 2EDNA 4JG0H 2WLYA 1QSED 5IBTL 4NT6B 2NXYC 4V1DB 3P30H 5KVFL 5C0BB 1LEKA 1HXYB 3WE6A 4HGWB 1I8IB 1AGDA 2EH7H 3FQXB 5CHNA 3L6FA 4YX2H 3IXTA 2HMID 5DQ9A 1MHHA 2XNAA 4P99A 3JWDC 4O2CA 1C16A 3KLDA 2XZQH 4YXHH 3LQAH 3KPRA 5CIPA 4TSCH 1A1OA 1NFDA 1Q1JH 3MUZ1 4YHLL 3E6FA 4O5LH 3HZMB 3FONB 1NGXB 5CZVH 4Y1AB 3H9SA 4ZAKD 3IJHA 1SJEA 5CMAB 1T4KB 1UKQA 2XA3A 3TBWA 1BEYL 3HPJB 4PGEA 2ZCHL 2WBJD 1KXTB 2WLZA 4HUWA 4XPAL 4YFEA 4DKFL 3MMEA 6FABH 5BV7L 1VA9A 1F4WH 2H45A 4GQ9H 4POYA 1KC5L 1K2DA 3TIEA 4XAWL 4L3CA 3ALXA 4U7MA 3UTZA 2I24N 4TNVF 4HEPG 4HMCA 4PY8I 4D94A 1R3IL 4X7SL 1BZ9B 3V4PL 1ZHBA 4OZHB 1EJOL 4FXKB 4J4PA 4TUJB 4WUKH 2BRRL 5I1JL 5E0QA 2NXYB 2B2XH 5FYLD 5KVEH 5MEOB 4Y5YC 1A6TB 4HIXH 3WLWC 2HAZA 1AO7A 1XZ0B 1CDCA 4X4MA 4OIIH 3I2CH 1V7ML 3HPLA 4PJHA 1V3KA 3SGDH 3T65B 4LSVH 3WDIA 2VH5L 4L5FL 1JHKL 4CMMB 5F7MC 5DMYA 4CN6A 1MFEL 3JWDH 4HWNA 5BZDA 4ORGA 2A9NH 5AYQA 1Y6MR 4GMTL 3ZL4L 1IGTB 1RVFL 1DLHA 2FJGB 2IPUK 1MAML 4IM8A 5LQBL 3OXRA 3RWDA 1MRDL 1WCBA 3WS6A 4HJJH 5ACLA 1LD9A 1XGYH 3QEQB 4UNUA 4U6YB 3HRZB 5DC9B 5B4MC 4LSPH 4KKBD 5I19L 3O6ML 3BO8B 3X3FH 8FABA 1GGCH 3P9WB 1TZHB 4H26B 4U1JA 5F21B 3QZWA 5J1TC 2YUVA 1U95A 1IM9D 2AJZB 2BVQA 2R2CA 2MKLC 5D7JD 2ILLA 4XMLL 4GRMB 3TO4A 5EN2A 3D1MC 4X99A 2CUIA 2JB5H 3QEHB 5BZWB 1FORL 1G7JA 4FFVD 1NBQA 3OMZA 3FOLB 3RNQB 4PGBB 3MNVA 3HNTL 5C9JA 2LAAA 5AZEH 1KF9B 3NN8B 4Z7OF 4HXBL 4HKBA 5DJ2A 3HHRB 3UPRA 4LSQH 1XF5A 3VJ6A 3IU3B 2HKFL 3NBNA 3RFZC 5K9OB 3PV6B 4WWID 4X9GA 1WBYB 1QVOA 3S96A 2ITCB 5DRZB 2H26B 4XBGA 5C7XH 1CQYA 4P2CG 4NUGH 3GHBH 5HTSA 1I1AD 4P9ML 5DDHA 5FUZL 1MFBH 1PG7X 4FG6C 1U8LA 4UUJA 4PLKC 3MXVL 1WQVT 3KS0J 5T1MB 5IMOA 1P6FA 5E2UH 1XF4B 2BVTA 3SGJC 2Z8WC 3DX9B 1JGUL 3CFCL 1ZGLM 1RUQL 3ZE0E 1G7IB 1DQMH 1MY5A 1T0MB 1N7ML 3AS0A 3A6BH 2D7MA 1VFUA 4OLZL 2GEEA 5J9PB 1S5IL 2J6EA 2YHGA 2B1AL 4M7JH 1A6VL 2PN5A 5DURB 1DR9A 2YXFA 3BKYL 1I4FA 3SQBA 3QUML 1KELH 4U1IB 1I9JH 1NGPH 2CIIA 1WIPA 4HWEL 4R96B 1MH5B 1K85A 4BZ1L 1P4BL 3MRPB 4WIQA 3GJFB 4GRWE 1ZLVK 3DO7B 2DF3A 3GJFH 4TN9A 4UAOB 3HKFA 4QXTA 2LAGB 1ES0A 3MRKA 2YD9A 4HD9A 2AGJL 2GJ6A 1B2WL 1FG2A 4Y8DC 3VFOB 5HDBE 3E3QC 4XVUC 3ZTNL 1Q9OB 1Q72L 3AS3A 3O8XD 4HUNB 4PGCB 9CGTA 3C2SA 3HCVB 2XKSA 2IC2A 3C6LA 4PJBB 2Q86B 2D0HA 3O2DA 5FOJA 3SJVB 4JKWA 3WE6B 4GW5A 2GSIB 1NSNH 2IQ9L 2DDQL 3QEGL 4XPHH 1Q38A 1YN7B 4OCNC 2YPLB 3RIAF 1P84J 3G5VA 3HUJE 3GGWA 3EYFA 4OFVA 5LXGH 2Q7YA 4ETQB 1O0VA 3OPZH 2MPAL 4JO3L 5GJSL 1FYTE 2CRYA 4G6KL 1A3LL 3BKMH 2NXZB 3MLYH 1P7QA 2Z4QB 2F8OA 5I1CH 3MCLL 2V2XA 2HWZH 2PR4L 5GS3A 1NGYB 4H8WC 4RMWA 3TM6A 4P46D 4HPOH 5KTEL 1A9EA 4ELMB 4DZBB 3FQUB 3PWPE 3RWIA 4HFUH 2HLFD 3CZFB 1HEZB 4XC1H 1F5WA 3PWNA 1SY6A 4OAWB 1I8KB 3B2VH 3RJDA 5ETUA 3TO2A 1QKZL 4X6CE 5EO9B 1IGCL 4CDHA 1QRNE 4XCFH 5D70L 5KG9A 3TO4C 4RA0C 2ZJSH 1C5BL 5E8DL 3FO1B 3N85L 4WW2F 1M6OB 3FZUD 3MZTA 3MXWH 3QHZL 2AJXL 4UDTB 1W72L 2YSSA 4PRBA 5GRVK 3PE9A 2BNRE 2XN9A 3SDXA 1RULL 4P2RA 4DJMA 3DGGB 2GAZB 3F5WA 2JK5B 3GMMB 2NZIA 4BFBD 2PNDA 3BRDA 5EPMA 3VXSE 2EDHA 1RPQA 4XCYB 1FZJB 2E3VA 2JKXA 3D48R 3UYPA 5LKNA 4LRNL 1S7WB 5IR1B 2X5PA 3P4OB 4X83A 3O11A 4ISVB 5EZIH 5F70A 1BQLH 4PR5A 3H9YA 3TZVB 3GSQA 4IJ3C 1MCFA 2BSSB 4J3WA 3LN5B 4QRSA 4KV5E 2IH1A 4OBSA 2J4WL 4QCIB 5D7IB 3QXAA 1MCEA 3KWWB 1H8NA 1JF5A 4KQ3H 3NIFE 5E00B 5E5MA 5L6YL 3INUL 3MRHA 5DVKA 5B8CC 3UC0H 1T21B 4F7EB 2BMKA 3C9NA 4PRNB 4S10A 5DVLA 1G6RA 4R90L 3X13A 3QULA 3O45B 3RWJA 1KLGB 3IRPX 1CDJA 3LMJL 3DUSA 3H3BC 5EU5B 5ERWA 5FM5M 3G6AA 5MERB 3T4YA 1F3DJ 5C9JB 1FYTD 1HNFA 4WEBL 5IROC 1B4JL 3S88H 2DICA 1J05B 1RZ7H 3SOBH 4S1DD 3T04D 3UTQA 4H1LA 5EORH 5IESL 1I7RA 1RU9H 1ETZB 5GHWL 4PJIF 4XCEB 5LG1A 1S7VA 1CLOL 1LNUA 5EU7E 4FS0A 3WIFA 3P9LA 3PWPD 3WN5A 4Y2DA 2ZPKL 2WP3T 3QXDA 5EUOA 2CR6A 4GS7B 3H3PL 5L88L 1LP9F 3PGFH 2HMIC 1U8JA 4IJ3B 5DD6B 4GG6E 3EYUL 2QJDA 3MOAH 4HGKC 1UM5H 4DZ8B 1QRND 2CLVA 5DRXA 3EDJA 3MRCB 4EUPG 2GQHA 2XRAH 3QP3A 4NJAH 1MFAH 1QZ1A 4ZAKC 4NSKB 5B8CB 4I3GA 1AGEB 1IAIL 1N5AB 3I6KB 3FN3A 3NZHL 3ZE2F 4QOKA 1A4JA 5GRXG 4FQJL 1R3KA 2WBJC 4NO3A 4IHOA 2BNRD 1UM4H 4JRXA 4NQCB 2FL5B 3U7AA 4LHJB 3SHSA 1UA6H 3O2VH 3R1GH 4KRPB 4ZDHA 3VXSD 4HKJB 4AIOA 1KCSL 1W8NA 4JRWA 4JRYE 3FT3B 3SCMD 3G6JA 3E2HC 4C57C 4XRCB 3WUWG 4HKXA 3TBYB 3V5DB 3P4MB 2DQDL 4NIKB 4JN2B 3IFNH 1QSEB 3TCLB 4LQFH 2RJMA 1NJ9A 2NY5H 5EO1A 3LKQA 4JVUA 3MLXH 1ZSDA 3VFGL 5JPNA 3QI9D 3T1FA 1IGMH 2FNBA 1P7HL 1IGFH 2E7CA 4OZGF 5HYJA 2IAMA 4GKNB 3K3QA 1K5NB 2FECI 4PJFF 4WHYG 5F1SA 1GC1L 1I7TA 1AHWC 1A6ZA 1Q0YH 1TCRB 4A2MA 2R0ZH 2ARWA 3RGVD 5ACZA 1WUNT 4MX7B 4R26H 2P7TA 3HI1B 1L7TH 3NFSL 4ZAKB 1G7QA 5EO0A 3I6GB 4ZXBA 3JTTA 1NEZB 4NUJB 2EXWD 5T3ZL 1W0YT 4I2XA 1CD0A 2N1KA 2F54B 1NBZA 1IT9L 1ZHNB 2WBJB 3CUPA 4V2BA 5E95B 4CNIA 2D03H 4F3FB 5CEXB 4GUPA 4KKBC 1YNLL 3SO5A 2XICA 1CL7L 3WL9A 5EBLB 3BJLA 1B0RB 1RZJL 1N2RB 3PWLA 2C1OB 43CAA 1CIUA 3DYMA 4QRQB 5D6CA 5LGJB 3DRTB 5D7JC 1YNKH 4HLJA 3WDHA 3MRGB 3E2HB 3O6KL 4F33A 3Q5TA 5L8KB 3RWIB 2BVYA 4L1DA 5SWZA 5E6YA 4XXCC 3TCXA 4FFVC 1ZWIA 2VXQL 4G8GA 2ZOKB 3F7VA 4OF0A 4FQ1H 4Y4KD 1OD7A 1AP2A 4U4BA 1ZHKB 1L9MA 1RAMA 3SE8H 2A6DA 5TQ2L 3IFOA 1WLHA 3QDGA 1GHFL 2Y6SD 4JKKA 3RWEA 4NZDA 4O02H 1AHWB 1QFPA 2VXTL 5C0JA 1ZV5A 4M8VA 4QHMB 2IPKA 1PDKA 4YH6A 2VAAA 3MA9H 3GRWH 1I1AC 3MV8A 5KANI 1B9ZA 2VLRA 4I0PD 2UZXB 2Q7NA 2DM3A 2NW3A 5FO8B 5IMLB 5SV3A 3VH8G 5KSVB 3KG5A 1NCUA 4N8VG 1SMOA 4I0KA 2GT9A 1T7VA 3KPQB 5L2JB 4PG9A 1E0OB 4LNRB 2R1YA 3KPLA 3HLAA 1OP3H 3EYQD 1IBGH 4HZLA 5I17A 4IOIB 1QG3A 4M62H 3K2UL 4DQOL 3KR3L 3BDBA 1FN4B 2HJFA 4IRZL 5HSFA 1IM9B 5D7JB 3L3OB 4MXWL 2E5EA 1UVQA 1KPVA 4YC2C 1ZEAL 2JCCA 3IKKA 4ZFOA 5T5FL 1PG7W 5BRZE 5JLZA 1F4XH 4CBPA 4LEXH 5BMFH 1BIHA 1IGIH 1FVEA 2ICES 3S37L 2DKUA 4WWKD 4DW2H 2E7MA 3BKJH 3SDDD 3VE0A 4G5ZH 4QEGA 4D9QE 5GGTH 3DIFA 1GGBH 4PGDA 1H3XA 1OAUL 1F3JB 2ADIB 1EERB 3HE6A 3Q3GA 4J23A 1VKXA 1IL1A 4PB9L 2VL5B 3DUSB 3MCKA 2Y7QA 5DQJB 1A0QL 3MRRB 5INCB 4ERSH 1GPOL 4PJGE 1NUFA 3O8XC 2X4UA 4NPYA 4W6WB 1I1AB 1JTPA 3CMOH 2R9HD 1FL6B 3HFMH 1TTFA 2EYSB 5FUOL 2VN4A 1EO5A 3LHPL 2CUHA 4OLEA 1HQRB 3I85A 4WU7A 3VCLA 1DN0B 3EHBD 3VXTB 1ORSB 4UOJA 5T3XD 1S3KL 2WZPD 1I8MB 5D9SA 4ZS7L 5C09D 2B1HH 4LLVA 4YBHA 4UIKH 1G9EA 4L8BA 1RUAH 3FFCA 1S7XA 2DQEH 4YC2B 4I48A 2NR6D 4NZJA 7FABH 3UO1L 1PBYA 5DRXB 3JUYA 4FQ2H 1N26A 3HG1E 5ITFA 4Z7VF 3PHQA 4LLMB 4M6MH 3VW3H 2BOCA 4C55A 2UUDK 1ND0B 2HT4D 1NL0L 2VOTA 4X4YA 3M8OL 3ZKQD 4HAGA 4P46C 2FIRT 5KJRL 3QWOA 3T8XB 2DLGA 4HC1A 1BVKB 5LJYH 1NFIA 1KV3A 2NTSP 4OCSH 2HLFC 1S9KC 2JLLA 3PHOB 4HX1B 3D5OF 3FHAA 4MA7H 4Q2ZB 2RBLA 1UB6B 4DUWA 3MNZA 4Q97A 3PWUA 4XP6L 3VDBA 4KRLB 3ZSTA 3P4LA 2LTQB 4XMKL 4DKAA 3PGCA 1J86A 3GSOB 4LIQL 1HHHA 3O8XB 4W68A 2VQ1B 5KOVC 2F19H 4QTIH 1GYAA 5IOPA 5AZ2L 3FZUC 3HC0A 3LKRA 4G80B 5C0AE 1ZGLA 3VGAC 1RZIB 3K1DA 2BRQA 1PEZA 3B9KD 4YHOH 1WV7T 4L4VA 1EGJH 4HS6B 3U30C 5F6HI 3G08B 3P0GB 2GY5A 2DKSA 1U8IA 5BRZD 2FHFA 3VFPA 1U8HB 4OIAA 4WI3A 4S2SB 1RY7B 2KL6A 2BCKA 1YUHA 4GXUN 4OLUL 3TT1H 2V2WB 5ICXA 1WITA 4D9QD 3IFLL 1SBSL 3BP4B 3HI5L 1RSFA 4XNUL 1JP5A 1B3JA 4OZ4B 5I1GL 3D2UA 5CGYD 1G1YA 4ELKA 4JKMA 5FV2A 3LKSA 2NLJA 3SGEH 4PJ9B 4P46B 4HCRL 5FKAB 1KB5A 1XEDA 4PB0L 4EBQH 1JWSB 1QSFE 4U7KA 4JREC 5BVJA 3JVGA 4N5ED 1NMAL 3MRLB 3EO9L 1YMME 4QY8A 3QO1A 4KY1L 4Y4KA 5DJZA 4UT6H 3C6SB 1CDUA 1MHEA 3B9EA 4YBQD 5I1IH 1ZT7A 3CDYA 5AUMB 1RFDH 2MTPA 4PRIE 2N7BA 4DN3L 3T4AA 5SWQA 1GIGH 1ZWIB 2BSRB 2VR4A 4I18C 3VGAB 3KJ4C 3N06B 2VXSL 1F8TH 2QTEA 2RGSA 1RI8A 3GI8L 4LHUG 4U0RC 3EO0B 2IF7A 3HG1D 5CEYB 1WSST 4JPIA 4S1DC 4I0PA 3ULUE 2J88H 3TBVB 5DLMH 1N3NA 3X17A 4NQEE 3P11H 1H15A 1S78D 3CLFL 4X7TA 4OFYA 4GRWB 5HPMA 3GMQB 1CGSL 1EH9A 3T09A 4X6BB 4GRWH 3S5LG 1INQB 3FB7B 4X7EC 3NTCH 5DD5H 1NCNA 3BN9D 4G9FE 2GCYA 4JQIL 2N56A 4P2OA 1PJ9A 5GGVL 2WIIB 4JREB 2IWGA 1KN4H 4J3VA 5C2BH 2Y25A 3BAEL 2K3TA 1YN6B 1U8NA 5C0AD 3WEXA 3SDDA 3L3IB 1J5OL 5K9QI 4R3SB 3V6FA 4OLXH 1RUPH 1DEDA 1MRFH 1SEBB 1TTGA 3T77B 2P8LA 1ERNA 4GBXD 1IC1A 4HS8H 1H3TA 3G5YB 3TH2T 1KPRA 5IEKB 5F3HB 3SY0A 1ZHLB 3HUJB 4GXVH 1J10A 4I18B 4ZOBA 4KKAD 3KJ4B 1MF2H 2H9GA 1IC4H 1BQSA 1RZKC 3SCMC 1FYTB 4MVBD 5DQDH 5I30L 1T3FA 4E9LA 4D8PA 4U0RB 1MNUH 4I77L 3BZ4B 3L3HA 1YPZA 3W2DH 2G9HB 5L2KE 1DBBH 3N50A 1LEIA 3QI9C 3MGOB 5IK3A 3PWPB 4UI2A 1OF2B 1QSFD 1VERA 1CTOA 4GAYA 3FFDB 5C09A 5BO1H 4AT6B 1R5IB 4UINL 2GJJA 1G7HB 2I25N 1YMMD 4GRLD 2ADFH 3RQ3A 4X6CB 1T5XA 3RGVC 3NCBB 1QRNB 5DHYB 2R1XA 3FAWA 4HV8A 2R2BB 5FK9A 3SPVB 4NZUH 3IS1X 5D93C 4PRID 1U0QA 1RK0A 1GRWA 2XWTA 3F58L 2HH0H 4BQCA 1NC2A 2EXWC 4ZOCA 1R3LB 5L7XH 1RHHB 3J8F7 5I1DB 1PYWA 4C59B 4NJ9L 1PY4A 5K9KB 2F74A 2BNRB 1IMHC 4NQSA 4LP5A 3DWTA 3TBSB 4GKSA 4JPVH 3RJQB 5IFHL 4OZHF 3PF2A 3ULUD 3VXSB 4JPWH 4LVEA 2Z31A 3SCMB 3MUHL 1RZKH 3P0YL 2NW2A 3GI9L 2RCSH 5J4MA 4MXVE 3EYOA 1BFOB 3JV6A 4XWGL 1RK1A 4G9FD 5JDSB 3GBNH 4Y4KC 1I1YB 3T2PA 5ANME 5IKCA 3QI9B 5FUCE 4EDWH 5IHUL 3ROLB 3Q2CA 1EA9C 3IDYC 1DBAH 2Y6SC 1S8DA 1LO0L 4N68A 1BJ1J 1L4IA 2Q76B 3RGVB 2NY1D 1SVZA 3OKMB 1MJ8H 1WF5A 5D93B 5EDXA 5GRJL 3JWOC 5CS7A 4I0PC 4R8WH 1LK2B 1I9IH 2X4OB 4UBDD 1G7PA 4LSSH 4QHUB 4NCC2 4WY7H 2VE6B 1P84K 4Z0XB 2PW1A 5KSBA 5C07E 4YHYC 3EYQC 3RL1B 4RAVB 4JE4B 1JGDA 3L3GB 2CK0L 1RHFA 2FLBT 4CL7A 5DJ0A 4U2ZA 2PYEA 1FZKB 4HUVB 3ARVA 2O5ZH 2EXYD 3QEUB 3RUGA 4I9WE 4F7MA 4M8QB 4ONOA 3W9DA 4UMGA 3KPSA 3O3BB 4JFQA 3ILQD 4WWKC 3MRFB 4GG6B 3SDDC 4PP2A 2IANA 5GGVY 4TNWF 4X80H 1PKQE 2Z91A 4KRNA 5CJQL 4ODTL 3AY4C 5GPRA 3BYYA 1EHXA 3IDYB 2EC9U 1JHLL 3QHFH 1P9MA 4WTWA 2HLAA 3EOBB 3NCMA 4N9OB 2QV2A 1E27B 1QA9A 1CD1A 3UPAA 2VZOA 1J88A 1GZPB 2P8MB 2NTFA 2EH8H 2XKUA 4Q9RH 2R9HC 4UTBH 5I74C 4MLIA 3TC9A 2CIKB 2AK4E 3BE1H 4K3GA 4F58H 1FO0L 2P49B 4L9DA 3HAEA 3SGKA 4I5BA 1WFOA 5TF1L 4XVSL 3EHBC 3MROA 4YHZH 2JJSC 4JRYB 3T3PE 3U7WL 1EUUA 3MBXH 3RIFF 4M61A 4YHYB 4XPFL 3WXVL 2WUCL 4LASH 4WU5A 2EECA 1T89C 3MRBA 4LVHB 1ORQA 2W0KA 3CXDH 2NR6C 2V5YA 1EBAA 2GSGB 4Y19E 2EDJA 4GBXA 2BC4A 5DI8A 2HT4C 2CSPA 1JNLL 2MCPH 1XGUA 3ABZA 1XR8A 3HNSH 1U8NB 4R97C 4WWKB 5CLWA 1B4RA 4MDIA 3MLZH 4GMSL 1KN2L 3WSQH 3QDME 3CNKA 4GJTB 1QFWI 5FDWA 1FNAA 2DI9A 4OD2B 4ODHH 3HZYA 3WS3B 1ED3A 1HHGA 1IKNA 3IDNA 3PJSB 1YEJL 4J1UB 5IG7B 3TGXA 4LGPB 4PJBF 2YBRB 1BD2A 1U8QB 3BUYA 5DTFA 4YJZL 1V3LA 3F7PC 4TUOB 1AXTL 5GS2H 1CLYH 4NFBA 4NKDB 5IJVA 4OD3L 3O6FA 3FQWA 1YNTB 2AP2A 3LS4L 5ITBH 3MYJB 5IB5A 3D87B 3LKNA 4M7KH 4KUZL 5C07D 4O2EB 4RFNB 3C5JB 3U9UB 2Y36H 4JKPL 3RA7L 1FNGA 3HMXA 4OM1L 4OCMC 3B9KC 4XPBL 2G60L 1AY1H 1CFVL 3O3DA 2VDNH 3P9MA 5C6WH 2D31A 5LWYH 2UZYB 4F7PB 1HSBA 5GSRB 2H2PD 3GKZA 4NQXA 1A7RH 1OAXL 2Z8RA 3OB0K 4I9WD 5DMKB 1OSPH 1NUGA 2EDEA 4G3YL 1QFHA 4ELMF 1EPFA 3MACL 3HA0A 2V9QA 4TPRH 3S4SB 4JG0L 5CGYC 4XCNA 5JXED 1MREH 1HXMB 2HJKB 3V7AG 2QR0A 3B9DA 4FQQA 4R97B 4EIGB 4M7LH 2P24B 2H1PH 3KPMA 3F6IA 4KQ4L 5TDPA 3CC5A 35C8H 3G5XB 3IKCA 3QQ3A 4N5EC 4M1GH 2O61B 2EH7L 1DQQB 4QWWD 5DK3A 4YX2L 2AK4D 3VXUE 3U0PA 1KIUA 2P48B 2IALB 1MRCH 2XZQL 4LEOA 4YXHL 3LQAL 3HZVA 1NKRA 1Y0LB 4YBQC 4TSCL 1B90A 3MFGB 1C1EH 3MLRH 5MP6H 4WI4A 1Y18A 1UG9A 4O5LL 5JUEH 3BPLC 3QXWA 4P48A 1MQ8A 5GIRA 3WUZA 5CZVL 4AM0A 5M94B 3QUXA 4LKXA 1N0XH 4ZUVB 5F71A 3U46A 3WHE0 1T2XA 2EKSB 4PD4J 2CLRA 1X4YA 3B9KB 1KENH 1ACZA 4OI8A 1PLGH 4Y19D 4A2LA 4ZUTA 5AG9A 5BRZB 3DVGB 5HGDB 5HHNB 6FABL 2AXHA 1ZT1A 1MCHA 2X4SA 4NHCH 1F4WL 1PD6A 4P2QA 4GQ9L 3GUTA 2DI7A 1NQBA 1S78C 3BD4A 5CZKA 5DJYB 3QDMD 1U58A 5HHQB 2GYSA 1CK0H 4HIHB 5D7IF 2H2SC 4R4BB 5JO5A 3MRJA 3SKMB 3IJYA 5BJTB 5EFIA 3BN9C 2DQGH 4WUKL 4R4ND 5KVEL 4HIXL 5M7QA 4HJGA 5IVZB 4PJGB 2RAMA 5ISZD 5CJ5A 4OIIL 3JV4A 1HIMH 3QFJE 5FM8A 4PJ5E 2YR3A 3HNVH 1ZLVH 4WI6A 3RU8L 1RZ8A 1KIPB 4PLOB 4N0RA 1UB5B 5DJ8B 3F65A 3BP6A 5JW3H 3OGCB 4Z76B 4L9LC 3C2AH 3VFVB 3BPLB 4WUUA 2A9NL 4GBXC 3DLQR 3G5ZB 5F96H 3MYZA 2YEZB 4U1LA 3EKCA 1UJTA 3QRFM 3AFLA 1FNFA 4HJJL 4KKAC 3EYVA 3ARZA 2XKNB 1XGYL 3O6LH 4E0RB 3P73B 3FRPG 1LEGB 3FT2A 4MVBC 4P57A 1X5GA 5EH1A 3HG1B 4K7PL 5HGHB 3X3FL 1JF1B 4JN1H 1GGCL 4MYWB 3V0AC 5DZLA 3UJTH 2XZAL 5F9AC 1E4XL 1FNHA 1UZ8B 3T3ME 1DEEA 2IH3B 1CFSB 2VN7A 2X4PB 4KC3B 4M6AA 4OV5A 5HY9B 2X10A 2JB5L 4NHUA 4M5YH 1RUML 3MR9A 4JHBA 4N0YH 1UJ3A 4Z7QE 3VXUD 4Y8AA 4GRLC 3WUWA 4WI8A 1E4WH 4OZFA 1EZVX 3WNOA 1K6QH 3QT2A 5AZEL 2P45B 3MRDB 4MSWB 1GSMA 2GUOB 3V5KA 3OWEA 3EUUA 3VXRE 5DR5H 1H9VA 1YEDB 4LSQL 5E6ID 4LOUD 5C0AB 2GJZB 4UU9A 2VDOH 4KTDH 4M5ZH 1S7UA 2PW2A 4NQVB 2P5WA 4L9LB 3UX9B 5C7XL 1KJMB 4HS3B 4CJ0A 1H3VA 2VB5A 2QKIA 3MRIA 1R5VA 3QQ9D 3R8QA 4YDKH 2W91A 5JNYA 3T0XA 5I2IB 2G2RB 3ULUC 3S3SA 1BQHA 5EBMA 5EOQH 3GJEB 4ZOEA 2ICWB 1YMHA 4K55A 5HI3D 5E2UL 4P59H 1CTNA 3VD5A 1IEBB 1REIA 4HDIB 2F15A 4NN7C 1ULVA 4DVBB 4CUCA 1ED3B 2FJHB 3GK8H 5IVXA 1SEQH 3CFDA 1NC4A 4F7TA 4XX1E 5J1AA 2DBLH 1HNGA 2X4RB 3N1FC 4U1HA 4LAQH 5GISH 2ADJB 5GS0L 4XPGH 2AQ3A 2FGZA 1WTLA 1QSFB 2NPLX 1KCLA 1R3HA 3EGSA 2ZSWB 3H0TB 3QFJD 4PJ5D 2XWBB 2ICEB 1KELL 1I9JL 1YMMB 4P9HC 1KACB 1NGPL 4GRLB 1CT8A 1WBXA 2NY1C 3B43A 4IMLA 4JM2A 4XHQA 5E8EB 4PRIB 2X9YA 4KROD 1G9MH 5J8OA 2W60B 2FX7H 4UBDC 5JA8B 1ZKAA 3QNYB 2UVEA 3PNWB 4PGZA 1ZVSA 3VI3F 3H7LA 4UDUB 4YO0B 3TPUA 4OCYH 1I8LA 2VERN 2XYCA 3FN0L 1XF3A 4A6YA 2D7QA 4BSVB 5I0ZA 2DRUA 1OVZA 2C1PB 3ALPA 3F8UB 3THMH 2K7PA 2OQJB 3ULUH 4Z18A 2Z93A 4NQEB 4S1RH 3OXSB 1C12B 4FTVE 1CDBA 5IB2B 5HVHC 1F4YL 5FCUH 1KG0A 4XPHL 4N9GB 3DSFH 1OGTA 4NN7B 1BZ7B 1RV6X 2YZ1A 2EXYC 1AQKH 4N8VA 3IDIA 1S7RB 3BD5A 2WV3A 3IYLW 1VACB 3ILQC 4G9FB 5BQ7B 1N0LA 5LXGL 2XWJA 4AH2A 2PTTA 1Y18B 5DUBA 2K9UA 3VXRD 3BKML 2JJUA 4LKCA 4JGUA 5I1CL 2HWZL 5ICZB 1JNJA 3TLRA 4ZNEA 2E9JA 4HPOL 1MQKH 1CE6A 2A73B 1JGVL 5CBEB 4HFUL 3RHWF 3GO1L 4P5TA 2AJVH 4XC1L 4E41A 4JQVA 4FA8A 1SYVA 2BSTB 5ISZA 1QBAA 4XCFL 3FQTA 2ZJSL 5DXWA 5L2KB 1N64H 4BH7A 4H25A 4DCQA 1FL3A 5HVHB 5FUCC 5A2KH 1KTDB 3ZT6A 2AQ1A 3KYKH 4EI5B 4ODUB 2Q8BH 5CCKH 4WEUD 1Z9OA 3RI5K 1T66D 1P7KA 1JGLL 5FA3B 3B5TA 1S9YB 3PL6D 4AY0A 1G7LB 2I9TA 2VISB 5EUKA 4B7IA 5IGXL 5JW5B 5FB8A 1CI5A 4CJ1A 3FO9B 1C08A 4X98B 4FP8L 5EZIL 1AKJD 3KHQA 2QSTA 3ZDYE 4Z5RB 5MEQB 5F3BA 3KPOB 5EA0H 1G7MA 4KRMB 2PXYA 4DK3A 3UC0L 2H6PB 2WNGA 3D69B 4HXAH 3KYMB 5IWLC 4FTVD 2O5XH 1NMCC 3S3JA 4EQ2A 3BWAA 4JFFE 5T3ZE 1ZVHA 12E8L 3RVWD 4BUHA 2H2PC 5MENE 1MVUB 4XXDA 1TJGH 4ONGH 5FKPB 3MRNB 2HVJA 5CINH 5ANMB 4JFPB 2A74B 4NRXB 1BFVL 1P1ZB 2AABH 3MV9A 2C4FU 2VSDA 4OZIE 1OQOA 3U7YL 2R56L 1M7DA 4PG2C 1NAMB 5JXEC 4JHAH 3S88L 1RZ7L 3SOBL 4X7DC 1QTYT 3SDAD 3STLB 5EORL 2W59A 3VXOA 1RU9L 3MA7A 1C7TA 4RX4A 2BVUA 1CXHA 4MQXD 5C0GA 3RTQD 5H94A 5FGCE 3GDBA 2BFVH 4ZQKB 4QWWC 2LV4A 4ZUSB 5TE6H 1CG9B 5TQ0H 3TJEH 3QWRD 3C8KB 3TJHD 1B0GB 3MOAL 1UM5L 1NUDA 3CH1B 5GGQL 2UYLA 3WLBA 4RRPA 4NM8L 3N0PB 4MWFA 3U36B 2CO7B 2XRAL 5C07B 4NJAL 1MFAL 4XCCL 1QLEH 4PTUB 4U1HB 5I73B 1C5DB 4NZTH 4YDIH 4OTXH 3MLTA 5BV7C 2DTSA 1VSCA 1NMCB 1M7IA 1UM4L 2DQJL 3D6GA 3H2WA 4OB5H 1S5HA 3QO0B 3GKWH 4PRHE 2BX5A 4XBPA 5EZLA 1UA6L 3O2VL 3R1GL 2BOBA 3CX2A 1LE5A 1UZ6E 4QRRA 3CX5J 1PKQB 3C60D 1AXSB 3SKUD 3S35X 3IFNL 2NY5L 5SX5K 4R4NC 4LHUA 2E7LA 3MLXL 5EIQA 3CFKB 4NO2B 4R7NA 1IGML 5ILTH 3ZE0F 1SY6H 2XOTA 2X41A 4BSJA 4P4KA 3BGMA 1H5BC 2AK4B 4GW4B 3PIQB 1QSVA 5C0EB 5D4QA 4Q6IC 4YHLH 2OTUB 3WNNA 3S5LA 1Q0YL 4R7DB 4RZCB 4W6XB 2R0ZL 3U2SA 3O81A 1W8OA 4OUUA 3EOYG 4CVUA 4R26L 2B5IC 4JFFD 3B83A 2JIXB 3NACH 5T3ZD 5DJXB 1L7TL 5MEND 4HG4J 1HK6A 3ROOA 2C4XA 4ZUWB 2C3VB 2ZCHH 5D1ZD 4L1HA 4AH2B 5BV7B 4F37F 5IIEB 4GRWF 3PGDA 4Y19B 5JORA 2YUWA 2CKBA 5F7NC 4GAJH 3KLSA 2EYTB 2NZ9D 3MRQB 3GSVA 1U8KA 3TV3H 3T2NH 3VXME 3IGAA 5HDBF 1MLCB 3QDMB 1Q9WA 2EDWA 4QYOA 4JO2H 1WZ1H 3L5WA 3KPNB 5GGRY 3V4PH 3OKLA 3UYRH 2EDFA 4H20H 4JFHE 1W0WB 5C0ND 3ZLQC 2BRRH 2VTFA 1MCCA 3GSWA 3PG2A 1GL4B 3T0VA 3ARDA 5TF0A 3V95A 2UUDH 1VPOL 1LGVA 4FQ1L 4PRDA 1Q9LB 4YDVA 4TQEL 1JRHH 1HSAB 1W0VB 5B38B 5CP3A 1NAKH 2MHAA 5TFSH 4V2CB 1JHKH 5E6IC 4LOUC 1H5BB 3HUJF 4U2YA 1G6RH 4Q6IB 3LB6D 2FZ3B 1WTGT 4MD4B 1QACA 1Z2KA 4O02L 1VEOA 4EI6A 1B88A 1GGYA 4YHPA 3MNWA 3ZL4H 1NDMB 1RVFH 1UWEL 5HYSG 1WBZB 4HBQA 1P2CB 2B5IB 3QQ9C 4AYFA 3MA9L 3GRWL 2IPUG 2DQCL 2ICWI 4PRHD 3GMRA 1JN6B 1D6EA 4LIQE 4XNMA 4Q0XL 3PABB 2E7BA 4ODVH 2DQIH 5HI3C 1F6AA 1FNEA 3UZQA 2AJ3B 4KJWD 3O6MH 4U49A 4H1LH 4KKNA 2RFXA 1IBGL 5H37G 3SE9L 2FB4H 3WIHH 5FYJU 4X6CF 5LAXB 4WO4D 1FZMB 4NKQB 2AEWA 3D0VB 4PJXE 4JY6A 4WHTB 4YHMH 2YMXH 3A67H 4JDVB 1F4XL 4OF6A 2G75B 4LEXL 5BMFL 1IGIL 4M00A 3DMMB 3VXUB 2D9QB 3D18A 2V6HA 4Z6AT 4DW2L 3BKJL 4G5ZL 2AEPH 5ICYB 5CEZH 5GGTL 2EYRB 4DTGH 3J7HA 2RIKA 2WBWB 3O4LE 4KROC 5E6IB 2ITDB 5HYQA 3HB3D 1MWAH 5DGRA 3VXQB 1AQDA 1F11B 3GMLA 3RTQA 5J1SC 1UT9A 4P9MH 4WVRA 3FB5B 2HP4A 4OFIA 1KOAA 3CMOL 1U93B 3MJ7B 2VXUL 3HFML 5D2NA 4HWZB 2UWEE 3VXMD 1JGUH 1RUQH 2DWEB 2X4NB 4RFOH 5D1QA 3CU7A 2R8SH 4DGYL 3NIFF 3GB7A 4JFHD 4K3JH 5HD8D 4AL8H 1JWUA 1CN4A 4CU7A 1M71A 1RUAL 1T1YB 2B1AH 3QUMB 4NYLB 7FABL 4F8QA 4HULB 1TPXC 4FQ2L 5C08A 3OJDA 3QFJB 4PJ5B 4M6ML 3VW3L 4O4YL 3LCYA 4ZPVB 3ZDZE 2F58H 4PV9A 1JYNA 3LDBB 5E70A 1FV1B 4C56A 1IEAB 4IRSA 4OCSL 4KROB 1B0WA 2BXYA 1IQDB 5EB9A 1YY8B 4TYUA 1FNLA 1J1OH 3QNXA 3GSRA 4PJDE 3UTPE 4KMLB 3OF6D 1CE1L 2Y07H 5CSBA 1MFDH 4XWOD 3V0VB 2CXGA 1T1WA 3STZA 1HHJB 2F19L 4QTIL 3AVEA 5GRZA 3TIDA 1S9WB 5A43C 4LCYB 4GG6F 4RWHA 3FN9A 3EFFA 3EO1B 4YDJA 4YHOL 3RWGB 1EGJL 5KANG 4U6TA 5DRWA 4KK9D 5BS0A 2ENSA 2ATKA 5E8NA 3O9WA 5D6DC 4M9OA 5DJCB 1T66C 4PJ8A 3WD5H 4NC1E 2MPAH 3M1BA 4JO3H 2FO4B 1V3MA 3PL6C 1JWMB 1M4KA 4G6KH 1F00I 3VXRB 4EDXB 1TPXB 3KGRA 3O4LD 3VXPA 1A47A 4UV7L 4HWBL 1YEHH 2AK1H 3F7YA 3WJLA 1CU4H 2FEEI 2Y5TA 5LBSH 5HHMB 4MDJB 2VITB 1XF2A 1RJCA 3H3KA 4HLZG 4PD4K 1A1NB 5EC2A 1IGCH 1D5IH 3KS0H 3VDAA 5FM5O 1WIUA 3MJ9A 4Z7NE 4UT6L 2ZUUA 3DX6B 5I1IL 2AXFA 1RFDL 3WNPA 2NY0D 2Z8SA 3RVWC 1YZZA 1W72B 1GIGL 4N8CL 2I60H 2NX5A 2FBJL 3TYFB 1W72H 1A64A 1F8TL 4P4RA 1RULH 5IB3B 4B5EA 4EVNA 3TBTA 2R1WA 5KBNC 3R06B 1INEH 2DQUH 4LDLB 5FYKU 3SDAC 3O41B 4HH9A 5DLML 1HOCB 3P4NA 4PYHA 3IT8D 2H32A 3P11L 3PL6B 4N8PA 3RTQC 5J12C 3QNZA 3FQNA 1BX2B 2ZKHH 4X6FA 3OKKB 3GBMH 4XHJD 3NTCL 1FFQA 5DD5L 1AR1D 1AKJB 3RWHA 4WO4A 3PWJB 3UTPD 1TIUA 3B9AA 4MAYA 3BFOA 4LHQB 5H8DA 1FRGH 5CWSB 1N5YL 3FCTB 1MFCL 3QCVL 1KN4L 3V5HB 1DDHB 5I66B 4M7LT 4LU5H 3REWA 1EFXD 4M93B 4NP4H 4UQ3A 2IFFL 3V6OA 1MCNA 4R90H 5DEZA 4F9LA 4FTVB 4OLXL 4L29B 5A40E 3EDFA 4CVXB 4HS8L 4LQ1A 1KJVB 5HGAB 4MNQD 5ENWB 4L3EA 4WENB 3T08A 1JVKA 3KYOA 4GXVL 4GKZB 1BMGA 2QQQA 5D1XD 1MF2L 4NO0D 4Q9QH 1IC4L 1PQZB 3O3EA 5F6IB 3C60C 3QG6A 5DQDL 1MNUL 1T1ZA 2VQTA 3SDAB 1G84A 3IDXH 3QDJA 3W2DL 1AJ7H 2Z35A 1DBBL 2OTWB 5I9QC 3QJFA 2A2QT 2VR9A 4WJ5B 2ESVE 1XGRA 5BXFA 1A6AB 1J9CT 5F1NB 1NCAH 5IFJA 5J13C 5IP4A 1UH2A 2XXMB 4YHKL 4WTXA 4XH2B 4HIIA 2ADFL 3GEWB 5ID1A 4HQQH 1X7QA 4AEEA 4U1MB 4Z7WE 3CVHL 4D0CB 4TNVK 3NZHH 3MLWH 5IM7B 4AIZB 2AV7B 1HI6A 5E94B 1TVBA 1JWUB 1R6VA 3CDGA 5D1ZC 1HYSD 4X7CC 3ECBA 5L7XL 5CSGA 1N6UA 4N1CA 4OKVB 1RZJC 4WNQB 15C8L 3SE4A 4W6YB 1XIWA 4NQUA 4CADA 4LFHG 4PJIA 1FL5A 4JO1H 3DXAD 1FFNA 3WHXB 2HG5A 2NZ9C 3L3DA 2EDXA 4QKXB 5JDJA 5JPMB 1KXVC 3IVKA 4JFOB 5EOCH 1P6AB 1FGVH 2IBGA 2IADA 2D7OA 3O2WH 4HGMA 3C60B 3K80A 4P5MA 3WO4C 5DD1H 4NNPL 1LP9A 5C0NC 2W92A 3FO2A 2X89D 1KB5H 5I9QB 2X1OA 5E24E 4IIQA 1N6QL 2R23A 3H9HB 1CGYA 3IF1A 5FFLA 4EDWL 5AD0A 2QQKL 5F7DA 3VWKD 4S0TD 3FB8A 5J13B 1FVCA 2X7LB 1AGBA 3LB6C 3MREA 3CVIH 2W65A 3OKEB 1TQBC 1KLFA 3ZKND 4JFFB 3OX8B 1T7YA 2IG2L 5DZOA 4QNPE 2EICA 2VWEE 5MENB 1G9NH 5T3ZH 2CDEB 3UTSE 3L5HA 4DAGL 5D1ZB 3HR5B 4N0UE 3GBLA 4LSSL 1F3DH 4NRZA 1PG7L 4QRPE 1IAOA 4KJWC 1OQXA 4WY7L 3X11B 4OZIB 4Q9BA 3KVQA 4MD0B 1RZJH 1XT5A 5K9QG 5LCVH 3I02B 1DCLA 1SYSB 1KCKA 1TMCB 2R2HB 4OF7A 4WO4C 3LN4B 4EN3D 2ESVD 1Z5LA 3OB0H 2VZ3A 1EEYB 1EEZB 5FGCB 3WO4B 1QBLH 3MLUH 2J7LA 2EIDA 4PJFA 4JFZL 1RUKL 2O5ZL 2ARJB 3LQZB 2Q8AH 3W81A 4FZ8H 4XI5D 5IJKA 2ED7A 3FO0H 4Q74A 4OD1H 4K7FB 2C9AA 3D25A 1TZIA 1X5IA 5I1LA 3DETD 4FQXD 4X80L 2EC8A 4D0BB 3BZEB 3B9VA 3MGTB 4U1NA 1IILE 3QHFL 1A7NL 5JQHC 1IGJB 3JUZA 4LLUB 3RWFB 3HB3C 2X4QA 3UTTA 4FQHB 4Y4FD 5TJWK 4MQ7B 4YXKH 3AM8C 1MI5E 4NKIL 1BVZA 3TNMB 3CCHB 4GG8A 5AAWA 4LCIH 1BP3B 2BNQE 2EH8L 3KLAB 4JEGB 4PRHB 2Y9RT 3GSNA 2VZTA 3BPCB 1A3RL 2GFBA 3BE1L 4F58L 1DN2A 4ONFH 1KBGL 3AXLA 3HS0A 4YHZL 2RB8A 1NGWB 2X9WA 1I1CA 4UQ2A 4YIQA 1JTTA 2FH8A 3MBXL 3OAUH 4L4TD 1M05A 2XFXB 3KR3H 4IRZH 1JZ3A 3KNBB 5HD8C 4LASL 3RWHB 3DV6B 5KAQF 1JK8B 2ZOLA 3CXDL 5E1HB 1U8OA 1EXUB 2VZ1A 5E2TH 5GS1C 1TCMA 1CF8H 4E42A 3BQUD 4MNQA 3S37H 3RY6A 3IETA 1FFRA 3W5NA 4F9PA 4Q7DA 2A1WL 1JTOA 3NH7L 4NO0A 3MLZL 3WSQL 4LLQB 4ODHL 3SE4C 4XVTL 1U36A 4L8CA 4G6FD 3ULUF 1A0QH 3UTSD 3RIAK 1GPOH 3EOAA 3PWVA 4YFLF 1T03L 1PZ5B 3U83A 1D9KA 1CLYL 4QRPD 3AU1B 1XCQA 4XWOC 3SDCD 5ITBL 1WFUA 4Y5VA 4M7KL 3NPZB 5CJXC 4RGOH 5JR1H 3LEXA 3TF7C 1DSFH 4IBLT 3IFPA 1HH6B 3VXMB 3GHEL 3SKJH 2ZNXA 1TZGH 1AY1L 1KTLB 3KPPB 4MZ3A 3VMOA 5IW6B 4ZS7H 5LWYL 4KK9C 3GIVB 2DLEA 3DVNA 4YQXH 1A7RL 3BMVA 1GAFH 5F88A 5F89A 3KYNB 2JB6B 4C83B 5I8KH 3W5MA 3DVFA 4OCWL 3QA3A 1F2QA 4ZYKB 1QR1A 1DE4B 1KIQA 3GMNB 3DUUB 5GS1B 3AB0B 2X1WL 4TPRL 4H88H 4G6JH 3DXAA 1TENA 5KJRH 3FRUA 1MREL 1JL8A 3T0BA 4M7LL 2H1PL 3KXFE 1MI5D 35C8L 1M1SA 1DQLH 1QO3B 2CDGA 4M1GL 2BNQD 2X89A 3MODH 5EU4A 2CH8A 1X4ZA 1HH9A 5C3LD 3RZCA 2YD2A 4YPGB 1MRCL 3WFZA 1HHKA 4QHNB 5E4EC 4XNQB 1C1EL 1AD9A 5MP6L 1Z9MA 4RMVA 5JIHA 4BQ8A 5JUEL 1YYML 3NCCB 2MCG1 2NY0C 3TN0D 3HE7D 1X6LA 4JCLA 2VLJA 1SM3H 1EUTA 3T0EA 3CX5K 1S9VA 4H1LG 1K4CB 3S36H 4Z95L 4PJXB 1RZFH 3FMGH 4JZNA 3VRIB 4Z7VA 1KENL 2Y72A 3D39A 4M3JA 4UT9H 1VFBA 4O58H 1HKFA 4JZJC 1OTSD 1CFQB 3G04A 3V6ZA 4FZEH 4NHCL 3D85A 1RURH 2R4RH 4NNYA 1DQJA 2WQRA 2XQBH 1QPXA 1CK0L 3O4LB 1BBJA 4J3UA 1TVHA 1GZQB 4K07A 4LF3B 1WAAE 4D3CH 4XHJC 4JFEE 1AR1C 2DQGL 3NZ8B 1ZLSH 3GSUB 5FYJH 1J0IA 4LBEA 2WM0A 1RQ5A 1UEYA 3CU1A 1HQ4A 4HG4K 1T0NB 3M17B 4QRTA 3PDOA 2XA8L 4HMEA 1XCTB 2NYYD 5F9JB 5DYOB 5TDNB 1HIML 1JUFB 1UXSA 3OKNA 2YD5A 4UV4H 3SQOH 2B0SL 3HNVL 4RAUA 3IJSB 3HAEH 4LP4A 4MB3A 4MXVF 3QPXH 1OCWH 3ILPA 4XZUA 5E6ZA 1T22A 2UWEB 4YGVA 5E4EB 5JW3L 1UKSA 3C2AL 3CFEA 1QEWB 2FJFB 1JNHB 2NY0B 1IC5H 1K8IB 4EQ3A 1D3CA 3S34H 5F96L 1J8KA 4MCZB 4Y4FA 4Z78B 4NC1C 5D1XC 4AQOA 3O6LL 5ID0A 3LRSB 4G8EA 4OCXH 3GI8H 2GTZB 4NQDA 3MJGX 3PP4H 4JZJB 5DVMA 4JANA 3BEWB 3VFWA 4JN1L 3SJVE 1F2XK 1JV5B 1T04B 3E0GA 5E9DE 3UJTL 5HJ3A 3KXFD 2QADD 2P5EE 4HIEA 3VFNB 3VGGA 4KXZI 2XG5A 2AV1A 4L4TA 4RGNE 3ZYJA 3D0LA 3IDMB 3DV4B 1ZT4B 3OKOA 4GW1A 1T20A 3BZDA 4HHAB 3VWJB 4PJDB 3G9VA 2V9TA 2FX8H 2M26A 3QUZA 5TPWH 2OK0L 1IAII 1K6QL 3QCTH 4RIRB 5D5ME 5DR5L 1J8HE 1EFXB 2CRIA 4XP1H 1MIEH 3HMXH 3CSYB 1N8ZB 5DSCB 2VDOL 4BFEA 4Z7UE 4KTDL 1HYSC 4M5ZL 3D3VE 1BF2A 1YEIL 2X70A 2F5BH 2F8XC 4YDKL 1RJLA 5IBLD 2GK2A 3UTSA 2A6KB 1MHPL 3QIUD 5ADPH 5EOQL 5D1XB 5ESAB 3HMWL 2EIEA 4P59L 2H3NB 2VJXA 3EOTH 4PJAE 2ADGB 2B4CH 4RCAA 4LDOB 3GK8L 3OG4B 5T1DH 1SEQL 5GRVL 4JFED 5J11C 4AENB 2DBLL 2CLZB 4PBWD 3X12B 3H7BA 4LAQL 4HUXA 4FABH 2GTWB 5GISL 1R3JB 4NGHH 3T3PF 1OSZB 4XPGL 1T2QL 1NDGA 1OW0C 3VWKC 1I7ZB 3KPTA 1K4DA 3RKPA 1XAUA 4JZOB 1JI2A 4X6DE 1IFHL 5DJAA 1XF1A 4LLWA 2JJTA 5FGBC 1ONQB 3ZKNC 4RFEB 4NT6A 5EZJB 3L7FB 3PHSA 4V1DA 4JR9L 5D96C 5DHVB 3BRFA 1G9ML 3IDJB 1CL7I 5C0BA 2FX7L 1HXYA 5DHVH 4DFHA 4HGWA 1I8IA 2CJUH 3C87A 3OSKA 4NJ9H 3UDWA 3FQXA 1JPGB 4OCYL 3U0WL 4PTTB 5F9OL 3L95B 1WGOA 3THML 3SJVD 3T1WA 1BOGB 4EN3C 2R69L 5E9DD 3HZMA 3FONA 3VG0H 1NGXA 2P5ED 4HPYH 2I5YH 4Y1AA 3W39B 2J8OA 3K0WA 4PJEE 5CMAA 1T4KA 1AQKL 5C0IB 3B3IA 3MRMB 3QWQB 5FO7B 5J11B 4XI5C 3HPJA 4MD5B 1KEMH 1AGFB 2PO6D 1QLRB 3DRQB 3DETC 1BOYA 2F9BT 4FQXC 4L8DB 5HI5D 2NXZD 3VWKB 4EZMA 2UVFA 5FYKH 4FQIH 3NFPB 1VFAB 4Y4FC 3OAZK 1INDH 5AEAA 3GSXB 4YWGH 4DGVH 4EOWH 3GNMH 4XNXH 4QF1B 3D3VD 1BZ9A 1GGTA 4EUPB 3EDKA 1H0DB 3MJ8B 4OZHA 4FXKA 4TUJA 5FO9B 5E2WL 3X3GH 4EUPH 1GJIA 2AJVL 5D96B 5MEOA 1A6TA 1XZ0A 1E28B 2F53E 2OL3B 1UWXK 2J12B 2OL3H 2DYPD 2FGWH 4WGVB 3T65A 1DUYB 5L9DL 2XG4A 4CMMA 2CK0H 1H8SA 3ULVE 5B22A 4EN3B 1T0PB 2AS5M 2ESVB 1N64L 1FP5A 2EIZB 1VEMA 1IGTA 4F7CB 4WV1C 2FJGA 3KYKL 3OR7B 1DZBA 3CSBA 3DYPA 4XGZB 5GGUB 3BQUC 2Q8BL 5CCKL 4KDVA 2Z92B 3F7RA 3ARFD 3QEQA 2YN3A 4OZFH 2ZUVA 4KMTH 1FLRH 4U6YA 3HRZA 1JNNH 4BA8A 4ODTH 4XC3H 4FQXB 5SX5H 2YUXA 3CD4A 3BO8A 4Z7WB 1TZHA 4H26A 2VWEC 3VD3A 3TZVD 1D6VH 5C6TL 2YKLH 2YXMA 5DFVD 3VXNB 4X8XA 2AJZA 1NCBH 1E4KC 3UXFA 1Q0XL 2AERT 4GRMA 1I9RH 3QAZB 5KW9H 4RGMC 4PLJD 3SDCC 3QEHA 5BZWA 1XGQB 4QHLB 1FO0B 5EA0L 4GAGH 4TULH 3FOLA 3RNQA 3C5SB 1KT2B 4PGBA 5IT2L 2WSKA 2IBZY 5TF1H 3MO1A 3RWCA 3DX7B 3NN8A 4HXAL 5JW4N 3IAGC 1OT2A 3CK0