3QR2A

Wild type cd147 ig0 domain
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
117
structure length
117
Chain Sequence
MAGFVQAPLSQQRWVGGSVELHCEAVGSPVPEIQWWFEGQGPNDICSQLWDGARLDRVHIHATYHQHAASTISIDTLVEEDTGTYECRASNDPDRNHLTRAPRVKWVRAQAVVLVLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords Basigin
publication title The Retinal Specific CD147 Ig0 Domain: From Molecular Structure to Biological Activity.
pubmed doi rcsb
source organism Homo sapiens
total genus 25
structure length 117
sequence length 117
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13927 Ig_3 Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qr2A00
3E6FA 5EBGA 3FB8B 5FYLE 3LKSB 5BS0E 4RGNE 4YH6A 4DOHE 1EFXD 2BRRL 5GGVY 4HS6B 3MCKA 1HDMB 4X83A 4BQ8A 3CU7A 1VFMA 5LWYH 3TO4C 1T22A 4ZTPH 5L2KE 5FOJA 3QDJB 1X5LA 3W0WB 3MXWL 5KOMC 3BGFB 3MLWL 1K4CB 1BAFL 1FAIL 2DWDB 3NOIA 4MD5A 2P49B 4F57H 5J06A 4JQXC 1YQVH 5GS0C 4NP4L 4TSBH 2VR4A 3HPJB 3HC4H 5C07A 2LVCA 2BVQB 4WENB 3MRGB 3HZVA 3ARDD 3WLWC 4WV1C 2JCCA 4Z7WA 1T4KA 4Z8FH 3BP4A 2OR9H 3MRHA 5J11C 2IGFH 3P0VH 1S5HB 2G5BA 3IFOB 3F5WA 1EEZA 3QFJB 4K7PL 3QAZC 1E4WH 5L9DL 4U1KA 2OTPA 4FQHB 4J3OC 4IBLT 4MXQC 2X5PA 3G6JB 3IU4H 3K8KA 1AGCB 2NQCA 5E03A 4X4YA 1EO8H 2DQCL 1XMWA 4HHAB 1RUQL 3DXAB 4HEPG 1WICA 2R2HB 1U8NB 3C9NA 3UBXB 4XWOD 1K8IB 4LPYA 5CWSB 4DKAA 3RWJA 4P23C 1G9NC 3FO2A 5E56A 2GTZA 3W0WD 3CK0H 4ZTOH 3LMJL 4YXHH 1LE9A 3EZJB 4TVPH 1JN6A 3HC0A 3X12B 4PJ5B 2V6HA 5CEZH 1FGNL 4F9LA 4YZFF 1DN2A 4KDVA 5F7UA 3QQ3A 4U1IA 1FNEB 1DJSA 3CDGB 3O4OC 2HFGH 2VE6A 2GK0B 4XNUL 2P24A 4OZIF 2V9QA 3TCXA 4YAQA 2V9RA 4E41B 1FNGA 3FN0L 1B4JH 3O2VL 1A6TA 5SWZA 3UZVB 1E6JH 1RZKH 3OZ9L 2B1AH 4PJFB 2NY4B 1TVHA 4EVNA 2NNAA 4NC0B 3T0ED 1DE4A 2BK8A 1FV1B 1MFEL 1QBMH 2UUDH 4MA8L 4F15B 3N1GC 2EXWC 4NWUH 4X6BB 4F37F 3ZKMC 2GY7B 1N2RB 2NW2A 4UT7H 5HYFA 1MIMH 1CE1H 2E7CA 4N0UB 5SX4I 1S7SB 1S7WB 3DXAD 3VFRA 1PY9A 1AQKL 5D2NB 4AIZA 1IBGL 2OTUA 3ELAT 4X98B 4WW2A 4NZUH 3BGMA 4N9GB 1EUUA 3KYAA 1A0QL 2G75A 1AGDA 1FVDA 4KTYA 4WI4A 3HE7B 3JWOC 2MPAL 4YX2L 3FRUA 3FB5A 5D1XD 5FO9A 2UWEA 3VFTA 4PJAA 5DRNB 3I75A 2C4FT 4Y5VB 1BBJB 3WFBH 1EJOL 4E41D 2NY1D 2BVOA 4O4YL 3WO3B 2VDRH 2F5AH 4OFDA 4FQIL 4LL9A 2XKSA 3CFCH 3WHE0 1BEYH 5F9DC 1A2YA 3PQYB 1U93A 3LKNA 4MCYB 4A2MA 1A6PA 5C0BE 5DJYB 3D0LA 2Z31A 3UTZB 1X5KA 3PV7A 4A2LA 5EZOH 1ZOXA 5ILTL 3H8NA 5BZDA 4YDLC 3WHE1 4DK3A 5EPMA 4NUGL 2A6KB 2E6JA 2R0LL 4ZOAA 3GIZL 3ZHKA 1BQSA 4BUGA 2WUCL 1PKQB 1A6AA 4EI5A 5INCB 5IQ7H 4WU7A 4TYUA 2EDXA 1AXSB 2DAVA 1OSPL 2VQTA 3EYSH 4Q58C 5I9QB 1UXSB 4I4WA 4OTXL 4N5EC 4Y4HD 4HX1A 4G7YL 1D5ZA 2K7QA 1TTGA 5MERA 5FUZH 1YNLH 3BESR 4Z7WF 1EZVY 4XCYB 3ULSB 3K7UA 4Y16B 1NPUA 4LOUD 2V2XB 2X4RB 4HFWA 1CL7I 4QTIH 3J8F7 5EC2B 3MRIB 1T20B 3U0TB 1ACYH 1WLHA 1MUJB 3TYFA 4R97B 5F6HJ 1P1ZB 4UNUA 4JM2D 4M6NL 5T33H 3CLEL 1S78D 2P8MB 5BVJA 1RI8A 5GRVL 4Z7VE 1G7QA 2R39A 4V2CB 1HKLH 4CADA 2AGJL 2NXYD 3V52L 1MF2H 4D9LH 2IFFL 1LD9A 4Q74A 2XZAL 2NY7L 3P9MA 2IPKA 3FOLA 3MSPA 2MHAB 4HJGA 2CO7B 2IANB 4UUJB 2VN7A 2ADIB 2UZXB 1BM3L 4PRNB 5KN5A 4JZOA 4XMPH 1G7PA 1ZHLB 2D7OA 2NYYC 1KT2A 3C60D 4WI6A 5IGXH 1Y6NR 1YMMA 4JN2B 1GGUA 5J57B 1VERA 1N7ML 4PR5A 1B2WH 1VPOL 1J8KA 2P46B 2Y5TB 3TVMB 2FD6H 3L3KB 3GO1H 3L3JB 4ETYA 2AK4E 1JGEA 3MRJB 4PLKD 3VGHA 2VXVH 3QNZB 4V1DE 1NMBL 5DFVD 3PABB 4OQTL 4PRDA 3SE3A 1OGAE 2PW2B 5HXMA 1NMCB 3KYMB 1F13A 4PRBA 3T4YA 5KVGL 3MLSL 5I16B 4LEXH 4XVSH 3ARYA 5C92A 2O5XH 4DKFH 4NKMB 5SX4H 3LSOA 3IAQA 3VRIB 1DBAL 1W72L 3VXPA 1F58H 2P5EB 3SQOL 3NAAH 4CMHB 2O61B 5IROC 1R5WA 5CGYC 4LLVA 1T0NB 3FKUS 4OT1H 4ZUWB 2W60A 4F58H 1GH7A 2WNGA 1HSAB 3OJMB 4X99A 2UWEF 1UT9A 1QA9B 25C8L 5DSCB 3TIDA 1NCBH 5H8DA 3RVVC 2VNCA 5JMRA 1XGTB 5LGHL 2A9ML 4NSKA 4XVTH 2IADA 3TVMD 3WE6B 3WXWL 3LOWA 1UKQA 3CFIC 3KPQB 4DGYL 1AO7B 3M1BB 2WBJA 5ITFB 1T7XA 4PGEA 1INEH 4LRIC 3PGCA 3T3MF 3ZE1E 2W0PA 1AI1L 3FQUA 3QIBB 3GSVB 5IVZB 4PRIE 1EERB 3K3QA 4NCC2 4QY8A 1G9MH 3DHJA 4XBEL 3GMPB 1B88A 4PJ7B 3ARVA 5E95B 5GZOD 3IRPX 1QSFA 4LHQB 1SJHA 1MLBB 5KSAD 4HFUL 4NC2B 4Y4KC 5E08H 2P5ED 2Q87A 3GI8L 2QHLA 1T5WB 1IVLA 4KKAD 4APQC 3PDDA 3VH8G 3KGRA 3ARFA 3ZDZF 5IESH 4I3SH 4M7LL 5CMAA 4F7EB 5DJDA 4LLUB 2FZ3A 1I1AC 4J3XA 5CBEA 4RCAA 1A9BA 3A6OA 1DQQB 4JPVL 5FV2A 3AGVA 3GFUA 3MV7D 4GKNA 4YDIH 5CGTA 1AGFA 4G8GA 1JNNH 3LD8C 1VA9A 5GGSY 4KGLA 3PWJB 1CL7H 5CEXB 5T1LA 5HI3D 3OHXB 4M6ML 1XF2B 2AEPH 1NC4A 3C2AL 5F7KC 2XN9D 4WHDA 5JQ6H 4BQCA 1JPGB 3EZ8A 3JTTA 3UTQA 2PCPA 5KJRH 3DX9B 1XGUB 5DA0B 1DUYB 3IRZA 1UH3A 4TNWF 1ZT1A 5HGHA 1E4JA 2J6EA 4L9LA 5FUOH 3UO1L 3HS0B 3ILQC 2DQGH 3I9GL 2ZPKL 4WO4D 1HQ4A 4O5LL 4W6XB 4JR9H 4OD1L 4EOWL 1JZ4A 3DRQB 4BK5A 2VAJA 3X11A 4IOIA 3LHPH 2HVJB 1DBJL 2CMRH 3LS5L 4KAQH 1N64L 1IGTB 4HZAA 2DQEL 1QSEB 3GJEB 4HXAL 1WBZA 1D5MA 3BPCA 4KMQA 3U9PL 4RAVB 5FYKE 5D7SL 4I18B 5CCKH 2J1KA 4PRAB 5T3XL 4YXKL 1GOGA 4J12A 5C09E 2Q8AH 3PHQA 3C6LB 5JW3H 2NR6D 1KBGL 1JNHA 5EOQL 1EO5A 4YWGH 1TJIH 1E4XI 2V7HA 5JXEA 5K33A 4LGRB 5F89A 3WIIH 1P4LB 1GGCL 5CS7A 4Q6IB 4MA7L 5FFLA 5IOPA 3TPKA 4OKDA 1G6VK 4HKZB 3E2HB 4HBCL 3PHOA 3MTRA 2I9TA 5J89A 2D7PA 1NAMB 3CX2A 1JF5A 1K9TA 4TUOB 4LASH 4ZAKC 3DJ9A 5A16B 5GIRA 1T03L 2QKIB 1UB5B 2XI9A 4G3YH 1JTTA 3ZSTA 1F3JA 4R0LA 3HAEG 5KG9A 5DD0H 4HUVA 2BOBB 3C5SB 3TT3H 2Z93B 2ZSVA 3BEVA 4NHUA 2HFEB 3UX9B 4G8EB 1DFBH 1JPTL 3BEWB 3LKRA 1YQ2A 1NKRA 1A7QL 5C0IA 4XP1L 1IJ9A 1DQDL 5FEBA 2IQ9H 3L3GB 3L3DA 2PUQT 2PYFA 1A4JB 5C3LD 1O5DT 3BQUB 2DQDH 5E6IA 1KIRB 4M43L 5C9JB 4FQ1H 4ZO9A 3S35X 5DJXA 3QWRD 5JIKA 1ZLVH 2GI7A 5ANMB 1R5VA 4NPYA 5LQBH 2M1KA 4X5XA 2JLLA 3O9WC 1OB1B 2EE3A 4OZHB 2H32A 3WN5A 1L7IH 4ELME 2J8UE 2EKSB 3T65B 5BV7C 5FHAL 3SO3B 3E3QC 4KMTH 4C56E 5E9DE 4JDZA 4NQCB 3QUYA 4HLJA 1JWMB 3IS0X 4JRYA 4FQ2L 1CICB 4MAYD 3ARED 4UOW0 1DQLL 3G6AA 3E3QE 4YIQA 4EBQH 4UB0L 5F7EH 1ZT4A 1LO4H 4ONHB 3VXNA 4DAGH 1PBYA 1EGJA 5KANG 3BPNB 5JQHC 2MFNA 1G7JA 4UOW1 4N0YL 1IAOB 3L3HB 3MV8A 4Q97A 2EDRA 4OGZA 4JFPB 3O6KL 4NNPH 3E8UH 2EDNA 5HVHC 4Y5YB 4UV7H 3EOYG 2Y36H 1CD8A 4P46A 5EOCJ 2XPGA 1FBIH 4KRPD 4PD4K 1G0DA 2N7AA 1UA6H 2OZ4H 1K4DB 5EU6E 2Q86A 5JTWA 3TA3A 4MDJB 4K94L 3QIWB 4DQOL 4LRNL 3C5ZB 3ABZA 5F7LB 1E4KC 5SWQB 3BISA 5GISH 3F7VB 4Y4FB 4MQXC 2VLKD 1CVRA 1CICD 3GB7B 3U4BL 3BKYL 1HIMH 1ZSDB 2FHBA 1VSCA 2B5IC 3BT2L 4L8DA 5DQDH 3EO0A 1UWEL 1CFQB 4Z7OE 2ESVE 3RWCB 2R0ZL 1Q1JH 2P5WE 3V6OE 4YBQC 2FHCA 2XFXA 4Z77A 3TT1H 3ZHDA 3GUTA 2BNRE 1YEIH 1XGRA 3PWLA 2VDOH 4K7FB 4WUKL 5D4QA 2FSEA 3AS0A 5ALCH 4G6JH 2YBRA 5IMKA 4GKSA 3A0OA 2H32H 5DGRA 2NW3B 4ONOA 4MA3A 5EU3A 3WO4B 3CAFA 1T7YA 1ZS8B 1EPFA 4U4BA 2W0FB 4IMKC 2W07A 5D1ZB 3NH7H 1PEWA 4RDQF 3RL1A 3RP1A 3MZGB 4LCCC 4QHNB 3QIWD 2EZ0C 1T1WA 3C5ZD 4JQIH 3BP6B 2R69L 4FFVD 3K4AA 4QRRE 1NGZA 3MGTB 5E5UB 4OZGA 4KXZH 4EN3C 3H9SB 4XI5C 3MRFA 4XCNA 3LEYH 3I50H 3CGTA 3GSNA 3QEQE 4YHKH 1ORQB 3EOTL 4OCSH 1DBBL 1HXMB 1CT8B 5D70H 4KV5E 5IBLC 3U0WH 2OL3L 2ITCB 5B8CB 1HZHH 3FB7A 3TH4T 2YK1L 3BP5A 4EXPX 3WS3A 4R90L 4BKLB 1AFVL 2AXHA 1FZJB 4NO2A 1AE6L 3O6FD 2KH2B 5J9PB 3F6LA 4LLYB 2DKSA 1LGVA 5TFSH 4ZG1A 1FGVL 4IIQC 4I0CC 5GRZA 5I1CL 3B2UC 4G5ZH 4H1LB 4IHOB 1T0MB 3FOMB 1OAUL 3LV3B 4ISVA 1OAZL 1EK3A 1B0GB 4IJ3B 1Y6KR 5GS1A 3QDMA 3NCMA 1YYLH 2H2PD 3HG1B 3QHZH 2I5YH 3VFUA 1KTDB 3F7QA 4X6DB 5FO7B 3DYMA 4X5LA 3T8XB 3Q5YA 4JY4B 5F1NB 5LWYL 3QCUH 4ZTPL 3IFNH 1IEBB 3TNMB 1FZOB 1VEMA 3QCVH 3SGEI 5ID0B 5FCUH 3OGCA 3LQZB 4POUB 4EUPG 4ODTH 4PJCE 4F57L 1UG9A 1YQVL 4TSBL 3DV4B 1P4IH 3BZ4A 1PDKA 4YC2C 2DQJH 1S7RA 3HC4L 4FQPA 1A21A 1S7UA 1D9KC 2HH0L 3VFNB 1PQZA 2HLFD 1VDGA 3BIAX 3CC5B 3MFFB 4Z8FL 3JUZA 2OR9L 5CINH 5L2JA 2EDWA 4QRPA 4XPAL 2IGFL 5JPMB 5CD3B 3QQ9D 3P0VL 3BZEA 4JANA 5EBLA 3LRSA 1JZ2A 1E4WL 5F7DA 3RY4A 1V3KA 3GBLA 1NFDA 3VWJB 1BFTA 5ACZA 3CXDL 3IU4L 3RPIB 1RJZB 4YDKH 2IC2A 1EO8L 1NDMB 1EMTH 1MCNA 4G42B 4P49A 1QO3A 4KK8D 1VFOA 4N8VA 2EYTA 3VD7A 1VKXB 4XRCA 2NY2B 4I3RH 5JHLH 3OXSA 5AG9A 1RJYA 2RHEA 4IS6B 2H3NB 2EH8H 3CK0L 4WIQA 1F6AA 4YXHL 4ZTOL 3GSRA 4TVPL 3IDNB 3KJ4B 5CEZL 4NT6A 1R3LB 1OLLA 2EC9T 1B0RA 2CQVA 4MZ3A 2JIXB 2HFGL 4L1HA 3U6RB 2XWJB 2KQNA 4PV8B 2NY0C 1B4JL 1I4FB 3WLBB 1OLZA 5GXBB 1E6JL 1RUAH 1RZKL 1F3DH 3AY4C 4PRPA 1C16A 1FZKA 2B1AL 1AIFB 1QLFA 1BZ7B 3BWAB 3KPRE 2GEEA 1A6UL 5EN2B 1QBML 5GZND 1T2QL 3VWJD 2X9XA 4NWUL 2Q6WA 1IAIH 4JE4B 1RJCA 4UT7L 4BZ2H 3HR6A 1MIML 1CE1L 2OTWA 4OZGF 2DWEB 5BJTA 3RZCC 4OLWH 1U8OA 1GGYA 4NQEB 5AYUH 3WIFB 5F7NC 1IEAA 1U3HB 3VJ6A 1O7SA 2SEBA 3OXRA 4L8BA 4NZUL 2X1WL 5J1AA 5IFAH 3U0PB 5F8QC 4ZUVB 4KJPD 4KKBC 3FO9B 4RX4D 1NEZB 1TITA 3DV6A 2A6DA 3T09A 2IALB 5F96H 3JTSA 1S7VA 3RVUC 1NAMH 4HMCA 3VWKC 3WFBL 1WBYA 1JUFA 5D7LA 5T1DH 4N0CC 5KS9A 2F5AL 4HUXA 5T1KB 3CFCL 4OM0H 4DGVH 1BEYL 4OF6A 4RA0C 3FQTA 1FN4B 1U36A 4FFZH 4RAUB 2LTQC 3CZFB 1K8DB 1U42A 1KCUH 1NLDH 3CSGA 3ZYOA 2FX9H 4KHXL 2O5ZH 1FL5A 3TH2T 3MUGA 5EZOL 4NNXA 4UBDD 2BVTA 1FFNB 3UEZA 1F11B 2Q8BH 1CFVH 4ODWB 2PXYD 4MSWA 4Z7QF 4LU5H 4PGDB 5CZXD 1INDH 1FAKT 4XPFH 5MENB 4FFWC 3GMRB 3DTXA 3IT8D 3VXME 4FG6C 2CDEA 1M6OB 1HHHA 1FJ1B 5IQ7L 4ZUTA 4TUKH 3HKFA 4O02H 4PJIB 1AP2A 1Q0XH 2PTUA 4X7TA 1QD0A 2FCBA 3EYSL 3RI5F 5JLZA 3TBTA 4OF3A 1P84K 1YNLL 1FE8H 5FB8B 2VUOA 1LMKA 2ICWA 3D2UA 2BP3A 3P4NA 4QTIL 1OF2A 3VXSE 3CFBB 4NFDA 3SGJC 3K4ZA 4PJ8C 4OIIL 1NFDF 3BH8A 3T04D 5IIEA 1OGTB 5TH2B 2CIIB 2BNQD 2Y6SC 4HS3B 4JFEB 2R29H 4U1LA 4HIIA 4QGYA 5T33L 1NCCL 2NXZB 3C87A 5FF6B 5JHDA 1U92A 1HKLL 3TPUB 4GRLD 1T89A 1UJ3C 3D5OF 3EYFA 4QNPF 1MF2L 1X44A 4IOFC 4LPTA 3O3UN 4KJWD 4PTUB 4D9LL 4GBXA 5C0GB 4RMQA 3LS4H 1NC2B 4JZJB 3D85A 3RDTC 2FRGP 2IAMA 4P59H 1UH4A 5MEND 2YC1B 4XMPL 3DVGB 3MA7B 5JOFA 3OKNA 4KK6C 5IGXL 5HHOE 3NIGF 4KI5D 5C86A 1NBQA 1RJLA 1B2WL 3SDAC 5ISZE 5HHMB 4OZHF 4LLQB 1B6DA 3QQ4B 3SKOB 1YYMH 2FD6L 3GO1L 4DN3L 1FYTA 5FIEA 3WDJA 5J12B 4M6OH 2IBBA 3L5WA 3GMMB 5F88B 12E8H 1Q9OB 3ESVF 2HMID 5TF0A 4ZDHA 1HN1A 2XIDA 4J3WA 4MD4A 1YNTA 2P47B 1S9YA 1NEUA 4HUUB 5DHXB 4JFED 3SJVB 1M7IB 2NXZD 3ZKND 3QHFH 4HKXB 4G9FD 4GO6B 3CXHK 1EEYB 4LEXL 4XVSL 3TV3L 1QYGH 2O5XL 4DKFL 1YEKH 1Y18B 5HYJB 2A83B 4NZRH 4UQ3A 1QR1A 3TBVA 1NCAH 3RL2B 1F58L 2ZOLB 5EWIH 4MAUH 3NAAL 5T3XE 2WUBH 3B5TA 1OQXA 4OT1L 3STLA 4U6XA 4DVBB 5HYSB 5I1LA 1QBLH 4L1DA 4F58L 1RUKL 2R0WH 3EYQC 3LDBC 4WHTA 4JDTL 4NCDA 1KG0B 1ORSA 3LY6A 5C08A 1U8MA 3QEHB 1NCBL 1RK1A 4M62L 5KS9F 4XXCA 1KTLA 4BH7A 4UAOB 3U9UA 1IC7H 3SDDA 4PS4H 3U4EA 4NO3A 1YPZB 1P6AB 3CH8A 3B9KD 4LSSH 4NRYA 1YUHB 1KNOA 1INEL 3RWGA 1QRNE 5ETUA 1KXQE 5DMYA 2AXGA 2E6QA 2B20A 4F7TB 4LCYA 3QDGD 3D39D 4UT6H 3TC9A 5I8CB 4Y1AA 2GT9A 5FO8B 1G9ML 3S7GA 4O2FA 4MQ7B 1YDPA 1C7TA 4Y8DC 4CN6A 4GLRH 2I9LB 1HI6B 4GS7C 3DX6A 2EYRA 4XTRC 3VRJA 1NBVH 4U7SA 5E08L 3BKMH 1ONQB 5KTEL 4UDTA 4H5SB 3ULUD 5IEKB 1MI5D 2VZTA 2QHRH 3OB0H 3OAZK 1YN7A 1HH6B 4H1LH 3TCLB 1KB5A 4I3SL 5EC1A 1JZ3A 3ZE0E 2YMXL 3KYOA 3G5XA 4OZFA 5E5MA 3S5LG 3UAJC 2BCKA 2ARJA 5E94B 5F6IB 4YDIL 1A1MB 3CSBA 1JNNL 5IHLB 4XCEB 2IBZX 5GRVK 2ZSWB 1CR9H 3UPRB 1BFOB 1CL7L 1CQKA 2HFTA 4PGCB 3IU3B 2Q76A 3ZMRA 4UINH 4WWKB 1TCRB 3QG7H 2QR0A 4TSCH 3DI3B 4S11A 1KIQA 1I3GH 5JQ6L 3EOAA 3LKOB 5D7IB 5ID1A 5KJRL 3DIFB 4NJAH 3F7RA 1J1OH 3U83A 1GIGH 4N68A 5DMGD 4I0PA 3DUUB 5AUMA 1MQ8A 5FUOL 4HIEA 4WVRA 2DQGL 4AYFA 5FDWA 4HQQL 3WS6C 4JR9L 3MGOB 3VU2A 4JAMA 2FEDC 4HIJA 3W9EA 3IVKA 4KK9D 2CKBB 3G5VA 3O8XC 3GHEH 3LHPL 2X70B 4QXTA 2DM2A 2IQAA 3OKMB 2CMRL 4KAQL 4XHJC 4BM7A 3SDCB 1CFNB 4PY7B 3NPZB 4K94C 4I2XE 2P8LA 1LILA 3HMXA 4FOMA 5AD0A 2Q8AL 5JW3L 1UM4H 3L3IA 4YE4H 1MHHB 2FJHA 1TJIL 4X8JB 3MV9B 4HJJH 1FFOA 2DQTL 3KHOA 2CXGA 4Q2ZB 1C12B 4X6DF 3N85H 3ZE2F 2H9GA 3VXTB 3GMNA 3WIIL 1G1CA 1RZFH 4LF3A 5BQ7A 2V7NA 4F8QA 5E6YA 4P4KC 4P2OD 3K1KC 2FJFA 1VFAA 5FKAA 3U30C 1ZT7A 1URLA 2VISB 1FNLA 4WUUE 4BQBA 2BSTA 4LSVH 5IFJA 5CSZB 3OR7A 2IEPA 4P5MB 4LASL 4BSVA 4X80H 5HDQH 4QT5A 4POZC 4DOHB 3IXAB 5BS0B 2A6JB 4G3YL 1P7QB 4OZFH 2NX5E 4NNYA 5C0DB 3QPXH 5IW6B 5DD0L 3QH3A 5D9SA 4CKVX 4JGMA 2A1WH 4JFFE 3VD3A 3GSQA 1AC0A 3D87B 5L2KB 3SDCD 1DFBL 5HY9B 2EC8A 2H45A 3TO4B 2PR4H 4PJDA 5I19H 1FL6B 1CD1A 3QG6B 4KKCC 5KVDH 2OYPA 1U3JA 1UKTA 2I07B 5CHNB 3WNNA 3K74B 4FQ1L 3VI4F 1R3IH 1FFPA 3UTSA 5I0ZA 5TDPA 2XWTA 3SE4A 1NCTA 3T0AA 1WJ3A 5L88H 5I1GH 1LNUA 5LQBL 4WV1B 4I77H 2B1HH 4NKIH 1L7IL 5J11B 2EYSB 1KTRL 2GK2A 3HZYB 3MJ7B 4KMTL 3ARBB 3QAZB 3LQAH 5BS0D 1XIWD 4RGND 5E8NB 3TBSB 2YPLA 1U8JB 1P7QD 3CDCA 4P5TC 3TBWB 3FCTA 3RWHA 4EBQL 3MBED 5DEGB 5DUBA 5HVFB 1K5NB 2R23A 1OTSC 1T1ZA 2YPKA 3MRCA 3EJYD 4UDUA 4FQXC 1LO4L 1J05B 3T1FA 4OFIA 5HGDB 4HPOH 3NN8B 5ESAB 2UZIH 1SMOA 4U3XA 3HFMH 4DAGL 3TO4D 1T7VA 4PY8J 1CDYA 1UQSA 2VZUA 4GAFB 5E2TH 1I7UB 2AJUL 4NNPL 4XZUA 1S7QB 3E8UL 3G5ZB 3BZFA 4PYHA 4XGZA 4UV7L 5GS0D 3P0GB 3DUHA 2Y36L 5CIPA 3PDOA 5K9QG 3JV0A 1NANH 3KYKH 1FBIL 1AGBA 4URTB 1UA6L 3UC0H 2OZ4L 4PB0H 1Z3GH 4H8WH 3LKQB 4QHUB 2DQIL 5F3BB 2OX5A 4BYHA 5IV2A 2ICEA 3NMEA 1VGKB 1G7HB 3EBAA 4P2CG 4YZFE 1KJVB 3MREA 4FQQA 1VGEH 1AD9B 5GISL 3WJLA 3DSFH 2UVEA 4OZIE 4MXQD 4NBYB 5D7JA 3RNQB 3UTPE 4M61B 4ACPA 5A3IC 1HIML 1FDLH 5F70A 4ZFOB 2BSSB 3N1QC 3NPSB 3IXTB 4WJ5B 4D0DA 1N8ZB 5DEFA 3VI3E 3BOVA 4CGTA 1Q1JL 1MRFH 3MO1A 4HKJA 3AROA 3OKEB 1IL1A 3QUZA 4BFGA 3IB4A 4NM8H 3QCTH 4P23D 3TT1L 5J6GB 1YEIL 2VB5A 2VDOL 1EVTC 5DZOA 4Y2DC 2XY1A 3SBWC 4CN4A 5ALCL 5TDNA 4G6JL 8FABA 4C59B 1L7TH 1ES0A 2XTJC 2GY5A 4PJIF 3C5JB 4CBPA 4LBEA 3NH7L 4X6EB 1UEYA 2HVKA 5IB4B 5IW1B 2XTJE 4TVPE 1O7VA 1FH5L 4HK0B 4YUEL 5CEZE 2ZUWA 4R4FH 4JQIL 4NCC1 1BX2B 1T83A 1H0DA 4GT7A 4PRHB 2A0LC 4K2UH 2GSGA 3G04A 3KNBA 2E7HA 2EXWD 3ZKMD 1OTTC 1RZKC 5F1IA 2ZG1A 5I8EA 5F71A 2XA3A 3LEYL 3TN0A 3I50L 1JJUA 4YHKL 4OCSL 3AC0A 4PJDF 5DRWB 4F80A 5D70L 3IKKA 4E0RA 3U0WL 4GKZA 3D25B 2Z4QA 5DK0A 3CX5J 4AIXA 1HZHL 3DO7B 1X4ZA 2V5MA 4K3EL 1SEBA 3NZ8B 5BZWA 4YHIA 5AZ2H 2VH5H 3FQNA 3N50A 3ZZ1A 3IDMA 5TFSL 4CW1A 1AKJB 3BDYL 1RZ8A 4HDIA 1MCHA 2WIIA 4G5ZL 1J87A 2FL5B 5IR1A 2FIRT 1EBPA 3QA3B 5HGAB 3BKCH 3O41A 3LB6C 5M7QA 4LFHD 4HIHB 1LO5A 4Z7VB 5C0BD 1KPVA 4Z7WE 4XAWH 3VDCA 3DMMC 1A64A 2ATPB 1R3HB 3QHZL 4UNVA 2I5YL 4D0CA 3P11L 3VFMA 4PIRF 1T1XB 2FIKA 5I30H 3QCUL 3GMOB 4XNZC 2CIKA 5C0CB 4GKOA 3V8OA 1KF9B 1G7IA 5DS8B 3QCVL 2HTLC 5FCUL 5FGBC 4PLJC 3V5KA 4ODTL 3SGKA 2AW2A 4G80A 5L0QB 1P4IL 4KGJA 2K3TA 2DQJL 4JPIA 4JVUA 1ZVSA 1F8TH 5L6YH 1Q9KB 5E00A 4QRUA 2WQ8A 4ZO8A 2F53E 4PJ9B 3WFZA 2AVGA 1HHKB 3T0EA 4LLWA 5GGUA 5CBAB 1D6EB 4F9LC 4Z7UA 5CINL 4N5ED 3G6DL 1ZLWK 2AK4B 1AKJD 1X4YA 4UOJA 2C3VA 2Y5EA 35C8H 1LP9A 4V1DB 1OAYH 2R9HC 1BQHB 5JW4N 4TTDC 3P2TA 2GIYA 3MRPA 2N7BA 1OGAB 4X6CB 3O2WL 3SHSA 4LLAA 4YDKL 1EMTL 5DD6A 1RZGB 5DRXB 3EHBC 5T5NG 4NYLB 5JHLL 3VE0B 1WIPA 3NA4A 2EH8L 1YPZF 4U2ZA 4G43B 3RVTC 5D1XA 1J0YA 1LEKA 1ZHBA 4GAJH 1FZMA 1FL3B 3NFSL 1UZ8A 2LVEA 3JVGA 5CJQH 5BXFB 3VGAC 2DBLH 2R4SH 2JELH 2NYYD 1ZA6B 3O3AB 3IDIA 4KU1A 4ODUA 1H3VA 1OP5K 5IT2H 5A40E 2E27H 1I9RH 3VH8A 2BERA 1RFDH 1RUAL 1JWUA 4XXDB 2AK4D 3HN3A 4V1DD 2CKBH 3LEVH 2C9AA 5C0EB 1JGVL 1SJEB 3F12A 4P2RB 1GCFA 1CBVH 2X9WA 1IAIL 2JB6B 4I48B 1REIA 2D2OA 5DHVB 4BZ2L 2UWEE 5J1TC 1RK0B 4PRIB 2O5YH 5C0RL 5E8PB 4KDTC 5AYUL 4U31A 1BLNA 1OCWH 5HYEA 3OWEA 4Y4HA 3FTGA 2Z31C 3ZKSD 4H25A 4XNMB 5IFAL 4QO1A 3FHQA 4ZODA 4PJGA 3MJGX 3T3ME 1DL7H 2BY2A 5F1KC 2FO1A 5CJXA 5GPRA 4LKXA 3BXNA 2R2EB 3RWFB 3SE9H 4RMWA 5B38B 4EI5C 1AH1A 2LV4A 1LK3H 5BOZG 2FBJH 5CGYD 5F96L 4APQB 5EZLA 3KS0H 4NZDA 1JHTA 1NAML 4JM2A 1BD2B 5K9OA 2G9HA 5T1DL 5FYLH 4TULH 5DJ0A 3MGAA 2GJ6A 4YBHA 4JO3H 4OM0L 4DGVL 4ZSOA 1P5UA 3RVVD 1MWAB 1NH6A 4FFZL 3LD8B 5LGJB 1OTUC 3KYNA 1KCUL 1NLDL 4JHWH 4ZS6C 2R8SL 2FX9L 3LN5B 4U1GB 2O5ZL 4Y19D 3ZDZE 4KDWA 2W9LA 4JREC 4R2GB 4E42A 3C60A 1CFVL 5DJ8B 2FB4H 5HHPA 4LU5L 5IBTL 4JY5L 1INDL 4XPFL 3QUMB 2E7LA 1ULVA 5DVMA 1JRHI 5DJZB 3EOBB 5DTFA 5F3HB 3RAJH 4TUKL 3DROA 5EBWB 1Q0XL 1R24B 2I26N 4RMVA 4JHZA 4K7PY 3EYOA 4Y4KD 4X7DC 3I6KA 1G9MC 4GJTB 1FE8L 4NQUA 4F37K 4APQD 4HH9B 2EO1A 1Q0YH 1NUGA 4ZFZB 3HRZA 4OCXH 1P84J 2ADJB 1U8KB 4EDXB 4Z0XB 3HAEA 2X4NA 3P77A 5C09B 5KANI 5HSFA 4KTEH 1I1AD 5EO9B 1YMME 4R3SB 3HLAA 4CVWA 4D9QE 2GCYB 3MUY1 4D0BB 4OLZH 4ZYKB 2RCSH 2R29L 2RB8A 5MEQB 2UZYB 4LSDA 5HHNB 3D18A 4Y88A 2C1PB 2FYYB 2VMFA 2H6PA 3OQ3B 5HD8C 3DBXA 4PPTA 1EIBA 2JJWA 3EFDH 3LS4L 4NZJA 4P59L 2APXA 3SE3C 2DLTA 5E1HB 2YEZB 1R3JB 2VAAA 4I9WE 1A6WH 3QULB 2J7LA 2FATH 1HINH 4PFEA 5J6HB 1SEQH 3BGFC 1RUMH 4ZNCD 1JPFB 4ZAKB 3FHAA 3ILQD 1OD9A 3F7YB 2A77H 4RQQB 1ADQA 5D72H 4LDOB 3U7AA 1JV5A 4HUWB 1I75A 4ODHH 4HV8A 3MNZB 4HWUA 5GS2D 5DRZA 1YYML 3TNNB 5FYKD 2B0SH 3MYJB 4M6OL 12E8L 2QV2A 4MCZA 1A14H 5C09D 4QHMA 3FONA 5EUKB 2JKXA 5HI4D 1FO0B 5ICZA 1P69B 3KPOA 3WHXA 4MNHA 4HCRH 2YN5A 1INQB 5LG1A 5KSAA 4HGWB 2F74B 2H8PA 4L29A 3QHFL 2HT2C 4YHPB 1S8DB 2CLZA 2WBJC 4ZUSB 4R4BB 2P4AB 3GJFA 4MMZC 2QL1A 2VL5B 4G8FA 1YEKL 3VFWA 3MUHL 4NZRL 3CSYB 3CXHJ 4ELMB 3LN9A 1NCAL 2JJVA 4RNRA 5FYJD 1PZ5A 4MAUL 1TJGH 4TPRL 4PJGF 4U1MA 3O9WB 4J3UA 2GAZA 2WUBL 1I8LA 5E9DB 4IRJD 3MV7A 3H3KA 3QZWB 1IQDA 3VDAA 1PKOA 5ACLA 3QFDB 1QBLL 2CLVB 4YR6B 4MQSB 2AXFA 2R0WL 5BV7B 4FZ8H 2YA1A 4LSTL 2J4WH 4ZAKD 2F58H 4TRPH 4AEHH 1OP9A 1MCJA 3KPMA 3AM8C 4PJ5E 2XN9A 4LLDB 4IMLA 5E24E 1IC7L 2WW8A 3FQXA 4PS4L 4LSSL 1CZ8H 1S5IH 1CLYH 3GSOB 2NY4C 2CJUH 2UVFA 4JEGB 4UT6L 3S96B 4Z5RB 3S88H 3JV6A 2BVPB 4WO4A 3VD4A 4G8GE 4LSUH 5HVHB 4RAHA 4NZTL 4JVWA 5EU6B 3DOSA 2W9EH 1JPST 4MJ6A 1NBVL 1ED3B 3BKML 2J12B 3Q6GH 3Q6FB 3O9WD 1KYOJ 3MJ6A 4N0UE 1IMHC 1TDQA 1JRHH 1WAAA 5D2NC 3V5DB 2D7NA 5E9DD 4C56D 5CP3H 5IMOB 2QHRL 2ITDB 3KPLA 3U7WH 4X4ME 2V5TA 4DZBA 1F5WA 1KFAH 4L9LC 5L7XL 5A2LH 5D2NE 5SV3A 2VDKH 3EKCA 4F3FB 3HE7C 3P9LB 2GSIB 4RSVA 4OZ4B 2P5WB 5JIHA 2B5IB 1CR9L 2C3WA 5FECA 1U8QB 1AD0B 2BNRB 4KJQD 2QQNH 4KK5C 4U1JA 3GJFH 3C08H 3QG7L 4RZCB 4TSCL 1KIPB 4U33A 5ICXA 5C0AB 1I3GL 2VTFA 3GSXA 4KQ3H 3D0VB 1JZ8A 1WBXA 3SY0A 3I3BA 4NJAL 4AM0A 1J1OL 1GIGL 5JXEC 1ZA3B 4WU5B 1H3PH 5EU6D 5JZ7C 2OJZL 2J88L 3SCMB 4UI2A 5F7HA 1Z9MA 4RGOH 4FTVA 1B90A 5D1QD 1XF5A 1FNSH 3HZKB 1FG9C 3CFDB 4QRRB 5JDJA 4PP1C 4ZXBD 1D5XB 4LCCB 4M5YH 3VG9B 3GHEL 1A6ZA 5E8EB 4DN4H 1CLCA 2KPNA 3L7EA 1I8KB 1PKQE 5I9QC 2ZOKB 3H0TB 1XGQB 4X8XA 3QEQB 2ESVD 4MHHG 4EN3B 2G2RA 5TGBA 1S9KC 2P5WD 3LH2H 3QWRA 4R0LC 3IAGC 4XBPB 3RGHA 1UM4L 1CFTA 3P4OA 1ZGLP 3U36B 3M17B 5C71A 4RBPK 3N06B 2BNRD 3NFNA 3GM8A 4YBQD 4EUPA 3N85L 2YWYA 1M1SA 4JJ5B 3PHSA 1RZFL 3S4SG 3T2NL 5ECJE 2D4FA 1RVFH 3QJHA 1IGJA 3OSKA 2LQRA 5E6IC 2BY0A 3MMEA 4MAYA 5IHZA 5IVXB 3L3OA 3AREA 1IAKB 5DQJB 2L4OA 4IIQB 4J6RH 4LSVL 2OJEB 5ELIA 4X80L 5HDQL 4NQTA 1WC7A 5F97E 4OCRH 1A4KB 4QRRD 1J5OH 4K8RC 5JOPD 3QPXL 2IANE 4H88H 2A1WL 1A7PL 1F4AA 4Q9RH 5HDLA 4HBQA 3QUYC 3V0VB 4UTBH 2CLRA 3QEQD 5DHVH 4EN3D 3C8HA 2X4SA 1I8MA 2A38A 4YHLL 5IFHH 2PR4L 5BRZB 5DR5H 1N0XH 3EUUA 4S0SD 4X6CF 4LLMA 3FN3A 3GBNH 4AH2B 5KVDL 1EHAA 3NZHH 3BW9A 1QVOB 1R3IL 4R7DB 2HJLB 3QPQC 3S34L 5L88L 4Y5XB 3FZUD 5IEHA 4WI8A 4I77L 1NMCC 2B1HL 1U95A 2VLKA 4NKIL 2OK0H 3FT2A 4F7PA 5ICYA 1LEIB 2VQ1B 4P46C 4PP2A 2DLGA 4GFTB 1UZ6F 3AMLA 3B2UD 2E5EA 3DWTA 1HQRA 1XEDA 3Q2CA 1A7OH 3LQAL 3OV6A 4BFIB 4ZFGH 2A73B 3FAXA 3RBGA 1RMFL 3TA3C 5I17A 2C1OA 3RUGB 1N4XL 3VXUD 1MH5B 4Q9CA 4HPOL 5CSBA 3LPWA 1X5YA 3LVEA 2UZIL 3U2SA 5JO5A 2RFXA 3HFML 5GGSA 3B3IA 4HH8A 4EUPH 3H7LA 2NTSP 5E2TL 43C9A 4P5KB 2BNUA 4HIXH 4FQJH 3SKMB 1L9MA 3NACH 1MLCB 1A7BA 4YGVB 2GUOA 1D9KD 5IHBA 4EIGB 4WWID 3UC0L 4PB0L 3KPRB 1Z3GL 4H8WL 2NY0B 3V6FA 2YSSB 2FO4A 1XCQB 3B6SB 1I7TB 5EO1B 2CPCA 3BZDA 2EXYC 3DSFL 3L6FB 4JFOB 1HH9B 1HHJB 1UCBL 1EXUA 1SYVA 3U82B 5FM5O 1FDLL 4QOKA 5ESVB 3QO0B 3PV6A 4R7NA 3QRGH 3RZCB 1TQBB 3DECA 3RVXC 4OI8A 1I3RB 5C6PB 1MRFL 4LQFL 5EBMA 2VO5A 2IBZY 3O6FA 4P9HH 5DMKB 3EYUH 3DGCR 2VABA 4NM8L 3QCTL 3NGBB 3VFPB 3QRFM 2VITA 1IGMH 3ES6B 2J3SA 3PWUA 4OZGE 5TQ0H 4CMMA 3IETB 5CKGA 4Z95H 4N8CH 2PO6A 3MV01 5C0NC 1L7TL 4JLRA 3FQWB 2V2WA 3VWKB 5IMMA 1W72B 3KPRD 5GSVA 1R3KB 4S2SB 4UU9A 5LCVH 3PGFH 4XC1H 4DEPC 4UQ2A 2DL2A 1G6RA 1JZ7A 1IFHH 1YN6B 3CUPA 4R4FL 3VFOB 1YMHB 2ARWA 3MRBB 3O11A 3BH9B 2LTQB 1X7QB 4K2UL 2QQQA 3REWB 2ZUXA 2DQFA 3GM0A 5HJ3B 1FO0H 1A9EA 4QCIA 3VXMB 5IJKA 2HT4C 2JK5B 3QR2A 1XF1A 4KWUA 4U0QB 5EDXA 2CUIA 5E2UH 2XT1B 3QDME 1EX0A 3FJTA 1G7MA 1NCDH 1VACA 3QXAB 4LDLB 1XGPB 4P4RB 5BO1H 1TJHH 3TBYA 3C6LC 2BC4B 5AZ2L 3WUWB 2XQBH 1L9NA 4KKBD 4QYOB 2VH5L 1CD9B 1NGWB 4Z7QE 4M03A 3JV4B 3RGVA 4H20H 2YD6A 3RVUD 1LK2A 4HKBB 4HLZG 1MAJA 3KPTA 1HSBA 3BKCL 3ULVH 4N0CD 4PJ8B 1U58A 4LCUB 1EA9C 4WW1B 3T4AA 4MWFB 1IKFH 1XAUA 5IWLA 3QJFA 5JNYA 1ZHKB 4F33B 4Z78B 5MEPA 1JWSB 1HHGB 5I30L 2Z35B 2YUXA 3BD5A 1UJ3B 2C7UB 4XB8A 3VXMD 1NFDE 4LKCB 3R0NA 4OGXH 2VDNH 4XPHH 2W65A 2IH3B 4O58H 4FFWD 5HHOB 4FG6D 3AB0B 1TVBB 5D71H 1TETH 5LAXA 3VD5A 2X4UA 1I7RB 1F8TL 3OR6A 3UXFA 4X9IA 4MDIB 4QNPE 4K71C 3MXWH 5ISZB 2X4PA 2BSED 3G5YA 3MLWH 3IF1A 3BQUC 1GOHA 1JI1A 4ELMF 3D3VB 4LK4A 3VXSD 3SDAB 35C8L 1MFBH 3HI5H 4P3DB 1RU9H 2NTFB 4DCQA 3WJJA 1BPVA 4W6WB 3VD9A 1A7RH 3NIGE 1U41A 2MCPH 3ULVF 2ED7A 5ANME 1U8LB 2KQMA 3VXRB 1MCEA 2FWOA 1H9VA 3SO3C 2Y6SD 1YECH 2Z0BA 2FJGA 4OZHE 2D7MA 5FYKU 4QRSB 1MJUH 3PWVA 2EDEA 1ND0B 2YUVA 3QSKB 1ZGLA 1U8PA 5EIIB 1XZ0B 5DK2A 5JDSA 4A6YA 3NCCB 4GAJL 4UV4H 2FDBP 3RDTD 3WFHB 2X44D 1ZHNB 5CJQL 5HHOD 3L5XH 2FLRT 2R4SL 3X14B 3IGAB 2JELL 2WINB 4KK6D 3T77A 5HPOA 3IJHB 2JB5H 3MRDB 3MLYL 5IT2L 5C0FB 4YO0B 1DANU 3U46B 2E27L 1I9RL 1RFDL 4XH2A 4FMKA 5EU4A 4WDIB 5H2BA 2CKBL 3LEVL 1A22B 2PXYA 5SWSB 3ZDXF 3S5LA 3V4VL 1CLOL 4JFYA 1CBVL 5KSVA 4PBXA 4UMGA 2O5YL 1HOCB 5FKPA 4Z7OF 1M71B 1NFIB 5MP6H 1OCWL 5KS9E 1MFEH 4N0FB 2FGWH 5CD5C 3ZYIA 1BJ8A 3AFLA 4L8CA 3OKDB 5FK9A 2G60L 5T3XD 4GS7B 1DL7L 3ARPA 3VGFA 3N1MC 2X10A 3MLUH 5BMFH 1MRCH 1UKSA 5EUOB 4TUJA 5GRJL 3DX7A 1LK3L 1DDHB 2FBJL 2Z8SA 2ICES 2HFFA 2BNQA 1WWBX 1P6FA 1WSST 3EYQD 4LVHB 5ADOH 3FT4A 4GUPA 4GRLA 4JO3L 43CAB 2R2BB 2AKRB 4EKXA 1BREA 1QRND 4JHWL 4YHYB 4NFBA 4X6FA 5D1ZC 3DGGB 2OMBA 3DRTA 3N9GH 1VCAA 5D6CA 4XX1E 3WEXA 2R15A 1CDJA 1X6LA 1T1YA 2EDTA 3S36H 2FB4L 1YEDA 3W9DA 4YPGB 1TTUA 1N5AA 4PG9A 5T1MA 3AS3A 3MJ9A 4EDWH 1HXYA 2W1NA 2D4DA 1SM3H 1KN2H 1T89C 4YNYB 3RAJL 1CI5A 1N59A 5TQ2L 3ZHLA 2B7DT 4GBXC 1DLFH 5ENWB 2R1YA 5ERWA 3ALXA 4ODXB 3KPPB 2IAMC 3H9SE 4NUGH 1KJMB 2BXZA 3MRKB 2HN7A 3KLSA 3U1SH 3GRWA 4ZO6A 3P30H 4ONGH 5B8CC 4CDHA 3X13A 2V17H 3QWOA 1CGWA 4AMKH 5IVXF 1NBYA 3O8XB 1KPRB 4OCXL 4MD0B 1J0HA 1MHEB 4K9EL 4PJEA 4G9FA 4MX7A 3MLTB 4KTEL 4ODBD 3NFPB 3UAJD 3EGSB 1C5DB 2X4TB 3RHWK 5JORA 1NJ9A 3GSUB 2D31B 4OLZL 2KZWA 2Z91B 3KPSA 1GZQA 4YBLB 3AAZA 1E27A 3OAZH 2D7QA 2DDQH 5K9QI 4NQXA 4LPWA 2KZ1B 4MNQD 5HPMB 5BW7A 4U6HB 1FYTE 3EFDL 1U8IA 2P8PB 1IE5A 3RTQD 4M8VA 5L8JB 5IUSA 3MRRB 4M8QA 1N3NB 2VZOA 5EULV 4NOFA 4P4KB 3Q1SH 3HG1E 4OUUB 2AGJH 4RRPG 3U30B 1HINL 2X7LA 5TJWK 1SEQL 4X6DE 2NX5B 1RUML 1JGDA 3ZE2E 1HEZA 2DLFH 4L3CB 4L4TD 4PJXA 2R1WA 1HCFX 4FNLL 2A77L 1OM3L 4JFFB 3B9KA 1P2CB 5D72L 2AJ3A 3BN3B 4MJ2A 5DO2D 1HHIA 4ODHL 4F9PA 2FEDD 4CJ1A 3QNXB 4J8RA 3UJIH 4Q9QL 3KPNB 5I2IA 3MRMA 2B0SL 4HZLB 3QDGA 3D39A 4PGBB 4XHJD 1ODAA 4YFDB 1A14L 3CD4A 4CN1A 4ZFOL 3WMSA 4HCRL 4XXCC 5CZVH 1VPOH 4O2EA 3EW3B 5C08E 1W0WA 5EFIA 4HUNB 3RUGF 3SDDC 4AENB 5JR1H 3MJ9H 2V2TA 3BIKA 4ONFH 1NMBH 1MI5A 4OI9A 2Y07H 5I1IH 4FABH 1G7LB 3OX8A 4PREA 4WUUD 2NY2C 2EIZB 5KVGH 2X4QB 3GRWH 2VXTH 1QUNA 3VI4E 4FZ8L 4Z76A 2DYPB 1Y6MR 2J4WL 2LABA 4M93C 4HWNA 2F58L 4TRPL 1CIUA 1W72H 4AEHL 5I66A 4JFFD 3WCYA 1PG7L 3PL6A 4ZPTA 4P5TB 1XR8B 3OKKB 2E9BA 1FFRA 5J8OA 2EDQA 2NZ9C 4J1UA 3GSWA 1A3LH 4FQXB 3C6SB 1CLYL 5GGTA 5IB1A 5EU5A 1AHWA 1SVCP 2MNUA 2CJUL 2YUZA 4ZO7A 4WFGE 5EB9A 2Y7QB 3S88L 2J8HA 4XMKH 3IYLW 5EO0B 5TE4H 5IB5A 3I3EA 2P7TA 3V5HA 2W9EL 4NN7C 3O45B 5E2JA 1S7TB 4U49A 4YFLF 1T5XB 3Q6GL 4OCLC 3FFDB 5F9AC 4ZOEA 3VGGA 1JRHL 2X41A 3D1MC 4JPWH 4NO0D 3IFPB 4OZIB 4I0PC 5GGRY 3U7WL 1KFAL 3DSNA 1OL0A 4U1HB 4JY6A 4P3WA 2VDKL 3O4LA 1QLRA 1WT5A 4GG8A 5DD3H 1Z5LB 5B22A 4PJEF 3FT3B 4P5TD 1JK8B 5I1AB 1F00I 2GITA 3MODH 2NY5H 3LQAC 1WQVT 2QQNL 4P2OA 4BSWA 3MLPA 2VERN 4ZFFA 2HJFB 3C08L 4AEIH 1CU4H 4P2QB 4I0KA 4EJ1C 1DQJA 3MOAH 3QUXD 1MCFA 1WEJH 4KQ3L 1M7DB 4C83A 3O0RH 4OQ1A 3MC0A 4Y2DB 4NUJB 2YZ1A 3PDGA 4J4PA 4CVZB 5F1SA 1H3PL 1IM3A 2AV1A 1UACH 1AGEB 1IM9D 3UJTH 2XTJB 4AT6B 1GPOH 1CDHA 2D9QB 4RGOL 1FNSL 4WI3A 2APFA 3MBXH 4M5YL 3DURB 3UTPD 2LU7A 2AV7B 5I6XC 5ADPH 3ZT5A 1HYRC 1JVKA 4PJIE 1OSZB 4O5LH 4RFNC 5GGTH 3E6FB 3LH2L 4KVCH 4OD1H 5A3ID 4L9DA 4JN1H 1XH3A 2BSRA 5C70A 1DBJH 3MCKB 5J0BA 1N64H 2ATKA 4OSUH 1BQUA 5FA3A 1T22B 2VLJA 2EE9A 2HAZA 3GMQA 2Z9TA 1S3KH 4I5BA 4MD5B 3OAYH 2D3VA 1XIWA 4AIOA 1LO0H 4PJDE 3WDHA 4J6RL 5C07B 3MBEA 3SDXA 2XTJD 4TVPD 1GGCH 3HZVB 5H37H 4MA7H 2JCCB 3VGDA 5CEZD 4Z7WB 1GZPA 1T4KB 4FP8H 3BP4B 1WZ1H 3MRHB 4QTHA 2ZWLT 2P43B 3MZTA 3GNMH 4H88L 1F2XK 2G5BB 4Q9RL 3F5WB 1EEZB 2F5BL 1G84A 4U1KB 1YEFH 3T2OA 1QEWA 2A0LD 1PX3A 4UTBL 3HNTH 1OTTD 1MHCA 1OOAA 4XNZB 4F7CA 5IFHL 1N0XL 4R26H 4X4YB 2CRIA 3SQBA 3GBNL 2YPLE 1PLGH 4HAGA 4IDLA 4LARH 5J12C 3NZHL 4GRWB 3C9NB 3CFJA 3BDXA 1C8PA 3A6BH 3RWJB 1DQDH 5K59F 4NKOA 4JZNA 3FO2B 2VR5A 2MTPA 4ETQA 2GTZB 3GKZA 1LE9B 1JN6B 3HC0B 3OB0K 1FYHB 5E8OA 2OK0L 3DI2B 2XOTA 5MHSE 3QQ3B 3TIEA 4U1IB 3TH3T 2XZCH 3SJVE 2VE6B 4OF8A 4K55A 2P24B 1A7OL 1QLEL 4WI9A 4YAQB 4FA8A 4ZFGL 1FNGB 4I3GA 1ZXQA 5HYJE 2DIJA 1A6TB 3LB6D 5SWZB 3CDYA 5D93B 3SKNA 3L95A 5EOTA 5IJVA 4P23A 1TVHB 4EVNB 2NNAB 3DMMD 2BZDA 1DE4B 3BN9C 1MOEA 2DS4A 1JNJA 3OKLA 4FQ2H 4M1DH 4XBGA 4GMTH 1BJ1H 2NW2B 1X5GA 3SEPA 3F62A 2MCG1 2HTLD 3E6HA 3BDBA 4HIXL 4UAOC 4PLJD 4FQJL 1DCLA 3VFRB 2F53D 2G5RA 3RZWA 3NACL 5B39G 3QUZC 1AY1H 4AIZB 2WP3T 2OTUB 3VGAB 3HPLA 4WW2B 3BGMB 2VLLA 1YPZE 1F4YH 2KKQA 3ET9F 5DURB 2G75B 1BOGA 3FQRA 1BHGA 1AGDB 1FVDB 1YA5A 2A9NH 2XKNA 3O6KH 4GW1A 1WTGT 4HC1A 5EUOF 3MOQA 2EDKA 3FRUB 5DVLA 2DI9A 1CFBA 3FB5B 1DVFA 3H2WA 3KWWA 3SOBL 2UWEB 3VFTB 5FO9B 4PJAB 4OI7A 3I75B 4HAFA 4MVBC 4TTDD 2BVOB 4OLVH 5HDOA 4JDVA 4JG0H 4KUCF 4NDMA 4K3HA 4WI2A 1FNAA 2XZZA 3QRGL 4Q9BA 4DQOH 1ZLWH 1SJXA 1T83C 1A2YB 1U93B 3VW3L 3LKNB 4P9HL 3D0LB 3EYUL 2Z31B 5F6IC 4POYA 3U4BH 4W70A 2R1XA 1T2JA 4L3EA 3TN0C 1MJ8H 5TQ0L 3IAPA 5BZDB 5AEAA 5EPMB 4Z95L 4N8CL 5LVEA 2VZ3A 2Z8WC 1P7HL 1IKNC 3ZDYF 1A6AB 4EI5B 4NGHH 5F9JA 5C0BA 1H8OA 4NJ9H 1LDPH 4MJID 1I85A 4WU7B 5JOEA 3RFZC 3QT2A 4KVNL 1YEHH 4L4VA 5DURD 4I4WB 4DVRH 5LCVL 3S98A 4HX1B 4XC1L 4PJBA 1D5ZB 1QPPA 2NZIA 4LSRH 5MERB 1IFHL 4D3CH 3QEUA 4NO5A 5SV4A 5HYQA 4HFWB 2DQUH 5D2LA 32C2A 1FO0L 1TCMA 3QIUA 1OP5H 3TYFB 3CCHA 3B2VL 3OKOA 5C6TH 5T5NF 5E2UL 2PN5A 1FRGH 1Q9LA 5BVJB 1BBDH 1G7QB 1NCDL 4B0MM 2BOCA 2Z31D 4CADB 4MJ4A 4GRMA 3RIAK 3RY6A 2XA8H 1TJHL 1LD9B 2WLZA 3P9MB 3AS1A 3SGKC 2IPKB 2XQBL 3FOLB 4HJGB 5I75C 3EOTH 3W11D 5KN5B 4JZOB 4EI5D 1G7PB 4H20L 1WFUA 3D9AH 3BP7A 4I1NB 4WCYH 1I1YA 1KT2B 4U6TA 1YMMB 2EDBA 4NN6B 3ULVL 1VEPA 2XACC 4PR5B 2C4XA 5IBUB 1IKFL 2H2SC 1QFWI 3QUKA 1WVZA 1KLGA 2Q3ZA 1BFSA 1OTUD 5KSUA 2MQ3A 3TP4A 4G6FB 1JGEB 3RBSA 5F9WC 2EE2A 4RWHA 1OAZH 4QGTA 4IRSD 4OGXL 5I15H 3BUYA 2VDNL 4XPHL 4PRDB 3ALWA 3B4NA 4O58L 1YEGL 3VA2C 4PRBB 3T4YB 5D71L 1TETL 5DFWH 2F54D 1KACB 4JQVC 4X4XA 5D1XC 3STZA 5F8RC 1JGUH 4KFZC 2IPUG 3LSOB 1MEXH 2P44B 2NY1C 5BCAA 5GJSL 3PWPD 3VXPB 3JVGC 2W9DH 2HG5A 4JFQA 1R5WB 4GW5A 1MFBL 3HI5L 4LLVB 1RU9L 5D7KD 3NCEB 4AJ0A 2W60B 1YMMD 2HH0H 5M95B 2AS5M 3SPVA 4D9QD 1A7RL 3L1OH 4X99B 2MCPL 3TIDB 1CXFA 4XPAH 2D7TH 1J1XH 3HTLX 4NSKB 2IADB 1J8HD 1YECL 3ARBC 4K9EC 1HWHB 1RHFA 3BPOC 3CXDH 3T0BA 2WBJB 4PGEB 1M05A 1MJUL 1D5BA 5HD8D 2BY3A 3ZT6A 3PGCB 4MLIA 3FQUB 4J2XA 4I9WD 4UV4L 4NRZA 5KSBA 3WFEH 1LEGA 4QY8B 2OCFD 1KTKE 3L5XL 3QDJD 1QSFB 2JB5L 1SJHB 5CJXC 4MHHI 2UY7A 1NUFA 5C2UB 4Y19A 1WWAX 2CRYA 4PJGE 4LRIA 4PGZA 3UJJH 2FGZA 2COQA 4BELD 4JM2C 4HSQA 3ARFB 5CMAB 2MKWA 5DJDB 2FZ3B 4N1HB 5CBEB 5F72S 1A9BB 2NXYC 4GKNB 2E8YA 2DMCA 5D2LF 3VI3F 1AGFB 4G8GB 1GYAA 5MP6L 4FXKA 2HWZH 5H94A 3QFJD 1FG2A 1A6UH 1T3FA 3VFGH 2GJ6E 1T2QH 4Y4KA 2FGWL 2HT2D 5T1LB 5IK3A 1KPUA 1ACZA 1NC4B 4AEFA 3C60C 3NPSC 3RWEA 3MLUL 5BMFL 1MRCL 5E2WL 3ZTNL 3JTTB 2B4CH 2C26A 2OP4H 2PCPB 3UTQB 1I1AA 1TZIA 1X5AA 1NUDA 4K23L 1IEHA 4LHUG 2BMKA 1ZT1B 4MB5A 2VC2H 5HGHB 1IGFH 2P45B 3RPKA 4L9LB 1RZIA 4PJ5D 4PLKC 5ADOL 1UWGH 1HQ4B 4JKPL 3X11B 4HGKC 5CLTA 3MR9A 4IOIB 4Z7NF 1TPXC 5JW4M 4M1GH 3BX7C 2X05A 3N9GL 2HP4A 4CNIA 1WBZB 1D5MB 3BPCB 3Q48A 1RURH 3S36L 4G8GD 5E8DH 4LIQH 2NY4D 4O9HH 5IG7B 3PHQB 4AEEA 4KKLC 1JNHB 4EDWL 4GRWH 4YDJA 1SM3L 1KN2L 4IDJH 3S4SA 4KHXH 2V7HB 3L7FA 4PRHE 1DLFL 5F89B 3DUSA 5IOPB 1U2CA 1CVSC 5HHVH 5K9JH 3U1SL 3P30L 4ONGL 3MXVH 3H6JA 3PHOB 2V17L 4AMKL 3UTTA 2I9TB 1FIGH 4UNTA 1U2HA 5GIRB 1A1OA 2JCCF 3HE7D 4YGAB 1F3JB 4R0LB 4NHCH 4AL8H 5KG9B 3GGWA 4HUVB 5FM4A 2ZSVB 3BEVB 4NHUB 3V6ZA 1FCCA 2NLJA 2DDQL 3LKRB 4OIIH 4IRJA 5C0IB 4P0DA 2HKHH 3L3DB 4FS0A 3PQYD 3QXDA 2PYFB 3VRLF 4XP5L 1NCCH 1RULL 2DOCA 2VDQH 2ZG3A 5KSBF 3Q1SL 5E6IB 4GRWF 1KXVC 4GG6A 5DJXB 1ZVHA 1JCKA 4KKNA 3B83A 2DLFL 4YPJA 2W91A 1R5VB 4LP5A 2Q7NA 1NGXB 4NPYB 3NVQA 4X5XB 5C0CE 5L0QC 4M1CC 1EAPA 1NKOA 1OP3K 1I8LC 2OXGA 1NFKA 2H32B 3WN5B 1F3DJ 3QHTC 4S1QH 3UJIL 4ELKA 4R9HA 4PJ9C 4JGUA 4JDZB 3K2MC 3QUYB 4FQLH 3MV7E 1ETZA 4F7MA 4JRYB 3MPCA 3P0YH 4C55A 1C08A 4XAKE 4LMQI 1KOAA 2VXUL 3G6AB 3QI9A 5CZVL 1IT9H 4PV9A 4Y16D 2C3HA 3FO0H 5K9KA 4YIQB 4M9OA 2EIEA 2YD3A 3JXAA 3FFCA 4DN3H 1ZT4B 4L5FL 2J8UA 5JR1L 3SN6N 3MJ9L 3CFKA 2XN9E 4ONFL 2OMNA 3VXNB 4C56A 3D69A 3Q5TA 2Y07L 5I1IL 2FECI 4FABL 1ZWIA 3KDMA 1G7JB 3MACH 1SVZA 3MV8B 1F02I 4C57C 4X6CE 2JF1A 1WUNT 3MFGB 4WO4C 3U4AA 1EFQA 3GRWL 2VZVA 2VXTL 3FO1A 1JMXA 3ROLA 4RBPH 3TV3H 4P46B 3CU1A 2XPGB 3WFCL 4FXGA 2MWCA 2QBWA 4WW2F 2IAND 4O51A 1JI2A 5J3HC 2Q86B 1U8HA 4DZ8A 3TA3B 4NQVA 1RV6X 3T2QA 4QXUH 5DQ9A 2NR6C 1A3LL 1UZ6E 1RUKH 4JDTH 5GSRA 3IDJA 4PJAF 4M62H 3UBXG 3MUJA 3BHBA 4L8DB 2EEBA 1S9XA 3EO0B 3MV11 5A2IH 4MXWL 4OV6F 3P40A 1NGYA 4XMKL 5D1QA 5TE4L 4OUOA 4ZXBA 2GYSA 2XFXB 4Z77B 4P2RE 3QPQD 5ACMA 2WIMA 4JRWA 1X5JA 3GUTB 1XGRB 3PWLB 4LNRA 2FSEB 1VADA 4JPWL 4CVXA 2ESVA 2YBRB 5IMKB 2JJSA 5JIIA 3V6OA 4GKSB 2APBA 1WTLA 3KLDA 2OSLA 4MA3B 3WNOA 5EU3B 2WZPD 5MI0B 5LKNA 1J0JA 3F8UB 4PG2A 5DD3L 5KTEH 3MRNA 3TA3D 3H7BA 1CFSA 4ZUUA 3RL1B 3ME0A 3MODL 2NY5L 3VXOA 1T1WB 4FTVE 5HYIA 3MQIA 3IKCA 3OF6D 1NGZB 1J7VR 2YMXH 2ENSA 3BVNA 3OB8A 4OZGB 1KJ2A 2YPVH 4AEIL 1CU4L 1BD2E 5I73B 3I02A 4N1EA 3MRFB 4NBZB 1DN0A 4XCNB 3MOAL 1WEJL 2CK2A 3GSNB 3O0RL 3ZKXB 3VGBA 1EDQA 4U1GC 1AO7D 1DLHA 4IMKA 1AR1C 3W2DH 3EO9H 2HRPH 4X0KA 5LXGL 4ZPVA 4R2GC 1UACL 2AJXH 3UJTL 3QIBD 2BJML 3FB7B 1GPOL 3BP5B 4GG6F 3WS3B 4OJFH 4HXBL 4NO2B 1ZE3C 5J13B 3MBXL 4MAYC 4DEPB 1X6NA 4JKKA 1MCRA 5ADPL 3BD3A 2EXYD 4ISVB 4HQQH 4KUZH 4WFHD 2I25N 3L5IA 5IMLA 1UB6A 5GGTL 4KVCL 3RIFK 4DJMA 5GS1B 4JN1L 3QDMB 1U91A 1K3IA 4GXUN 4O00A 4CDGC 4ZQKA 3RVXD 5FGCE 3VFUB 4W4OC 3DNKA 4OSUL 3F65A 2ZNWA 1U3ZA 1MCSA 5ESQA 4WFFE 2Q7YA 4KRPC 5IG7A 1S3KL 3OGCB 3V6BR 4P9HC 1A1NA 1LO0L 3N1PC 4MJ5A 4BZYA 3BZ4B 5DGQA 2DQTH 1S7RB 5C0ND 2DLEA 1S7UB 2HLAA 2EIBA 4MB3A 3LPGA 1PQZB 4JHBA 3V2AR 3VXUA 1I3UA 4YXLH 3NABH 3PIQA 1VB9A 4FP8L 3TEUA 1WZ1L 5L2JB 2DTMH 4QRPB 1TLKA 4PJCA 5IB2A 3GNML 2V5SA 1B9ZA 3BZEB 3W5NA 4JANB 4WHYG 3T2PA 5EBLB 2VLKE 3LRSB 5F7DB 1YEFL 1NFDB 4I13B 3REVA 5ACZB 1BECA 3HNTL 2VL4A 1KJ2H 4EQ2A 4R26L 1X5IA 1D9KA 4HGMA 2HT4D 1PLGL 2DB8A 4LARL 1QO3B 5FOBA 4U6YA 4J3TA 4N8VB 4G9DA 2EYTB 3CNKA 1QSED 4XRCB 5DYOA 4X4ZA 3OXSB 1MFCH 1RJYB 3A6BL 4E5XA 2RBLA 1F6AB 4K71B 3GSRB 3EJJX 3C6LD 3UZEA 4NT6B 1QZ1A 3B5HA 1K6QH 2Y4SA 5DD1H 2Z8VC 2XZCL 1B0RB 4G7VL 5GS3A 5ALBL 3RWDA 3H9HA 1UEMA 2J6EH 4CU8A 4FFVC 1NGXA 2R2CA 5E6ZA 3MRQA 4RFEA 3QO1A 1I1FA 2VLRA 4IRZL 4PRPB 1C16B 1FZKB 1QLFB 4N0RA 4GSDH 4OFYD 2FX8H 3GJFK 3ULVC 2Q6WB 4Q0XH 5IHUH 4M1DL 4GMTL 2OTWB 5BJTB 3ULVE 2IF7A 1U8OB 1P9MA 3MYZA 4MXVF 1IEAB 2X09A 4QOKE 3O6FC 3VJ6B 3JUYA 1AY1L 3KLAA 2SEBB 2QADC 3OXRB 4L8BB 1SHMA 5AZEH 5J1AB 4PJHA 2DJUA 3BD4A 3QEGH 2PKDA 1F4YL 1HILA 1OW0A 1XF4A 2AJUH 2A9NL 3BQUD 3VA6A 5FV1L 3DV6B 3DVNA 2PO6C 2A6DB 1IARB 3S37X 3KHQA 4W81A 3JTSB 1T0PB 1L4IA 1DUZA 1S7VB 4OLYH 3SO5A 1T7WA 4RIRA 2XRAH 1WBYB 1JUFB 1O0VA 5D7LB 4OLVL 5KS9B 2DQIH 4JG0L 4HUXB 5HHQA 1J12A 1UC6A 2XQYG 1CTOA 3FQTB 4XNQA 4OQTA 5I0DA 1Q38A 3ZDXE 4NQCD 1FQ9C 5B3JF 1FL5B 3MUGB 1XT5A 3FB6A 4CUCA 4NNXB 5IJKC 5CP7A 4MA1C 1MJ8L 2WLYA 5DI8A 4MSWB 2ICCA 3I3DA 3ARTA 3DTXB 3MJ8A 2CDEB 4KJYA 1HHHB 4NGHL 1BVLA 4ZUTB 4ENEC 4NJ9L 1LDPL 1VESA 1AP2B 1NDGA 3EIFA 4X7TB 5F21B 1YEHL 2D9CA 1WITA 4NKDA 2ARJQ 2AAVA 5JLZB 1BIIA 3ILPA 4DVRL 3TBTB 5C0AE 4LSRL 3RGVC 1E4XH 4D3CL 1I3VA 1RZJL 2ZJSH 4K8RH 2ICWB 3D2UB 4DGIH 3SCMC 4WEBH 3IJSA 2CRMA 4ZNEE 3P4NB 1OF2B 3EO1A 2DQUL 1JNLH 3ECBA 3EFFA 2L7UA 3BH8B 5IIEB 5FM5M 3VG9C 1FH5H 4YUEH 5I71C 5IWLC 3O6LH 5E1AA 3UPAA 5C6TL 2ZUQB 4U1LB 4HIIB 4OCNC 1FRGL 1NQBA 2DRUA 2HJKA 5DJCA 1BBDL 4Y4FD 1U92B 1XF3A 4XVUC 5JHDB 4R96A 5L8KB 5CD5D 1XR9A 3VXSA 1JF1A 1CK0L 3ARWA 3EYFB 3WL9A 2XA8L 1EGJH 4MZ2A 1X5HA 4GBXB 4OM1H 3S8WA 3D85B 3MX0A 2IAMB 4RRPA 5DDHA 1J0IA 3SGJA 4ODVH 5JOFB 3INUL 3D9AL 4WCYL 3TZVA 3OKNB 4K7PX 5I1DA 3B9DA 5GZNC 4K3EH 2QSCH 1RJLB 3BMWA 3PWNA 3I6GA 1QTYT 2PYEA 1EO7A 3BDYH 3G08A 3IFLH 3VCLA 3WJJC 3K1DA 1FYTB 5IVXE 3RDTA 1D6VH 4ZD3H 3L5WB 5D1ZD 1MFDH 4DFHA 4ZDHB 1F4WH 4LPVA 4MD4B 4WFEE 1YNTB 4LPUA 1S9YB 5I15L 2AEQH 4KJPC 3C09C 3C8KA 3KJ6H 1HYSC 1S9VA 3P11H 4P3CH 4DWHA 2CDFA 2I27N 3H9SD 2C5DC 3U7YH 3GMLA 1JGUL 4GBXD 4UQ3B 1T6WA 1UGNA 1QR1B 1MEXL 3D85D 3TBVB 1KCLA 4PJHF 3M45A 4LCWA 2IAMD 4NIKB 2W9DL 5BRZE 1EEUA 3STLB 4OKVA 4U6XB 4Y5XC 5I1LB 4X5WA 1S9WA 4WHTB 3L1OL 4AQOA 1ORSB 5C08B 1U8MB 5H35A 3G6DH 2XWBA 1RK1B 2D7TL 3WFDL 2IWGA 3PGDA 5E4EB 4S1DC 1J1XL 4UBDC 3HB3C 1KTLB 4BH7B 4LVNC 3U9UB 4DKEH 3SDDB 3U4EB 4NO3B 5JXAH 4NRYB 4WTZG 1T21A 1KNOB 3T0WA 3RWGB 3O2WH 2EDYA 5ETUB 2AXGB 3TO2A 1KLFA 3HG1D 1WK0A 2DI7A 4LCYB 1H8NA 3GSNH 3WFEL 3FMGH 4Y1AB 2GT9B 5A1AA 3VFVA 3RUGE 1IQWL 4O2FB 2PW1A 1YDPB 2YR3A 3OJDA 1CE6A 2UYLA 3CH1A 1Y0LA 2PTTA 3DX6B 1QRNA 5DZNA 3ESUF 2EYRB 3V4PH 3VRJB 4M93B 5GHWH 2IH1A 3RNKA 4TNVK 4UDTB 3NFSH 1L0XA 1QRKA 2DL9A 1WFNA 1W0VA 1T66C 3UJJL 1YN7B 3O3EA 1CG9A 3HC3H 4ESKA 1KB5B 5EC1B 2VKWA 4WEMB 2PF6A 5IB3A 2M2DA 3KYOB 5C08D 3G5XB 4GRLC 4M02A 4OZFB 5E5MB 2BCKB 2ARJB 3P73A 2BNQE 4KJWC 1GVIA 2YA2A 2HWZL 1FLRH 4C54A 1JF6A 1JGVH 3VFGL 3SDDD 2Y06L 2Q76B 4J7RA 4OIAA 4OV5A 1I7ZA 1SYSA 1UM5H 2QR0B 5C0RH 4NN7B 1TQBC 1KIQB 5AG8A 3EOAB 2B4CL 2OP4L 5ID1B 3K4DA 4NQSA 2NY2D 3HR5A 3RHWF 2XTLA 1AJ7H 5D5MA 3NGBC 4I0PB 2VC2L 2ICWI 1IGFL 5AUMB 1QQDA 4QRQA 4YEFA 1VFBA 4HIEB 3AU1A 2ZG2A 5FDWB 3HI1A 3Q3GA 1PJ9A 1H3WM 1UWGL 1TVDA 1JP5A 4K07A 3JSSA 3VFSA 4MNQA 4JAMB 4HIJB 2JIXD 5CEYA 3W9EB 3IVKB 3G5VB 5MEOA 3RTQA 5DJ6A 2P1YA 4QXTB 2IQAB 2RIKA 1WCQA 2APTA 2NZ9D 4M1GL 3ZKNC 1E6OH 4P99A 2QEJA 1WIOA 1FP5A 2OQJA 4WFGD 5AYQA 5D6DC 4NKQB 2P8LB 1FNFA 1RURL 4Q7DA 2BXYA 3OKYA 1E28A 4LIQL 5E8DL 4O9HL 4PJEE 5AD0B 1Q9WA 3I2CH 3L3IB 4L4TA 3BWUC 5I1HH 4ZS7H 2R8SH 2FJHB 4IDJL 5DJ2A 1AQDA 2ED9A 1FFOB 2BX5A 5BW7C 3KPSE 4OCYL 3A6CH 2H9GB 3GMNB 5BQ7B 4LF3B 5E70A 2V7NB 1V3LA 4I2XA 4NQED 3BJ91 4U2YA 4LEOA 5IBTH 2P48B 5DHYA 4JY5H 5HHVL 5K9JL 4S0TD 5C3TA 1U3HD 4XX1G 3MXVL 3ARGA 2X1XR 3ARZA 2FJFB 1JYNA 1VFAB 4OBRA 5FKAB 4YHNA 4I0PD 1FIGL 1ZT7B 1UH2A 3OG6B 1R5IA 2BSTB 4CU7A 4JFDA 5IFJB 3OR7B 1CTNA 3SGEH 4RMRA 5I6XB 4BSVB 4QT5B 4H26A 5JUEL 3MCG1 5DJAA 3HNSH 4RFNB 4F9PC 4NHCL 4NNYB 4AL8L 3QH3B 5D9SB 3CFEA 3O3DA 3GEWB 3EYVA 3GSQB 5FUCC 4WUUA 4G8IA 1GHFL 1ZGLM 2P42B 5T1KD 2XICA 2HKHL 3IJYA 5FUCE 1L0YA 3EDFA 2NY5C 1LO2H 4PJDB 1UXWA 1VENA 1CD1B 1UVQA 1FVCA 2B39A 2K1MA 2VDQL 4LGSB 4W6YB 4N1CA 1FFPB 1KB9K 3UTSB 5TDPB 2XWTB 4NC1C 1V7MH 2X4OA 4FZEH 4HWEH 1LNUB 3OTTA 5DD5H 4H1LG 3AB0C 2ZCLH 2JJTA 4NC1E 3CLFH 3ZL4H 4S1QL 5JW4Q 1FLTX 4FQLL 1J11A 1L6ZA 2YPLB 1XCTA 3P0YL 4LQ1A 3PL6C 2BHUA 1IT9L 5F7MC 3FCTB 4U1NA 3FO0L 3RWHB 1FPTH 1TZHA 5DUBB 1T2XA 2R23B 1T1ZB 2YPKB 3D3VE 1H3XA 3MRCB 4UDUB 3T1FB 4UIMA 4YK4C 1GGTA 2OL3A 3F58H 1AHWC 4JKLA 4NO0A 4U1SA 1H5BA 1UQSB 3MACL 1MJJA 5B39A 3D6GA 4TOYH 1I1CA 4JRXA 1MPAL 1FVEA 1Q94A 4XZUB 4M7KH 5F1OB 5HVWA 3BZFB 4XGZB 2NY6C 3VXRE 5FA4A 3MA9H 5DF0A 5CIPB 3PDOB 2QSVA 3KS0J 3LEXA 3MLVH 5K59E 5D5MF 1NC2D 1QACA 1AGBB 2XZQH 3PJSA 2R0KH 5INDA 4TPRH 5IV2B 1K2DA 2ICEB 4NRXA 4L8SA 1GOFA 4PBVC 4J3SA 4QXUL 3T0DA 4FQCH 3QUXA 5LJYH 3MREB 4FQQB 5E7BA 5TDOA 5FYJL 2YA0A 4LSTH 4OFPA 1WT5C 5D7JB 2EDDA 5HI5D 1IM9A 3IDXH 5FM8A 3T0VA 1JYWA 1T04A 1KN4H 5HHMD 5A2JH 3E0GA 3O4LE 4D0DB 5DEFB 1A5FH 4XB7A 1QFUH 4B41A 1BVKA 1DBKH 3MO1B 4HKJB 4P2OC 5FDYA 1IL1B 3QUZB 3BRDA 5SWSE 3ROOA 5MHSD 1GGBL 2GTWA 3SJVD 4KZDH 4GXVL 4J4PC 5TDNB 8FABB 1C5BH 4OD2A 5GRXG 1KCSH 4NZTH 5HYJD 3GKWH 1ES0B 1YY8A 4B7LA 2ADGA 3TLRA 3CPLA 3OG4B 3RKDC 4LBEB 1QHPA 2HVKB 3TFKD 4QRTA 5JPNA 3I6LE 1L6XA 5EUOE 4XPGH 3UP1A 2ORBH 5IF0A 5L7XH 1H0DB 2AEIT 4LVHC 4MNGA 3BN9D 2GSGB 3G04B 3KNBB 2X2YA 1OAQL 2YPVL 3G9VA 5F1IB 3HE6A 2D03H 5I8EB 2A74A 4X7SL 3TN0B 5HBBA 4YHYC 4ZOBA 4B53A 3HHRB 4QHKJ 3W2DL 3EO9L 4E0RB 1I8IA 2HRPL 3QUZD 4GKZB 2AJXL 2Z4QB 1NEZG 5DK0B 1MJ7H 1OPGH 1UWXK 4QHLA 4NQDA 2WP3O 1SEBB 4OJFL 5BZWB 4YHIB 4R4NC 4RGNC 1S7XA 3H3PH 2VLJE 3FQNB 4JFHE 3IDMB 5DA4A 4CW1B 3BE1H 1RZ8B 4HDIB 3MBEC 2WIIB 4HT1H 3ZDYE 2GJZA 2OJZH 3NTCL 2J88H 5IR1B 3EJYC 4KUZL 4MVBD 4QWWC 3O41B 4XVJH 3KXFA 4GAYA 3SDXE 3SKJH 1DEDA 4J23A 1LO5B 3WD5H 2VWEC 4BQ9A 1KPVB 3MRLA 3BO8A 4D0CB 3VFMB 1TZGH 2FIKB 5E5RB 3L9RA 3MNWA 3HUJA 2EH7H 1NBZA 2VWEE 4QKXB 4E9LA 4JO4H 1RD6A 2CIKB 2EDOA 4OLEA 1G7IB 3TN0D 4YBLC 3V5KB 3T0XA 5I75B 4G80B 3GIVA 4JPIB 4GMSH 4JFXA 2FECL 1ZVSB 15C8H 4WWKD 5E00B 4QRUB 4BH8A 3NIFF 5I76A 3V79C 3DMMA 3T0EB 5C0JA 3T2NH 3IDGA 4LLWB 5GGUB 3RWIA 4YXLL 3EAKA 3NABL 4GW4A 1A3QA 1YEEH 4Z7UB 5TPWH 2DTML 4H0GA 2APWA 5IQ9A 4KROC 2C3VB 3LN4A 1LP9B 1QOKA 3QNYA 5FGBA 5KVEH 1KB5H 4P57A 4WGWB 2F53A 3AXLA 3WNKA 4WGVB 5F9WB 5IM7A 2J8OA 3MRPB 1KJ2L 1RZJC 3EDDA 4Z18A 5DD6B 5JW5A 1KLUA 1A7PH 1R6VA 1TNNA 1H15A 1MCQA 4YHOH 1MFCL 1WV7T 3WDIA 1QG3A 3R06A 1Z0NA 4YHLH 1IGYA 3DX8A 5D1XB 2D0HA 1LEKB 3KLHC 1W0YT 2FNBA 1ZHBB 1FZMB 1P53A 1CGYA 1QPXA 2NY1B 1K6QL 2DD8H 5DD1L 3MV9D 2X89D 1UZ8B 5I8OH 4BSJA 3S34H 2Y25A 2CUMA 3IDIB 2J6EL 4ORGA 1DBMH 1Z9SA 2FR4A 4ODUB 1RHHA 3LKPA 3RJDA 1IC1A 3VH8B 5GGRA 3DETD 1JWUB 2H26A 1F4XH 2H2SD 1DVFC 2XKUA 5I18H 3BKJL 4GSDL 1ZV5A 2FX8L 3F12B 3MROA 5FYLD 4Q0XL 5IHUL 3BPOB 1IILE 3TF7C 1RMFH 4RMUA 2VDPH 4MJIA 4QF1A 2XY2A 2IMMA 3HMXH 2MMXA 3NCFB 1N4XH 5L2KD 1BLNB 2N1KA 4HWZA 3CVHA 3WKNA 2EKJA 1DEEA 3UDWA 1P7KA 3HCVA 4Y4HB 3FTGB 4O2CA 5AZEL 4H25B 2VIRA 3O3BA 3QEGL 2Z92A 4PJGB 5FCSH 2W0KA 4LAJH 5LBSL 2GFBA 3W81A 5E2VH 4LKXB 4LHUA 5EU7C 3BXNB 5HYSG 1JL8A 1LE5A 4L3EE 4W4NA 5EZLB 1I85C 3IDUA 4MS8C 4KDTA 1JHTB 4JM2B 4OLYL 5EU7E 3B5GA 2XRAL 2G9HB 4PB9H 3WLWD 5K9OB 1RUPH 3W39A 1WCBA 5DJ0B 2CSPA 2GJ6B 3O2DA 3RIAF 2NXYB 4ZSOB 4X9GA 3AS2A 4PD4J 4EI6A 4L4VE 2FHFA 2DQHL 1JE6A 5C8JA 2AJZA 3KYNB 3ARBD 4PJBE 3WSQH 2EICA 2QSTA 5EZJA 2CDGA 1GC1H 1UCBH 3QIUC 3OAYK 4E42B 3C60B 3V4UH 5HDBF 3HUJF 2ADFH 5HHPB 5KAQG 5D2LE 4F2MA 4XNXL 3WNPA 1CXIA 4HEME 1HK6A 4LQFH 2AP2A 4JB9H 3LCYA 1DTUA 5DTFB 3DROB 4KY1H 3K0WA 1BZQK 3RY6C 5F7FA 3V7AE 4PTTA 4YDVA 3EYOB 3HZMA 4IM8A 4P2QE 5IKCA 3I6KB 1BZ9A 3R8QA 1E4XL 5HGBA 4K8RL 2ZJSL 5T3ZH 2WWKT 1FCGA 4IRSA 4DGIL 4LPCA 4WEBL 1EFXA 1C5CH 3HRZB 1TPXB 3OMZA 2A6IA 1ZLUH 5CKAA 1JNLL 2D0FA 3HAEB 2X4NB 3P77B 1T7ZA 3LIZH 4KZEH 2GJ6D 4TQEH 3HLAB 2F54A 1LO3H 3O6LL 1X3DA 3VXQA 4Z7NE 2XNAA 3CVHH 1MVUA 1ROWA 3D18B 3PWPA 1MCOL 4D8PA 2H6PB 3BRGC 4WNQA 2HTKC 3DBXB 4MQTB 4OAWA 1EGJL 4OM1L 3MNVA 3P4MA 3ARDA 2AQ3A 1YJDC 3QB7C 3PNWA 5TE7L 1PYWA 4ODVL 2VAAB 3ZLQC 5CIPH 2QQLH 1X5FA 5D96B 1CDBA 1J8HA 2QSCL 5I8KH 2B4CC 1MAKA 4GH7B 3UBXI 1CLZH 1H3GA 1JV5B 3O2DH 3FB8A 3LKSA 4HV8B 5DRZB 3IFLL 4ALAL 4HS6A 1RZ7H 4ZD3L 1D6VL 1X9QA 1ZEAH 1HDMA 2M26A 2W0LA 1MFDL 4MCZB 3TESA 5C07E 3V9FA 4QHMB 3FONB 3TJEH 5ICZB 3KVQA 1CDCA 1F4WL 3KPOB 3QDJA 4MNHB 3WHXB 2JCCE 3W0WA 2AEQL 3UROR 5KSAB 1K4CA 2X40A 2H8PB 3KJ6L 2DWDA 3PXHA 4L29B 4P3CL 4PRHD 4KKLD 3VDBA 4WY7H 1W8NA 2CLZB 4M7ZC 2XG4A 2RJMA 3GJFB 2VJXA 3HPJA 3U7YL 4MGXA 4HULB 4G8FB 3VFWB 4LSPH 2ENYA 3CMGA 2E6PA 2BVQA 1QFOA 3MRGA 1I9IH 4RNRB 1PZ5B 1UCTA 4NBXB 4U1MB 4LVEA 4LIQE 3VRLE 3DLQR 2GAZB 2FLBT 3MV7B 4IEFB 3PP4L 5KSBE 2Q3AA 1IQDB 1U0QA 1S5HA 4GRWE 1QHOA 3IFOA 3QFJA 1ITCA 2AXFB 2OS7A 4FQHA 3G6JA 3KPMB 1AGCA 2YXMA 2XN9B 4IMLB 4Y19E 4HHAA 3DXAA 1X5ZA 2R2HA 4DKEL 3ISWA 1U8NA 3FQXB 5JXAL 3UBXA 3ZTJG 1K8IA 1II4E 2Q1EA 5CWSA 5D93C 1MY7A 1ZKAA 2VZ1A 4GOSA 2DBJA 2YHGA 3X12A 4U05A 4PJ5A 3GSNL 2Y9RT 3FMGL 1F90H 5SWZE 3JV6B 2F9BT 4WO4B 1FNEA 5C0CD 1V5JA 3CDGA 3AM8A 5I1KH 2GK0A 3V4PL 3BPLB 4MJ6B 5GHWL 4E41A 4M1CD 1Z0MA 1MVFA 4ZMAT 2EEAA 4WW2C 5A2FA 3KPLB 4PJFA 3KAAA 3HC3L 4DZBB 4PJ9D 1MY5A 4XAKD 1FV1A 3MLYH 4X6BA 4QXWA 1BOYA 1N2RA 4RMSA 4N0UA 1S7SA 1FLRL 1OP3H 1S7WA 5FECB 1MQKH 3V4VH 1CLOH 4X4MA 5E0QA 5D2NA 2AJSH 1OGAD 4U1JB 4PJAE 4X98A 1UM5L 3OL2A 5ICXB 4N9GA 4P48A 1H3TA 3GSXB 5LGKA 3B8YA 1WBXB 3SY0B 2ZCHH 3F6IA 3IS1X 4AM0B 3HE7A 1AJ7L 3R4DA 2HRLA 2G60H 5DRNA 1CIDA 4Y5VA 1BBJA 4FTVB 3M8OH 1XF5B 5GRJH 5J3HD 5HI4C 4JFZH 1UYWH 3NA9H 2LAAA 1OWWA 1A6ZB 4RMTA 1ZLSH 4RA3A 3PQYA 2NCMA