3QR3A

Crystal structure of cel5a (eg2) from hypocrea jecorina (trichoderma reesei)
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
329
structure length
329
Chain Sequence
MGVRFAGVNIAGFDFGCTTDGTCVTSKVYPPLKNFTGSNNYPDGIGQMQHFVNEDGMTIFRLPVGWQYLVNNNLGGNLDSTSISKYDQLVQGCLSLGAYCIVDIHNYARWNGGIIGQGGPTNAQFTSLWSQLASKYASQSRVWFGIMNEPHDVNINTWAATVQEVVTAIRNAGATSQFISLPGNDWQSAGAFISDGSAAALSQVTNPDGSTTNLIFDVHKYLDSDNSGTHAECTTNNIDGAFSPLATWLRQNNRQAILTETGGGNVQSCIQDMCQQIQYLNQNSDVYLGYVGWGAGSFDSTYVLTETPTSSGNSWTDTSLVSSCLARKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endoglucanase EG-II
publication title A structural study of Hypocrea jecorina Cel5A.
pubmed doi rcsb
source organism Hypocrea jecorina
molecule tags Hydrolase
total genus 129
structure length 329
sequence length 329
chains with identical sequence B
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2011-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3qr3A00
1JGIA 2X09A 3TP4A 5C8BB 1BYBA 3K4DA 1J12A 1VEMA 4UQEA 1LLOA 2EPKX 3OGRA 3W0KA 4AISA 2V5DA 4OUEA 2ZX9A 1KXVA 4J3VA 4V2XA 2YL6A 3ARZA 1HJQA 1SYTA 1JIBA 4XX6A 3M07A 4UQ9A 4UQDA 3RMEA 1E56A 1HJXA 4MPKA 1JZ4A 2J7GA 2JALA 4HMDA 3MMDA 4F9DA 2VZUA 3MANA 2OWWA 2DSUA 4PTVA 1ZBCA 2WSKA 1BF2A 4HPGA 1PIGA 1WDQA 4HMCA 2BHZA 4BA0A 5I24A 1CXFA 3AHXA 2BV9A 2VUYA 3AROA 4LPCA 3THDA 4MB1A 1FFQA 5BCAA 3FW6A 3AMLA 2EPOA 4JKMA 3WBAA 3BGAA 1ISZA 3DECA 3MUAA 2CNCA 4MJ2A 3DHPA 3B8SA 2GJXA 2EPMX 4BCEA 3W38A 1WE5A 1CXKA 5A6LA 2YL8A 2CYGA 1GOOA 5ABFA 1B3ZA 2VZOA 4GI8A 1UKSA 5GNXA 3CZ8A 3WUBA 4Q7NA 1VEOA 3CUJA 1GCYA 1QI2A 1QNRA 1CXLA 1UR2A 1XSJA 2DT3A 1MQQA 4S3KA 3L4TA 3KE0A 1UR9A 1UWSA 2VZVA 2VO5A 4H2CA 3VDHA 3PZTA 1E6RA 1NWRA 1V6XA 1PPIA 3SEPA 2WVSA 2VMFA 2X0YA 8A3HA 2NT0A 3BAKA 1NOWA 1Q6GA 2OSXA 3N04A 1K9TA 1E6PA 2Y8KA 3CHDA 1BHGA 2OYLA 2YJQA 4PMQA 1MWOA 3PZOA 1WP6A 1V3HA 1WCGA 3BC9A 3VIMA 4YN5A 3AFBA 2XGIA 2ZE0A 3GBEA 1OT2A 2Y24A 1ZJAA 1CXEA 1MQPA 4XV0A 4H8VA 3ZSSA 3HN3A 1M53A 1HN1A 2J7CA 2ZXBA 3AISA 5FOOA 2JF6A 1KGXA 1W9VA 4TTUA 3L4UA 4MJ4A 3UG3A 4UFMA 4PUEA 4CN6A 4E8CA 3WMCA 3WQ8A 1GOWA 2NW0A 5HOSA 1V02E 3FY1A 3TTOA 1CTNA 4KMQA 3ZJKA 3BAYA 4LGXA 1UD2A 1M7XA 4QFUA 5I3DA 4JFVA 1GQIA 5BXRA 1XD1A 2JEPA 2J8FA 1CGWA 2CESA 3AZTA 3K4AA 3L4XA 5D9PA 5E70A 2VX6A 3AS3A 1OIFA 4CN1A 1VB9A 4C7FA 3UG5A 1C93A 3KWXA 1JF5A 1WDPA 2FH6A 3AICA 4MADA 3FNDA 4AIEA 4UQBA 4FF5A 3CUGA 4CD7A 1DP0A 2WZIA 4GZEA 4U33A 3SCUA 2GDUA 2WMJA 1B90A 4HOXA 1QNQA 1MW3A 3GH7A 3N1AA 4CCEA 4M29A 1EH9A 3N12A 3VD5A 4C7GA 3L2MA 1X6NA 3W27A 4CU6A 3OB8A 3ZJ7A 3NJ3A 1H3GA 5HPOA 2EO7A 2O9RA 1NM9A 2CITA 4C7DA 1CDGA 4PYSA 4KH2A 3WEZA 4CD5A 4W87A 3NCOA 4AZGA 1B3WA 3QGVA 2XSAA 3CTTA 2J8GA 1R85A 2JEQA 1C8YA 5I77A 2XVKA 2YL9A 4XZBA 1AQMA 1VFMA 1FH8A 2WLZA 2QPSA 3WDPP 3ZJ6A 9CGTA 3ARPA 3EDEA 5C70A 4ML4A 1J18A 3L4YA 8CGTA 5HPCA 1H5VA 3N15A 4V28A 4X0VA 1LG2A 2QV4A 3RM8A 1QI0A 2DPEA 3WBEA 1B3VA 4PCSA 3BLPX 1E6ZA 3TTSA 5I6SA 1HP4A 3FHAA 1UKTA 3WQWA 1G5AA 1OGSA 1JDDA 3AZRA 2XVPA 2ZICA 2BY1A 1QW9A 3POHA 3CMJA 3AXHA 4ATLA 4D6EA 4EAMA 5HNNA 5JIPA 4WKHA 5GNYA 2WHLA 1ISYA 1DWGM 2XWEA 1V6WA 3WDJA 1UD4A 1ZBVA 1QBAA 4U2ZA 3WH7A 3BAIA 2WZHA 2DSZA 3WDRA 1GQKA 2PWGA 2WLYA 3NIYA 3FN9A 1XSIA 5E0CA 1JDCA 4AD4A 4URIA 3UETA 1RH9A 4PMOA 5BRQA 3W81A 4M82A 3AIQA 2VTFA 2AMGA 1JZ2A 3ZO9A 1MXDA 4UQAA 4E8DA 2ZXQA 1XD0A 1OWQA 1HXJA 1ZU8A 2Q8XA 4JL2A 2V3GA 1E3ZA 3HMCA 1GPFA 4F66A 3GBDA 3OIHA 1E6SM 2D24A 3W82A 3CZEA 4W89A 1E3XA 3SCQA 1JZ6A 4CD6A 2UY5A 4B16A 4HMEA 4Z2JA 3OA5A 4B15A 5D9NA 4HA1A 1XYFA 4BS0A 4OJYA 3WDHA 2DIJA 3GH5A 4UQCA 3ARSA 3T0AA 1D3CA 4A3YA 5CSYA 2WK2A 5AC5A 4XZWA 3OGSA 3RO8A 4HZ6A 1UA3A 2YIHA 1EIBA 3EYPA 3B9AA 3LPGA 3VD3A 5A94A 1S46A 1NQ6A 4M56A 5AY7A 3AIRA 1LL6A 3EMZA 2WVVB 1CGYA 4FLQA 1JYNA 4TUFA 2W63A 3SCWA 3UR7A 3VD7A 1G94A 4HA3A 2BFGA 2J75A 1ITCA 4IM4A 4K68A 3VGHA 1V6YA 4AZ6A 2UWFA 2YKKA 2VVNA 3WFZA 1JNEA 4BQ5A 3VX0A 1JD7A 1R7AA 2XFYA 1C8XA 4D71A 1QNOA 2C0HA 4Z2KA 2XFRA 3CBWA 1RP8A 3K1DA 2PWFA 1W9PA 2G4FA 4MAZA 4B9YA 2YBTA 4LYRA 5CGMA 1XH0A 3F5KA 3NSNA 2YDRA 4E2OA 3GZAA 4J3XA 3NDZA 1VFUA 5IHSA 4PSRA 4RE2A 5IHRA 3UERA 4JFWA 3MUIA 5A6KA 1CGXA 3OBAA 3AS0A 5D9OA 2J4GA 2XJ7A 1KGUA 4KRTA 1CYGA 1W32A 5DO8A 3VIOA 4AD0A 5AYBA 1C3FA 1GOQA 2OSYA 1VFOA 5A6AA 1AMYA 1ZBKA 1E40A 2BY3A 4P8XA 3W4RA 1KQYA 3I3DA 5M17A 3CUFA 1PX4A 4AZBA 5EB8A 1V6VA 4D6JA 1VJSA 2BHUA 2GJXB 2WNWA 2WSPA 2XVLA 3AOFA 3ZT6A 3LPFA 2ZUTA 3VMNA 1ZJBA 3KZSA 2GUYA 4JHOA 1Q6CA 4DWSB 2WBGA 3ARQA 2VX7A 2NSXA 4WK9A 2W92A 5GNZA 3QR3A 4JZ5A 5ABFB 2E3ZA 2YDQA 1FFRA 1U33A 4MDPA 3B9DA 3VM5A 4A3HA 3TTYA 3KL3A 4AWEA 3L2LA 2XIBA 1HNYA 1U30A 2AOSA 4ZXLA 2VR4A 3WUGA 3APGA 1GW1A 3OZOA 2GFTA 4IUGA 3QOMA 2CHNA 3AHZA 3T09A 4GZJA 3WIJA 2BS9A 1CGTA 1EHAA 6A3HA 1JYXA 1J0JA 5JIWA 3BMVA 3T0BA 1FHDA 1HL8A 3NDYA 5I23A 3CO4A 7A3HA 4LX4A 1QI5A 2CBUA 4KGJA 1E4LA 3WMSA 3F4VA 1J10A 4J3SA 5KZ6A 5IXEA 5DMYA 4HZ7A 4GI6A 4GXPA 3EDKA 1UQZA 3NSMA 4H7VA 1KXQA 5I79A 4JFSA 1LF1A 1JDAA 1VEPA 4S3JA 1XCXA 1BYCA 5A6JA 4BQ4A 3WNKA 1VBUA 2IXUA 1EDGA 5GPRA 4GKLA 5ABGA 1F4HA 2GVYA 1UHVA 2DT1A 4HZ8A 1UH4A 1GJWA 2BVDA 3M6DA 4LXFA 1JI1A 3ZOAA 4CU7A 1BGAA 1QPKA 3VGEA 2ZIDA 4AD1A 3CMGA 1CNVA 3GYCA 4P7QA 4FLRA 2VT0A 1H09A 3ARXA 4AEEA 3EMCA 1K9FA 4D6IA 2VX5A 1TVNA 2DSKA 4J3WA 4A4AA 4UTFA 1B9ZA 4CKQA 1HVQA 1CXIA 1OT1A 4V27A 1QI3A 4UFHA 4W7WA 1H1NA 4AD3A 1WNOA 4U5KA 3A3HA 4GZIA 1JZ8A 3EBVA 4CN4A 4F9JA 3AMGA 2YDSA 3VVGA 4KWUA 5BROA 3L4ZA 1W1VA 1CWYA 3AS1A 4DWSC 1XH1A 2C8NA 3CZKA 5CG0A 4U2YA 2WHKA 1QHPA 4XUYA 3BAWA 1WB0A 5CZKA 4ACZA 2WVTA 7TAAA 2XIIA 3A6OA 5FL0A 2EBNA 1OD8A 1NP0A 4B9ZA 4D72A 3TA9A 3D5HA 4M24A 3CZGA 5E09A 4ACYA 4W93A 5FCZA 2DDXA 1UD8A 1TA3A 2WMIA 3SUUA 3WQ5A 3PBGA 4WKAA 2YLLA 3RPMA 2CBJA 3BLKA 1OB0A 2D0GA 2TAAA 5CXPA 4PTXA 2W5FA 1I1WA 1QHOA 4MB5A 4DM2A 2ZX8A 2ESCA 2J47A 4PCTA 4WKFA 5CPTA 3ZIZA 1EOMA 3WH9A 1W1YA 3AIUA 4MNJA 3GH4A 3GXDA 1E73M 1TMQA 4J3TA 1SR0A 2X2YA 4P7OA 1HJUA 1MFUA 4CCDA 1LL7A 1V3JA 4PMUA 1E0WA 3GNOA 1HIZA 1UR4A 3BCFA 3VM7A 3AHVA 1ZBWA 1GONA 2VURA 2WAGA 3PZMA 1MQRA 2X05A 5A8OA 3BSHA 2PB1A 1OM0A 1XHGA 3VO0A 4LQ1A 2Y5EA 3AIVA 1QOXA 1UZ1A 2IXVA 3RDKA 1D7FA 1H0IA 3NSXA 5D8ZA 4AZCA 4KGLA 3WDIA 3WD3A 3OLDA 1E5JA 2D0FA 2VZTA 1LL4A 2CCRA 4AD2A 2XPKA 3WD1A 2Y8VA 4DM1A 1J0KA 5BRPA 3N9KA 3O9NA 1W9XA 3SIMA 2BXZA 1ITXA 1E0XA 1UR0A 3WN6A 4TOQA 2ZUVA 3NUKA 4UCFA 4N42A 5BXPA 3FAXA 3VKKA 4EANA 2DIEA 3TONA 3WF2A 2Y4SA 1E1EA 2CXGA 2VX4A 1GVIA 1DWFM 2J77A 1EQPA 2ZWYA 4HOZA 4P8WA 2VI0A 4F79A 1W1TA 1UOKA 1W2PA 2D20A 3AXIA 4MB4A 4Z2IA 4YHEA 2YBUA 3KL5A 5A2AA 1TUXA 1C91A 3WUEA 1FA2A 1JZ3A 1O7AA 1M03A 1PJ9A 5BYWA 1US2A 4MDOA 3ARWA 3QOKA 1XV8A 3WDQA 2WKLA 1HF6A 3OG2A 1HVXA 1CEOA 4PN2A 2J78A 5M5DA 1KR1A 4TX8A 2Z1SA 4GQQA 3CH9A 2CERA 1FH7A 3W29A 2XM1A 2JIEA 2DQXA 2QPUA 2XVGA 4B3KA 2WCGA 1AQ0A 2CIPA 4ATDA 1KCLA 2BY0A 1W9DM 1V03A 1E9LA 2DSWA 4NRSA 1UH2A 3GXMA 3ZR6A 4U3CA 3CPUA 1IZKA 1Q6FA 3B9EA 5TD4A 1UR8A 2E9BA 1KWGA 1XH2A 5DF0A 2WANA 5ABEA 1L0PA 2YA0A 4D6GA 1X6LA 1OBAA 3AMDA 1AVAA 2E9MA 4Z2HA 1FOBA 2A3BA 2CKSA 3U7BA 4RL3A 2QHAA 4AIOA 2QF8A 4OIFA 3OLGA 1DTUA 1KQZA 5A6BA 3EMQA 1MFVA 2CBIA 4NRRA 2PBOA 2V38A 4W5UA 3A4WA 3RM9A 1U2YA 1VRXA 4GQRA 5CGTA 4AMCA 5JBDA 1TFVA 3GDBA 2E9LA 1E71M 1V3LA 5EFDA 2WB5A 1MW0A 1FH9A 1UA7A 1ESWA 2MANA 3VNYA 2GK1A 3ARRA 1ISVA 3MS8A 3GTNA 3QHNA 1JF6A 1OINA 4ZE5A 4GO8A 3PTKA 1C8QA 4TTGA 2FH8A 3PZ9A 3VNZA 2DT0A 1PZ2A 3ZQ9A 4JCMA 5LA1A 2XHYA 5E6YA 1JFXA 1UD6A 3ZM8A 3ZT7A 2WMKA 2PC8A 2XVNA 3TOPA 4CVWA 3W37A 1V0NA 4HTYA 5A2BA 1KCKA 1PEZA 2WXDM 4UFKA 3SUVA 3VDCA 1F4AA 3F5JA 2EQDA 1KR0A 2BHYA 3AJ7A 5EBAA 1Q4NX 2CHOA 3VIPA 2QMJA 1DWAM 4GI9A 4OOUA 1MXGA 2Z1KA 4QP0A 1UH3A 3KEHA 2PWDA 2XWDA 3SCRA 2OYMA 1I1XA 5D4YA 2O9PA 7CGTA 1EDQA 3SUWA 4PRWA 1B2YA 4TVDA 1W3JA 2E8YA 2JE8A 2YL5A 1H11A 3DYPA 4Z2LA 3UR8A 5HXMA 1GUVA 1UWQA 2WVUA 1DHKA 1E4IA 1NARA 2BY2A 3OGVA 3U5YA 1KBKA 2VL4A 3T2QA 1EO7A 2X1IA 3CUHA 4QLLA 1GQJA 1TCMA 2VC9A 1K9DA 2VCBA 3IANA 3WF3A 4BQ3A 3N18A 2WCAA 3D3AA 1XYZA 1D2KA 5EMYA 2V5CA 2J7DA 1EO5A 3WQVA 1EOKA 1HX0A 2W66A 4CD8A 5E0FA 5FKYA 5LYRA 5C71A 4PMDA 1E15A 1NOFA 3ZR5A 2BVYA 3N13A 2BXYA 2CETA 2JIWA 2UY3A 2A3EA 4QLJA 4CGTA 1IZJA 2WC7A 3M46A 4BF7A 1JAEA 4OBRA 4P7NA 2EPLX 4GPNA 3PZUA 1NWSA 1OCQA 2W91A 5DT5A 1MW1A 5ABHA 2B31A 1EQCA 3RCNA 3W25A 1UKOA 2HVMA 2J62A 4E4PA 2D2OA 3MMUA 4XB3A 1C7TA 2ZUNA 4LYQA 1CZ1A 3VGBA 1ZL1A 4OOZA 1J0HA 2J7FA 5I5RA 1TG7A 5BXTA 4R5EA 1JZ5A 4ACZB 2ZX5A 3G6LA 3BXWA 2VRKA 4AIUA 1JAKA 5M03A 1QBBA 2CEQA 1JFHA 2A3HA 4MNLA 3CHFA 1VIWA 2ZUMA 4H8HA 4BQ2A 3WL1A 4D6HA 4HU0A 4L4PA 1TA3B 1WDSA 2WMIB 2D3LA 1QNPA 2E4TA 4PMRA 3FXYA 3WNOA 4MAVA 2EPNA 3BAXA 1DWIM 3ARVA 3WH8A 1LWJA 2D1ZA 1E6XM 1WAWA 4NSBA 3SCTA 1MYRA 1MW2A 2E8ZA 1HKKA 3AYRA 3AHYA 3T08A 2VVSA 1SMAA 5AYIA 4IPLA 3I3BA 5D9MA 3VMPA 1WPCA 2DGAA 4W7UA 1AQHA 4PMYA 4ZXOA 4NF7A 2OSWA 4F8XA 3O2LA 1OD0A 1ISWA 4D1IA 1CENA 4MTVA 3CUIA 3ALGA 1UKQA 3TTQA 1GNXA 5A6BD 4GO9A 3N17A 5BWFA 2G3NA 2FHCA 3UCQA 1B31A 1V3MA 3AIEA 4JCLA 4AZCB 2C7FA 3OZPA 1ZS2A 1HT6A 3CZLA 3SCSA 3WF0A 5E6ZA 4IPNB 4UOQA 3WMBA 1H49A 4PMVA 2YA2A 1GOKA 5BXSA 5CLTA 5CPSA 2V3FA 3VIJA 1FP9A 3WEOA 2WMHA 2XM2A 4Z2GA 2AAAA 3PZIA 1GOIA 2ZUWA 3THCA 1G9HA 3W6LA 2VQTA 1BG9A 2OLHA 1CGUA 3VIGA 4MNKA 3MKKA 4AZ5A 3IJ8A 4D1JA 2DH3A 3WFLA 1PBGA 2CBVA 4UZUA 3A4XA 1L8NA 4WLCA 1XRVA 1V3IA 2VRJA 3PHAA 1ISXA 3JUGA 2O9TA 3RJXA 2PWHA 1KWKA 3IJ9A 4EK7A 3VDAA 1SMDA 3WQ4A 1JXKA 3GM8A 1W9UA 1VFFA 4U31A 4JFUA 3A4AA 3W28A 2ZXAA 1KB3A 2WC3A 3RIKA 1R8LA 2ZX6A 2GJRA 1B3YA 1JI2A 1W9BM 4L4OA 3MV01 3FHQA 5E9AA 5A3HA 5CSUA 2VZSA 1WDRA 4PTMA 3VOCA 4TVCA 2G3JA 1I75A 1C92A 3QHMA 3K8LA 1CXHA 4RE4A 4FMVA 2J7BA 4X0NA 1UWUA 4D6DA 1CBGA 4BZYA 1HKIA 1RPKA 2V3EA 3K46A 1UD3A 2BNJA 4AD5A 1W3KA 3ARTA 1VENA 4P7RA 2DSVA 3M7SA 3DYOA 3S6TA 1QNSA 4ATWA 2ZX7A 3AMCA 2W4XA 3WNNA 3WY1A 1PX8A 2JF7A 1NOUA 4B3LA 2VCCA 3WF4A 3MSGA 4WJXA 2A3CA 2WW5A 4H41A 4TVUA 1JYVA 3AYSA 3VX1A 3MSDA 4PTWA 4DWSA 1UG6A 3SUSA 5D8WA 5LA0A 3ECQA 4U3AA 3VIHA 2F8QA 2O9OA 1V6UA 1UWTA 4UOZA 1BGGA 3VIKA 5HDRA 5FD0A 1OIMA 3SCOA 1JZ7A 1W3HA 2DEPA 1VJZA 3VD4A 4AY1A 4AXNA 5I2UA 3OLEA 1TE1A 3NYDA 1RP9A 5A6MA 5CPQA 1EDTA 1YHTA 3SCPA 1E6QM 1K9EA 1JD9A 4W8AA 2F2HA 1E5NA 2XUCA 5A8QA 1NWTA 5IDIA 3PZGA 4PMZA 3WSUA 2GK1B 1CGVA 1JYWA 1ODUA 1DWJM 3VD9A 3G6MA 4JL1A 1J0ZA 4D6FA 4OZOA 4ZEPA 3LPPA 1QW8A 3W53A 5LA2A 1CIUA 1UKPA 1Y7VA 2PI6A 1KFWA 1KXHA 3W6MA 2O92A 3SCVA 1V0KA 2Y2WA 2HISA 4WF7A 1EHNA 1TVPA 1PIFA 4PMNA 4WSKA 3AMKA 3VILA 3UEQA 1BVNP 4P8UA 1HJVA 3BH4A 3II1A 2XSBA 3VIFA 3VUPA 4CUCA 1QI4A 3VPLA 3GNRA 4RE3A 3WNPA 4OKDA 2BVTA 1UYQA 3WNLA 2YA1A 1BFNA 1VAHA 3WELA 2ZUSA 1E55A 3RM4A 1WZMA 1XSKA 2WCSA 3DYMA 5EFFA 1E4NA 1LJYA 4CVUA 5CLWA 4EKJA 3CHCA 2EJ1A 4JHZA 2X8RA 3WEMA 1GJUA 4X9YA 1GORA 4PBGA 2W61A 4W84A 1E43A 5IFPA 3CLWA 5JUVA 4QDMA 1BVZA 1ZB5A 1E1FA 3DC0A 2A3AA 3KL0A 1N82A 2FGZA 2G3MA 1IT0A 2D0HA 3VGFA 4FLSA 1E72M 1W2VA 1R86A 1PAMA 2J7HA 4YPJA 5A8NA 4PEEA 2VCAA 3ARUA 2J25A 3E1F1 2FHBA 3WH5A 2FGLA 1YQ2A 1O6IA 1H4PA 4W88A 1UZ4A 1HJSA 3T2PA 1BG4A 1W1PA 2PBGA 4JKLA 4PUDA 2GSJA 4Q22A 5F7UA 2WZEA 2ZXDA 4FLOA 2GDVA 2PF0A 3F5LA 3GXIA 3N11A 4HA4A 1DWHM 1UWRA 4JKKA 2IUZA 5DEZA 4D6CA 1GOMA 1HL9A 1C90A 3IJ7A 4AYSA 2J74A 1H2JA 2ZWZA 2WPGA 1JG9A 1EXPA 2G41A 4AZ7A 4DUVA 2EXOA 4CCCA 1E4MM 5FL1A 3ARYA 3ZT5A 3T0DA 2WBKA 1J0YA 2CKRA 5A2CA 4PSPA 2FHFA 2UY2A 4UR9A 1PX3A 3CGTA 3ALFA 2ZUUA 1LG1A 1HKMA 4WSJA 4HPHA 1Z32X 4AC1X 3PZQA 1UUQA 4M8UA 3AS2A 3POCA 1BPLB 1EGZA 4HOWA 2YOCA 1M01A 1B30A 1GVYA 1VF8A 2VJXA 2XGBA 3MUY1 2WHJA 1V02A 3PZNA 3O6AA 1A3HA 3CIVA 1H0GA 3QHOA 5DFAA 3WD2A 5AC4A 2XYLA 2WM0A 4UFLA 4LYPA 3SURA 3PTMA 2WHMA 3S2CA 1BSIA 4UNIA 5KEZA 4AZHA 3CZJA 3IK2A 3WD0A 3WQ6A 1TZ7A 2F61A 5DT7A 1BQCA 1E6NA 1GQLA 4H04A 1R87A 2OYKA 4AEFA 4MNMA 1OSEA 1ODZA 3VGDA 4DWSD 4EE9A 2YLAA 2PWEA 3MMWA 3WF1A 3WL0A 4QLKA 2D23A 1JXJA 4ZFMA 3J7HA 3MV11 1BAGA 2VR5A 4Y7EA 3VU2A 5HBFA 4W8BA 2ZOXA 2VNCA 4MB3A 1EA9C 2E0PA 1E70M 1MVYA 3WUFA 1NWUA 1XGZA 3MU7A 4KRUA 1OGBA 2UY4A 3MO4A 3BSGA 2RGLA 1H41A 4UFIA 4J7RA 3ZSTA 3GXFA 4W85A 4NI3A 3VTRA 3GNPA 4TXEA 1JL8A 4J3UA 1RD6A 3W24A 3WENA 1B3XA 5A8MA 2FDMA 5A8PA 1BLIA 3PTQA 3AIWA 2RGMA 1P6WA 3SCNA 3VGGA 2J79A 3ZMRA 5IFTA 1UWIA 2X0HA 1FP8A 3ZJ8A 2VRQA 2WC4A 1V08A 5I0DA 3VMOA 1XC6A 2XG9A 2QMKA 2WMGA 4JFTA 1CPUA 2VOTA 5A6SA 4OBSA 2V3DA 4IISA 4HU8A 3OLIA 3MUZ1 1UQYA 2WYSA 3BAJA 1Q6EA 5ECUA 1E0VA 1BYDA 5A69A 4J28A 3IAQA 3U5UA 4M80A 1G0CA 3HU7A 1K6AA 1JNDA 1J9YA 3EDJA 1WZAA 1M04A 3LPOA 4UOJA 2QLYA 4PMXA 1BYAA 2G8ZA 3WKZA 1WZKA 5JBFA 3LMYA 5CQ1A 4QAWA 3AQUA 4JIEA 3HJEA 1J0IA 4U5IA 2WWCA 2J7EA 3RJYA 1XCWA 4AZIA 1G1YA 2WWDA 4HP5A 1W3LA 2DT2A 3U7VA 4CD4A 1US3A 4P7LA 5FIPA 1OGGA 1V0MA 3K8MA 2DH2A 2EEXA 5JBEA 2GJPA 3L4VA 3WNMA 4FK9A 1HKJA 1CLXA 1BTCA 1ECEA 4UZSA 3IAPA 3WD4A 3WH6A 1G01A 2NT1A 4DUWA 1WKYA 1R7OA 3I3EA 1Q6DA 1J11A 1HP5A 4JAWA 5A95A 3EDFA 1WZLA 1NH6A 3AIBA 4N0RA 4M1RA 4W86A 2WKGA 3L4WA 4M81A 4WIWA 4H8UA 2JFEX 3BMWA 1A47A 5M3WA 1UR1A 4W5ZA 1GZJA 2XTKA 4W7VA 3UESA 1KBBA 1CLVA 1SFSA 6CGTA 1CECA 4GINA 4YHGA 3VDBA 4QCEA 1UD5A 4TX6A 2E40A 1DEDA 3AI0A 1QHZA 1J01A 1NP2A 3W26A 4GIAA 4AW7A 3SUTA 4DUXA 2W67A 2D3NA 1WO2A 2WMFA 4CU8A 3PZVA 1B1YA 2OWXA 3AHTA 2OWCA 4NZCA 3U57A 5CJ5A 3EDDA 1GHRA 1IV8A 5A1AA 3VINA 4QCFA 1C7SA 4R27A 1V0LA 1QVBA 3AXXA 3DHUA 1KXTA 1LWHA 3BCDA 1LQ0A 1TR1A 2G3IA 4ZE4A 2VQUA 4J27A 5GQBA 3K8KA 3FAWA 1V3KA 4UFJA 1PZ3A 2D22A 1X1NA 3VIIA 4ZENA 3UG4A 1GHSA 1HJWA 3T2OA 1KGWA 6TAAA 1W91A 2WVVA 5I78A 1B0IA 1VBRA 3A47A 2W62A 2CPUA 4P8VA 4W8LA 3RILA 2XFFA 1FHLA 3CHEA 3PN8A 3AZSA
chains in the Genus database with same CATH superfamily
4XQ6A 2BZNA 4ZB0A 4EPBC 4JGDA 3OGRA 3W0KA 2V5DA 4OUEA 1MEIA 1VKFA 4CEUC 2YL6A 1R47A 4CQ9A 1HJQA 4GMEA 3M07A 2FVMA 5HWNA 4KCWA 3V1PA 1YEYA 1HJXA 3BICA 1QCWA 2JALA 1U5VA 3LLFA 4QG9A 3W7NA 2WSKA 1BF2A 4HPGA 2H3BA 1N8FA 8XIAA 5BOOA 1AW5A 4GVGA 4BA0A 3PTDA 3GC4A 2VUYA 1HW6A 4PTNA 3THDA 3F03K 1REQB 3NQEA 2B4GA 4FALA 3BGAA 3MUAA 1S5VA 3NO5A 2PTDA 3B8SA 1HZYA 3TN3A 1IEQA 2W79A 1NF7A 4K36A 5A6LA 5B80A 2YL8A 4D2JA 2CYGA 1GOOA 1A5AA 1VJIA 4FNQA 3GVRA 3MTWA 1EXBA 1WUFA 3MCOA 1VEOA 2FZBA 1GCYA 5TIMA 2GUUA 4S3KA 3L4TA 3F4NA 1UR9A 1Q6OA 2VZVA 4H2CA 5D02A 3PZTA 4IMFA 4C6OA 1OF8A 1GKRA 3LOTA 1P43A 1V7YA 4Y8EA 4MWAC 3EWXA 2I5GA 3STGA 2VMFA 4ZQNA 1NOWA 4K1GA 2XN0A 5FSDC 2Y8KA 1TQXA 3CHDA 1BHGA 4A8LA 2IQDA 1MWOA 2YCKX 3PZOA 1NQKA 1NY1A 5FJUA 1V3HA 3NQ8A 3VDGA 2ON3A 5LGXA 4YN5A 4UB9A 2FZNA 3LQGA 1JPHA 3IARA 4TU1A 2C1HA 2EPHA 2E28A 4C91A 4O8RA 2JQXA 1V8EA 3FSTA 3MYOA 4C6MA 3HN3A 4IMEA 3U2OA 3AISA 2VUNA 1XI3A 3C3UA 1XPGA 3O6YX 3L5LA 2QDHA 4UFMA 4POCA 1WDDA 4JTHA 1GOWA 1PTGA 1D9EA 1V02E 2OEKA 1CTNA 1LQ2A 3DERA 4LGXA 1XLJA 4UCGA 4QFUA 4C6FA 3F4DA 3W72A 2JEPA 2WPBA 1EJUC 4UWMA 5SWUA 2VDIA 4WY0B 3L4XA 2CLEA 4L64A 3UXIA 3AS3A 1RPXA 3MI6A 3NPUA 2GGJA 3UG5A 1C93A 2QVHA 3PPFA 3VE9A 6XIAA 5BMXA 4S39A 3RU8X 3H70A 4NU7A 5ABTA 3GUGA 2Q01A 1AD4A 2GDUA 1B90A 3ITGA 4HB7A 3RXZA 2FIQA 2NQJA 4CCEA 2OGYA 1LDCA 4GIRA 4C7GA 1SJAA 4H9XA 3ZWSA 3NO3A 2CITA 1LRTA 2IPFA 4C7DA 1EJWC 3GVGA 1CDGA 4PYSA 4Y6GA 1ZLPA 3COTA 3WK0A 3WEZA 3CNYA 1NFBA 3CTTA 4V15A 3IJIA 2XVKA 1FY6A 1FH8A 4EXAA 1K4HA 1TPH1 5KZDA 2VEIA 3F4WA 4XD6A 5AZ1A 3ARPA 3BSMA 2OZ8A 1LG2A 3HOJA 3ABXA 2DPEA 4X22A 1B3VA 1DXIA 1GYMA 1E6ZA 3TTSA 1TV5A 3M0JA 5I6SA 1B54A 1UKTA 2DZWA 2XVPA 1B3OA 5HA7A 3QN3A 1UBPC 4K7YA 5F2IA 3E02A 4C6NA 3A21A 4FNSA 4RCXA 4OUIA 5HNNA 3BZGA 2XWEA 4XZ9A 3O05A 4C6JA 4IGMA 3ITLA 2G95A 2QGHA 3WH7A 3H6OA 4IGHA 4PB4A 3ABRA 2DSZA 3SJ3A 1GQKA 3KZPA 2BP1A 1ZALA 2PWGA 4UMBA 3URNA 1XSIA 3LCGA 3UETA 3P60A 4M82A 4IF2A 3AIQA 2VTFA 4GC3A 5CZJA 1JZ2A 3ZO9A 4UQAA 4ZO7A 2ZXQA 1XQKA 4IMGA 1XD0A 1OWQA 4INFA 1W5PA 3EEZA 4XWUA 3NXLA 4DAFA 4IFRA 3HMCA 3OQ8A 4IP7A 1W1A1 3WQOA 3OIHA 1E6SM 4PFMA 1EC7A 3NA8A 4Q7IA 4B16A 3N3MA 5JMUA 1EX1A 3ITTA 1IE7C 3O0KA 3LEPA 2REQB 2D69A 4OJYA 2ZDSA 3QLDA 4UQCA 5CSYA 1O66A 3PFRA 1PWMA 3CV2A 1V51A 2V5JA 4HZ6A 4NNBA 2YIHA 3EYPA 2QZRA 3B8VA 3HJZA 1TVLA 1S46A 1DBTA 3TW7A 3VZXA 2C14A 3QMSA 3AIRA 3ZZ1A 1IEIA 2WVVB 1KC7A 4DJEC 5G2IA 3G1RA 4B3ZA 3SCWA 3UR7A 4F0SA 3DFOA 1ITCA 3DZ1A 1F61A 3VGHA 2E77A 1V6YA 3PB2A 1Z3NA 4H19A 2DUXA 1H7RA 3FYOA 4CQAA 2YKKA 4HNTA 3IGXA 3WFZA 4H3DA 4BJHA 4O4VA 3ZVIA 2Z6JA 2C0HA 2INEA 3O07A 4FIRA 3K1DA 1W9PA 3PANA 5CGMA 3F5KA 3O0FA 3NSNA 3P5ZA 3HG3A 5DRCA 4KWVA 2E6AA 1EJ7L 4J3XA 3C86A 2DUZA 3TQVA 4PSRA 3TMQA 1HUVA 3NQBA 1ECQA 4UTLA 3CC1A 1CGXA 1L6SA 5CBJA 1W5NA 5E93A 3EA1A 3VIOA 4B91A 5AYBA 4E2DA 1C3FA 1GOQA 1VFOA 3PWAA 1GJPA 1ZBKA 2Q8ZA 1A80A 4BEQA 3G1HA 3D0CA 3I3DA 5FJIA 1PX4A 4MUPA 3AOFA 5LIYX 1VYPX 3BWWA 4DWSB 3FJ4A 1TZ9A 2TSYA 3IGSA 3ARQA 4IMCA 3G1FA 4JTAA 5GNZA 4C1LA 2QF7A 4MDPA 4EF8A 3TTYA 3K1GA 3P7YA 4AWEA 3L2LA 2AOSA 2WZTA 3QMTA 3ORWA 3WUGA 1GW1A 4F2TA 5CC3A 3QOMA 2ISDA 3FX4A 2Q6ZA 2PSNA 3IGHX 3EX4A 4JY9A 1KLYA 4GZJA 5FAGA 1X7IA 1QOPA 3URAA 3W1PA 3HPSA 8XIMA 1SZNA 3H53A 1JYXA 1J0JA 5BU9A 4OHQA 9XIMA 4JN6A 5I23A 3CO4A 7A3HA 1CX9A 3KRUA 1XIGA 3CPGA 2NV9A 3AALA 3F4VA 4UR8A 4J3SA 4Y90A 3H2EA 4GX9A 1A5BA 1UQZA 4JFSA 3UZ5A 1JDAA 2JBMA 4BQ4A 1N8WA 1VBUA 2IXUA 5GPRA 4JNMA 2ALDA 2A21A 4B5VA 4XO7A 3NYZA 7XIMA 1UHVA 2DT1A 4HZ8A 4LVDA 1PZ0A 3PB0A 3M6DA 4LXFA 2ALRA 3R79A 1BGAA 3FA5A 2CWXA 3S5SA 1BF6A 4ZTYA 1XLBA 3LNMA 4ZO9A 2G96A 4P7QA 2GQ3A 2QCDB 3ES8A 1YX1A 3LI0A 2VT0A 3OYXA 3G0SA 2VX5A 2VEPA 3T40A 1DL3A 1X8FA 1B9ZA 4OGZA 3DFQA 2QV5A 3LRLA 1OT1A 4V27A 1ME8A 3BDKA 4JTJA 4GZIA 1PHWA 3K5XA 1JZ8A 1XISA 3KXQA 4YYFA 3PG9A 4CNSA 4DB7A 3W02A 5HAOA 4PODA 5BROA 1FWBC 1VPXA 3UWUA 4XKYA 5J8LA 1CWYA 2ZA2A 3E2VA 1AW1A 2C8NA 5CG0A 4Z0SA 5AZ0A 4NZ1A 3VOJA 2XIMA 1QHPA 3OZYA 2ZRWA 4V1XA 2WVTA 1Y65A 1W1IE 2VGIA 4EPEC 2CLLA 4B9ZA 3TA9A 3GDKA 1RCQA 1Q45A 4M24A 3D3FA 3HQ1A 5E09A 4LCQA 4OWGA 2DDXA 1WAUA 2CLHA 3PBGA 4WKAA 2YLLA 4JICA 3ITOA 3T8LA 1OB0A 5CXPA 3WLQA 3VNLA 1P0EA 1ZAIA 2ESCA 4O1AA 2OEJA 1EOMA 2R1NA 4MNJA 1UIPA 1E73M 4R7WA 3TQ0A 1B5TA 4BK9A 4RZBA 1RY8A 3L21A 2GVEA 4CCDA 4PMUA 1E0WA 1HIZA 4WHBA 1C29A 3L2IA 1GONA 2VURA 2QCNA 1DE5A 2X05A 2ZDRA 3BSHA 3TC7A 2PB1A 3F2DA 3W7QA 2XH2A 1FVPA 4LS1A 3LLDA 3NSXA 1DIEA 4KKXA 2VFHA 2J24A 2ZC8A 3SDOA 4MWAA 4R7OA 4XAYA 2CCRA 1J0KA 1LOQA 3LHVA 2BXZA 1ITXA 1E0XA 1UR0A 2Q3OA 3HMJG 4HT3A 2X1UA 3NUKA 2PWUA 2UBPC 3TUUA 3U4AA 2XSXA 1M7OA 1OFOA 3NO1A 4H00A 3GDMA 4JYDA 1M65A 3T1GA 1TPEA 1DVJA 4F79A 2AGKA 3HGRA 3E2QA 3AXIA 3G8EA 2YBUA 3MO7A 3C8NA 2HVOA 1FA2A 5JXQA 4YYCA 3B9OA 2HS6A 4G7EB 4I3GA 3DHFA 3VYLA 2NUWA 2GVJA 2WZMA 2YW3A 4HN4A 3T55A 4O1CA 2WNNA 3F2BA 1XC4A 1WXYA 2J78A 4XZNX 1KR1A 3W7DA 4L4LA 2Z1SA 3T07A 1TRIA 3CH9A 4QNWA 2CERA 2H3DA 4KQNA 5LXEA 3DN5A 3E9AA 1AQ0A 2BOGX 2CIPA 2V5BA 2QUTA 1UZDA 4QIUA 1XFBA 1V03A 1E9LA 4NRSA 1UH2A 1THFD 4K8GA 1ALDA 1DJNA 4U3CA 3LBMA 1TIMA 2VYOA 3TH6A 1XLHA 3BLFA 1XH2A 1UJQA 3QH2A 2WANA 1GWJA 2H90A 4MZ8A 1X6LA 3AYVA 1OBAA 4LRTA 1KM4A 1AVAA 3B05A 3SSZA 4US5D 2ACQA 1KM3A 2CKSA 4O0QA 2QHAA 4OIFA 2ZZ4A 1KQZA 5A6BA 3EMQA 1MFVA 1QTWA 2CBIA 4PTDA 3A9BA 3BLLA 3UWWA 1KLZA 3H2OA 2PBOA 2V38A 1U2YA 3SY1A 2FPVA 3CEUA 3SIZA 1TFVA 2OQHA 1QPOA 2E9LA 1OY0A 2A6NA 3H22A 4ZOBA 3MI3A 1US0A 4XD5A 5JVLA 4Y9OA 4KIRA 1UA7A 2JGQA 1ESWA 3S0CA 5C7HA 2QUUA 3P0XA 3TAKA 3M43A 2W9MA 3QHNA 3VC5A 1ELSA 4ZE5A 2I56A 2FH8A 4WOQA 3APYA 1YXDA 3PJTA 3TN4A 1PZ2A 4JCMA 5F2LA 4M6UA 4YNGA 1O68A 2E67A 4QITA 2ZYFA 1UD6A 1QRQA 5FSEC 3EWCA 2WMKA 4HJWA 3LENA 1XLKA 2GYIA 4M7SA 5A2BA 1KM2A 3CQJA 3KBMA 1J6OA 4PULA 4UFKA 3LB0A 1M7PA 2EQDA 2BHYA 3AJ7A 1Q4NX 3NL6A 3GZ3A 4NHVA 2QMJA 4IFKB 4OOUA 5CC5A 2XWDA 3SCRA 2OYMA 1YRRA 3SW6A 1X39A 3PPCA 4F0LA 3SUWA 4Q4QA 2YB4A 3QTGA 4PRWA 1K77A 1B2YA 2QDEA 3CM4A 1W3JA 3TFXA 2JE8A 1S2TA 4FOJA 4JN7A 4GQGA 3TZFA 1FXQA 4HSHA 3QMRA 1NARA 1TR9A 5I3GA 3K30A 3OGVA 2VL4A 1L2QA 1UCWA 2DY3A 5HQEA 3KBNA 1EO7A 3CUHA 4WDTA 3MDUA 4QLLA 1UROA 2WNQA 1GQJA 1K9DA 3WF3A 1PV8A 3N18A 1OFRA 3TCEA 1D2KA 2FTPA 2E09A 2C3ZA 3KHDA 5KMYA 1KCZA 3EWZA 3TWBA 1JPIA 3RG6A 3GR8A 1ONEA 3EOOA 2EGZA 2AL2B 4EWJA 4IPJA 2A3EA 1IZJA 3TJLA 4BF7A 4GPNA 5EL1A 4DJEA 1OCQA 4J2MA 3W25A 1H50A 2J62A 2D2OA 3MMUA 2GGHA 3FS2A 1TTJA 2ZUNA 1H60A 5BOEA 2J7FA 2PMQA 5AECA 5I5RA 3C2FA 3G2GA 4QSFA 3WK2A 1EWDA 2Z1VA 2CZDA 2ZX5A 1BWLA 3E74A 5CSSA 2O4QA 2VRKA 1UB3A 4H7ZA 3KBSA 3TYDA 3N4AA 1JFHA 1OFBA 2A3HA 3FIGA 4MNLA 2V67A 2Y63A 4RX0A 4H8HA 4X61A 4BQ2A 1IF2A 4X63A 3GG0A 4HK5A 2WMIB 1QNPA 2ZZ6A 1RBOB 3GRIA 4ADUA 4GJJA 2C0AA 2IKHA 1H5YA 1OADA 3CS2A 1VCGA 2X42A 2D1ZA 1WAWA 2NX9A 3SCTA 1MW2A 3S1UA 2E8ZA 2OFJA 3AHYA 1S1RA 2VVSA 5I02A 1YDOA 3C2RA 5RUBA 5F1UA 1AQHA 4PMYA 1FCVA 4RK8A 3LXAA 3GAYA 4YVXA 1H7XA 1GYLA 3I6RA 4JHMA 3UFYA 1ISWA 5B7YA 1A5LC 2P0OA 1CENA 2CU0A 1KM0A 3ALGA 2G5WA 2VEGA 1GNXA 2X2GA 2G3NA 1V3MA 3AIEA 3BW2A 2PP1A 2C7FA 4LBSA 1L8PA 3SCSA 3H12A 5E6ZA 4XKMA 4UOQA 3N4FA 4W9TA 4PMVA 3WLOA 1NEYA 5BXSA 1DOSA 1IR1A 4UMCA 4IWWA 2HPIA 3M7WA 3FK4A 1GOIA 1OF6A 3THCA 3OJGA 2G97A 3H2AA 5J5DA 3SY8A 1M3UA 1BG9A 4L9ZA 4LEFA 1BKHA 3IJ8A 1OX5A 1UUOA 4UZUA 2V5KA 1VGAA 2FYMA 1L8NA 4MHBA 3VCNA 4DZ5A 2DVUA 5LSMA 3G1YA 3WQFA 3IV3A 3W2KA 3RAOA 1OC6A 1HKVA 3WJWA 4MM1A 3W2NA 2AL1A 3O63A 4U31A 5C9XA 3EWUA 3IS4A 2HXUA 3JZEA 5D2XA 2WC3A 2Z29A 3RIKA 2ZX6A 2PRMA 3MV01 3RCMA 1JPDX 2QCFA 3R11A 4HQVA 2YFNA 2A7PA 1Q6RA 4H9UA 2OB3A 3FDGA 2NXIA 4DJFA 4MGGA 1KD0A 3QHMA 3K8LA 4ASTA 3NQMA 1WBHA 3N3TA 3P2VA 1OQFA 2ICSA 1CBGA 6PTDA 2EJAA 3GFXA 1UD3A 4B5NA 4AD5A 2W6RA 3IJLA 4DEFA 4P7RA 3GXNA 2QYGA 3S42A 3DYOA 3S9ZA 2DJLA 3HA1A 4C6LA 3W2LA 3UPMA 3M0MA 2DP3A 3NVTA 2OPJA 3LXBA 1PX8A 3MSGA 4WJXA 2A3CA 4UTKA 2H8XA 4AG0A 2FFIA 3VX1A 3MSDA 2F2KA 1UG6A 3SUSA 3PJXA 6ENLA 4H6EA 5D8WA 5LA0A 4LAKA 3ECQA 3TOYA 3PY2A 3MCNA 1I6NA 2X7WA 3HTWA 2CLOA 5HDRA 1TV8A 3RR4A 2BSLA 1VJZA 4AY1A 5I2UA 3MPGA 3NYDA 1SFTA 1TZZA 4HSOA 3U4FA 2X1RA 4L6OA 1VYRA 1AH3A 4YTQA 4W8AA 3RPDA 4XIAA 1KTBA 4B5TA 3PZGA 3B8DA 2GQAA 3PBMA 4PMZA 1CGVA 3DFPA 1ZFJA 3G6MA 4JL1A 3V1HA 1E51A 4OZOA 3IACA 3LPPA 8RUCA 1CIUA 3FV9A 1CI1A 1UKPA 4FEZA 4DF2A 3FFSA 3OOQA 1IZCA 3TCSA 3VXGA 1G7UA 4PMNA 3Q2DA 1MNZA 1BVNP 3UJEA 4JOMA 1PE1A 4GYFA 4PZVA 3GHSA 3KRBA 4OKDA 1UYQA 1HO1A 2YA1A 5FJPA 2BXVA 3RM4A 1ONXA 5LNWA 1N2VA 2WCSA 1K8CA 5EFFA 1E4NA 1A5UA 4DF0A 4JQ4A 2EJ1A 3WO8A 1FWJC 1TV7A 1I8JA 3A12A 2YW4A 3WEMA 1TWSA 4PR4A 1GJUA 4BWLA 3P82A 3GVVA 4IMDA 1ZB5A 1JCYA 5REQB 2A3AA 1N82A 3TJXA 1IT0A 2X16A 1GVRA 1TTPA 3VGFA 3E96A 4E3TA 4FLSA 5I3KA 1R86A 2J7HA 1Y5XA 2VCAA 1F74A 4LY8A 1NSJA 2FHBA 3QM3A 3T6CA 4RPQA 3ZYZA 1HTIA 3S5ZA 2A5HA 3VKBA 4KEVA 3EA3A 1BG4A 2R82A 4UTHA 4OU1A 2GSJA 3ITYA 5F7UA 2WZEA 2GDVA 2QCLA 2PF0A 4UTTC 4N7QA 2Q02A 3F5LA 3RO6A 3GXIA 5C9UA 4HA4A 1DWHM 1UWRA 3V35A 2IUZA 4WX2A 4JBRA 5IDZA 3IVTA 2J74A 3ATZA 2C1GA 3AU2A 4IPIA 2ZWZA 4AUBA 1JG9A 1ZHAA 1IXOA 3ZS4A 1RD5A 2G41A 3WBXA 1DTNA 3CTLA 4NXKA 2GWNA 3ARYA 2P8BA 3ATYA 4OFCA 3RLUA 3LCIA 3T0DA 2WBKA 1J0YA 2CKRA 3G1DA 2DORA 2YZ5A 3LBCA 2UY2A 2PDCA 4WUIA 4EVZA 1WKFA 5G2HA 5DXXA 2ZUUA 1LG1A 1HKMA 4YMZA 3C6CA 3PZQA 1UUQA 1S39A 4TMCA 3AS2A 3REQB 2J66A 1L6GA 3S46A 1B30A 2J6VA 1PKNA 3OG3A 3T0TA 3OTRA 4L9XA 1UZHA 1J5TA 2WHJA 4L80A 3XINA 4JQAA 3CWOX 3ZR4A 5DFAA 4DO5A 4HD5A 2RDWA 3S2CA 3CZJA 2BBFA 1I2PA 3IK2A 4G1KA 2V0TA 4QNEA 1LP6A 3WD0A 5DT7A 2EG8A 4O1BA 1R87A 4LJ3A 4C6DA 4C6CA 3IV8A 1UMLA 3DIPA 3AU6A 3WF1A 5LNSA 3BJTA 3TKFA 1JXJA 3SRDA 3R13A 3S1WA 3BLIA 1P6CA 3V0SA 3PM6A 2OMAA 5HBFA 1XYAA 3AUJA 3WUFA 3DDMA 1Z69A 2GJLA 4K6AA 3IIXA 4KRUA 4QEHA 1SJDA 5HUOA 2ZADA 3UQNA 1PKMA 2XINA 3QV7A 1BWKA 4JDYA 3M1ZA 4J7RA 3ZSTA 4W85A 4LEQA 3D47A 3WENA 1B3XA 4HN8A 3R25A 5LZLA 3G0XA 3HQPA 2RGMA 3VGGA 5IFTA 4OV4A 3ZJ8A 3H2CA 1W5MA 3M0XA 5I0DA 2YCLB 3USBA 4Z1BA 2WMGA 1R2TA 4JFTA 5U7SA 2HQAA 9XIAA 3THQA 2ACRA 3LN3A 1KA9F 1UOZA 3EZ4A 4OBSA 1MI3A 4IISA 4HU8A 1UQYA 3BAJA 3B3DA 3RGTA 1BYDA 3KDOA 4J28A 4O52A 3U5UA 4M80A 1KFLA 4TO8A 3S6OA 1J9YA 3W22A 1SM9A 3EDJA 4Z08A 2PD9A 4UOJA 3H7VA 1BYAA 3NL5A 1W37A 1V93A 1J96A 2BGQA 3GVWA 1TJ2A 1HKWA 3W1UA 1P7TA 3HG5A 1AUSL 3I65A 3CK5A 4XSLA 5HULA 3E0LA 1H1ZA 1PS9A 5FIPA 2EEXA 4PRTA 2PTWA 3NEHA 3UXDA 4FK9A 1HKJA 2FPYA 1BTCA 1ECEA 5FEZA 1BD0A 3WD4A 2NT1A 2C16A 3MWCA 5HK4A 1R7OA 3T42A 1RSCA 1TB3A 5A95A 1WZLA 1NH6A 3MT1A 4W86A 1RJPA 1IIHA 4MYXA 1R46A 1GVQA 5M3WA 4QJ5B 4N6FA 3VFCA 4NJHA 3AXKA 5K2ZA 1KBBA 1XG3A 5C55A 3M6YA 4GINA 1XW8A 3VDBA 2WO5A 4HMNA 2HE5A 4DUXA 2Q09A 3TDFA 4GGBA 4PUWA 2WMFA 4CU8A 3PBUA 3A3WA 2P8CA 2OWCA 4RV3A 3OA3A 1XWYA 3QZEA 3H21A 2PDQA 2BASA 1IV8A 5A1AA 1WBJA 3VINA 4Y9PA 1XLDA 4JTFA 1V0LA 1QVBA 3DHUA 2QJIA 1POJA 2VQUA 3W7KA 3KFTA 2AAMA 1GZ1A 3G5EA 4UFJA 3P6LA 1OABA 3T2OA 3KVKA 3TSDA 5BZAA 6TAAA 4PC8A 1ICPA 3A47A 2RDTA 2W62A 2CPUA 4LUIA 3LRKA 2A0NA 4W8LA 1FWCC 3R8RA 4GYPA 1FHLA 4P5UA 1KNWA 4OE7A 3C56A 4LUSB 1JDEA 3K4DA 3I7RA 4MYAA 2O7QA 2ZX9A 5AC7A 1KXVA 3MUXA 2Y6ZA 3ARZA 2A2IA 3M0LA 2ISFA 3EEGA 1TQJA 4DZAA 2VGBA 5FACA 4XX6A 4E0CA 4UQDA 3RMEA 4O18A 3EB4A 1ENUA 4MJZA 2BDQA 4DPQA 4EAYA 4HMDA 1NDYA 3TWAA 4C6QA 4F9DA 2O4MA 4PTVA 1LT7A 2ZQ0A 4PL2A 1SZFA 2R24A 3IIVA 1WDQA 4HMCA 2BHZA 2BV9A 1OFDA 4UTWC 1PTAA 3AROA 5CJMA 4MB1A 1FFQA 3ITCA 5BCAA 5AHLA 4AYGA 2EPOA 3WBAA 1BEUA 4GI4A 3QVQA 3INPA 3ITXA 3AWNA 2GJXA 2A3LA 1IXNA 4FXJA 1CXKA 2WSRA 4GZ7A 4HNVA 3NNTA 5DBTA 4GUFA 4AB4A 1B4EA 1QXLA 4DYKA 3DBNA 4S3BA 2YCJA 1QW7A 1QI2A 1WA3A 2Y70A 1UR2A 3CAQA 3ITVA 1VQTA 2VO5A 3QZAA 3VDHA 5FI8A 3OBKA 4Q7BA 4E5TA 3SEPA 1DJWA 2X0YA 8A3HA 2NT0A 3BAKA 1OK4A 4ICCX 2FZ8A 5C0QA 3JR2A 1SZGA 1E6PA 3LBOA 2QEZA 1S2UA 3FVDA 1P5BA 1ADSA 1ITQA 1WP6A 1WCGA 3BC9A 4M19A 3SZ8A 3AFBA 2ZE0A 3LCFA 1OT2A 2Y24A 1IEWA 4RNIA 5DBUA 1ZJAA 1CXEA 2PP0A 4XV0A 5CZTA 3WLPA 3NQVA 3ZSSA 3LHZA 4JYFA 1EZ2A 5HR7A 1YBQA 2J7CA 1EJXC 4TTUA 1YE4A 4YTRA 4NJJA 1NFPA 1VH7A 2QGYA 3T4CA 3UG3A 1I2RA 4E8CA 2RH9A 2BMBA 3W7IA 2HROA 4UNKA 2J13A 2NUXA 2XDFA 3EPNA 3G0UA 1GQIA 2J8FA 4XTIA 3NFUA 3I6EA 3M9YA 4HGXA 1R3VA 4JNYA 1A5OC 2PDJA 1RQHA 3KCOA 1Q63A 3CUZA 1JF5A 1WDPA 4AIEA 4JTDA 3NTYA 1LUCA 3R5EA 2YR1A 2GL5A 4L1GA 4PB3A 2WZIA 4U33A 1MUWA 5AHEA 2WMJA 4O53A 4ADSA 5HR6A 2PCEA 3N1AA 1EH9A 3N12A 3GWQA 3VD5A 4O28A 5CC7A 3A5VA 4Q8MA 3W27A 4CU6A 4I5UA 1F7BA 3NZ1A 5HPOA 4ZQPA 1J79A 3UW6A 1QR7A 3CAWA 3NCOA 1UUMA 1ZP4A 1P4CA 2J8GA 1P1XA 1VBHA 1C8YA 3B06A 2WKJA 1FWEC 2AQOA 2YL9A 4RDYA 2QCHA 2WM1A 1Z44A 2WLZA 2OXNA 4FNTA 3ZJ6A 3U2EA 3CIWA 5EGRA 1MSSA 4Y9MA 4HBKA 3W2UA 8CGTA 1HG3A 2Y7FA 4V28A 4O1EA 4PBFA 5DRIA 2QULA 5H91A 3TJIA 1XLAA 3SRKA 2AKMA 3FHAA 3LHWA 1FWRA 1XS2A 3XIMA 4FOUA 2F6KA 2HCVA 4UTTA 3K2GA 4ATLA 3O15A 3URQA 4WKHA 4R7JA 1ISYA 3BLEA 4HPNA 5CCZA 3GO2A 4E4UA 4GGHA 1QBAA 3BAIA 3CPRA 2WZHA 1X98A 5HWJA 4NAEB 3BG5A 4IIFA 1SVDA 2WLYA 5TNVA 3S1VA 3SQSA 1YE6A 4ZVJA 4YXGA 4XUGA 1TV2A 4ZZ9A 2INZA 5BRQA 4GA8A 1TPDA 5K9CA 1HXJA 2PEVA 1UP2A 1E3ZA 3H2MA 2Z0IA 1GPFA 4J5NA 4QDPA 1Z41A 2OVLA 1DJGA 1KBLA 4LS2A 4L4MA 1FCQA 4QS5A 3W82A 3VKDA 1XXXA 1JZ6A 2PDHA 4U28A 1OJXA 4Z2JA 3OA5A 5D9NA 3PUGA 5K9DA 3RRXA 1XYFA 3P61A 4RW5A 3T0AA 1D3CA 2CZ5A 3GAKA 4IJCA 3C2EA 3RO8A 4XVEA 1XLLA 3PSVA 3LPGA 1XLFA 3VD3A 2OT0A 1NQ6A 1Q3NA 5AY7A 3A3XA 2O0TA 3ZVHB 1L6WA 1PB0A 3EMZA 3TYZA 1KM1A 4S38A 3A9IA 1LROA 4TUFA 2VC6A 3LM7A 4J4KA 3W76A 4F3HA 1JDFA 3VD7A 1AMKA 1EBGA 1O60A 3UY8A 5LIKX 2WJFA 3OVRA 4AZ6A 1BXBA 4KIEA 3E49A 1YPXA 1VP5A 2V63A 1JNEA 3QXBA 3ZLHA 4BQ5A 2VR2A 3VX0A 2W3ZA 3HV8A 4LYKA 4D71A 4Z2KA 1FWDC 1RP8A 3W83A 5KITA 1G4EA 4MAZA 3IUIA 4B9YA 4LYRA 1F9CA 3DG6A 4DPPA 4IJRA 1VR6A 4NNCA 3U2CA 2YGYA 4O0KA 2F6XA 4FX7A 4K3ZA 4RDZA 1V77A 3DI1A 4RE2A 1ONRA 2ONEA 3JS3A 3W1TA 3UERA 5A6KA 4JIQA 3VOGA 4J3ZA 4XSMA 3OBAA 4CNOA 2XJ7A 1NDVA 1TPWA 3L5AA 2OKTA 1W32A 3MHGA 3W71A 1C9WA 2CZFA 3ID7A 4LBUA 1R9YA 5MKGA 4F2BA 2PP3A 2BY3A 4B4HA 3MBFA 4P8XA 4PFHA 1KQYA 2VC7A 3CUFA 1FWHC 4AZBA 4D6JA 3NQAA 2GVLA 2WSPA 1E1CA 2WNWA 3LCWA 4EXQA 1PDYA 3H24A 3LHTA 2GUYA 1Q6CA 3TYAA 4EPKA 2WBGA 2NSXA 1FDZA 4DWDA 5LIXX 1AK5A 4JZ5A 5ABFB 2E3ZA 3GG8A 3G22A 4JTQA 1R3YA 1KFCA 2KZHA 4ZXLA 3HURA 3S4TA 3N29A 2NUYA 1Q7QA 2XIJA 4IUGA 1A4LA 2CHNA 3T09A 2NV2A 2V30A 3VCRA 5XIAA 4LY4A 2ABAA 3BMVA 2BGNE 3CYVA 1FHDA 1HL8A 3NDYA 3RU6A 1QI5A 4KGJA 3W9ZA 1E4LA 5I3IA 3CL6A 4I9AA 5DMYA 4Q6XA 1VFSA 4GXPA 2P76A 3NSMA 3V3WA 1KXQA 5I79A 3M0KA 3MJMA 4AU0A 3GR4A 1LF1A 1VEPA 4I90A 2QKFA 3WNKA 2XU2A 4A6GA 3UR5A 2GSEA 4QDWA 2VFIA 2IPWA 4DBSA 4IQEA 4NXSA 4LS0A 4E8GA 1RVGA 1LT8A 1GJWA 3JVAA 3R4IA 3W1XA 2E7FA 4CU7A 3QQWA 1K7XA 1CCWB 3THAA 3VGEA 2ZIDA 3KBVA 3GYCA 1HO4A 4FLRA 3CYJA 2ZRYA 1H7OA 4MY9A 4TIMA 4D6IA 3ABZA 4I8YA 5CPMA 4UTFA 4CKQA 1HVQA 4E38A 4US5A 3T05A 1FXPA 2BTMA 1OEPA 4AD3A 1WNOA 3A3HA 3DFTA 3GU1A 1U1JA 2OGJA 2VD9A 4YLWA 3LXCA 2YDSA 3VNKA 3VVGA 4KWUA 4ECLA 3DEQA 3G3DA 2PGWA 3L4ZA 3TAOA 4ZQMA 4HK6A 3AS1A 2PCQA 3TFCA 3CZKA 3NR0A 3CV7A 4U2YA 2WHKA 3G1VA 4O16A 4NNAA 3PC0A 4ACZA 1D3HA 3UZYA 7TAAA 5IBXC 3A6OA 3LM3A 5B7ZA 1OD8A 3FGCB 2B7PA 5T26A 2W27A 1O1ZA 1WOAA 3CQIA 3CZGA 5K9XA 3BURA 4GYJA 1UD8A 1TA3A 3S5YA 3IRDA 4GH3A 2CBJA 1XYMA 3MJYA 4PRRA 1GVEA 1I1WA 1KKOA 1QHOA 4Z1YA 2ZX8A 1T8QA 4HHLA 4UTWA 1AJ0A 4WKFA 3NQ2A 1W1YA 5DLCA 1SR0A 2PLKA 4P7OA 1LL7A 1G7VA 1UR4A 3VM7A 2WV8A 1YDYA 4R85A 1Z9AA 4H6KA 5AHNA 2V9DA 4JIPA 1XHGA 4G2DA 1W31A 3VO0A 4C60A 3O6CA 4UR7A 1QOXA 1UZ1A 2IXVA 1NELA 1D7FA 5CAHA 5EPDA 4IG2A 4AZCA 2XISA 4IIDA 3WDIA 3WD3A 4UBPC 2D0FA 3CJPA 1R3QA 2IMRA 1K8YA 2VZTA 1O94A 4AD2A 2XPKA 3NG3A 2Y8VA 1A5CA 5BRPA 4RV8A 3DX5A 1W9XA 4OV9A 3TTEA 3WN6A 3FKRA 5E1QA 3WQDA 3KTXA 4LV4A 1D7KA 1ZTVA 4LAUA 3WQPA 2P5NA 2R9RA 3VKKA 5G4WA 2DIEA 3TONA 2ZVRA 3CWHA 3N2CA 2QJMA 4HOZA 2VI0A 3FCPA 3EX2A 1QUMA 2DZVA 2V2CA 1W2PA 1PDZA 2PTZA 3VE7A 4Z2IA 4YHEA 3KL5A 3PAOA 1C91A 2V5LA 3WUEA 4LANA 3UPWA 3H23A 1TTIA 6REQA 3RX4A 3MKCA 4BY3A 4Y9AA 5FAJA 4G6CA 1US2A 2DFAA 4MDOA 2NXGA 1XV8A 3WDQA 3IEBA 3DC8A 1L6YA 3FEQA 5KETA 4WD0A 3VOFA 2OX1A 2V81A 1YIXA 1FH7A 3UVAA 3LG3A 3NDOA 2DQXA 2QPUA 2XVGA 5XIMA 2WCGA 3ANVA 4AIBA 4QE5A 5E5CA 3PUOA 3U0HA 3LQLA 1AJ2A 1R3WA 3HFYA 4HPXA 3TE9A 4ONVA 3HF3A 1IZKA 1Q6FA 4N9DA 1W1B1 4X2RA 2GWGA 1KV8A 4DELA 5TD4A 1KWGA 2E9BA 1R3TA 1SW0A 3ANYA 4B5XA 1ICSA 3QGAC 1MMFA 4LF1A 2JKPA 3FDKA 4Z2HA 2A3BA 1EYEA 4C90A 1K8XA 4RL3A 5C2XA 2VKZG 4ZQCA 4AIOA 1LWIA 3OLGA 1SGJA 1DTUA 4Q8NA 3A4WA 3V7PA 2V8ZA 4Q8WA 5C2CA 5CGTA 1SSDA 1KBJA 5FF0A 3P0WA 1FH9A 4ZCWA 4IFOA 4DJFD 3VNYA 2ZA1A 2GK1A 3EGJA 1ISVA 3L12A 3NVDA 1Y5VA 4GNVA 4RR4A 2CLFA 2VP8A 4ZL1A 1DHPA 4PUKA 1JCXA 3BCJA 3WBWA 2PU1A 1Q6LA 1LORA 3LUTA 5E6YA 2V2DA 3EX3A 1JFXA 3M0IA 3ZM8A 3TNBA 3TOPA 1XIIA 3OBEA 2QUMA 4W4QA 3KW3A 1DE6A 3SUVA 4WXZA 3VDCA 3SFWA 1FBAA 4LTSA 3PNZA 3F5JA 4LAOA 1TJ1A 5D09A 2FGBA 3W1LA 5EBAA 3UF9A 3W6YA 3LYEA 2OU4A 3HPZA 3PULA 3KEHA 2PWDA 3RITA 2E1WA 2O9PA 1EDQA 3W7MA 4Z0JA 1EUNA 1F3TA 4LB3A 3ABOA 4Z2LA 2NQHA 3GQYA 3LZ5A 1T40A 1DHKA 1E4IA 4LAMA 1TRDA 4IIHA 2BY2A 1Q8JA 5LIWX 3RFAA 4EXBA 1XFCA 1TCMA 1K3UA 3IANA 2XZ7A 5D2VA 5FA5A 5EMYA 4EP8C 2V5CA 1XQLA 4CQDA 5LGZA 3TIMA 3M47A 1EGVA 1OHLA 1VLWA 4JTIA 3WYZA 1NOFA 3Q65A 4L56A 3N13A 3QLLA 4KWWA 3THUA 6TIMA 3P84A 4QLJA 5FEPA 4CGTA 2WC7A 1VIZA 3M46A 1G4SA 5CBBA 4GRSA 3QFEA 5DT5A 1MW1A 3RCNA 3GKFA 3HQOA 4X9SA 4E4PA 4XB3A 5FF7A 1CZ1A 3VGBA 1ZL1A 5C6MA 2FZMA 2VEMA 4GIYA 2ZZ3A 3PSWA 5BXTA 1JCTA 3E0VA 3P93A 3S3GA 1FWNA 3ABQA 3EXSA 2YXGA 1AA1B 1AQFA 1U5JA 1XIJA 2ZUMA 3WL1A 4MF4A 4L4PA 1EJSC 4K7VA 2GGGA 1I2NA 2CLPA 4HZMA 1XDLA 3WNOA 5JH1A 4A2RA 2IPJA 1FKWA 2HEJA 2PFHA 1UIOA 4NSBA 1MYRA 4H4IA 4UTMA 2Z27A 4L1XA 3T08A 3QSRA 2XIOA 3I3BA 3LV6A 3P5YA 5D9MA 1F05A 3W86A 3HG2A 3KVLA 4W7UA 4H9YA 2NQ5A 4ZXOA 2VFGA 4IL0A 1VFHA 3UWYA 5EMLA 3E0WA 4F8XA 4UTUA 4D1IA 5D2WA 1T96A 3TTQA 4WXYA 2OODA 4GO9A 3N17A 3YPIA 3CUXA 3BVJA 4M6VA 1ZS2A 1XX1A 4QAIA 1F6PA 5CLTA 2NVDA 3VIJA 1X96A 3WEOA 4EF9A 4Z2GA 3WCZA 4PCPA 4QJ4B 1MO0A 1KRCC 4HIBA 2VQTA 5AYZA 1PO9A 2XN1A 3QGKC 1DJIA 4D1JA 2DZAA 2DH3A 3KOZA 1PBGA 3A4XA 3R0UA 1VPQA 3LNPA 3PHAA 2QPXA 3BQ6A 3RJXA 4AWUA 4RNJA 3M41A 3R58A 4EK7A 4LVGA 1R30A 3LV5A 3W00A 4E6MA 1VFFA 1XLEA 2NQ9A 4JFUA 5CKSA 4C1NA 4GY0A 3A4AA 1VD6A 4UUIA 1R8LA 3GW0A 1B3YA 2OEMA 4L4OA 2PDLA 3OP2A 1VBJA 3FHQA 3GFZA 3QYQA 5A3HA 4KW2A 4PTMA 3VOCA 2G3JA 3UJ2A 5G1TA 1PTDA 1CXHA 4RE4A 1Q13A 2HRWA 3FSUA 3LCXA 1IXPA 3RK8A 4D6DA 5E9XA 1HKIA 5EA9A 1W3KA 1VENA 4UTIA 4BFAA 3QFWA 3NQDA 3ELFA 2ZX7A 2W4XA 3WNNA 1RALA 1NOUA 3WF4A 7REQB 2ISWA 4YJ5A 2RFGA 3CU2A 4TVUA 2Y0FA 1JYVA 3AYSA 3VCCA 4PTWA 3W85A 5MF5A 3MZ2A 4U3AA 3VIHA 4WRHA 2LLEA 5IBXA 3E6EA 4IOTA 1JEZA 4N02A 1OIMA 3FJLA 1W3HA 3VD4A 2PAJA 1RP9A 5CPQA 1F73A 1IXQA 2FLIA 4JTSA 2DIKA 2GZXA 3PWGA 3IJQA 1J6PA 3M0HA 4XBSA 3SM0A 1JD9A 1NDWA 4B90A 5A8QA 4H6QA 3M5YA 4GK8A 1EA0A 1ODUA 2CLIA 3VD9A 2PPGA 1J2WA 1ZNNA 4QTGA 3SAZA 4CNTA 1J0ZA 4D6FA 2R6OA 2J8TA 3EXRA 3W53A 3KS5A 3UJSA 4G9PA 4IIGA 3WQEA 1Y7VA 4GX8A 2PI6A 4R9XA 4A35A 3W6MA 2O92A 1LRNA 1A49A 1TVPA 1P0BA 4YVPA 3I4KA 3AMKA 4O14A 1OX6A 1IWAA 3VIFA 4CUCA 3IWPA 1QI4A 1KM6A 3VPLA 3WNPA 4LRSA 4K37A 3QJAA 4KETA 1KFJA 1BFNA 2ZFAA 5H8MA 1TWWA 2EG6A 1H7WA 1WZMA 3WLMA 1RHCA 3R43A 3DYMA 4A22A 3WG6A 5CLWA 3I4EA 3KLKA 1Z42A 4JHZA 3VI2A 2H9AB 3W73A 2X8RA 4DXKA 1PYFA 3M4HA 4YWIA 4PBGA 4W84A 4LC8A 4JXCA 5I00A 1UJPA 2L5HA 1E1FA 1LOSA 3V75A 4D8AA 2FGZA 4RXFA 2G3MA 4JEJA 3DCPA 4AC7C 3WLRA 1PAMA 1W17A 4PEEA 3ARUA 3PAJA 3RLVA 3CO8A 4REQB 7ENLA 2FGLA 3W7GA 1YQ2A 1DV7A 1REQA 5DY3A 4ZSTA 3FKKA 1H4PA 1EEXA 3PJWA 1UZ4A 1HJSA 8TIMA 1W1PA 1W6TA 4RZ5A 2PBGA 2VWTA 3RUBL 1AL8A 4PUDA 1POKA 3QSTA 3RX3A 2ZXDA 5BNKA 1FX6A 1KRAC 4MMWA 1TYGA 1TO3A 4AYSA 3MCMA 5K7JA 2WPGA 1EXPA 4UNLA 3SJNA 2HNEA 1IQ8A 4LT9A 3CMFA 1KFBA 1SUXA 4GC4A 1UP0A 3TA6A 2YFOA 5A2CA 2Z24A 4PSPA 3BG3A 2XZ9A 2ISVA 5A6TC 1LBMA 3ALFA 4WSJA 5U4NA 4AC1X 1DQUA 1ZCCA 3VNIA 3WLLA 1X38A 3TW6A 2YOCA 1GEHA 1M01A 3GTFA 1GVYA 2VJXA 3DXIA 5CEWA 3GIYA 2NZLA 3CH0A 1O1HA 2VC5A 3PG8A 5AC4A 1WUEA 2XYLA 3EWWA 3SURA 4Q33A 2WHMA 1VYSX 2P0IA 4NYYA 4M6QA 4AHOA 2PDMA 1BQCA 2FQIA 4MNMA 3KCLA 2POZA 1Q8AA 2ISSA 1F6KA 3PNUA 1R9ZA 4EE9A 3H26A 5EY5A 4GUJA 2PUZA 1WOBA 1FWSA 3MMWA 2YSWA 4QEEA 2NVCA 3B0XA 3VKCA 3FJ6A 3A5FA 1DJXA 4S23A 4Y7EA 2VNCA 1XBXA 1EA9C 3AAMA 1FWWA 4ZODA 3UY7A 3MO4A 3GDTA 3BSGA 1H41A 5E0KA 5AHFA 1QOQA 2TMDA 3QC0A 3VTRA 4TXEA 4J3UA 5A8MA 4D8ZA 2FDMA 5A8PA 3PTQA 3CLMA 3AIWA 3SCNA 3ZMRA 2J79A 2X0HA 4IXXA 1FP8A 4NQ1A 2WC4A 4JDBA 1W8SA 2ATSA 1UR3M 3VMOA 1N7KA 4M7TA 4F40A 5FF3A 3GG1A 1Z6KA 4N9EA 2RJHA 2V3DA 3UYCA 3MUZ1 2GSHA 3B03A 5ECUA 4GFSA 3IAQA 3DGRA 1IWPA 4XVDA 3IIPA 1M04A 3LPOA 4ERGA 4LVFA 1L2UA 4FXFA 4WOZA 3T44A 4G56A 2G8ZA 1WZKA 3UJFA 3LMYA 3TU9A 3MHUA 4QAWA 2F38A 3AQUA 4JIEA 3HJEA 1J0IA 1S2CA 2FMNA 3W7EA 1PZ1A 1XCWA 3WMLA 2I9EA 2P1FA 4Z1DA 2EAWA 2WWDA 4YTTA 3TYUA 2HPMA 1R2SA 1A5KC 3KCJA 3V18A 1T6MA 3W7HA 1VPYA 2Y62A 3VC6A 5JBEA 2GJPA 1KW1A 1XICA 3L4VA 3OODA 1CLXA 5J5RA 1XKJA 3GG7A 5C9ZA 4GBDA 4UZSA 4US6A 4JX4A 4HK7A 2OZ3A 3DBPA 4DUWA 1WKYA 1Q2SA 2BB0A 1XYLA 1OZQA 1HP5A 2CFFA 1JULA 4AX7A 4QISA 3AIBA 2MUCA 2F9RA 4M81A 3VUSA 2KAUC 4KRZA 3V5FA 3BMWA 1A47A 2ZZ1A 1UR1A 2XTKA 3AC0A 3SY5A 4W7VA 3QC3A 1VHCA 6XIMA 3USZA 3BK0A 1I0BA 3R89A 3APTA 2FJUB 1TPB1 3C2YA 3UNDA 2E40A 1J01A 1NP2A 3W26A 4FAMA 2PF8A 3SUTA 2W67A 2V69A 2GGEA 4FPSA 1YTDA 1B1YA 2OWXA 1E0UA 3H55A 1LRQA 3AHTA 4Y8FA 3WLHA 4GH1A 3FOKA 3I10A 3EDDA 1VHNA 4Q8QA 2VOMA 1GTEA 4ILSA 4AFYA 2X0SA 2REQA 1GHRA 4YIWA 2IKGA 1C7SA 2WQDA 1KXTA 1LWHA 1LQ0A 1TR1A 4ERAA 2G3IA 4WDWA 3UA4A 3K8KA 2C91A 1PZ3A 3NZQA 1HJWA 3NURA 1VRDA 2PDYA 2WVVA 4JX5A 2PD5A 1N55A 5F1VA 2OO6A 3UJRA 1EGMA 4P8VA 1XYBA 3UR2A 4HVXA 5CBIA 3RILA 4KWSA 1RBLA 4ZO8A 5F2MA 3WLIA 1JGIA 3L66A 2OG9A 5C8BB 2PDUA 4A8IA 4Q8OA 4JQ2A 1J12A 4HNCA 1VEMA 4UQEA 4DJFC 3UT0A 2H6RA 4GY1A 1LLOA 2ZVIA 1RAKA 3B97A 5D05A 4JTRA 4V2XA 2QVNA 4MPQA 3U2ZA 1SYTA 3B8TA 1SPQA 5CGQA 1IR2A 1SO6A 3W1QA 3TZNA 1E56A 4ES4A 1JZ4A 2Z4GA 2ZC1A 3MMDA 3W1AA 2VZUA 5AN7A 5AVNA 3OEXA 2OWWA 2DSUA 1PIGA 4I5RA 4ICNA 3HGJA 4FSAA 3V0TA 3B40A 4S2CA 1CXFA 1NVMA 3W2MA 2NWRA 3HPFA 4UXDA 1TWZA 3PK7A 3GFYA 3AMLA 4PCNA 1BKSA 1PSCA 2CNCA 3DHPA 2EPMX 4BCEA 3W38A 4FNRA 3BO9A 3PF3A 2FVKA 4G7FA 3V5OA 3IRSA 1TUFA 4DYEA 1K7FA 1B3ZA 1OZMA 2VZOA 3H4XA 5XINA 2R1LA 1ITUA 1ZRQA 3WUBA 3LHUA 3DFNA 3NL3A 1QNRA 1CXLA 4JTCA 3W1MA 2JGYA 3KWSA 3LHYA 1JUEA 1NWRA 1OFEA 3P67A 1WX0A 2WVSA 1QPQA 2Z1WA 1Q6GA 3N04A 1LLWA 1K9TA 4IGSA 1AL7A 2PC4A 3WLSA 3DGBA 4PMQA 1YPIA 3T9PA 3FA3A 3TQKA 3UGRA 5AC8A 2QIIA 2XGIA 4IT1A 3GBEA 4KEMA 4DNHA 4Y9NA 4E2BA 4DLMA 3KTSA 4Q4SA 1A0EA 4H8VA 3N25A 1XLIA 2JF6A 1W9VA 3L4UA 1ZZMA 4MJ4A 2ZCGA 4CN6A 2OOFA 2NW0A 3IK4A 2RDXA 1KM5A 5HOSA 2UV8G 4BWLC 1QDSA 3FY1A 3TTOA 5I07A 3ZJKA 1VBGA 1M7XA 2VHLA 5I3DA 1FRBA 1B4KA 4JFVA 2QCDA 5BXRA 1XD1A 3WLKX 1CGWA 2CESA 4I8DA 3JZUA 1T7LA 4QHRA 3S47A 1K1DA 1FTXA 3C2OA 2BLEA 4CN1A 1VB9A 4WGHA 2PDGA 1N8IA 4R9OA 3T4WA 4MADA 3STPA 1PUDA 4DNMA 4FF5A 1JCJA 3CUGA 1CLKA 4GVFA 1DP0A 4QE1A 4GZEA 3SCUA 4WVXA 3GE7A 2YXOA 4C6KA 4HOXA 5EMUA 3GH7A 1G4TA 4M29A 4X2PA 3LZ3A 1R3SA 1QPRA 2IKJA 1I4NA 2D2HA 3LTYA 3TXVA 3L2MA 1X6NA 4MIMA 3PP7A 2XGZA 3STCA 2Y5SA 1XDJA 2EO7A 3P8JA 2W0UA 2O9RA 1W1ZA 1NM9A 4DXXA 4GY7A 3DI0A 3NM3A 4MKSA 4KH2A 4CD5A 4W87A 4AZGA 3H8AA 4GWEA 2J6XA 2OO0A 1R85A 4HCDA 3MHFA 2JEQA 3PBWA 3G18A 1VFMA 3IGUA 1YNYA 3S2LA 3WDPP 9CGTA 3DFHA 3EDEA 5C70A 1H5VA 4BI5A 4X0VA 2QV4A 4L1WA 4TR9A 4XD3A 3TR9A 1FWGC 3WQGA 4PCSA 1EUAA 2NV1A 1XYCA 3I7SA 2ACUA 1XIFA 3LK6A 4WDUA 3WQWA 2X1TA 5DXYA 1JDDA 1FWAC 3FEMA 2ZICA 5H8UA 1QW9A 1SU5A 7PTDA 1A50A 2FDSA 5JIPA 2QJHA 4LOCA 2WHLA 1V6WA 1T5AA 3EWDA 3UWVA 3WDJA 3L7RA 1CW2A 1V4YA 4U2ZA 4O15A 5BOFA 3N14A 2B81A 4GVHA 1GVFA 1DIKA 3B4UA 3KTCA 4O10A 3VA8A 2OX4A 4PH6A 5E0CA 1JDCA 1YTEA 4NAFB 4KEUA 4LF2A 1EIXA 1RH9A 4PMOA 1DORA 3B9NA 3W81A 3W87A 3MSYA 4O54A 1MXDA 1TWDA 5GJPA 1ZU8A 2XIQA 1M7JA 1OFPA 3EA2A 3WQCA 3ISIX 7TIMA 2I5QA 4ZMGA 4B5WA 3D6NA 4F66A 2F7FA 1IT8A 1EYWA 5EMMA 4W89A 3S8HA 4CD6A 4NVTA 4QROA 1EX5A 3UBPC 3PVFA 4LALA 4HMEA 1R5YA 4B15A 1V6TA 1YKWA 2QDGA 3G24A 4HA1A 2VDGA 1EB3A 3CASA 1Q6QA 4BS0A 3WDHA 2DIJA 3GH5A 3ARSA 3DESA 2Y7DA 1RCXB 4A3YA 2WK2A 3LX9A 5AC5A 4G7EA 3ME3A 3VZYA 1UA3A 2PTYA 1LBFA 3K4WA 4KERA 2DVXA 4M56A 1K03A 3PJUA 5EMJA 1LL6A 3KRZA 5F4SA 4FLQA 2HBVA 4DO7A 2W63A 2PLCA 1G94A 1XIBA 2BFGA 1KFEA 1D8CA 2UWFA 3MYPA 4IIEA 2C6QA 3KS6A 4ERIA 1NDZA 1C8XA 2HZGA 3EOLA 3CBWA 4HKPA 1Z7AA 3VNDA 2PWFA 2G4FA 2YBTA 1U1UA 4ADTA 3IJ6A 2PRHA 2YDRA 3GZAA 3JRKA 4ORMA 4LSBA 3NDZA 1QPNA 1SFLA 1VFUA 5IHSA 1PCWA 3N2BA 4RDVA 1GYNA 3AS0A 5D9OA 2J4GA 5G4HC 1KGUA 4KRTA 3UZZA 4DO4A 1CYGA 1O95A 4EX4A 5DO8A 5DMMA 4AD0A 1IIGA 2AKZA 4AEOA 5A6AA 4IMAA 2ZRUA 1PWLA 4WJ8A 3W4RA 5M17A 5EB8A 1V6VA 4H6RA 2KX9A 4N9CA 2OQLA 1VJSA 2PRLA 2XVLA 3ZT6A 1K7EA 2ZUTA 3VMNA 4O17A 1ZJBA 3KZSA 5AFDA 2B7NA 2VX7A 3MP4A 4WK9A 4PUUA 1HL2A 2YDQA 3TN6A 1FFRA 1GG1A 1U33A 1W3TA 2YZRA 3B9DA 3VM5A 5HUPA 4TX9A 3KOWA 3BQ5A 3KVJA 1U30A 2J27A 2VR4A 3LI1A 1F07A 4Q8UA 2F84A 4AY8A 4XK2A 4GOAA 2TPSA 3AHZA 1XLCA 4IQJA 2BS9A 5T9BG 4RUBA 1JCLA 4LBRA 4WR3A 1J2BA 1O5XA 3SFKA 4IFKA 4NP7A 3T0CA 1CB7B 3N2OA 3B0YA 2GDQA 2CBUA 4F48A 1Q65A 1FWIC 4AVFA 3R10A 1J10A 2VFFA 4GYPC 2PODA 4GI6A 3E0IA 4GJ1A 5EMKA 4AQLA 3DUGA 1DIOA 4FX6M 4H7VA 1JPMA 2DQWA 4S3JA 4KFPA 4LH8A 1JVNA 3BLOA 2GVYA 1UH4A 3SBFA 2ZRVA 1AFSA 1BRLA 2QCGA 1SFJA 3CT2A 4AD1A 3CMGA 3S83A 1CNVA 2XH7A 3D46A 1ONWA 4A3RA 2PZ0A 1M5WA 4DYJA 1H09A 4AEEA 3EMCA 2OT1A 2NQLA 4CCZA 1KTCA 5CAKA 3N2MA 3LCLA 4DHGA 1TVNA 2AL2A 4MWAE 2DSKA 4J3WA 3UCCA 4ZO6A 1M1BA 4A4AA 2XH4A 5C5YA 1CXIA 5AVHA 4UFHA 4W7WA 5CZSA 5HQLA 4U5KA 4YWSA 1JPKA 3BJFA 1MNSA 3IVUA 3EBVA 4CN4A 1ZP3A 4YTSA 3PS7A 4IL2A 2E5CA 2PZNA 3UZJA 2BWGA 2HK0A 4E3VA 4OT7A 1X1OA 1W1VA 1TTQA 1XH1A 4I7UA 1KTNA 1XIMA 3W1RA 3BAWA 5H2ZA 4FA3A 3UWQA 2XIIA 4QM1A 2EBNA 2PLJA 4D72A 3N9RA 3GIQA 4QXIA 3GR7A 1QNVA 1YXYA 4W93A 5FCZA 2WMIA 3WQ5A 3EB2A 3RPMA 1L9WA 4G5DA 2TAAA 4PTXA 3N4EA 4MB5A 3W3OA 2FFCA 4WEVX 1A0CA 4QG8A 2J47A 4PCTA 4IZGA 5CPTA 5D37A 3ZIZA 3WH9A 1GTHA 3GH4A 3GXDA 2YDAA 4J3TA 2H8ZA 4I5XA 2X2YA 4V33A 1V3JA 3GNOA 1GG0A 2PURA 3AHVA 3ZLGA 4ALDA 4K38A 3KRSA 3SADA 1MQRA 1Z48A 2ADAA 1OM0A 2P3EA 1FWFC 4LNYA 2Y5EA 3AIVA 3MI2A 2PS2A 3RDKA 5JU6A 5D8ZA 5I03A 2OLAA 1P0NA 2Z2AA 3S9IA 5C2GA 1SSGA 4C6BA 2CZVA 3CEPA 1LL4A 3WD1A 4XZHA 1Q7ZA 3QY7A 1QT1A 5L6UA 2IPGA 4Z42C 3KP0A 5DN1A 4BF5A 4UCFA 3NZGA 3WX7A 5I06A 3CB8A 3BJSA 3WJXA 5BXPA 4N4PA 4EANA 4FZIA 4EACA 3WF2A 4K8EA 4R3UA 1E1EA 5I3JA 4ZQRA 1H7PA 2J77A 4YU1A 2ZWYA 4NILA 4P8WA 3T78A 2A1YA 1W1TA 4LWWA 3EX1A 4Z1CA 4MB4A 3R1ZA 1PHQA 4GISA 5A2AA 1TUXA 3JU2A 1S1PA 3Q67A 2IW0A 3QKZA 1PJ9A 5BYWA 3LRMA 4HHMA 1KO0A 1QWKA 4ORIA 1S5TA 4R33A 2A6LA 3HIJA 3QOKA 3R7MA 1OVDA 4B2DD 2R1PA 1HF6A 3OG2A 1HVXA 1CEOA 3LSCA 2OKOA 1W8GA 3XISA 4DQWA 4GQQA 3W29A 3S6DA 3QYSA 4RPPA 3C0LA 2DZXA 2HE8A 3WLNA 3F4CA 1KCLA 1DQXA 3LERA 2FJKA 4AH7A 1W9DM 2J9ZA 2QCEA 3GXMA 5IOBA 3ZR6A 1R38A 4XISA 3B9EA 4LV9A 3NGJA 2PDFA 1V5XA 1UR8A 1IGWA 3R0DA 4N2YA 4QBXA 3TV8A 5ABEA 1L0PA 3T81A 2YA0A 2P88A 1JRBA 2INFA 3GD6A 3AMDA 2QS8A 3SI9A 3TQPA 4JTGA 2E9MA 3TMLA 2GGIA 1FOBA 3U7BA 1QMLA 2QF8A 4MFDA 2UZ9A 2OLSA 3QPYA 1W56A 3N2TA 4NRRA 4E2VA 2WJEA 1GKQA 3K13A 1VRXA 4DBEA 2IQ0A 3V36A 1QK2A 1V3LA 3EWBX 5EFDA 3IUHA 1MW0A 1NFGA 4GHRA 4ZSUA 2MANA 3ARRA 4A3UA 3GTNA 4CQCA 2QJNA 3WZ0E 5M1TA 1OINA 1KCXA 4QJ1A 1WXJA 3PTKA 5FJJA 2JK2A 3NEVA 4FNUA 1IGSA 4DBWA 2XHYA 1M9HA 3BGGA 1W5OA 1A3WA 3ZT7A 2PC8A 2XVNA 3W37A 1V0NA 1BTMA 3UP8A 4HTYA 4LU0A 1PEZA 3LCHA 4L9YA 4ZR8A 3H54A 3V0UA 1EWEA 5DCBA 3AUOA 1F4AA 1SZRA 4H9MA