3QR9A

Anthranilate phosphoribosyltransferase (trpd) from mycobacterium tuberculosis (apo structure)
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
347
structure length
347
Chain Sequence
b'PSWPQILGRLTDNRDLARGQAAWAMDQIMTGNARPAQIAAFAVAMTMKAPTADEVGELAGVMLSHAHPLPADTVPDDAVDVVGTGGDGVNTVNLSTMAAIVVAAAGVPVVKHGNRAASSLSGGADTLEALGVRIDLGPDLVARSLAEVGIGFCFAPRFHPSYRHAAAVRREIGVPTVFNLLGPLTNPARPRAGLIGCAFADLAEVMAGVFAARRSSVLVVHGDDGLDELTTTTTSTIWRVAAGSVDKLTFDPAGFGFARAQLDQLAGGDAQANAAAVRAVLGGARGPVRDAVVLNAAGAIVAHAGLSSRAEWLPAWEEGLRRASAAIDTGAAEQLLARWVRFGRQIL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Anthranilate phosphoribosyltransferase
publication title The Substrate Capture Mechanism of Mycobacterium tuberculosis Anthranilate Phosphoribosyltransferase Provides a Mode for Inhibition.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 124
structure length 347
sequence length 347
chains with identical sequence B
ec nomenclature ec 2.4.2.18: Anthranilate phosphoribosyltransferase.
pdb deposition date 2011-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00591 Glycos_transf_3 Glycosyl transferase family, a/b domain
A PF02885 Glycos_trans_3N Glycosyl transferase family, helical bundle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.970.10 Mainly Alpha Up-down Bundle Transferase, Pyrimidine Nucleoside Phosphorylase; Chain A, domain 3 Transferase, Pyrimidine Nucleoside Phosphorylase; Chain C 3qr9A01
3.40.1030.10 Alpha Beta 3-Layer(aba) Sandwich Pyrimidine Nucleoside Phosphorylase; Chain A, domain 2 Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain 3qr9A02
1V8GA 4ZOJA 2DSJA 1KGZA 4ZOFA 4EADA 1GXBA 4X5AA 1O17A 5C2LA 4M0RA 4GA5A 4YYYA 4LHMA 4GIUA 1BRWA 3QR9A 5BO2A 4ZOKA 5EP8A 4X5EA 4OWSA 4MUOA 3QQSA 2J0FA 3GBRA 4X58A 5BO3A 4OWNA 1KHDA 1ZXYA 1AZYA 2WK5A 4X5DA 3QS8A 1OTPA 5EY3A 1UOUA 2BPQA 4OWOA 4ZTVA 4YI7A 2TPTA 4EAFA 3R88A 5C7SA 5BYTA 2ELCA 1VQUA 4GKMA 4IJ1A 4OWMA 3UU1A 1ZVWA 5BNEA 1ZYKA 4YEKA 4OWVA 3R6CA 4N5VA 4X46A 4X5BA 3TWPA 4GA4A 2WK6A 4N8QA 2GVQA 4X59A 4XR5A 4OWUA 3QSAA 4OWQA 3H5QA 5C1RA 4N93A 4HKMA 4GA6A 4X5CA 4GTNA
chains in the Genus database with same CATH superfamily
1V8GA 4ZOJA 2DSJA 1KGZA 4ZOFA 4EADA 1GXBA 4X5AA 1O17A 5C2LA 4GA5A 4M0RA 4YYYA 4LHMA 4GIUA 1BRWA 3QR9A 5BO2A 4ZOKA 5EP8A 4X5EA 4OWSA 4MUOA 3QQSA 2J0FA 3GBRA 4X58A 5BO3A 4OWNA 1KHDA 1ZXYA 1AZYA 2WK5A 4X5DA 3QS8A 1OTPA 5EY3A 1RRZA 1UOUA 2BPQA 4OWOA 4ZTVA 4YI7A 2TPTA 4EAFA 3R88A 5C7SA 5BYTA 2ELCA 1VQUA 4GKMA 4IJ1A 4OWMA 3UU1A 1ZVWA 5BNEA 1ZYKA 4YEKA 4OWVA 3R6CA 4N5VA 4X46A 4X5BA 3TWPA 4GA4A 4F3FC 2WK6A 4N8QA 1RF8B 2GVQA 4X59A 4XR5A 4OWUA 3QSAA 4OWQA 3H5QA 5C1RA 4N93A 4HKMA 4GA6A 4X5CA 4GTNA
chains in the Genus database with same CATH topology
1V8GA 4ZOJA 2DSJA 1KGZA 4ZOFA 4EADA 1GXBA 4X5AA 1O17A 5C2LA 4M0RA 4GA5A 4YYYA 4LHMA 4GIUA 1BRWA 3QR9A 5BO2A 4ZOKA 5EP8A 4X5EA 4OWSA 4MUOA 3QQSA 2J0FA 3GBRA 4X58A 5BO3A 4OWNA 1KHDA 1ZXYA 1AZYA 2WK5A 4X5DA 3QS8A 1OTPA 5EY3A 1UOUA 2BPQA 4OWOA 4ZTVA 4YI7A 2TPTA 4EAFA 3R88A 5C7SA 5BYTA 2ELCA 1VQUA 4GKMA 4IJ1A 4OWMA 3UU1A 1ZVWA 5BNEA 1ZYKA 4YEKA 4OWVA 3R6CA 4N5VA 4X46A 4X5BA 3TWPA 4GA4A 2WK6A 4N8QA 2GVQA 4X59A 4XR5A 4OWUA 3QSAA 4OWQA 3H5QA 5C1RA 4N93A 4HKMA 4GA6A 4X5CA 4GTNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V8G A;  4ZOJ A;  2DSJ A;  1KGZ A;  4ZOF A;  4EAD A;  1GXB A;  4X5A A;  1O17 A;  5C2L A;  4M0R A;  4GA5 A;  4YYY A;  4LHM A;  4GIU A;  1BRW A;  3QR9 A;  5BO2 A;  4ZOK A;  5EP8 A;  4X5E A;  4OWS A;  4MUO A;  3QQS A;  2J0F A;  3GBR A;  4X58 A;  5BO3 A;  4OWN A;  1KHD A;  1ZXY A;  1AZY A;  2WK5 A;  4X5D A;  3QS8 A;  1OTP A;  5EY3 A;  1UOU A;  2BPQ A;  4OWO A;  4ZTV A;  4YI7 A;  2TPT A;  4EAF A;  3R88 A;  5C7S A;  5BYT A;  2ELC A;  1VQU A;  4GKM A;  4IJ1 A;  4OWM A;  3UU1 A;  1ZVW A;  5BNE A;  1ZYK A;  4YEK A;  4OWV A;  3R6C A;  4N5V A;  4X46 A;  4X5B A;  3TWP A;  4GA4 A;  2WK6 A;  4N8Q A;  2GVQ A;  4X59 A;  4XR5 A;  4OWU A;  3QSA A;  4OWQ A;  3H5Q A;  5C1R A;  4N93 A;  4HKM A;  4GA6 A;  4X5C A;  4GTN A; 
#chains in the Genus database with same CATH topology
 1V8G A;  4ZOJ A;  2DSJ A;  1KGZ A;  4ZOF A;  4EAD A;  1GXB A;  4X5A A;  1O17 A;  5C2L A;  4GA5 A;  4M0R A;  4YYY A;  4LHM A;  4GIU A;  1BRW A;  3QR9 A;  5BO2 A;  4ZOK A;  5EP8 A;  4X5E A;  4OWS A;  4MUO A;  3QQS A;  2J0F A;  3GBR A;  4X58 A;  5BO3 A;  4OWN A;  1KHD A;  1ZXY A;  1AZY A;  2WK5 A;  4X5D A;  3QS8 A;  1OTP A;  5EY3 A;  1RRZ A;  1UOU A;  2BPQ A;  4OWO A;  4ZTV A;  4YI7 A;  2TPT A;  4EAF A;  3R88 A;  5C7S A;  5BYT A;  2ELC A;  1VQU A;  4GKM A;  4IJ1 A;  4OWM A;  3UU1 A;  1ZVW A;  5BNE A;  1ZYK A;  4YEK A;  4OWV A;  3R6C A;  4N5V A;  4X46 A;  4X5B A;  3TWP A;  4GA4 A;  4F3F C;  2WK6 A;  4N8Q A;  1RF8 B;  2GVQ A;  4X59 A;  4XR5 A;  4OWU A;  3QSA A;  4OWQ A;  3H5Q A;  5C1R A;  4N93 A;  4HKM A;  4GA6 A;  4X5C A;  4GTN A; 
#chains in the Genus database with same CATH homology
 1V8G A;  4ZOJ A;  2DSJ A;  1KGZ A;  4ZOF A;  4EAD A;  1GXB A;  4X5A A;  1O17 A;  5C2L A;  4M0R A;  4GA5 A;  4YYY A;  4LHM A;  4GIU A;  1BRW A;  3QR9 A;  5BO2 A;  4ZOK A;  5EP8 A;  4X5E A;  4OWS A;  4MUO A;  3QQS A;  2J0F A;  3GBR A;  4X58 A;  5BO3 A;  4OWN A;  1KHD A;  1ZXY A;  1AZY A;  2WK5 A;  4X5D A;  3QS8 A;  1OTP A;  5EY3 A;  1UOU A;  2BPQ A;  4OWO A;  4ZTV A;  4YI7 A;  2TPT A;  4EAF A;  3R88 A;  5C7S A;  5BYT A;  2ELC A;  1VQU A;  4GKM A;  4IJ1 A;  4OWM A;  3UU1 A;  1ZVW A;  5BNE A;  1ZYK A;  4YEK A;  4OWV A;  3R6C A;  4N5V A;  4X46 A;  4X5B A;  3TWP A;  4GA4 A;  2WK6 A;  4N8Q A;  2GVQ A;  4X59 A;  4XR5 A;  4OWU A;  3QSA A;  4OWQ A;  3H5Q A;  5C1R A;  4N93 A;  4HKM A;  4GA6 A;  4X5C A;  4GTN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...