3QREA

Crystal structure of an enoyl-coa hydratase echa12_1 from mycobacterium marinum
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
227
structure length
198
Chain Sequence
QDAVLYEATPGGVAIITFNRADRLNAWGPDLAAGFYAAIDRAEADPGIRVIVLTGRGRGFCAGARPPHFVTMLRKPVIAAINGPCVGIGLTQALMCDVRFAAAGAKFAAVFARRGLIAEFGISWILPRLTSWAVALDLLLSGRTFLAEEAAQLGLVKEVVTPEQLMPRALEYAEDIARYCSPSSMAVIKRQVYGDATR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Increasing the structural coverage of tuberculosis drug targets.
pubmed doi rcsb
source organism Mycobacterium marinum m
molecule tags Lyase
molecule keywords Enoyl-CoA hydratase, EchA12_1
total genus 74
structure length 198
sequence length 227
ec nomenclature
pdb deposition date 2011-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3qreA00
4F47A 2J5IB 4B3IA 4JOTA 5DUCA 4JWVA 3OC7A 4U19A 1WZ8A 5DZKH 5JBWA 2J5II 3NJDA 1YG6A 4G2RA 3HE2A 3R6HA 2PBPA 3GF3A 3Q1TA 3TZ3A 3MOYA 1HNOA 4MI2A 3QYRA 1K32A 2J5IA 2X58A 3FDUA 3ZWCA 2DUBA 2ZL4A 1TG6A 5IKLB 3R9TA 2CBYA 4JCRA 3I47A 4JCQA 2FW2A 4FN8A 4EMLA 5MGBA 1UYTA 4KNPA 5E0SH 3PGQA 1WDLA 1UYVA 2F9IA 3Q0GA 2VSUC 1DUBA 2F9IB 5DU8A 4JYLA 1PIXA 4RCNA 5G1RA 1X0UA 2Q34A 5G1QA 4JCTA 3ZW8A 3R9SA 3H81A 4FJWD 4JJTA 4GM2A 1OD4A 1N6EA 3L3SA 1VRGA 1Q51A 4FZWA 4I52A 4ELSA 4QFEA 2VSUE 4FNBA 3P2LA 1XNVA 4IZBA 5FUSA 4QIIA 4FN7A 3T8AA 3MFMA 3R9QA 3H02A 2X24A 2A7SA 4U18A 2HW5A 3HP0A 5G1SA 2DEOA 3T88A 2VSSA 2VX2A 3GF7A 3NJBA 4QIJA 4FZWC 3T89A 4I4ZA 2C8TA 3KTIA 4U0GA 2Q35A 3OMEA 2QQ3A 4ZDBA 1TYFA 3SWXA 5DU4A 4EMMA 4MXIA 5JBXA 1RJNA 4LK5A 1K39A 3N6RB 3IAVA 1DCIA 2J5GD 4EMPA 3T8BA 1J7XA 3M6MA 4FB8A 1WDMA 3H0JA 3QXIA 3Q7HA 5CTBA 3U9RB 1FC9A 2VSSF 3P85A 2CE3A 2PPYA 3TLFA 3SLLA 3ZWBA 2J5SA 3P5MA 3QXZA 2ZL0A 4IZCA 3HRXA 4YLHA 1OD2A 3MT6A 5KJPA 3DJAA 4Z0MA 3KTJA 3ISAA 4JSBA 4ZDCA 3WG5A 4NNQA 2F9YA 3IBBA 3V5IA 3PZKA 1UYRA 3GLMA 3QREA 5DUFA 5INIA 3KTKA 3KTHA 3LAOA 3K50A 1FC6A 2ZQRA 4GHNA 5DU6A 4ASIA 3GKBA 3QMJA 1RJMA 5INGA 2IEXA 3RSTA 4RYFA 4OG1A 3U9TB 4B3HA 3TT7A 2J5GA 3OT6A 5DTPA 4ZDFA 3QKAA 1PJHA 3JU1A 4K2NA 2F9YB 1N6DA 4ZDEA 3MYBA 2NP9A 3QWDA 3H0UA 1Y7OA 3RSIA 3LKEA 4RYFH 1N6FA 2D3TA 3R0OA 3M6NA 3ST9A 5FIFA 3PE8A 4L6WA 1XO6A 3QK8A 3FF6A 4JCSA 3V5EA 4Q0GA 3K8XA 2VSUF 1Q52A 5C9GA 3PEAA 4Q1IA 5DZKA 1UYSA 3IB9A 2F6IA 3Q0JA 2EJ5A 1FCFA 3GMAA 2VREA 5E0NX 1EY3A 3H0QA 4ZU2A 4ZDDA 2GTRA 2ZL2A 2FZSA 4I42A 4DI1A 3TRRA 1EF8A 4U0GH 4L8KA 3KQFA 3H0SA 1XNYA 2FBMA 5KDRB 2A7KA 4K29A 4OLQA 1EF9A 4U1AA 4WCZA 2F6QA 1XX4A 3STAA 1XNWA 4KPKA 4HNKA 2ZQQA 3ZW9A 1FC7A 2WTBA 4KWBA 4IZDA 3VIVA 4HC8A 5DTWA 3BPPA 4MOUA 3TVUA 3TDCA 3TV5A 2A81A 4ELXA 4KD6A 1SZOA 4U0HA 5CTCA 4NEKA 2ZL3A 2BZRA 3T3WA 3G64A 1O8UA 1MJ3A 5INFA 1HZDA 1NZYB 3HINA 1HNUA 1UIYA 2VSSE 1ON3A 5E0SA 3TT6A 3HLN1 1YG8A 4JYJA 1NZYA 5KDRA 2VSUA 4JVTA 3ZWAA 2PG8A 3RRVA 4JFCA 4FNDA 5DL1A 2Q2XA 1WDKA 5C90A 4WZ8B 1ON9A 3KTGA 2W3PA 3BF0A 4WYOB 4ELWA 5DKPA 4OMRA 1W2XA 4K3WA 3U9SB 3DORA 1SG4A 2UZFA 4B3JA 3BEZA 1JXZA 3TVWA
chains in the Genus database with same CATH superfamily
4F47A 2J5IB 4B3IA 4JOTA 5DUCA 4JWVA 3OC7A 4U19A 1WZ8A 5DZKH 5JBWA 2J5II 3NJDA 1YG6A 4G2RA 3HE2A 3R6HA 2PBPA 3GF3A 3Q1TA 3TZ3A 3MOYA 1HNOA 4MI2A 3QYRA 1K32A 2J5IA 2X58A 3FDUA 3ZWCA 2DUBA 2ZL4A 1TG6A 5IKLB 3R9TA 2CBYA 4JCRA 3I47A 4JCQA 2FW2A 4FN8A 4EMLA 5HUQA 5MGBA 1UYTA 4KNPA 5E0SH 3PGQA 1WDLA 1UYVA 2F9IA 3Q0GA 2VSUC 1DUBA 2F9IB 5DU8A 4JYLA 1PIXA 4RCNA 5G1RA 1X0UA 2Q34A 5G1QA 4JCTA 3ZW8A 3R9SA 3H81A 4FJWD 4JJTA 4J2UA 4GM2A 1OD4A 1N6EA 3L3SA 1VRGA 1Q51A 4FZWA 4I52A 4ELSA 4QFEA 2VSUE 4FNBA 3P2LA 1XNVA 4IZBA 5FUSA 4QIIA 4FN7A 3T8AA 3MFMA 3R9QA 3H02A 2X24A 2A7SA 4U18A 2HW5A 3HP0A 5G1SA 2DEOA 3T88A 2VSSA 2VX2A 3GF7A 3NJBA 4QIJA 4FZWC 3T89A 4I4ZA 2C8TA 3KTIA 4U0GA 2Q35A 3OMEA 2QQ3A 4ZDBA 1TYFA 3SWXA 5DU4A 4EMMA 4MXIA 5JBXA 1RJNA 4LK5A 1K39A 3N6RB 3IAVA 1DCIA 2J5GD 4EMPA 3T8BA 1J7XA 3M6MA 4FB8A 1WDMA 3H0JA 3QXIA 3Q7HA 4NARA 5CTBA 3U9RB 1FC9A 2VSSF 3P85A 2CE3A 2PPYA 3TLFA 3SLLA 3ZWBA 2YJGA 2J5SA 3P5MA 3QXZA 2ZL0A 4IZCA 3HRXA 4YLHA 1OD2A 3MT6A 5KJPA 3DJAA 4Z0MA 3KTJA 3ISAA 4JSBA 4ZDCA 3WG5A 4NNQA 2F9YA 3IBBA 3V5IA 3PZKA 1UYRA 3GLMA 3QREA 5DUFA 5INIA 3KTKA 3KTHA 3LAOA 3K50A 1FC6A 2ZQRA 4GHNA 5DU6A 4ASIA 3BPTA 3GKBA 3QMJA 1RJMA 2IEXA 5INGA 3RSTA 4RYFA 4OG1A 3U9TB 4B3HA 3TT7A 2J5GA 3OT6A 5DTPA 4ZDFA 3QKAA 1PJHA 3JU1A 4K2NA 2F9YB 1N6DA 4ZDEA 3MYBA 2NP9A 3QWDA 3H0UA 1Y7OA 3RSIA 3LKEA 4RYFH 1N6FA 2D3TA 3R0OA 3M6NA 3ST9A 5FIFA 3PE8A 4L6WA 1XO6A 3QK8A 3FF6A 4JCSA 3V5EA 4Q0GA 3K8XA 2VSUF 1Q52A 5C9GA 3PEAA 4Q1IA 5DZKA 1UYSA 3IB9A 2F6IA 3Q0JA 2EJ5A 1FCFA 3GMAA 2VREA 5E0NX 1EY3A 3H0QA 4ZU2A 4ZDDA 2GTRA 2ZL2A 2FZSA 4I42A 4DI1A 3TRRA 1EF8A 4U0GH 4L8KA 3KQFA 3H0SA 1XNYA 2FBMA 2A7KA 4K29A 5KDRB 4OLQA 1EF9A 4U1AA 4WCZA 2F6QA 1XX4A 3STAA 1XNWA 4KPKA 4HNKA 2ZQQA 3ZW9A 1FC7A 2WTBA 4KWBA 4IZDA 3VIVA 4HC8A 5DTWA 3BPPA 4MOUA 3TVUA 3TDCA 3TV5A 2A81A 4ELXA 4KD6A 1SZOA 4U0HA 5CTCA 4NEKA 2ZL3A 4HDTA 2BZRA 3T3WA 3G64A 1O8UA 1MJ3A 5INFA 1HZDA 1NZYB 3HINA 1HNUA 1UIYA 2VSSE 1ON3A 5E0SA 3TT6A 3HLN1 1YG8A 4JYJA 1NZYA 5KDRA 2VSUA 4JVTA 3ZWAA 2PG8A 3RRVA 4JFCA 4FNDA 5DL1A 2Q2XA 1WDKA 5C90A 4WZ8B 1ON9A 3KTGA 2W3PA 3BF0A 4WYOB 4ELWA 5DKPA 4OMRA 1W2XA 4K3WA 3U9SB 3DORA 1SG4A 2UZFA 4B3JA 3BEZA 1JXZA 3TVWA
chains in the Genus database with same CATH topology
4F47A 2J5IB 4B3IA 4JOTA 5DUCA 4JWVA 3OC7A 4U19A 1WZ8A 5DZKH 5JBWA 2J5II 3NJDA 1YG6A 4G2RA 3HE2A 3R6HA 2PBPA 3GF3A 3Q1TA 3TZ3A 3MOYA 1HNOA 4MI2A 3QYRA 1K32A 2J5IA 2X58A 3FDUA 3ZWCA 2DUBA 2ZL4A 1TG6A 5IKLB 3R9TA 2CBYA 4JCRA 3I47A 4JCQA 2FW2A 4FN8A 4EMLA 5HUQA 5MGBA 1UYTA 4KNPA 5E0SH 3PGQA 1WDLA 1UYVA 2F9IA 3Q0GA 2VSUC 1DUBA 2F9IB 5DU8A 4JYLA 1PIXA 4RCNA 5G1RA 1X0UA 2Q34A 5G1QA 4JCTA 3ZW8A 3R9SA 3H81A 4FJWD 4JJTA 4J2UA 4GM2A 1OD4A 1N6EA 3L3SA 1VRGA 1Q51A 4FZWA 4I52A 4ELSA 4QFEA 2VSUE 4FNBA 3P2LA 1XNVA 4IZBA 5FUSA 4QIIA 4FN7A 3T8AA 3MFMA 3R9QA 3H02A 2X24A 2A7SA 4U18A 2HW5A 3HP0A 5G1SA 2DEOA 3T88A 2VSSA 2VX2A 3GF7A 3NJBA 4QIJA 4FZWC 3T89A 4I4ZA 2C8TA 3KTIA 4U0GA 2Q35A 3OMEA 2QQ3A 4ZDBA 1TYFA 3SWXA 5DU4A 4EMMA 4MXIA 5JBXA 1RJNA 4LK5A 1K39A 3N6RB 3IAVA 1DCIA 2J5GD 4EMPA 3T8BA 1J7XA 3M6MA 4FB8A 1WDMA 3H0JA 3QXIA 3Q7HA 4NARA 5CTBA 3U9RB 1FC9A 2VSSF 3P85A 2CE3A 2PPYA 3TLFA 3SLLA 3ZWBA 2YJGA 2J5SA 3P5MA 3QXZA 2ZL0A 4IZCA 3HRXA 4YLHA 1OD2A 3MT6A 5KJPA 3DJAA 4Z0MA 3KTJA 3ISAA 4JSBA 4ZDCA 3WG5A 4NNQA 2F9YA 3IBBA 3V5IA 3PZKA 1UYRA 3GLMA 3QREA 5DUFA 5INIA 3KTKA 3KTHA 3LAOA 3K50A 1FC6A 2ZQRA 4GHNA 5DU6A 4ASIA 3BPTA 3GKBA 3QMJA 1RJMA 2IEXA 5INGA 3RSTA 4RYFA 4OG1A 3U9TB 4B3HA 3TT7A 2J5GA 3OT6A 5DTPA 4ZDFA 3QKAA 1PJHA 3JU1A 4K2NA 2F9YB 1N6DA 4ZDEA 3MYBA 2NP9A 3QWDA 3H0UA 1Y7OA 3RSIA 3LKEA 4RYFH 1N6FA 2D3TA 3R0OA 3M6NA 3ST9A 5FIFA 3PE8A 4L6WA 1XO6A 3QK8A 3FF6A 4JCSA 3V5EA 4Q0GA 3K8XA 2VSUF 1Q52A 5C9GA 3PEAA 4Q1IA 5DZKA 1UYSA 3IB9A 2F6IA 3Q0JA 2EJ5A 1FCFA 3GMAA 2VREA 5E0NX 1EY3A 3H0QA 4ZU2A 4ZDDA 2GTRA 2ZL2A 2FZSA 4I42A 4DI1A 3TRRA 1EF8A 4U0GH 4L8KA 3KQFA 3H0SA 1XNYA 2FBMA 2A7KA 4K29A 5KDRB 4OLQA 1EF9A 4U1AA 4WCZA 2F6QA 1XX4A 3STAA 1XNWA 4KPKA 4HNKA 2ZQQA 3ZW9A 1FC7A 2WTBA 4KWBA 4IZDA 3VIVA 4HC8A 5DTWA 3BPPA 4MOUA 3TVUA 3TDCA 3TV5A 2A81A 4ELXA 4KD6A 1SZOA 4U0HA 5CTCA 4NEKA 2ZL3A 4HDTA 2BZRA 3T3WA 3G64A 1O8UA 1MJ3A 5INFA 1HZDA 1NZYB 3HINA 1HNUA 1UIYA 2VSSE 1ON3A 5E0SA 3TT6A 3HLN1 1YG8A 4JYJA 1NZYA 5KDRA 2VSUA 4JVTA 3ZWAA 2PG8A 3RRVA 4JFCA 4FNDA 5DL1A 2Q2XA 1WDKA 5C90A 4WZ8B 1ON9A 3KTGA 2W3PA 3BF0A 4WYOB 4ELWA 5DKPA 4OMRA 1W2XA 4K3WA 3U9SB 3DORA 1SG4A 2UZFA 4B3JA 3BEZA 1JXZA 3TVWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F47 A;  2J5I B;  4B3I A;  4JOT A;  5DUC A;  4JWV A;  3OC7 A;  4U19 A;  1WZ8 A;  5DZK H;  5JBW A;  2J5I I;  3NJD A;  1YG6 A;  4G2R A;  3HE2 A;  3R6H A;  2PBP A;  3GF3 A;  3Q1T A;  3TZ3 A;  3MOY A;  1HNO A;  4MI2 A;  3QYR A;  1K32 A;  2J5I A;  2X58 A;  3FDU A;  3ZWC A;  2DUB A;  2ZL4 A;  1TG6 A;  5IKL B;  3R9T A;  2CBY A;  4JCR A;  3I47 A;  4JCQ A;  2FW2 A;  4FN8 A;  4EML A;  5MGB A;  1UYT A;  4KNP A;  5E0S H;  3PGQ A;  1WDL A;  1UYV A;  2F9I A;  3Q0G A;  2VSU C;  1DUB A;  2F9I B;  5DU8 A;  4JYL A;  1PIX A;  4RCN A;  5G1R A;  1X0U A;  2Q34 A;  5G1Q A;  4JCT A;  3ZW8 A;  3R9S A;  3H81 A;  4FJW D;  4JJT A;  4GM2 A;  1OD4 A;  1N6E A;  3L3S A;  1VRG A;  1Q51 A;  4FZW A;  4I52 A;  4ELS A;  4QFE A;  2VSU E;  4FNB A;  3P2L A;  1XNV A;  4IZB A;  5FUS A;  4QII A;  4FN7 A;  3T8A A;  3MFM A;  3R9Q A;  3H02 A;  2X24 A;  2A7S A;  4U18 A;  2HW5 A;  3HP0 A;  5G1S A;  2DEO A;  3T88 A;  2VSS A;  2VX2 A;  3GF7 A;  3NJB A;  4QIJ A;  4FZW C;  3T89 A;  4I4Z A;  2C8T A;  3KTI A;  4U0G A;  2Q35 A;  3OME A;  2QQ3 A;  4ZDB A;  1TYF A;  3SWX A;  5DU4 A;  4EMM A;  4MXI A;  5JBX A;  1RJN A;  4LK5 A;  1K39 A;  3N6R B;  3IAV A;  1DCI A;  2J5G D;  4EMP A;  3T8B A;  1J7X A;  3M6M A;  4FB8 A;  1WDM A;  3H0J A;  3QXI A;  3Q7H A;  5CTB A;  3U9R B;  1FC9 A;  2VSS F;  3P85 A;  2CE3 A;  2PPY A;  3TLF A;  3SLL A;  3ZWB A;  2J5S A;  3P5M A;  3QXZ A;  2ZL0 A;  4IZC A;  3HRX A;  4YLH A;  1OD2 A;  3MT6 A;  5KJP A;  3DJA A;  4Z0M A;  3KTJ A;  3ISA A;  4JSB A;  4ZDC A;  3WG5 A;  4NNQ A;  2F9Y A;  3IBB A;  3V5I A;  3PZK A;  1UYR A;  3GLM A;  3QRE A;  5DUF A;  5INI A;  3KTK A;  3KTH A;  3LAO A;  3K50 A;  1FC6 A;  2ZQR A;  4GHN A;  5DU6 A;  4ASI A;  3GKB A;  3QMJ A;  1RJM A;  5ING A;  2IEX A;  3RST A;  4RYF A;  4OG1 A;  3U9T B;  4B3H A;  3TT7 A;  2J5G A;  3OT6 A;  5DTP A;  4ZDF A;  3QKA A;  1PJH A;  3JU1 A;  4K2N A;  2F9Y B;  1N6D A;  4ZDE A;  3MYB A;  2NP9 A;  3QWD A;  3H0U A;  1Y7O A;  3RSI A;  3LKE A;  4RYF H;  1N6F A;  2D3T A;  3R0O A;  3M6N A;  3ST9 A;  5FIF A;  3PE8 A;  4L6W A;  1XO6 A;  3QK8 A;  3FF6 A;  4JCS A;  3V5E A;  4Q0G A;  3K8X A;  2VSU F;  1Q52 A;  5C9G A;  3PEA A;  4Q1I A;  5DZK A;  1UYS A;  3IB9 A;  2F6I A;  3Q0J A;  2EJ5 A;  1FCF A;  3GMA A;  2VRE A;  5E0N X;  1EY3 A;  3H0Q A;  4ZU2 A;  4ZDD A;  2GTR A;  2ZL2 A;  2FZS A;  4I42 A;  4DI1 A;  3TRR A;  1EF8 A;  4U0G H;  4L8K A;  3KQF A;  3H0S A;  1XNY A;  2FBM A;  5KDR B;  2A7K A;  4K29 A;  4OLQ A;  1EF9 A;  4U1A A;  4WCZ A;  2F6Q A;  1XX4 A;  3STA A;  1XNW A;  4KPK A;  4HNK A;  2ZQQ A;  3ZW9 A;  1FC7 A;  2WTB A;  4KWB A;  4IZD A;  3VIV A;  4HC8 A;  5DTW A;  3BPP A;  4MOU A;  3TVU A;  3TDC A;  3TV5 A;  2A81 A;  4ELX A;  4KD6 A;  1SZO A;  4U0H A;  5CTC A;  4NEK A;  2ZL3 A;  2BZR A;  3T3W A;  3G64 A;  1O8U A;  1MJ3 A;  5INF A;  1HZD A;  1NZY B;  3HIN A;  1HNU A;  1UIY A;  2VSS E;  1ON3 A;  5E0S A;  3TT6 A;  3HLN 1;  1YG8 A;  4JYJ A;  1NZY A;  5KDR A;  2VSU A;  4JVT A;  3ZWA A;  2PG8 A;  3RRV A;  4JFC A;  4FND A;  5DL1 A;  2Q2X A;  1WDK A;  5C90 A;  4WZ8 B;  1ON9 A;  3KTG A;  2W3P A;  3BF0 A;  4WYO B;  4ELW A;  5DKP A;  4OMR A;  1W2X A;  4K3W A;  3U9S B;  3DOR A;  1SG4 A;  2UZF A;  4B3J A;  3BEZ A;  1JXZ A;  3TVW A; 
#chains in the Genus database with same CATH topology
 4F47 A;  2J5I B;  4B3I A;  4JOT A;  5DUC A;  4JWV A;  3OC7 A;  4U19 A;  1WZ8 A;  5DZK H;  5JBW A;  2J5I I;  3NJD A;  1YG6 A;  4G2R A;  3HE2 A;  3R6H A;  2PBP A;  3GF3 A;  3Q1T A;  3TZ3 A;  3MOY A;  1HNO A;  4MI2 A;  3QYR A;  1K32 A;  2J5I A;  2X58 A;  3FDU A;  3ZWC A;  2DUB A;  2ZL4 A;  1TG6 A;  5IKL B;  3R9T A;  2CBY A;  4JCR A;  3I47 A;  4JCQ A;  2FW2 A;  4FN8 A;  4EML A;  5HUQ A;  5MGB A;  1UYT A;  4KNP A;  5E0S H;  3PGQ A;  1WDL A;  1UYV A;  2F9I A;  3Q0G A;  2VSU C;  1DUB A;  2F9I B;  5DU8 A;  4JYL A;  1PIX A;  4RCN A;  5G1R A;  1X0U A;  2Q34 A;  5G1Q A;  4JCT A;  3ZW8 A;  3R9S A;  3H81 A;  4FJW D;  4JJT A;  4J2U A;  4GM2 A;  1OD4 A;  1N6E A;  3L3S A;  1VRG A;  1Q51 A;  4FZW A;  4I52 A;  4ELS A;  4QFE A;  2VSU E;  4FNB A;  3P2L A;  1XNV A;  4IZB A;  5FUS A;  4QII A;  4FN7 A;  3T8A A;  3MFM A;  3R9Q A;  3H02 A;  2X24 A;  2A7S A;  4U18 A;  2HW5 A;  3HP0 A;  5G1S A;  2DEO A;  3T88 A;  2VSS A;  2VX2 A;  3GF7 A;  3NJB A;  4QIJ A;  4FZW C;  3T89 A;  4I4Z A;  2C8T A;  3KTI A;  4U0G A;  2Q35 A;  3OME A;  2QQ3 A;  4ZDB A;  1TYF A;  3SWX A;  5DU4 A;  4EMM A;  4MXI A;  5JBX A;  1RJN A;  4LK5 A;  1K39 A;  3N6R B;  3IAV A;  1DCI A;  2J5G D;  4EMP A;  3T8B A;  1J7X A;  3M6M A;  4FB8 A;  1WDM A;  3H0J A;  3QXI A;  3Q7H A;  4NAR A;  5CTB A;  3U9R B;  1FC9 A;  2VSS F;  3P85 A;  2CE3 A;  2PPY A;  3TLF A;  3SLL A;  3ZWB A;  2YJG A;  2J5S A;  3P5M A;  3QXZ A;  2ZL0 A;  4IZC A;  3HRX A;  4YLH A;  1OD2 A;  3MT6 A;  5KJP A;  3DJA A;  4Z0M A;  3KTJ A;  3ISA A;  4JSB A;  4ZDC A;  3WG5 A;  4NNQ A;  2F9Y A;  3IBB A;  3V5I A;  3PZK A;  1UYR A;  3GLM A;  3QRE A;  5DUF A;  5INI A;  3KTK A;  3KTH A;  3LAO A;  3K50 A;  1FC6 A;  2ZQR A;  4GHN A;  5DU6 A;  4ASI A;  3BPT A;  3GKB A;  3QMJ A;  1RJM A;  2IEX A;  5ING A;  3RST A;  4RYF A;  4OG1 A;  3U9T B;  4B3H A;  3TT7 A;  2J5G A;  3OT6 A;  5DTP A;  4ZDF A;  3QKA A;  1PJH A;  3JU1 A;  4K2N A;  2F9Y B;  1N6D A;  4ZDE A;  3MYB A;  2NP9 A;  3QWD A;  3H0U A;  1Y7O A;  3RSI A;  3LKE A;  4RYF H;  1N6F A;  2D3T A;  3R0O A;  3M6N A;  3ST9 A;  5FIF A;  3PE8 A;  4L6W A;  1XO6 A;  3QK8 A;  3FF6 A;  4JCS A;  3V5E A;  4Q0G A;  3K8X A;  2VSU F;  1Q52 A;  5C9G A;  3PEA A;  4Q1I A;  5DZK A;  1UYS A;  3IB9 A;  2F6I A;  3Q0J A;  2EJ5 A;  1FCF A;  3GMA A;  2VRE A;  5E0N X;  1EY3 A;  3H0Q A;  4ZU2 A;  4ZDD A;  2GTR A;  2ZL2 A;  2FZS A;  4I42 A;  4DI1 A;  3TRR A;  1EF8 A;  4U0G H;  4L8K A;  3KQF A;  3H0S A;  1XNY A;  2FBM A;  2A7K A;  4K29 A;  5KDR B;  4OLQ A;  1EF9 A;  4U1A A;  4WCZ A;  2F6Q A;  1XX4 A;  3STA A;  1XNW A;  4KPK A;  4HNK A;  2ZQQ A;  3ZW9 A;  1FC7 A;  2WTB A;  4KWB A;  4IZD A;  3VIV A;  4HC8 A;  5DTW A;  3BPP A;  4MOU A;  3TVU A;  3TDC A;  3TV5 A;  2A81 A;  4ELX A;  4KD6 A;  1SZO A;  4U0H A;  5CTC A;  4NEK A;  2ZL3 A;  4HDT A;  2BZR A;  3T3W A;  3G64 A;  1O8U A;  1MJ3 A;  5INF A;  1HZD A;  1NZY B;  3HIN A;  1HNU A;  1UIY A;  2VSS E;  1ON3 A;  5E0S A;  3TT6 A;  3HLN 1;  1YG8 A;  4JYJ A;  1NZY A;  5KDR A;  2VSU A;  4JVT A;  3ZWA A;  2PG8 A;  3RRV A;  4JFC A;  4FND A;  5DL1 A;  2Q2X A;  1WDK A;  5C90 A;  4WZ8 B;  1ON9 A;  3KTG A;  2W3P A;  3BF0 A;  4WYO B;  4ELW A;  5DKP A;  4OMR A;  1W2X A;  4K3W A;  3U9S B;  3DOR A;  1SG4 A;  2UZF A;  4B3J A;  3BEZ A;  1JXZ A;  3TVW A; 
#chains in the Genus database with same CATH homology
 4F47 A;  2J5I B;  4B3I A;  4JOT A;  5DUC A;  4JWV A;  3OC7 A;  4U19 A;  1WZ8 A;  5DZK H;  5JBW A;  2J5I I;  3NJD A;  1YG6 A;  4G2R A;  3HE2 A;  3R6H A;  2PBP A;  3GF3 A;  3Q1T A;  3TZ3 A;  3MOY A;  1HNO A;  4MI2 A;  3QYR A;  1K32 A;  2J5I A;  2X58 A;  3FDU A;  3ZWC A;  2DUB A;  2ZL4 A;  1TG6 A;  5IKL B;  3R9T A;  2CBY A;  4JCR A;  3I47 A;  4JCQ A;  2FW2 A;  4FN8 A;  4EML A;  5HUQ A;  5MGB A;  1UYT A;  4KNP A;  5E0S H;  3PGQ A;  1WDL A;  1UYV A;  2F9I A;  3Q0G A;  2VSU C;  1DUB A;  2F9I B;  5DU8 A;  4JYL A;  1PIX A;  4RCN A;  5G1R A;  1X0U A;  2Q34 A;  5G1Q A;  4JCT A;  3ZW8 A;  3R9S A;  3H81 A;  4FJW D;  4JJT A;  4J2U A;  4GM2 A;  1OD4 A;  1N6E A;  3L3S A;  1VRG A;  1Q51 A;  4FZW A;  4I52 A;  4ELS A;  4QFE A;  2VSU E;  4FNB A;  3P2L A;  1XNV A;  4IZB A;  5FUS A;  4QII A;  4FN7 A;  3T8A A;  3MFM A;  3R9Q A;  3H02 A;  2X24 A;  2A7S A;  4U18 A;  2HW5 A;  3HP0 A;  5G1S A;  2DEO A;  3T88 A;  2VSS A;  2VX2 A;  3GF7 A;  3NJB A;  4QIJ A;  4FZW C;  3T89 A;  4I4Z A;  2C8T A;  3KTI A;  4U0G A;  2Q35 A;  3OME A;  2QQ3 A;  4ZDB A;  1TYF A;  3SWX A;  5DU4 A;  4EMM A;  4MXI A;  5JBX A;  1RJN A;  4LK5 A;  1K39 A;  3N6R B;  3IAV A;  1DCI A;  2J5G D;  4EMP A;  3T8B A;  1J7X A;  3M6M A;  4FB8 A;  1WDM A;  3H0J A;  3QXI A;  3Q7H A;  4NAR A;  5CTB A;  3U9R B;  1FC9 A;  2VSS F;  3P85 A;  2CE3 A;  2PPY A;  3TLF A;  3SLL A;  3ZWB A;  2YJG A;  2J5S A;  3P5M A;  3QXZ A;  2ZL0 A;  4IZC A;  3HRX A;  4YLH A;  1OD2 A;  3MT6 A;  5KJP A;  3DJA A;  4Z0M A;  3KTJ A;  3ISA A;  4JSB A;  4ZDC A;  3WG5 A;  4NNQ A;  2F9Y A;  3IBB A;  3V5I A;  3PZK A;  1UYR A;  3GLM A;  3QRE A;  5DUF A;  5INI A;  3KTK A;  3KTH A;  3LAO A;  3K50 A;  1FC6 A;  2ZQR A;  4GHN A;  5DU6 A;  4ASI A;  3BPT A;  3GKB A;  3QMJ A;  1RJM A;  2IEX A;  5ING A;  3RST A;  4RYF A;  4OG1 A;  3U9T B;  4B3H A;  3TT7 A;  2J5G A;  3OT6 A;  5DTP A;  4ZDF A;  3QKA A;  1PJH A;  3JU1 A;  4K2N A;  2F9Y B;  1N6D A;  4ZDE A;  3MYB A;  2NP9 A;  3QWD A;  3H0U A;  1Y7O A;  3RSI A;  3LKE A;  4RYF H;  1N6F A;  2D3T A;  3R0O A;  3M6N A;  3ST9 A;  5FIF A;  3PE8 A;  4L6W A;  1XO6 A;  3QK8 A;  3FF6 A;  4JCS A;  3V5E A;  4Q0G A;  3K8X A;  2VSU F;  1Q52 A;  5C9G A;  3PEA A;  4Q1I A;  5DZK A;  1UYS A;  3IB9 A;  2F6I A;  3Q0J A;  2EJ5 A;  1FCF A;  3GMA A;  2VRE A;  5E0N X;  1EY3 A;  3H0Q A;  4ZU2 A;  4ZDD A;  2GTR A;  2ZL2 A;  2FZS A;  4I42 A;  4DI1 A;  3TRR A;  1EF8 A;  4U0G H;  4L8K A;  3KQF A;  3H0S A;  1XNY A;  2FBM A;  2A7K A;  4K29 A;  5KDR B;  4OLQ A;  1EF9 A;  4U1A A;  4WCZ A;  2F6Q A;  1XX4 A;  3STA A;  1XNW A;  4KPK A;  4HNK A;  2ZQQ A;  3ZW9 A;  1FC7 A;  2WTB A;  4KWB A;  4IZD A;  3VIV A;  4HC8 A;  5DTW A;  3BPP A;  4MOU A;  3TVU A;  3TDC A;  3TV5 A;  2A81 A;  4ELX A;  4KD6 A;  1SZO A;  4U0H A;  5CTC A;  4NEK A;  2ZL3 A;  4HDT A;  2BZR A;  3T3W A;  3G64 A;  1O8U A;  1MJ3 A;  5INF A;  1HZD A;  1NZY B;  3HIN A;  1HNU A;  1UIY A;  2VSS E;  1ON3 A;  5E0S A;  3TT6 A;  3HLN 1;  1YG8 A;  4JYJ A;  1NZY A;  5KDR A;  2VSU A;  4JVT A;  3ZWA A;  2PG8 A;  3RRV A;  4JFC A;  4FND A;  5DL1 A;  2Q2X A;  1WDK A;  5C90 A;  4WZ8 B;  1ON9 A;  3KTG A;  2W3P A;  3BF0 A;  4WYO B;  4ELW A;  5DKP A;  4OMR A;  1W2X A;  4K3W A;  3U9S B;  3DOR A;  1SG4 A;  2UZF A;  4B3J A;  3BEZ A;  1JXZ A;  3TVW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...