3QREA

Crystal structure of an enoyl-coa hydratase echa12_1 from mycobacterium marinum
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
227
structure length
198
Chain Sequence
QDAVLYEATPGGVAIITFNRADRLNAWGPDLAAGFYAAIDRAEADPGIRVIVLTGRGRGFCAGARPPHFVTMLRKPVIAAINGPCVGIGLTQALMCDVRFAAAGAKFAAVFARRGLIAEFGISWILPRLTSWAVALDLLLSGRTFLAEEAAQLGLVKEVVTPEQLMPRALEYAEDIARYCSPSSMAVIKRQVYGDATR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Increasing the structural coverage of tuberculosis drug targets.
pubmed doi rcsb
source organism Mycobacterium marinum m
molecule tags Lyase
molecule keywords Enoyl-CoA hydratase, EchA12_1
total genus 74
structure length 198
sequence length 227
ec nomenclature
pdb deposition date 2011-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3qreA00
5JBWA 1WDLA 4K3WA 4HC8A 3R9SA 1FC7A 4Q1IA 3DORA 1TYFA 5DU8A 3ZWCA 4NNQA 3ZW8A 3V5IA 4B3IA 4IZBA 3IBBA 1XX4A 4ZDDA 3TVUA 2J5II 4K29A 3BPPA 3MT6A 3Q0GA 3KQFA 4JOTA 4JVTA 2ZQQA 1HNOA 1EY3A 1UYSA 1UYVA 3H0QA 4JCSA 3M6NA 1OD4A 3H02A 2VX2A 4L6WA 4KNPA 3KTKA 2GTRA 3G64A 4L8KA 3GKBA 2VSUC 1TG6A 3BF0A 1WDKA 4I42A 4Z0MA 4JJTA 4OLQA 2VSUF 3T3WA 1NZYB 3LKEA 3KTJA 3HE2A 1O8UA 3R0OA 4IZDA 1ON9A 5KDRB 5FUSA 3MFMA 3ZW9A 3L3SA 3GMAA 4G2RA 1UIYA 3OT6A 4YLHA 4GHNA 1XNYA 2QQ3A 3FDUA 1FC6A 5DUFA 2J5GD 3TV5A 4KD6A 2F9IB 3ST9A 3MOYA 4ZDEA 5G1QA 2IEXA 4IZCA 1XNVA 1RJMA 2VSSF 1N6DA 3WG5A 3TT6A 4FZWA 3T88A 3U9RB 5DZKH 2HW5A 4EMMA 5INIA 2F6QA 3U9SB 3K50A 1XO6A 5INFA 4RYFA 3P5MA 4QIJA 4WYOB 3TRRA 2BZRA 1OD2A 3HLN1 1EF9A 1DUBA 2VSUA 4Q0GA 3FF6A 2J5SA 3BEZA 4OG1A 1JXZA 3QKAA 1N6EA 4B3JA 1UYTA 4JYJA 4QIIA 4MXIA 2ZL4A 3RSIA 3QK8A 2X58A 3QWDA 3NJDA 4DI1A 2PG8A 4ZU2A 4LK5A 5KDRA 2VSSA 2FBMA 1N6FA 2C8TA 3K8XA 2FZSA 1Q52A 3GLMA 3U9TB 1NZYA 3ZWBA 3QXZA 4MI2A 5E0SH 4ELWA 4RYFH 3QXIA 4JCQA 4RCNA 1FCFA 1DCIA 3PEAA 5KJPA 4F47A 2A7SA 2VREA 2F9IA 3KTGA 3KTIA 2A7KA 2Q34A 3Q0JA 1SG4A 3VIVA 4ZDCA 3TLFA 5DTWA 2NP9A 3TZ3A 5G1RA 4ELXA 2Q35A 4GM2A 1PIXA 4U0GH 3H0SA 4U0HA 3Q7HA 2UZFA 4U1AA 1SZOA 5C90A 3RSTA 4FN8A 1HZDA 5MGBA 2CE3A 5IKLB 3P85A 4ELSA 4JYLA 3HRXA 5DKPA 1WZ8A 3Q1TA 3JU1A 3QREA 5JBXA 4FNDA 3IB9A 2D3TA 1EF8A 1YG8A 3GF7A 4EMPA 3SWXA 5FIFA 4EMLA 4JFCA 4FJWD 5DU4A 2DEOA 5E0SA 3HINA 2DUBA 3RRVA 3DJAA 1VRGA 3T8AA 2WTBA 4QFEA 3H81A 4MOUA 1RJNA 3ISAA 3NJBA 3PE8A 1WDMA 4I4ZA 3M6MA 1J7XA 2J5GA 3IAVA 5INGA 2VSSE 4JCTA 2PBPA 3R6HA 3H0UA 4U19A 1PJHA 5CTBA 5DTPA 1W2XA 4WCZA 1MJ3A 1XNWA 4KWBA 5E0NX 4U18A 3HP0A 4K2NA 2F9YB 4ZDFA 3TVWA 2ZL3A 3STAA 2PPYA 3V5EA 2J5IA 3KTHA 4B3HA 2FW2A 1X0UA 1Y7OA 2ZL2A 3MYBA 2ZL0A 4FZWC 5G1SA 4FNBA 3OC7A 2J5IB 1ON3A 4KPKA 2CBYA 4NEKA 2X24A 1HNUA 1Q51A 3TDCA 1UYRA 3N6RB 1YG6A 5DZKA 4I52A 3H0JA 4JSBA 4FN7A 2EJ5A 3T89A 3LAOA 3I47A 4JCRA 3R9QA 3P2LA 2W3PA 1FC9A 3SLLA 3T8BA 1K32A 2F6IA 4HNKA 5DUCA 4ASIA 4JWVA 4ZDBA 4WZ8B 3OMEA 4U0GA 3R9TA 3GF3A 1K39A 5DL1A 3PZKA 4FB8A 2Q2XA 2A81A 2F9YA 3QMJA 3TT7A 4OMRA 5C9GA 3PGQA 3QYRA 2VSUE 2ZQRA 5DU6A 3ZWAA 5CTCA
chains in the Genus database with same CATH superfamily
5JBWA 1WDLA 4K3WA 4HC8A 3R9SA 1FC7A 4Q1IA 3DORA 1TYFA 5DU8A 3ZWCA 4NNQA 3ZW8A 3V5IA 4B3IA 4IZBA 3IBBA 1XX4A 4ZDDA 3TVUA 2J5II 4K29A 3BPPA 3MT6A 3Q0GA 3KQFA 4JOTA 4JVTA 2ZQQA 1HNOA 1EY3A 1UYSA 1UYVA 3H0QA 4JCSA 3M6NA 1OD4A 3H02A 2VX2A 4L6WA 5HUQA 4KNPA 3KTKA 2GTRA 3G64A 4L8KA 3GKBA 2VSUC 1TG6A 3BF0A 1WDKA 4I42A 4Z0MA 4JJTA 4OLQA 2VSUF 3T3WA 1NZYB 3LKEA 3KTJA 3HE2A 1O8UA 3R0OA 4IZDA 1ON9A 5KDRB 5FUSA 3MFMA 3ZW9A 3L3SA 3GMAA 4G2RA 1UIYA 3OT6A 4YLHA 4GHNA 1XNYA 2QQ3A 3FDUA 1FC6A 5DUFA 2J5GD 3TV5A 4KD6A 2F9IB 3ST9A 3MOYA 4ZDEA 5G1QA 2IEXA 4IZCA 1XNVA 1RJMA 2VSSF 1N6DA 3WG5A 3TT6A 4FZWA 3T88A 3U9RB 5DZKH 2HW5A 4EMMA 5INIA 2F6QA 3U9SB 3K50A 1XO6A 5INFA 4RYFA 3P5MA 4QIJA 4WYOB 3TRRA 2BZRA 1OD2A 3HLN1 1EF9A 1DUBA 2VSUA 4Q0GA 3FF6A 2J5SA 3BEZA 4OG1A 1JXZA 3QKAA 1N6EA 4B3JA 1UYTA 4JYJA 4QIIA 4MXIA 2ZL4A 3RSIA 3QK8A 2X58A 3QWDA 3NJDA 4DI1A 2PG8A 4ZU2A 4LK5A 5KDRA 2VSSA 2FBMA 1N6FA 2C8TA 3K8XA 2FZSA 1Q52A 3GLMA 3U9TB 1NZYA 3ZWBA 3QXZA 4MI2A 5E0SH 4ELWA 4RYFH 3QXIA 4JCQA 4RCNA 1FCFA 1DCIA 3PEAA 5KJPA 4F47A 2A7SA 2VREA 2F9IA 3KTGA 3KTIA 2A7KA 2Q34A 3Q0JA 1SG4A 3VIVA 4ZDCA 3TLFA 5DTWA 2NP9A 3TZ3A 5G1RA 4ELXA 2Q35A 4GM2A 1PIXA 4U0GH 3BPTA 3H0SA 4U0HA 3Q7HA 2UZFA 4U1AA 1SZOA 5C90A 3RSTA 4FN8A 1HZDA 5MGBA 2CE3A 2YJGA 5IKLB 4HDTA 3P85A 4ELSA 4JYLA 3HRXA 5DKPA 1WZ8A 3Q1TA 3JU1A 3QREA 5JBXA 4FNDA 3IB9A 2D3TA 1EF8A 1YG8A 3GF7A 4EMPA 3SWXA 5FIFA 4EMLA 4JFCA 4FJWD 5DU4A 2DEOA 5E0SA 3HINA 2DUBA 3RRVA 3DJAA 1VRGA 3T8AA 2WTBA 4QFEA 3H81A 4MOUA 1RJNA 3ISAA 3NJBA 3PE8A 1WDMA 4I4ZA 3M6MA 1J7XA 2J5GA 3IAVA 5INGA 2VSSE 4JCTA 2PBPA 3R6HA 3H0UA 4U19A 1PJHA 5CTBA 5DTPA 1W2XA 4WCZA 1MJ3A 1XNWA 4KWBA 5E0NX 4U18A 3HP0A 4K2NA 2F9YB 4ZDFA 3TVWA 2ZL3A 3STAA 2PPYA 3V5EA 2J5IA 3KTHA 4B3HA 2FW2A 1X0UA 1Y7OA 2ZL2A 3MYBA 2ZL0A 4FZWC 5G1SA 4FNBA 3OC7A 2J5IB 1ON3A 4KPKA 2CBYA 4NEKA 2X24A 1HNUA 1Q51A 3TDCA 1UYRA 3N6RB 1YG6A 5DZKA 4I52A 3H0JA 4JSBA 4FN7A 2EJ5A 3T89A 3LAOA 3I47A 4JCRA 3R9QA 3P2LA 2W3PA 1FC9A 3SLLA 3T8BA 1K32A 2F6IA 4HNKA 5DUCA 4ASIA 4JWVA 4ZDBA 4WZ8B 3OMEA 4U0GA 3R9TA 3GF3A 4J2UA 1K39A 5DL1A 3PZKA 4FB8A 2Q2XA 2A81A 2F9YA 3QMJA 3TT7A 4OMRA 5C9GA 3PGQA 3QYRA 2VSUE 2ZQRA 5DU6A 3ZWAA 5CTCA 4NARA
chains in the Genus database with same CATH topology
5JBWA 1WDLA 4K3WA 4HC8A 3R9SA 1FC7A 4Q1IA 3DORA 1TYFA 5DU8A 3ZWCA 4NNQA 3ZW8A 3V5IA 4B3IA 4IZBA 3IBBA 1XX4A 4ZDDA 3TVUA 2J5II 4K29A 3BPPA 3MT6A 3Q0GA 3KQFA 4JOTA 4JVTA 2ZQQA 1HNOA 1EY3A 1UYSA 1UYVA 3H0QA 4JCSA 3M6NA 1OD4A 3H02A 2VX2A 4L6WA 5HUQA 4KNPA 3KTKA 2GTRA 3G64A 4L8KA 3GKBA 2VSUC 1TG6A 3BF0A 1WDKA 4I42A 4Z0MA 4JJTA 4OLQA 2VSUF 3T3WA 1NZYB 3LKEA 3KTJA 3HE2A 1O8UA 3R0OA 4IZDA 1ON9A 5KDRB 5FUSA 3MFMA 3ZW9A 3L3SA 3GMAA 4G2RA 1UIYA 3OT6A 4YLHA 4GHNA 1XNYA 2QQ3A 3FDUA 1FC6A 5DUFA 2J5GD 3TV5A 4KD6A 2F9IB 3ST9A 3MOYA 4ZDEA 5G1QA 2IEXA 4IZCA 1XNVA 1RJMA 2VSSF 1N6DA 3WG5A 3TT6A 4FZWA 3T88A 3U9RB 5DZKH 2HW5A 4EMMA 5INIA 2F6QA 3U9SB 3K50A 1XO6A 5INFA 4RYFA 3P5MA 4QIJA 4WYOB 3TRRA 2BZRA 1OD2A 3HLN1 1EF9A 1DUBA 2VSUA 4Q0GA 3FF6A 2J5SA 3BEZA 4OG1A 1JXZA 3QKAA 1N6EA 4B3JA 1UYTA 4JYJA 4QIIA 4MXIA 2ZL4A 3RSIA 3QK8A 2X58A 3QWDA 3NJDA 4DI1A 2PG8A 4ZU2A 4LK5A 5KDRA 2VSSA 2FBMA 1N6FA 2C8TA 3K8XA 2FZSA 1Q52A 3GLMA 3U9TB 1NZYA 3ZWBA 3QXZA 4MI2A 5E0SH 4ELWA 4RYFH 3QXIA 4JCQA 4RCNA 1FCFA 1DCIA 3PEAA 5KJPA 4F47A 2A7SA 2VREA 2F9IA 3KTGA 3KTIA 2A7KA 2Q34A 3Q0JA 1SG4A 3VIVA 4ZDCA 3TLFA 5DTWA 2NP9A 3TZ3A 5G1RA 4ELXA 2Q35A 4GM2A 1PIXA 4U0GH 3BPTA 3H0SA 4U0HA 3Q7HA 2UZFA 4U1AA 1SZOA 5C90A 3RSTA 4FN8A 1HZDA 5MGBA 2CE3A 2YJGA 5IKLB 4HDTA 3P85A 4ELSA 4JYLA 3HRXA 5DKPA 1WZ8A 3Q1TA 3JU1A 3QREA 5JBXA 4FNDA 3IB9A 2D3TA 1EF8A 1YG8A 3GF7A 4EMPA 3SWXA 5FIFA 4EMLA 4JFCA 4FJWD 5DU4A 2DEOA 5E0SA 3HINA 2DUBA 3RRVA 3DJAA 1VRGA 3T8AA 2WTBA 4QFEA 3H81A 4MOUA 1RJNA 3ISAA 3NJBA 3PE8A 1WDMA 4I4ZA 3M6MA 1J7XA 2J5GA 3IAVA 5INGA 2VSSE 4JCTA 2PBPA 3R6HA 3H0UA 4U19A 1PJHA 5CTBA 5DTPA 1W2XA 4WCZA 1MJ3A 1XNWA 4KWBA 5E0NX 4U18A 3HP0A 4K2NA 2F9YB 4ZDFA 3TVWA 2ZL3A 3STAA 2PPYA 3V5EA 2J5IA 3KTHA 4B3HA 2FW2A 1X0UA 1Y7OA 2ZL2A 3MYBA 2ZL0A 4FZWC 5G1SA 4FNBA 3OC7A 2J5IB 1ON3A 4KPKA 2CBYA 4NEKA 2X24A 1HNUA 1Q51A 3TDCA 1UYRA 3N6RB 1YG6A 5DZKA 4I52A 3H0JA 4JSBA 4FN7A 2EJ5A 3T89A 3LAOA 3I47A 4JCRA 3R9QA 3P2LA 2W3PA 1FC9A 3SLLA 3T8BA 1K32A 2F6IA 4HNKA 5DUCA 4ASIA 4JWVA 4ZDBA 4WZ8B 3OMEA 4U0GA 3R9TA 3GF3A 4J2UA 1K39A 5DL1A 3PZKA 4FB8A 2Q2XA 2A81A 2F9YA 3QMJA 3TT7A 4OMRA 5C9GA 3PGQA 3QYRA 2VSUE 2ZQRA 5DU6A 3ZWAA 5CTCA 4NARA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JBW A;  1WDL A;  4K3W A;  4HC8 A;  3R9S A;  1FC7 A;  4Q1I A;  3DOR A;  1TYF A;  5DU8 A;  3ZWC A;  4NNQ A;  3ZW8 A;  3V5I A;  4B3I A;  4IZB A;  3IBB A;  1XX4 A;  4ZDD A;  3TVU A;  2J5I I;  4K29 A;  3BPP A;  3MT6 A;  3Q0G A;  3KQF A;  4JOT A;  4JVT A;  2ZQQ A;  1HNO A;  1EY3 A;  1UYS A;  1UYV A;  3H0Q A;  4JCS A;  3M6N A;  1OD4 A;  3H02 A;  2VX2 A;  4L6W A;  4KNP A;  3KTK A;  2GTR A;  3G64 A;  4L8K A;  3GKB A;  2VSU C;  1TG6 A;  3BF0 A;  1WDK A;  4I42 A;  4Z0M A;  4JJT A;  4OLQ A;  2VSU F;  3T3W A;  1NZY B;  3LKE A;  3KTJ A;  3HE2 A;  1O8U A;  3R0O A;  4IZD A;  1ON9 A;  5KDR B;  5FUS A;  3MFM A;  3ZW9 A;  3L3S A;  3GMA A;  4G2R A;  1UIY A;  3OT6 A;  4YLH A;  4GHN A;  1XNY A;  2QQ3 A;  3FDU A;  1FC6 A;  5DUF A;  2J5G D;  3TV5 A;  4KD6 A;  2F9I B;  3ST9 A;  3MOY A;  4ZDE A;  5G1Q A;  2IEX A;  4IZC A;  1XNV A;  1RJM A;  2VSS F;  1N6D A;  3WG5 A;  3TT6 A;  4FZW A;  3T88 A;  3U9R B;  5DZK H;  2HW5 A;  4EMM A;  5INI A;  2F6Q A;  3U9S B;  3K50 A;  1XO6 A;  5INF A;  4RYF A;  3P5M A;  4QIJ A;  4WYO B;  3TRR A;  2BZR A;  1OD2 A;  3HLN 1;  1EF9 A;  1DUB A;  2VSU A;  4Q0G A;  3FF6 A;  2J5S A;  3BEZ A;  4OG1 A;  1JXZ A;  3QKA A;  1N6E A;  4B3J A;  1UYT A;  4JYJ A;  4QII A;  4MXI A;  2ZL4 A;  3RSI A;  3QK8 A;  2X58 A;  3QWD A;  3NJD A;  4DI1 A;  2PG8 A;  4ZU2 A;  4LK5 A;  5KDR A;  2VSS A;  2FBM A;  1N6F A;  2C8T A;  3K8X A;  2FZS A;  1Q52 A;  3GLM A;  3U9T B;  1NZY A;  3ZWB A;  3QXZ A;  4MI2 A;  5E0S H;  4ELW A;  4RYF H;  3QXI A;  4JCQ A;  4RCN A;  1FCF A;  1DCI A;  3PEA A;  5KJP A;  4F47 A;  2A7S A;  2VRE A;  2F9I A;  3KTG A;  3KTI A;  2A7K A;  2Q34 A;  3Q0J A;  1SG4 A;  3VIV A;  4ZDC A;  3TLF A;  5DTW A;  2NP9 A;  3TZ3 A;  5G1R A;  4ELX A;  2Q35 A;  4GM2 A;  1PIX A;  4U0G H;  3H0S A;  4U0H A;  3Q7H A;  2UZF A;  4U1A A;  1SZO A;  5C90 A;  3RST A;  4FN8 A;  1HZD A;  5MGB A;  2CE3 A;  5IKL B;  3P85 A;  4ELS A;  4JYL A;  3HRX A;  5DKP A;  1WZ8 A;  3Q1T A;  3JU1 A;  3QRE A;  5JBX A;  4FND A;  3IB9 A;  2D3T A;  1EF8 A;  1YG8 A;  3GF7 A;  4EMP A;  3SWX A;  5FIF A;  4EML A;  4JFC A;  4FJW D;  5DU4 A;  2DEO A;  5E0S A;  3HIN A;  2DUB A;  3RRV A;  3DJA A;  1VRG A;  3T8A A;  2WTB A;  4QFE A;  3H81 A;  4MOU A;  1RJN A;  3ISA A;  3NJB A;  3PE8 A;  1WDM A;  4I4Z A;  3M6M A;  1J7X A;  2J5G A;  3IAV A;  5ING A;  2VSS E;  4JCT A;  2PBP A;  3R6H A;  3H0U A;  4U19 A;  1PJH A;  5CTB A;  5DTP A;  1W2X A;  4WCZ A;  1MJ3 A;  1XNW A;  4KWB A;  5E0N X;  4U18 A;  3HP0 A;  4K2N A;  2F9Y B;  4ZDF A;  3TVW A;  2ZL3 A;  3STA A;  2PPY A;  3V5E A;  2J5I A;  3KTH A;  4B3H A;  2FW2 A;  1X0U A;  1Y7O A;  2ZL2 A;  3MYB A;  2ZL0 A;  4FZW C;  5G1S A;  4FNB A;  3OC7 A;  2J5I B;  1ON3 A;  4KPK A;  2CBY A;  4NEK A;  2X24 A;  1HNU A;  1Q51 A;  3TDC A;  1UYR A;  3N6R B;  1YG6 A;  5DZK A;  4I52 A;  3H0J A;  4JSB A;  4FN7 A;  2EJ5 A;  3T89 A;  3LAO A;  3I47 A;  4JCR A;  3R9Q A;  3P2L A;  2W3P A;  1FC9 A;  3SLL A;  3T8B A;  1K32 A;  2F6I A;  4HNK A;  5DUC A;  4ASI A;  4JWV A;  4ZDB A;  4WZ8 B;  3OME A;  4U0G A;  3R9T A;  3GF3 A;  1K39 A;  5DL1 A;  3PZK A;  4FB8 A;  2Q2X A;  2A81 A;  2F9Y A;  3QMJ A;  3TT7 A;  4OMR A;  5C9G A;  3PGQ A;  3QYR A;  2VSU E;  2ZQR A;  5DU6 A;  3ZWA A;  5CTC A; 
#chains in the Genus database with same CATH topology
 5JBW A;  1WDL A;  4K3W A;  4HC8 A;  3R9S A;  1FC7 A;  4Q1I A;  3DOR A;  1TYF A;  5DU8 A;  3ZWC A;  4NNQ A;  3ZW8 A;  3V5I A;  4B3I A;  4IZB A;  3IBB A;  1XX4 A;  4ZDD A;  3TVU A;  2J5I I;  4K29 A;  3BPP A;  3MT6 A;  3Q0G A;  3KQF A;  4JOT A;  4JVT A;  2ZQQ A;  1HNO A;  1EY3 A;  1UYS A;  1UYV A;  3H0Q A;  4JCS A;  3M6N A;  1OD4 A;  3H02 A;  2VX2 A;  4L6W A;  5HUQ A;  4KNP A;  3KTK A;  2GTR A;  3G64 A;  4L8K A;  3GKB A;  2VSU C;  1TG6 A;  3BF0 A;  1WDK A;  4I42 A;  4Z0M A;  4JJT A;  4OLQ A;  2VSU F;  3T3W A;  1NZY B;  3LKE A;  3KTJ A;  3HE2 A;  1O8U A;  3R0O A;  4IZD A;  1ON9 A;  5KDR B;  5FUS A;  3MFM A;  3ZW9 A;  3L3S A;  3GMA A;  4G2R A;  1UIY A;  3OT6 A;  4YLH A;  4GHN A;  1XNY A;  2QQ3 A;  3FDU A;  1FC6 A;  5DUF A;  2J5G D;  3TV5 A;  4KD6 A;  2F9I B;  3ST9 A;  3MOY A;  4ZDE A;  5G1Q A;  2IEX A;  4IZC A;  1XNV A;  1RJM A;  2VSS F;  1N6D A;  3WG5 A;  3TT6 A;  4FZW A;  3T88 A;  3U9R B;  5DZK H;  2HW5 A;  4EMM A;  5INI A;  2F6Q A;  3U9S B;  3K50 A;  1XO6 A;  5INF A;  4RYF A;  3P5M A;  4QIJ A;  4WYO B;  3TRR A;  2BZR A;  1OD2 A;  3HLN 1;  1EF9 A;  1DUB A;  2VSU A;  4Q0G A;  3FF6 A;  2J5S A;  3BEZ A;  4OG1 A;  1JXZ A;  3QKA A;  1N6E A;  4B3J A;  1UYT A;  4JYJ A;  4QII A;  4MXI A;  2ZL4 A;  3RSI A;  3QK8 A;  2X58 A;  3QWD A;  3NJD A;  4DI1 A;  2PG8 A;  4ZU2 A;  4LK5 A;  5KDR A;  2VSS A;  2FBM A;  1N6F A;  2C8T A;  3K8X A;  2FZS A;  1Q52 A;  3GLM A;  3U9T B;  1NZY A;  3ZWB A;  3QXZ A;  4MI2 A;  5E0S H;  4ELW A;  4RYF H;  3QXI A;  4JCQ A;  4RCN A;  1FCF A;  1DCI A;  3PEA A;  5KJP A;  4F47 A;  2A7S A;  2VRE A;  2F9I A;  3KTG A;  3KTI A;  2A7K A;  2Q34 A;  3Q0J A;  1SG4 A;  3VIV A;  4ZDC A;  3TLF A;  5DTW A;  2NP9 A;  3TZ3 A;  5G1R A;  4ELX A;  2Q35 A;  4GM2 A;  1PIX A;  4U0G H;  3BPT A;  3H0S A;  4U0H A;  3Q7H A;  2UZF A;  4U1A A;  1SZO A;  5C90 A;  3RST A;  4FN8 A;  1HZD A;  5MGB A;  2CE3 A;  2YJG A;  5IKL B;  4HDT A;  3P85 A;  4ELS A;  4JYL A;  3HRX A;  5DKP A;  1WZ8 A;  3Q1T A;  3JU1 A;  3QRE A;  5JBX A;  4FND A;  3IB9 A;  2D3T A;  1EF8 A;  1YG8 A;  3GF7 A;  4EMP A;  3SWX A;  5FIF A;  4EML A;  4JFC A;  4FJW D;  5DU4 A;  2DEO A;  5E0S A;  3HIN A;  2DUB A;  3RRV A;  3DJA A;  1VRG A;  3T8A A;  2WTB A;  4QFE A;  3H81 A;  4MOU A;  1RJN A;  3ISA A;  3NJB A;  3PE8 A;  1WDM A;  4I4Z A;  3M6M A;  1J7X A;  2J5G A;  3IAV A;  5ING A;  2VSS E;  4JCT A;  2PBP A;  3R6H A;  3H0U A;  4U19 A;  1PJH A;  5CTB A;  5DTP A;  1W2X A;  4WCZ A;  1MJ3 A;  1XNW A;  4KWB A;  5E0N X;  4U18 A;  3HP0 A;  4K2N A;  2F9Y B;  4ZDF A;  3TVW A;  2ZL3 A;  3STA A;  2PPY A;  3V5E A;  2J5I A;  3KTH A;  4B3H A;  2FW2 A;  1X0U A;  1Y7O A;  2ZL2 A;  3MYB A;  2ZL0 A;  4FZW C;  5G1S A;  4FNB A;  3OC7 A;  2J5I B;  1ON3 A;  4KPK A;  2CBY A;  4NEK A;  2X24 A;  1HNU A;  1Q51 A;  3TDC A;  1UYR A;  3N6R B;  1YG6 A;  5DZK A;  4I52 A;  3H0J A;  4JSB A;  4FN7 A;  2EJ5 A;  3T89 A;  3LAO A;  3I47 A;  4JCR A;  3R9Q A;  3P2L A;  2W3P A;  1FC9 A;  3SLL A;  3T8B A;  1K32 A;  2F6I A;  4HNK A;  5DUC A;  4ASI A;  4JWV A;  4ZDB A;  4WZ8 B;  3OME A;  4U0G A;  3R9T A;  3GF3 A;  4J2U A;  1K39 A;  5DL1 A;  3PZK A;  4FB8 A;  2Q2X A;  2A81 A;  2F9Y A;  3QMJ A;  3TT7 A;  4OMR A;  5C9G A;  3PGQ A;  3QYR A;  2VSU E;  2ZQR A;  5DU6 A;  3ZWA A;  5CTC A;  4NAR A; 
#chains in the Genus database with same CATH homology
 5JBW A;  1WDL A;  4K3W A;  4HC8 A;  3R9S A;  1FC7 A;  4Q1I A;  3DOR A;  1TYF A;  5DU8 A;  3ZWC A;  4NNQ A;  3ZW8 A;  3V5I A;  4B3I A;  4IZB A;  3IBB A;  1XX4 A;  4ZDD A;  3TVU A;  2J5I I;  4K29 A;  3BPP A;  3MT6 A;  3Q0G A;  3KQF A;  4JOT A;  4JVT A;  2ZQQ A;  1HNO A;  1EY3 A;  1UYS A;  1UYV A;  3H0Q A;  4JCS A;  3M6N A;  1OD4 A;  3H02 A;  2VX2 A;  4L6W A;  5HUQ A;  4KNP A;  3KTK A;  2GTR A;  3G64 A;  4L8K A;  3GKB A;  2VSU C;  1TG6 A;  3BF0 A;  1WDK A;  4I42 A;  4Z0M A;  4JJT A;  4OLQ A;  2VSU F;  3T3W A;  1NZY B;  3LKE A;  3KTJ A;  3HE2 A;  1O8U A;  3R0O A;  4IZD A;  1ON9 A;  5KDR B;  5FUS A;  3MFM A;  3ZW9 A;  3L3S A;  3GMA A;  4G2R A;  1UIY A;  3OT6 A;  4YLH A;  4GHN A;  1XNY A;  2QQ3 A;  3FDU A;  1FC6 A;  5DUF A;  2J5G D;  3TV5 A;  4KD6 A;  2F9I B;  3ST9 A;  3MOY A;  4ZDE A;  5G1Q A;  2IEX A;  4IZC A;  1XNV A;  1RJM A;  2VSS F;  1N6D A;  3WG5 A;  3TT6 A;  4FZW A;  3T88 A;  3U9R B;  5DZK H;  2HW5 A;  4EMM A;  5INI A;  2F6Q A;  3U9S B;  3K50 A;  1XO6 A;  5INF A;  4RYF A;  3P5M A;  4QIJ A;  4WYO B;  3TRR A;  2BZR A;  1OD2 A;  3HLN 1;  1EF9 A;  1DUB A;  2VSU A;  4Q0G A;  3FF6 A;  2J5S A;  3BEZ A;  4OG1 A;  1JXZ A;  3QKA A;  1N6E A;  4B3J A;  1UYT A;  4JYJ A;  4QII A;  4MXI A;  2ZL4 A;  3RSI A;  3QK8 A;  2X58 A;  3QWD A;  3NJD A;  4DI1 A;  2PG8 A;  4ZU2 A;  4LK5 A;  5KDR A;  2VSS A;  2FBM A;  1N6F A;  2C8T A;  3K8X A;  2FZS A;  1Q52 A;  3GLM A;  3U9T B;  1NZY A;  3ZWB A;  3QXZ A;  4MI2 A;  5E0S H;  4ELW A;  4RYF H;  3QXI A;  4JCQ A;  4RCN A;  1FCF A;  1DCI A;  3PEA A;  5KJP A;  4F47 A;  2A7S A;  2VRE A;  2F9I A;  3KTG A;  3KTI A;  2A7K A;  2Q34 A;  3Q0J A;  1SG4 A;  3VIV A;  4ZDC A;  3TLF A;  5DTW A;  2NP9 A;  3TZ3 A;  5G1R A;  4ELX A;  2Q35 A;  4GM2 A;  1PIX A;  4U0G H;  3BPT A;  3H0S A;  4U0H A;  3Q7H A;  2UZF A;  4U1A A;  1SZO A;  5C90 A;  3RST A;  4FN8 A;  1HZD A;  5MGB A;  2CE3 A;  2YJG A;  5IKL B;  4HDT A;  3P85 A;  4ELS A;  4JYL A;  3HRX A;  5DKP A;  1WZ8 A;  3Q1T A;  3JU1 A;  3QRE A;  5JBX A;  4FND A;  3IB9 A;  2D3T A;  1EF8 A;  1YG8 A;  3GF7 A;  4EMP A;  3SWX A;  5FIF A;  4EML A;  4JFC A;  4FJW D;  5DU4 A;  2DEO A;  5E0S A;  3HIN A;  2DUB A;  3RRV A;  3DJA A;  1VRG A;  3T8A A;  2WTB A;  4QFE A;  3H81 A;  4MOU A;  1RJN A;  3ISA A;  3NJB A;  3PE8 A;  1WDM A;  4I4Z A;  3M6M A;  1J7X A;  2J5G A;  3IAV A;  5ING A;  2VSS E;  4JCT A;  2PBP A;  3R6H A;  3H0U A;  4U19 A;  1PJH A;  5CTB A;  5DTP A;  1W2X A;  4WCZ A;  1MJ3 A;  1XNW A;  4KWB A;  5E0N X;  4U18 A;  3HP0 A;  4K2N A;  2F9Y B;  4ZDF A;  3TVW A;  2ZL3 A;  3STA A;  2PPY A;  3V5E A;  2J5I A;  3KTH A;  4B3H A;  2FW2 A;  1X0U A;  1Y7O A;  2ZL2 A;  3MYB A;  2ZL0 A;  4FZW C;  5G1S A;  4FNB A;  3OC7 A;  2J5I B;  1ON3 A;  4KPK A;  2CBY A;  4NEK A;  2X24 A;  1HNU A;  1Q51 A;  3TDC A;  1UYR A;  3N6R B;  1YG6 A;  5DZK A;  4I52 A;  3H0J A;  4JSB A;  4FN7 A;  2EJ5 A;  3T89 A;  3LAO A;  3I47 A;  4JCR A;  3R9Q A;  3P2L A;  2W3P A;  1FC9 A;  3SLL A;  3T8B A;  1K32 A;  2F6I A;  4HNK A;  5DUC A;  4ASI A;  4JWV A;  4ZDB A;  4WZ8 B;  3OME A;  4U0G A;  3R9T A;  3GF3 A;  4J2U A;  1K39 A;  5DL1 A;  3PZK A;  4FB8 A;  2Q2X A;  2A81 A;  2F9Y A;  3QMJ A;  3TT7 A;  4OMR A;  5C9G A;  3PGQ A;  3QYR A;  2VSU E;  2ZQR A;  5DU6 A;  3ZWA A;  5CTC A;  4NAR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...