3QREA

Crystal structure of an enoyl-coa hydratase echa12_1 from mycobacterium marinum
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
227
structure length
198
Chain Sequence
b'QDAVLYEATPGGVAIITFNRADRLNAWGPDLAAGFYAAIDRAEADPGIRVIVLTGRGRGFCAGARPPHFVTMLRKPVIAAINGPCVGIGLTQALMCDVRFAAAGAKFAAVFARRGLIAEFGISWILPRLTSWAVALDLLLSGRTFLAEEAAQLGLVKEVVTPEQLMPRALEYAEDIARYCSPSSMAVIKRQVYGDATR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enoyl-CoA hydratase, EchA12_1
publication title Increasing the structural coverage of tuberculosis drug targets.
pubmed doi rcsb
source organism Mycobacterium marinum m
molecule tags Lyase
total genus 74
structure length 198
sequence length 227
ec nomenclature
pdb deposition date 2011-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3qreA00
4FN7A 1O8UA 4KD6A 2ZL3A 1JXZA 2J5IB 4JCQA 1X0UA 5G1RA 2J5SA 5DZKA 4GM2A 1UYTA 3OT6A 3TT7A 4ELWA 4RCNA 3T88A 4FZWC 1XNWA 4LK5A 1SG4A 3H81A 3H0JA 2A7KA 5DTPA 1HZDA 4RYFH 1WDMA 3JU1A 5DUCA 3PGQA 1FC7A 3WG5A 4ASIA 3P85A 3H02A 3H0UA 1J7XA 3RRVA 4JCSA 5C9GA 2Q34A 3MYBA 2VSSF 4MXIA 3R9QA 1OD4A 4ELSA 4OLQA 4FB8A 5KDRB 3NJBA 1EF8A 1MJ3A 3MT6A 3U9TB 2QQ3A 1W2XA 4RYFA 2J5GD 2PPYA 3HP0A 4K3WA 4FNBA 4ZDEA 1DUBA 3ST9A 3MOYA 4U0GA 1WDLA 3ISAA 1TYFA 5G1SA 4JSBA 1WDKA 3NJDA 4FNDA 3Q1TA 3OMEA 3TV5A 3GLMA 3ZWCA 4U18A 1VRGA 3GKBA 3TLFA 1UIYA 3PEAA 4JCRA 4HNKA 2ZL0A 1FCFA 4U1AA 1XX4A 4JCTA 4GHNA 2A7SA 5E0SH 3TZ3A 4JVTA 5DL1A 3LKEA 5G1QA 3L3SA 1WZ8A 3DORA 3IB9A 4MI2A 3HRXA 1RJMA 2VSUF 2ZQQA 4Q1IA 2DUBA 3HINA 3TVUA 3QYRA 4HC8A 4B3JA 4KPKA 3QK8A 3QXZA 1Y7OA 4QIIA 2FZSA 2UZFA 1PIXA 3TVWA 2F9IA 3QREA 3QMJA 4JYJA 1UYRA 4FJWD 4KWBA 5CTBA 5INGA 3P5MA 2BZRA 5E0SA 1K32A 2W3PA 4EMLA 3BF0A 2A81A 4OMRA 3QXIA 5FUSA 3HE2A 4B3HA 5DTWA 4JWVA 4JOTA 3M6NA 2Q35A 5JBXA 4ELXA 3VIVA 3T8BA 3ZWAA 4JFCA 1ON9A 3P2LA 3Q7HA 4I52A 4K2NA 3KTHA 1EF9A 2IEXA 3OC7A 3I47A 5INIA 3H0QA 3KTJA 1XNVA 3SWXA 3G64A 4F47A 2X58A 3STAA 4YLHA 3R9SA 1RJNA 3TDCA 1PJHA 3R9TA 2VSSE 3KTGA 3PE8A 4QFEA 5KJPA 5E0NX 3FF6A 4U19A 1FC9A 3U9RB 1SZOA 2J5II 2Q2XA 4K29A 2J5GA 3PZKA 3RSTA 2F9IB 2VSUA 2EJ5A 3TRRA 1TG6A 3GF7A 4Q0GA 2F6IA 2WTBA 3K8XA 1XNYA 3V5EA 5JBWA 3BEZA 1Q51A 2FW2A 2HW5A 3QWDA 1EY3A 4IZCA 4L6WA 4WZ8B 1N6DA 2ZL4A 3R6HA 4EMPA 5C90A 3BPPA 3R0OA 4JYLA 4ZDDA 3GMAA 3LAOA 4OG1A 3U9SB 5IKLB 2DEOA 4WYOB 3V5IA 4WCZA 5DU4A 3ZW9A 1N6EA 2VSSA 4NNQA 4G2RA 2F9YA 1NZYA 2VSUE 2CBYA 1N6FA 1HNUA 3K50A 4EMMA 4MOUA 5CTCA 3SLLA 4FN8A 4U0GH 4ZU2A 1K39A 3KQFA 5DKPA 1YG8A 4ZDCA 3Q0GA 2J5IA 4I42A 4IZBA 3ZWBA 2PG8A 3RSIA 2ZQRA 4DI1A 3N6RB 3QKAA 5FIFA 3Q0JA 4L8KA 2PBPA 1OD2A 5INFA 3M6MA 4FZWA 1ON3A 2C8TA 2VSUC 4Z0MA 3IAVA 3KTIA 3IBBA 5DU8A 1FC6A 1DCIA 2F6QA 3KTKA 2FBMA 2X24A 3MFMA 4U0HA 3DJAA 2GTRA 1Q52A 1UYSA 3GF3A 4B3IA 4I4ZA 1UYVA 2CE3A 5DU6A 4KNPA 3HLN1 2VREA 4ZDFA 2VX2A 5DZKH 2ZL2A 4JJTA 1HNOA 5MGBA 4QIJA 3ZW8A 4IZDA 5DUFA 3T3WA 3H0SA 5KDRA 3T89A 1YG6A 3T8AA 2NP9A 1XO6A 4ZDBA 3TT6A 2F9YB 1NZYB 2D3TA 4NEKA 3FDUA
chains in the Genus database with same CATH superfamily
4FN7A 1O8UA 4KD6A 2ZL3A 3BPTA 1JXZA 2J5IB 4JCQA 1X0UA 5G1RA 2J5SA 5DZKA 4GM2A 1UYTA 3OT6A 3TT7A 4ELWA 4RCNA 3T88A 4FZWC 1XNWA 4LK5A 1SG4A 3H81A 3H0JA 2A7KA 5DTPA 1HZDA 4RYFH 1WDMA 3JU1A 5DUCA 3PGQA 1FC7A 3WG5A 4ASIA 3P85A 3H02A 3H0UA 1J7XA 3RRVA 4JCSA 5C9GA 2Q34A 3MYBA 2VSSF 4MXIA 3R9QA 1OD4A 4ELSA 4OLQA 4FB8A 5KDRB 3NJBA 1EF8A 1MJ3A 3MT6A 3U9TB 2QQ3A 1W2XA 4RYFA 2J5GD 2PPYA 3HP0A 4K3WA 4FNBA 4ZDEA 1DUBA 3ST9A 3MOYA 4U0GA 1WDLA 3ISAA 1TYFA 5G1SA 2YJGA 4JSBA 1WDKA 3NJDA 4FNDA 3Q1TA 3OMEA 3TV5A 3GLMA 3ZWCA 4U18A 1VRGA 3GKBA 3TLFA 1UIYA 3PEAA 4JCRA 4HNKA 2ZL0A 1FCFA 4U1AA 1XX4A 4JCTA 4GHNA 2A7SA 5E0SH 3TZ3A 4JVTA 5DL1A 3LKEA 5G1QA 3L3SA 1WZ8A 3DORA 3IB9A 4MI2A 3HRXA 1RJMA 2VSUF 2ZQQA 4Q1IA 4J2UA 2DUBA 3HINA 3TVUA 3QYRA 4HC8A 4B3JA 4KPKA 3QK8A 3QXZA 1Y7OA 4QIIA 2FZSA 2UZFA 1PIXA 3TVWA 2F9IA 3QREA 3QMJA 4JYJA 1UYRA 4FJWD 4KWBA 5CTBA 5INGA 3P5MA 2BZRA 5E0SA 1K32A 2W3PA 4EMLA 3BF0A 2A81A 4OMRA 3QXIA 5FUSA 3HE2A 4B3HA 5DTWA 4JWVA 4JOTA 3M6NA 2Q35A 5JBXA 4ELXA 3VIVA 3T8BA 3ZWAA 4JFCA 1ON9A 3P2LA 3Q7HA 4I52A 4K2NA 3KTHA 1EF9A 2IEXA 3OC7A 3I47A 5INIA 3H0QA 3KTJA 1XNVA 3SWXA 3G64A 4F47A 2X58A 3STAA 4YLHA 3R9SA 1RJNA 3TDCA 1PJHA 3R9TA 2VSSE 3KTGA 3PE8A 4QFEA 5KJPA 5E0NX 3FF6A 4U19A 4HDTA 1FC9A 3U9RB 1SZOA 2J5II 2Q2XA 4K29A 2J5GA 3PZKA 3RSTA 2F9IB 2VSUA 2EJ5A 3TRRA 1TG6A 3GF7A 4Q0GA 2F6IA 2WTBA 3K8XA 1XNYA 3V5EA 5JBWA 3BEZA 1Q51A 2FW2A 2HW5A 3QWDA 1EY3A 4IZCA 4L6WA 4WZ8B 1N6DA 2ZL4A 3R6HA 4EMPA 5C90A 3BPPA 3R0OA 4NARA 4JYLA 4ZDDA 3GMAA 3LAOA 4OG1A 3U9SB 5IKLB 2DEOA 4WYOB 3V5IA 4WCZA 5DU4A 3ZW9A 5HUQA 1N6EA 2VSSA 4NNQA 4G2RA 2F9YA 1NZYA 2VSUE 2CBYA 1N6FA 1HNUA 3K50A 4EMMA 4MOUA 5CTCA 3SLLA 4FN8A 4U0GH 4ZU2A 1K39A 3KQFA 5DKPA 1YG8A 4ZDCA 3Q0GA 2J5IA 4I42A 4IZBA 3ZWBA 2PG8A 3RSIA 2ZQRA 4DI1A 3N6RB 3QKAA 5FIFA 3Q0JA 4L8KA 2PBPA 1OD2A 5INFA 3M6MA 4FZWA 1ON3A 2C8TA 2VSUC 4Z0MA 3IAVA 3KTIA 3IBBA 5DU8A 1FC6A 1DCIA 2F6QA 3KTKA 2FBMA 2X24A 3MFMA 4U0HA 3DJAA 2GTRA 1Q52A 1UYSA 3GF3A 4B3IA 4I4ZA 1UYVA 2CE3A 5DU6A 4KNPA 3HLN1 2VREA 4ZDFA 2VX2A 5DZKH 2ZL2A 4JJTA 1HNOA 5MGBA 4QIJA 3ZW8A 4IZDA 5DUFA 3T3WA 3H0SA 5KDRA 3T89A 1YG6A 3T8AA 2NP9A 1XO6A 4ZDBA 3TT6A 2F9YB 1NZYB 2D3TA 4NEKA 3FDUA
chains in the Genus database with same CATH topology
4FN7A 1O8UA 4KD6A 2ZL3A 3BPTA 1JXZA 2J5IB 4JCQA 1X0UA 5G1RA 2J5SA 5DZKA 4GM2A 1UYTA 3OT6A 3TT7A 4ELWA 4RCNA 3T88A 4FZWC 1XNWA 4LK5A 1SG4A 3H81A 3H0JA 2A7KA 5DTPA 1HZDA 4RYFH 1WDMA 3JU1A 5DUCA 3PGQA 1FC7A 3WG5A 4ASIA 3P85A 3H02A 3H0UA 1J7XA 3RRVA 4JCSA 5C9GA 2Q34A 3MYBA 2VSSF 4MXIA 3R9QA 1OD4A 4ELSA 4OLQA 4FB8A 5KDRB 3NJBA 1EF8A 1MJ3A 3MT6A 3U9TB 2QQ3A 1W2XA 4RYFA 2J5GD 2PPYA 3HP0A 4K3WA 4FNBA 4ZDEA 1DUBA 3ST9A 3MOYA 4U0GA 1WDLA 3ISAA 1TYFA 5G1SA 2YJGA 4JSBA 1WDKA 3NJDA 4FNDA 3Q1TA 3OMEA 3TV5A 3GLMA 3ZWCA 4U18A 1VRGA 3GKBA 3TLFA 1UIYA 3PEAA 4JCRA 4HNKA 2ZL0A 1FCFA 4U1AA 1XX4A 4JCTA 4GHNA 2A7SA 5E0SH 3TZ3A 4JVTA 5DL1A 3LKEA 5G1QA 3L3SA 1WZ8A 3DORA 3IB9A 4MI2A 3HRXA 1RJMA 2VSUF 2ZQQA 4Q1IA 4J2UA 2DUBA 3HINA 3TVUA 3QYRA 4HC8A 4B3JA 4KPKA 3QK8A 3QXZA 1Y7OA 4QIIA 2FZSA 2UZFA 1PIXA 3TVWA 2F9IA 3QREA 3QMJA 4JYJA 1UYRA 4FJWD 4KWBA 5CTBA 5INGA 3P5MA 2BZRA 5E0SA 1K32A 2W3PA 4EMLA 3BF0A 2A81A 4OMRA 3QXIA 5FUSA 3HE2A 4B3HA 5DTWA 4JWVA 4JOTA 3M6NA 2Q35A 5JBXA 4ELXA 3VIVA 3T8BA 3ZWAA 4JFCA 1ON9A 3P2LA 3Q7HA 4I52A 4K2NA 3KTHA 1EF9A 2IEXA 3OC7A 3I47A 5INIA 3H0QA 3KTJA 1XNVA 3SWXA 3G64A 4F47A 2X58A 3STAA 4YLHA 3R9SA 1RJNA 3TDCA 1PJHA 3R9TA 2VSSE 3KTGA 3PE8A 4QFEA 5KJPA 5E0NX 3FF6A 4U19A 4HDTA 1FC9A 3U9RB 1SZOA 2J5II 2Q2XA 4K29A 2J5GA 3PZKA 3RSTA 2F9IB 2VSUA 2EJ5A 3TRRA 1TG6A 3GF7A 4Q0GA 2F6IA 2WTBA 3K8XA 1XNYA 3V5EA 5JBWA 3BEZA 1Q51A 2FW2A 2HW5A 3QWDA 1EY3A 4IZCA 4L6WA 4WZ8B 1N6DA 2ZL4A 3R6HA 4EMPA 5C90A 3BPPA 3R0OA 4NARA 4JYLA 4ZDDA 3GMAA 3LAOA 4OG1A 3U9SB 5IKLB 2DEOA 4WYOB 3V5IA 4WCZA 5DU4A 3ZW9A 5HUQA 1N6EA 2VSSA 4NNQA 4G2RA 2F9YA 1NZYA 2VSUE 2CBYA 1N6FA 1HNUA 3K50A 4EMMA 4MOUA 5CTCA 3SLLA 4FN8A 4U0GH 4ZU2A 1K39A 3KQFA 5DKPA 1YG8A 4ZDCA 3Q0GA 2J5IA 4I42A 4IZBA 3ZWBA 2PG8A 3RSIA 2ZQRA 4DI1A 3N6RB 3QKAA 5FIFA 3Q0JA 4L8KA 2PBPA 1OD2A 5INFA 3M6MA 4FZWA 1ON3A 2C8TA 2VSUC 4Z0MA 3IAVA 3KTIA 3IBBA 5DU8A 1FC6A 1DCIA 2F6QA 3KTKA 2FBMA 2X24A 3MFMA 4U0HA 3DJAA 2GTRA 1Q52A 1UYSA 3GF3A 4B3IA 4I4ZA 1UYVA 2CE3A 5DU6A 4KNPA 3HLN1 2VREA 4ZDFA 2VX2A 5DZKH 2ZL2A 4JJTA 1HNOA 5MGBA 4QIJA 3ZW8A 4IZDA 5DUFA 3T3WA 3H0SA 5KDRA 3T89A 1YG6A 3T8AA 2NP9A 1XO6A 4ZDBA 3TT6A 2F9YB 1NZYB 2D3TA 4NEKA 3FDUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FN7 A;  1O8U A;  4KD6 A;  2ZL3 A;  1JXZ A;  2J5I B;  4JCQ A;  1X0U A;  5G1R A;  2J5S A;  5DZK A;  4GM2 A;  1UYT A;  3OT6 A;  3TT7 A;  4ELW A;  4RCN A;  3T88 A;  4FZW C;  1XNW A;  4LK5 A;  1SG4 A;  3H81 A;  3H0J A;  2A7K A;  5DTP A;  1HZD A;  4RYF H;  1WDM A;  3JU1 A;  5DUC A;  3PGQ A;  1FC7 A;  3WG5 A;  4ASI A;  3P85 A;  3H02 A;  3H0U A;  1J7X A;  3RRV A;  4JCS A;  5C9G A;  2Q34 A;  3MYB A;  2VSS F;  4MXI A;  3R9Q A;  1OD4 A;  4ELS A;  4OLQ A;  4FB8 A;  5KDR B;  3NJB A;  1EF8 A;  1MJ3 A;  3MT6 A;  3U9T B;  2QQ3 A;  1W2X A;  4RYF A;  2J5G D;  2PPY A;  3HP0 A;  4K3W A;  4FNB A;  4ZDE A;  1DUB A;  3ST9 A;  3MOY A;  4U0G A;  1WDL A;  3ISA A;  1TYF A;  5G1S A;  4JSB A;  1WDK A;  3NJD A;  4FND A;  3Q1T A;  3OME A;  3TV5 A;  3GLM A;  3ZWC A;  4U18 A;  1VRG A;  3GKB A;  3TLF A;  1UIY A;  3PEA A;  4JCR A;  4HNK A;  2ZL0 A;  1FCF A;  4U1A A;  1XX4 A;  4JCT A;  4GHN A;  2A7S A;  5E0S H;  3TZ3 A;  4JVT A;  5DL1 A;  3LKE A;  5G1Q A;  3L3S A;  1WZ8 A;  3DOR A;  3IB9 A;  4MI2 A;  3HRX A;  1RJM A;  2VSU F;  2ZQQ A;  4Q1I A;  2DUB A;  3HIN A;  3TVU A;  3QYR A;  4HC8 A;  4B3J A;  4KPK A;  3QK8 A;  3QXZ A;  1Y7O A;  4QII A;  2FZS A;  2UZF A;  1PIX A;  3TVW A;  2F9I A;  3QRE A;  3QMJ A;  4JYJ A;  1UYR A;  4FJW D;  4KWB A;  5CTB A;  5ING A;  3P5M A;  2BZR A;  5E0S A;  1K32 A;  2W3P A;  4EML A;  3BF0 A;  2A81 A;  4OMR A;  3QXI A;  5FUS A;  3HE2 A;  4B3H A;  5DTW A;  4JWV A;  4JOT A;  3M6N A;  2Q35 A;  5JBX A;  4ELX A;  3VIV A;  3T8B A;  3ZWA A;  4JFC A;  1ON9 A;  3P2L A;  3Q7H A;  4I52 A;  4K2N A;  3KTH A;  1EF9 A;  2IEX A;  3OC7 A;  3I47 A;  5INI A;  3H0Q A;  3KTJ A;  1XNV A;  3SWX A;  3G64 A;  4F47 A;  2X58 A;  3STA A;  4YLH A;  3R9S A;  1RJN A;  3TDC A;  1PJH A;  3R9T A;  2VSS E;  3KTG A;  3PE8 A;  4QFE A;  5KJP A;  5E0N X;  3FF6 A;  4U19 A;  1FC9 A;  3U9R B;  1SZO A;  2J5I I;  2Q2X A;  4K29 A;  2J5G A;  3PZK A;  3RST A;  2F9I B;  2VSU A;  2EJ5 A;  3TRR A;  1TG6 A;  3GF7 A;  4Q0G A;  2F6I A;  2WTB A;  3K8X A;  1XNY A;  3V5E A;  5JBW A;  3BEZ A;  1Q51 A;  2FW2 A;  2HW5 A;  3QWD A;  1EY3 A;  4IZC A;  4L6W A;  4WZ8 B;  1N6D A;  2ZL4 A;  3R6H A;  4EMP A;  5C90 A;  3BPP A;  3R0O A;  4JYL A;  4ZDD A;  3GMA A;  3LAO A;  4OG1 A;  3U9S B;  5IKL B;  2DEO A;  4WYO B;  3V5I A;  4WCZ A;  5DU4 A;  3ZW9 A;  1N6E A;  2VSS A;  4NNQ A;  4G2R A;  2F9Y A;  1NZY A;  2VSU E;  2CBY A;  1N6F A;  1HNU A;  3K50 A;  4EMM A;  4MOU A;  5CTC A;  3SLL A;  4FN8 A;  4U0G H;  4ZU2 A;  1K39 A;  3KQF A;  5DKP A;  1YG8 A;  4ZDC A;  3Q0G A;  2J5I A;  4I42 A;  4IZB A;  3ZWB A;  2PG8 A;  3RSI A;  2ZQR A;  4DI1 A;  3N6R B;  3QKA A;  5FIF A;  3Q0J A;  4L8K A;  2PBP A;  1OD2 A;  5INF A;  3M6M A;  4FZW A;  1ON3 A;  2C8T A;  2VSU C;  4Z0M A;  3IAV A;  3KTI A;  3IBB A;  5DU8 A;  1FC6 A;  1DCI A;  2F6Q A;  3KTK A;  2FBM A;  2X24 A;  3MFM A;  4U0H A;  3DJA A;  2GTR A;  1Q52 A;  1UYS A;  3GF3 A;  4B3I A;  4I4Z A;  1UYV A;  2CE3 A;  5DU6 A;  4KNP A;  3HLN 1;  2VRE A;  4ZDF A;  2VX2 A;  5DZK H;  2ZL2 A;  4JJT A;  1HNO A;  5MGB A;  4QIJ A;  3ZW8 A;  4IZD A;  5DUF A;  3T3W A;  3H0S A;  5KDR A;  3T89 A;  1YG6 A;  3T8A A;  2NP9 A;  1XO6 A;  4ZDB A;  3TT6 A;  2F9Y B;  1NZY B;  2D3T A;  4NEK A;  3FDU A; 
#chains in the Genus database with same CATH topology
 4FN7 A;  1O8U A;  4KD6 A;  2ZL3 A;  3BPT A;  1JXZ A;  2J5I B;  4JCQ A;  1X0U A;  5G1R A;  2J5S A;  5DZK A;  4GM2 A;  1UYT A;  3OT6 A;  3TT7 A;  4ELW A;  4RCN A;  3T88 A;  4FZW C;  1XNW A;  4LK5 A;  1SG4 A;  3H81 A;  3H0J A;  2A7K A;  5DTP A;  1HZD A;  4RYF H;  1WDM A;  3JU1 A;  5DUC A;  3PGQ A;  1FC7 A;  3WG5 A;  4ASI A;  3P85 A;  3H02 A;  3H0U A;  1J7X A;  3RRV A;  4JCS A;  5C9G A;  2Q34 A;  3MYB A;  2VSS F;  4MXI A;  3R9Q A;  1OD4 A;  4ELS A;  4OLQ A;  4FB8 A;  5KDR B;  3NJB A;  1EF8 A;  1MJ3 A;  3MT6 A;  3U9T B;  2QQ3 A;  1W2X A;  4RYF A;  2J5G D;  2PPY A;  3HP0 A;  4K3W A;  4FNB A;  4ZDE A;  1DUB A;  3ST9 A;  3MOY A;  4U0G A;  1WDL A;  3ISA A;  1TYF A;  5G1S A;  2YJG A;  4JSB A;  1WDK A;  3NJD A;  4FND A;  3Q1T A;  3OME A;  3TV5 A;  3GLM A;  3ZWC A;  4U18 A;  1VRG A;  3GKB A;  3TLF A;  1UIY A;  3PEA A;  4JCR A;  4HNK A;  2ZL0 A;  1FCF A;  4U1A A;  1XX4 A;  4JCT A;  4GHN A;  2A7S A;  5E0S H;  3TZ3 A;  4JVT A;  5DL1 A;  3LKE A;  5G1Q A;  3L3S A;  1WZ8 A;  3DOR A;  3IB9 A;  4MI2 A;  3HRX A;  1RJM A;  2VSU F;  2ZQQ A;  4Q1I A;  4J2U A;  2DUB A;  3HIN A;  3TVU A;  3QYR A;  4HC8 A;  4B3J A;  4KPK A;  3QK8 A;  3QXZ A;  1Y7O A;  4QII A;  2FZS A;  2UZF A;  1PIX A;  3TVW A;  2F9I A;  3QRE A;  3QMJ A;  4JYJ A;  1UYR A;  4FJW D;  4KWB A;  5CTB A;  5ING A;  3P5M A;  2BZR A;  5E0S A;  1K32 A;  2W3P A;  4EML A;  3BF0 A;  2A81 A;  4OMR A;  3QXI A;  5FUS A;  3HE2 A;  4B3H A;  5DTW A;  4JWV A;  4JOT A;  3M6N A;  2Q35 A;  5JBX A;  4ELX A;  3VIV A;  3T8B A;  3ZWA A;  4JFC A;  1ON9 A;  3P2L A;  3Q7H A;  4I52 A;  4K2N A;  3KTH A;  1EF9 A;  2IEX A;  3OC7 A;  3I47 A;  5INI A;  3H0Q A;  3KTJ A;  1XNV A;  3SWX A;  3G64 A;  4F47 A;  2X58 A;  3STA A;  4YLH A;  3R9S A;  1RJN A;  3TDC A;  1PJH A;  3R9T A;  2VSS E;  3KTG A;  3PE8 A;  4QFE A;  5KJP A;  5E0N X;  3FF6 A;  4U19 A;  4HDT A;  1FC9 A;  3U9R B;  1SZO A;  2J5I I;  2Q2X A;  4K29 A;  2J5G A;  3PZK A;  3RST A;  2F9I B;  2VSU A;  2EJ5 A;  3TRR A;  1TG6 A;  3GF7 A;  4Q0G A;  2F6I A;  2WTB A;  3K8X A;  1XNY A;  3V5E A;  5JBW A;  3BEZ A;  1Q51 A;  2FW2 A;  2HW5 A;  3QWD A;  1EY3 A;  4IZC A;  4L6W A;  4WZ8 B;  1N6D A;  2ZL4 A;  3R6H A;  4EMP A;  5C90 A;  3BPP A;  3R0O A;  4NAR A;  4JYL A;  4ZDD A;  3GMA A;  3LAO A;  4OG1 A;  3U9S B;  5IKL B;  2DEO A;  4WYO B;  3V5I A;  4WCZ A;  5DU4 A;  3ZW9 A;  5HUQ A;  1N6E A;  2VSS A;  4NNQ A;  4G2R A;  2F9Y A;  1NZY A;  2VSU E;  2CBY A;  1N6F A;  1HNU A;  3K50 A;  4EMM A;  4MOU A;  5CTC A;  3SLL A;  4FN8 A;  4U0G H;  4ZU2 A;  1K39 A;  3KQF A;  5DKP A;  1YG8 A;  4ZDC A;  3Q0G A;  2J5I A;  4I42 A;  4IZB A;  3ZWB A;  2PG8 A;  3RSI A;  2ZQR A;  4DI1 A;  3N6R B;  3QKA A;  5FIF A;  3Q0J A;  4L8K A;  2PBP A;  1OD2 A;  5INF A;  3M6M A;  4FZW A;  1ON3 A;  2C8T A;  2VSU C;  4Z0M A;  3IAV A;  3KTI A;  3IBB A;  5DU8 A;  1FC6 A;  1DCI A;  2F6Q A;  3KTK A;  2FBM A;  2X24 A;  3MFM A;  4U0H A;  3DJA A;  2GTR A;  1Q52 A;  1UYS A;  3GF3 A;  4B3I A;  4I4Z A;  1UYV A;  2CE3 A;  5DU6 A;  4KNP A;  3HLN 1;  2VRE A;  4ZDF A;  2VX2 A;  5DZK H;  2ZL2 A;  4JJT A;  1HNO A;  5MGB A;  4QIJ A;  3ZW8 A;  4IZD A;  5DUF A;  3T3W A;  3H0S A;  5KDR A;  3T89 A;  1YG6 A;  3T8A A;  2NP9 A;  1XO6 A;  4ZDB A;  3TT6 A;  2F9Y B;  1NZY B;  2D3T A;  4NEK A;  3FDU A; 
#chains in the Genus database with same CATH homology
 4FN7 A;  1O8U A;  4KD6 A;  2ZL3 A;  3BPT A;  1JXZ A;  2J5I B;  4JCQ A;  1X0U A;  5G1R A;  2J5S A;  5DZK A;  4GM2 A;  1UYT A;  3OT6 A;  3TT7 A;  4ELW A;  4RCN A;  3T88 A;  4FZW C;  1XNW A;  4LK5 A;  1SG4 A;  3H81 A;  3H0J A;  2A7K A;  5DTP A;  1HZD A;  4RYF H;  1WDM A;  3JU1 A;  5DUC A;  3PGQ A;  1FC7 A;  3WG5 A;  4ASI A;  3P85 A;  3H02 A;  3H0U A;  1J7X A;  3RRV A;  4JCS A;  5C9G A;  2Q34 A;  3MYB A;  2VSS F;  4MXI A;  3R9Q A;  1OD4 A;  4ELS A;  4OLQ A;  4FB8 A;  5KDR B;  3NJB A;  1EF8 A;  1MJ3 A;  3MT6 A;  3U9T B;  2QQ3 A;  1W2X A;  4RYF A;  2J5G D;  2PPY A;  3HP0 A;  4K3W A;  4FNB A;  4ZDE A;  1DUB A;  3ST9 A;  3MOY A;  4U0G A;  1WDL A;  3ISA A;  1TYF A;  5G1S A;  2YJG A;  4JSB A;  1WDK A;  3NJD A;  4FND A;  3Q1T A;  3OME A;  3TV5 A;  3GLM A;  3ZWC A;  4U18 A;  1VRG A;  3GKB A;  3TLF A;  1UIY A;  3PEA A;  4JCR A;  4HNK A;  2ZL0 A;  1FCF A;  4U1A A;  1XX4 A;  4JCT A;  4GHN A;  2A7S A;  5E0S H;  3TZ3 A;  4JVT A;  5DL1 A;  3LKE A;  5G1Q A;  3L3S A;  1WZ8 A;  3DOR A;  3IB9 A;  4MI2 A;  3HRX A;  1RJM A;  2VSU F;  2ZQQ A;  4Q1I A;  4J2U A;  2DUB A;  3HIN A;  3TVU A;  3QYR A;  4HC8 A;  4B3J A;  4KPK A;  3QK8 A;  3QXZ A;  1Y7O A;  4QII A;  2FZS A;  2UZF A;  1PIX A;  3TVW A;  2F9I A;  3QRE A;  3QMJ A;  4JYJ A;  1UYR A;  4FJW D;  4KWB A;  5CTB A;  5ING A;  3P5M A;  2BZR A;  5E0S A;  1K32 A;  2W3P A;  4EML A;  3BF0 A;  2A81 A;  4OMR A;  3QXI A;  5FUS A;  3HE2 A;  4B3H A;  5DTW A;  4JWV A;  4JOT A;  3M6N A;  2Q35 A;  5JBX A;  4ELX A;  3VIV A;  3T8B A;  3ZWA A;  4JFC A;  1ON9 A;  3P2L A;  3Q7H A;  4I52 A;  4K2N A;  3KTH A;  1EF9 A;  2IEX A;  3OC7 A;  3I47 A;  5INI A;  3H0Q A;  3KTJ A;  1XNV A;  3SWX A;  3G64 A;  4F47 A;  2X58 A;  3STA A;  4YLH A;  3R9S A;  1RJN A;  3TDC A;  1PJH A;  3R9T A;  2VSS E;  3KTG A;  3PE8 A;  4QFE A;  5KJP A;  5E0N X;  3FF6 A;  4U19 A;  4HDT A;  1FC9 A;  3U9R B;  1SZO A;  2J5I I;  2Q2X A;  4K29 A;  2J5G A;  3PZK A;  3RST A;  2F9I B;  2VSU A;  2EJ5 A;  3TRR A;  1TG6 A;  3GF7 A;  4Q0G A;  2F6I A;  2WTB A;  3K8X A;  1XNY A;  3V5E A;  5JBW A;  3BEZ A;  1Q51 A;  2FW2 A;  2HW5 A;  3QWD A;  1EY3 A;  4IZC A;  4L6W A;  4WZ8 B;  1N6D A;  2ZL4 A;  3R6H A;  4EMP A;  5C90 A;  3BPP A;  3R0O A;  4NAR A;  4JYL A;  4ZDD A;  3GMA A;  3LAO A;  4OG1 A;  3U9S B;  5IKL B;  2DEO A;  4WYO B;  3V5I A;  4WCZ A;  5DU4 A;  3ZW9 A;  5HUQ A;  1N6E A;  2VSS A;  4NNQ A;  4G2R A;  2F9Y A;  1NZY A;  2VSU E;  2CBY A;  1N6F A;  1HNU A;  3K50 A;  4EMM A;  4MOU A;  5CTC A;  3SLL A;  4FN8 A;  4U0G H;  4ZU2 A;  1K39 A;  3KQF A;  5DKP A;  1YG8 A;  4ZDC A;  3Q0G A;  2J5I A;  4I42 A;  4IZB A;  3ZWB A;  2PG8 A;  3RSI A;  2ZQR A;  4DI1 A;  3N6R B;  3QKA A;  5FIF A;  3Q0J A;  4L8K A;  2PBP A;  1OD2 A;  5INF A;  3M6M A;  4FZW A;  1ON3 A;  2C8T A;  2VSU C;  4Z0M A;  3IAV A;  3KTI A;  3IBB A;  5DU8 A;  1FC6 A;  1DCI A;  2F6Q A;  3KTK A;  2FBM A;  2X24 A;  3MFM A;  4U0H A;  3DJA A;  2GTR A;  1Q52 A;  1UYS A;  3GF3 A;  4B3I A;  4I4Z A;  1UYV A;  2CE3 A;  5DU6 A;  4KNP A;  3HLN 1;  2VRE A;  4ZDF A;  2VX2 A;  5DZK H;  2ZL2 A;  4JJT A;  1HNO A;  5MGB A;  4QIJ A;  3ZW8 A;  4IZD A;  5DUF A;  3T3W A;  3H0S A;  5KDR A;  3T89 A;  1YG6 A;  3T8A A;  2NP9 A;  1XO6 A;  4ZDB A;  3TT6 A;  2F9Y B;  1NZY B;  2D3T A;  4NEK A;  3FDU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...