3QREA

Crystal structure of an enoyl-coa hydratase echa12_1 from mycobacterium marinum
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
227
structure length
198
Chain Sequence
QDAVLYEATPGGVAIITFNRADRLNAWGPDLAAGFYAAIDRAEADPGIRVIVLTGRGRGFCAGARPPHFVTMLRKPVIAAINGPCVGIGLTQALMCDVRFAAAGAKFAAVFARRGLIAEFGISWILPRLTSWAVALDLLLSGRTFLAEEAAQLGLVKEVVTPEQLMPRALEYAEDIARYCSPSSMAVIKRQVYGDATR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enoyl-CoA hydratase, EchA12_1
publication title Increasing the structural coverage of tuberculosis drug targets.
pubmed doi rcsb
source organism Mycobacterium marinum m
molecule tags Lyase
total genus 74
structure length 198
sequence length 227
ec nomenclature
pdb deposition date 2011-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3qreA00
3NJDA 4FNDA 3I47A 4ZDDA 5MGBA 1YG8A 4ZDCA 3Q7HA 3JU1A 2VX2A 1SZOA 1HNUA 4QIIA 3ZW8A 5DKPA 3ZWAA 1OD4A 1N6DA 4KNPA 2F9IB 2ZL2A 2CBYA 5JBXA 3QREA 4I42A 1Q52A 4Q1IA 4FN7A 4JWVA 2VSUC 1ON3A 1XX4A 4OLQA 3DJAA 5INFA 3IAVA 5DU8A 4LK5A 3TT7A 3LAOA 3V5EA 5DZKH 2F6IA 3ST9A 3T8BA 3TRRA 4EMMA 2GTRA 4JYLA 3R9TA 4K3WA 3BPPA 4FN8A 1DCIA 4EMPA 1WDKA 2VSSF 3M6MA 4Z0MA 3T8AA 4GM2A 2F9YB 3TVWA 3GLMA 3KQFA 3U9TB 3HINA 1WZ8A 3P85A 3T3WA 1UYRA 4OMRA 3QYRA 1PJHA 4HNKA 2J5II 1TG6A 4L8KA 2Q35A 3PE8A 4ZDEA 3SWXA 2ZQQA 3RSIA 4FZWC 3RRVA 3KTJA 3QXIA 3G64A 3GKBA 5IKLB 3P5MA 3H0UA 3QKAA 1HZDA 3R6HA 1EY3A 3GMAA 2ZQRA 2F9IA 4I4ZA 2PG8A 3OT6A 2VSSA 4JSBA 2EJ5A 4JCRA 5JBWA 2VSUF 3GF3A 4WYOB 2FBMA 2ZL0A 3MOYA 2CE3A 3TVUA 1DUBA 4MI2A 5DZKA 3T89A 2WTBA 1UYTA 1UYVA 5KDRB 3TDCA 4I52A 2J5IB 1K32A 4QFEA 1UYSA 2PPYA 5E0NX 4NEKA 5DU6A 3ISAA 1FC6A 3H0JA 2Q2XA 3PGQA 4ASIA 4B3IA 2F9YA 2UZFA 4HC8A 3ZWBA 3H0QA 3R9SA 2VSUA 1PIXA 4JCSA 1RJNA 1WDLA 2DEOA 5FUSA 3MT6A 1SG4A 4IZBA 1N6EA 4KD6A 3OC7A 3M6NA 4QIJA 4B3JA 3HP0A 5CTCA 2ZL4A 3QWDA 4JYJA 2A7SA 3TT6A 4IZCA 2HW5A 4ZDBA 5DUFA 4U18A 5G1RA 3VIVA 1NZYB 3LKEA 4GHNA 4WCZA 4RCNA 5INGA 3K8XA 3T88A 4U19A 3QK8A 1EF8A 4G2RA 3TV5A 1EF9A 1J7XA 3L3SA 2X58A 3HRXA 3QMJA 1O8UA 4JCTA 3TZ3A 2FZSA 1Q51A 2NP9A 3IBBA 2VSSE 3IB9A 1K39A 4F47A 5KDRA 3RSTA 2J5IA 1YG6A 3R9QA 4FZWA 3Q0JA 1Y7OA 3H81A 4U1AA 3KTGA 1WDMA 4U0HA 4ELXA 3KTKA 1OD2A 3Q1TA 3MFMA 1JXZA 3P2LA 2D3TA 3HE2A 4B3HA 3STAA 4Q0GA 5DU4A 1XNYA 2BZRA 3KTIA 2FW2A 3HLN1 4ZDFA 4K29A 3U9SB 5INIA 5E0SA 2J5SA 2VSUE 4MOUA 3NJBA 3WG5A 4YLHA 2J5GA 1XNWA 3H02A 5FIFA 1NZYA 4OG1A 1N6FA 2J5GD 4DI1A 4U0GA 2A81A 3SLLA 3OMEA 3U9RB 4EMLA 4JJTA 1XO6A 3GF7A 3KTHA 3V5IA 1MJ3A 1XNVA 1FCFA 5DTWA 2QQ3A 1HNOA 5C9GA 2W3PA 4KPKA 3R0OA 5E0SH 4JVTA 5DL1A 4IZDA 3ZW9A 2C8TA 3BEZA 1TYFA 4JCQA 3Q0GA 4MXIA 3ZWCA 1UIYA 3QXZA 3TLFA 4RYFA 2VREA 4U0GH 2IEXA 2F6QA 4WZ8B 5G1SA 3PEAA 4ZU2A 5G1QA 4L6WA 1ON9A 4FB8A 3FF6A 2X24A 3DORA 1FC7A 2ZL3A 4ELWA 4JOTA 5KJPA 1X0UA 1RJMA 1FC9A 4ELSA 4KWBA 2A7KA 3FDUA 4JFCA 5DUCA 2Q34A 4RYFH 4NNQA 5CTBA 3K50A 3PZKA 3H0SA 3MYBA 5C90A 2PBPA 4FJWD 4K2NA 2DUBA 4FNBA 3N6RB 1W2XA 1VRGA 3BF0A 5DTPA
chains in the Genus database with same CATH superfamily
3NJDA 4FNDA 3I47A 4ZDDA 5MGBA 1YG8A 4ZDCA 3Q7HA 3JU1A 2VX2A 1SZOA 1HNUA 4QIIA 3ZW8A 5DKPA 3ZWAA 1OD4A 1N6DA 4KNPA 2F9IB 2ZL2A 2CBYA 5JBXA 3QREA 4I42A 1Q52A 4Q1IA 4FN7A 4JWVA 2VSUC 1ON3A 1XX4A 4OLQA 3DJAA 5INFA 3IAVA 5DU8A 4LK5A 3TT7A 3LAOA 3V5EA 5DZKH 2F6IA 3ST9A 3T8BA 3TRRA 4EMMA 2GTRA 4JYLA 3R9TA 4K3WA 3BPPA 4J2UA 4FN8A 1DCIA 4EMPA 1WDKA 2VSSF 3M6MA 4Z0MA 5HUQA 3T8AA 4GM2A 2F9YB 3TVWA 3GLMA 3KQFA 3U9TB 3HINA 1WZ8A 3P85A 3T3WA 1UYRA 4OMRA 3QYRA 1PJHA 4HNKA 2J5II 1TG6A 4L8KA 2Q35A 3PE8A 4ZDEA 3SWXA 2ZQQA 3RSIA 4FZWC 3RRVA 3KTJA 3QXIA 3G64A 3GKBA 5IKLB 3P5MA 3H0UA 3QKAA 1HZDA 3R6HA 1EY3A 3GMAA 2ZQRA 2F9IA 4I4ZA 2PG8A 3OT6A 2VSSA 4JSBA 2EJ5A 4JCRA 5JBWA 2VSUF 3GF3A 4WYOB 2FBMA 2ZL0A 3MOYA 2CE3A 4HDTA 3TVUA 1DUBA 4MI2A 5DZKA 3T89A 2WTBA 1UYTA 1UYVA 5KDRB 3TDCA 4I52A 2J5IB 1K32A 4QFEA 1UYSA 2PPYA 5E0NX 4NEKA 5DU6A 3ISAA 1FC6A 3H0JA 2Q2XA 3PGQA 4ASIA 4B3IA 2F9YA 2UZFA 4HC8A 3ZWBA 3H0QA 3R9SA 2VSUA 1PIXA 4JCSA 1RJNA 1WDLA 2DEOA 5FUSA 3MT6A 1SG4A 4IZBA 1N6EA 4KD6A 3OC7A 3M6NA 4QIJA 4B3JA 3HP0A 5CTCA 2ZL4A 3QWDA 4JYJA 2A7SA 3TT6A 4IZCA 2HW5A 4ZDBA 5DUFA 4U18A 5G1RA 3VIVA 1NZYB 3LKEA 4GHNA 4WCZA 4RCNA 5INGA 3K8XA 3T88A 4U19A 3QK8A 1EF8A 4G2RA 3TV5A 1EF9A 1J7XA 3L3SA 2X58A 3HRXA 3QMJA 1O8UA 4JCTA 3TZ3A 2FZSA 1Q51A 2NP9A 3IBBA 2VSSE 3IB9A 1K39A 4F47A 5KDRA 3RSTA 2J5IA 1YG6A 3R9QA 4FZWA 3Q0JA 1Y7OA 3H81A 4U1AA 3KTGA 1WDMA 4U0HA 4ELXA 3KTKA 1OD2A 3Q1TA 3MFMA 1JXZA 3P2LA 2D3TA 3HE2A 4B3HA 3STAA 4Q0GA 5DU4A 1XNYA 2BZRA 3KTIA 2FW2A 3HLN1 4ZDFA 4K29A 3U9SB 4NARA 5INIA 5E0SA 2J5SA 2VSUE 4MOUA 3NJBA 3WG5A 4YLHA 2J5GA 1XNWA 3H02A 5FIFA 1NZYA 4OG1A 1N6FA 2J5GD 4DI1A 4U0GA 2A81A 3SLLA 3OMEA 3U9RB 4EMLA 4JJTA 1XO6A 3GF7A 3KTHA 3V5IA 1MJ3A 3BPTA 1XNVA 1FCFA 5DTWA 2QQ3A 1HNOA 5C9GA 2W3PA 4KPKA 3R0OA 5E0SH 4JVTA 5DL1A 4IZDA 3ZW9A 2C8TA 3BEZA 1TYFA 4JCQA 3Q0GA 4MXIA 3ZWCA 1UIYA 3QXZA 3TLFA 4RYFA 2VREA 4U0GH 2IEXA 2F6QA 4WZ8B 5G1SA 3PEAA 4ZU2A 5G1QA 4L6WA 1ON9A 4FB8A 3FF6A 2X24A 3DORA 1FC7A 2ZL3A 4ELWA 4JOTA 5KJPA 1X0UA 1RJMA 1FC9A 4ELSA 4KWBA 2A7KA 3FDUA 4JFCA 5DUCA 2Q34A 4RYFH 4NNQA 5CTBA 3K50A 3PZKA 3H0SA 3MYBA 5C90A 2PBPA 4FJWD 4K2NA 2DUBA 4FNBA 3N6RB 1W2XA 1VRGA 2YJGA 3BF0A 5DTPA
chains in the Genus database with same CATH topology
3NJDA 4FNDA 3I47A 4ZDDA 5MGBA 1YG8A 4ZDCA 3Q7HA 3JU1A 2VX2A 1SZOA 1HNUA 4QIIA 3ZW8A 5DKPA 3ZWAA 1OD4A 1N6DA 4KNPA 2F9IB 2ZL2A 2CBYA 5JBXA 3QREA 4I42A 1Q52A 4Q1IA 4FN7A 4JWVA 2VSUC 1ON3A 1XX4A 4OLQA 3DJAA 5INFA 3IAVA 5DU8A 4LK5A 3TT7A 3LAOA 3V5EA 5DZKH 2F6IA 3ST9A 3T8BA 3TRRA 4EMMA 2GTRA 4JYLA 3R9TA 4K3WA 3BPPA 4J2UA 4FN8A 1DCIA 4EMPA 1WDKA 2VSSF 3M6MA 4Z0MA 5HUQA 3T8AA 4GM2A 2F9YB 3TVWA 3GLMA 3KQFA 3U9TB 3HINA 1WZ8A 3P85A 3T3WA 1UYRA 4OMRA 3QYRA 1PJHA 4HNKA 2J5II 1TG6A 4L8KA 2Q35A 3PE8A 4ZDEA 3SWXA 2ZQQA 3RSIA 4FZWC 3RRVA 3KTJA 3QXIA 3G64A 3GKBA 5IKLB 3P5MA 3H0UA 3QKAA 1HZDA 3R6HA 1EY3A 3GMAA 2ZQRA 2F9IA 4I4ZA 2PG8A 3OT6A 2VSSA 4JSBA 2EJ5A 4JCRA 5JBWA 2VSUF 3GF3A 4WYOB 2FBMA 2ZL0A 3MOYA 2CE3A 4HDTA 3TVUA 1DUBA 4MI2A 5DZKA 3T89A 2WTBA 1UYTA 1UYVA 5KDRB 3TDCA 4I52A 2J5IB 1K32A 4QFEA 1UYSA 2PPYA 5E0NX 4NEKA 5DU6A 3ISAA 1FC6A 3H0JA 2Q2XA 3PGQA 4ASIA 4B3IA 2F9YA 2UZFA 4HC8A 3ZWBA 3H0QA 3R9SA 2VSUA 1PIXA 4JCSA 1RJNA 1WDLA 2DEOA 5FUSA 3MT6A 1SG4A 4IZBA 1N6EA 4KD6A 3OC7A 3M6NA 4QIJA 4B3JA 3HP0A 5CTCA 2ZL4A 3QWDA 4JYJA 2A7SA 3TT6A 4IZCA 2HW5A 4ZDBA 5DUFA 4U18A 5G1RA 3VIVA 1NZYB 3LKEA 4GHNA 4WCZA 4RCNA 5INGA 3K8XA 3T88A 4U19A 3QK8A 1EF8A 4G2RA 3TV5A 1EF9A 1J7XA 3L3SA 2X58A 3HRXA 3QMJA 1O8UA 4JCTA 3TZ3A 2FZSA 1Q51A 2NP9A 3IBBA 2VSSE 3IB9A 1K39A 4F47A 5KDRA 3RSTA 2J5IA 1YG6A 3R9QA 4FZWA 3Q0JA 1Y7OA 3H81A 4U1AA 3KTGA 1WDMA 4U0HA 4ELXA 3KTKA 1OD2A 3Q1TA 3MFMA 1JXZA 3P2LA 2D3TA 3HE2A 4B3HA 3STAA 4Q0GA 5DU4A 1XNYA 2BZRA 3KTIA 2FW2A 3HLN1 4ZDFA 4K29A 3U9SB 4NARA 5INIA 5E0SA 2J5SA 2VSUE 4MOUA 3NJBA 3WG5A 4YLHA 2J5GA 1XNWA 3H02A 5FIFA 1NZYA 4OG1A 1N6FA 2J5GD 4DI1A 4U0GA 2A81A 3SLLA 3OMEA 3U9RB 4EMLA 4JJTA 1XO6A 3GF7A 3KTHA 3V5IA 1MJ3A 3BPTA 1XNVA 1FCFA 5DTWA 2QQ3A 1HNOA 5C9GA 2W3PA 4KPKA 3R0OA 5E0SH 4JVTA 5DL1A 4IZDA 3ZW9A 2C8TA 3BEZA 1TYFA 4JCQA 3Q0GA 4MXIA 3ZWCA 1UIYA 3QXZA 3TLFA 4RYFA 2VREA 4U0GH 2IEXA 2F6QA 4WZ8B 5G1SA 3PEAA 4ZU2A 5G1QA 4L6WA 1ON9A 4FB8A 3FF6A 2X24A 3DORA 1FC7A 2ZL3A 4ELWA 4JOTA 5KJPA 1X0UA 1RJMA 1FC9A 4ELSA 4KWBA 2A7KA 3FDUA 4JFCA 5DUCA 2Q34A 4RYFH 4NNQA 5CTBA 3K50A 3PZKA 3H0SA 3MYBA 5C90A 2PBPA 4FJWD 4K2NA 2DUBA 4FNBA 3N6RB 1W2XA 1VRGA 2YJGA 3BF0A 5DTPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NJD A;  4FND A;  3I47 A;  4ZDD A;  5MGB A;  1YG8 A;  4ZDC A;  3Q7H A;  3JU1 A;  2VX2 A;  1SZO A;  1HNU A;  4QII A;  3ZW8 A;  5DKP A;  3ZWA A;  1OD4 A;  1N6D A;  4KNP A;  2F9I B;  2ZL2 A;  2CBY A;  5JBX A;  3QRE A;  4I42 A;  1Q52 A;  4Q1I A;  4FN7 A;  4JWV A;  2VSU C;  1ON3 A;  1XX4 A;  4OLQ A;  3DJA A;  5INF A;  3IAV A;  5DU8 A;  4LK5 A;  3TT7 A;  3LAO A;  3V5E A;  5DZK H;  2F6I A;  3ST9 A;  3T8B A;  3TRR A;  4EMM A;  2GTR A;  4JYL A;  3R9T A;  4K3W A;  3BPP A;  4FN8 A;  1DCI A;  4EMP A;  1WDK A;  2VSS F;  3M6M A;  4Z0M A;  3T8A A;  4GM2 A;  2F9Y B;  3TVW A;  3GLM A;  3KQF A;  3U9T B;  3HIN A;  1WZ8 A;  3P85 A;  3T3W A;  1UYR A;  4OMR A;  3QYR A;  1PJH A;  4HNK A;  2J5I I;  1TG6 A;  4L8K A;  2Q35 A;  3PE8 A;  4ZDE A;  3SWX A;  2ZQQ A;  3RSI A;  4FZW C;  3RRV A;  3KTJ A;  3QXI A;  3G64 A;  3GKB A;  5IKL B;  3P5M A;  3H0U A;  3QKA A;  1HZD A;  3R6H A;  1EY3 A;  3GMA A;  2ZQR A;  2F9I A;  4I4Z A;  2PG8 A;  3OT6 A;  2VSS A;  4JSB A;  2EJ5 A;  4JCR A;  5JBW A;  2VSU F;  3GF3 A;  4WYO B;  2FBM A;  2ZL0 A;  3MOY A;  2CE3 A;  3TVU A;  1DUB A;  4MI2 A;  5DZK A;  3T89 A;  2WTB A;  1UYT A;  1UYV A;  5KDR B;  3TDC A;  4I52 A;  2J5I B;  1K32 A;  4QFE A;  1UYS A;  2PPY A;  5E0N X;  4NEK A;  5DU6 A;  3ISA A;  1FC6 A;  3H0J A;  2Q2X A;  3PGQ A;  4ASI A;  4B3I A;  2F9Y A;  2UZF A;  4HC8 A;  3ZWB A;  3H0Q A;  3R9S A;  2VSU A;  1PIX A;  4JCS A;  1RJN A;  1WDL A;  2DEO A;  5FUS A;  3MT6 A;  1SG4 A;  4IZB A;  1N6E A;  4KD6 A;  3OC7 A;  3M6N A;  4QIJ A;  4B3J A;  3HP0 A;  5CTC A;  2ZL4 A;  3QWD A;  4JYJ A;  2A7S A;  3TT6 A;  4IZC A;  2HW5 A;  4ZDB A;  5DUF A;  4U18 A;  5G1R A;  3VIV A;  1NZY B;  3LKE A;  4GHN A;  4WCZ A;  4RCN A;  5ING A;  3K8X A;  3T88 A;  4U19 A;  3QK8 A;  1EF8 A;  4G2R A;  3TV5 A;  1EF9 A;  1J7X A;  3L3S A;  2X58 A;  3HRX A;  3QMJ A;  1O8U A;  4JCT A;  3TZ3 A;  2FZS A;  1Q51 A;  2NP9 A;  3IBB A;  2VSS E;  3IB9 A;  1K39 A;  4F47 A;  5KDR A;  3RST A;  2J5I A;  1YG6 A;  3R9Q A;  4FZW A;  3Q0J A;  1Y7O A;  3H81 A;  4U1A A;  3KTG A;  1WDM A;  4U0H A;  4ELX A;  3KTK A;  1OD2 A;  3Q1T A;  3MFM A;  1JXZ A;  3P2L A;  2D3T A;  3HE2 A;  4B3H A;  3STA A;  4Q0G A;  5DU4 A;  1XNY A;  2BZR A;  3KTI A;  2FW2 A;  3HLN 1;  4ZDF A;  4K29 A;  3U9S B;  5INI A;  5E0S A;  2J5S A;  2VSU E;  4MOU A;  3NJB A;  3WG5 A;  4YLH A;  2J5G A;  1XNW A;  3H02 A;  5FIF A;  1NZY A;  4OG1 A;  1N6F A;  2J5G D;  4DI1 A;  4U0G A;  2A81 A;  3SLL A;  3OME A;  3U9R B;  4EML A;  4JJT A;  1XO6 A;  3GF7 A;  3KTH A;  3V5I A;  1MJ3 A;  1XNV A;  1FCF A;  5DTW A;  2QQ3 A;  1HNO A;  5C9G A;  2W3P A;  4KPK A;  3R0O A;  5E0S H;  4JVT A;  5DL1 A;  4IZD A;  3ZW9 A;  2C8T A;  3BEZ A;  1TYF A;  4JCQ A;  3Q0G A;  4MXI A;  3ZWC A;  1UIY A;  3QXZ A;  3TLF A;  4RYF A;  2VRE A;  4U0G H;  2IEX A;  2F6Q A;  4WZ8 B;  5G1S A;  3PEA A;  4ZU2 A;  5G1Q A;  4L6W A;  1ON9 A;  4FB8 A;  3FF6 A;  2X24 A;  3DOR A;  1FC7 A;  2ZL3 A;  4ELW A;  4JOT A;  5KJP A;  1X0U A;  1RJM A;  1FC9 A;  4ELS A;  4KWB A;  2A7K A;  3FDU A;  4JFC A;  5DUC A;  2Q34 A;  4RYF H;  4NNQ A;  5CTB A;  3K50 A;  3PZK A;  3H0S A;  3MYB A;  5C90 A;  2PBP A;  4FJW D;  4K2N A;  2DUB A;  4FNB A;  3N6R B;  1W2X A;  1VRG A;  3BF0 A;  5DTP A; 
#chains in the Genus database with same CATH topology
 3NJD A;  4FND A;  3I47 A;  4ZDD A;  5MGB A;  1YG8 A;  4ZDC A;  3Q7H A;  3JU1 A;  2VX2 A;  1SZO A;  1HNU A;  4QII A;  3ZW8 A;  5DKP A;  3ZWA A;  1OD4 A;  1N6D A;  4KNP A;  2F9I B;  2ZL2 A;  2CBY A;  5JBX A;  3QRE A;  4I42 A;  1Q52 A;  4Q1I A;  4FN7 A;  4JWV A;  2VSU C;  1ON3 A;  1XX4 A;  4OLQ A;  3DJA A;  5INF A;  3IAV A;  5DU8 A;  4LK5 A;  3TT7 A;  3LAO A;  3V5E A;  5DZK H;  2F6I A;  3ST9 A;  3T8B A;  3TRR A;  4EMM A;  2GTR A;  4JYL A;  3R9T A;  4K3W A;  3BPP A;  4J2U A;  4FN8 A;  1DCI A;  4EMP A;  1WDK A;  2VSS F;  3M6M A;  4Z0M A;  5HUQ A;  3T8A A;  4GM2 A;  2F9Y B;  3TVW A;  3GLM A;  3KQF A;  3U9T B;  3HIN A;  1WZ8 A;  3P85 A;  3T3W A;  1UYR A;  4OMR A;  3QYR A;  1PJH A;  4HNK A;  2J5I I;  1TG6 A;  4L8K A;  2Q35 A;  3PE8 A;  4ZDE A;  3SWX A;  2ZQQ A;  3RSI A;  4FZW C;  3RRV A;  3KTJ A;  3QXI A;  3G64 A;  3GKB A;  5IKL B;  3P5M A;  3H0U A;  3QKA A;  1HZD A;  3R6H A;  1EY3 A;  3GMA A;  2ZQR A;  2F9I A;  4I4Z A;  2PG8 A;  3OT6 A;  2VSS A;  4JSB A;  2EJ5 A;  4JCR A;  5JBW A;  2VSU F;  3GF3 A;  4WYO B;  2FBM A;  2ZL0 A;  3MOY A;  2CE3 A;  4HDT A;  3TVU A;  1DUB A;  4MI2 A;  5DZK A;  3T89 A;  2WTB A;  1UYT A;  1UYV A;  5KDR B;  3TDC A;  4I52 A;  2J5I B;  1K32 A;  4QFE A;  1UYS A;  2PPY A;  5E0N X;  4NEK A;  5DU6 A;  3ISA A;  1FC6 A;  3H0J A;  2Q2X A;  3PGQ A;  4ASI A;  4B3I A;  2F9Y A;  2UZF A;  4HC8 A;  3ZWB A;  3H0Q A;  3R9S A;  2VSU A;  1PIX A;  4JCS A;  1RJN A;  1WDL A;  2DEO A;  5FUS A;  3MT6 A;  1SG4 A;  4IZB A;  1N6E A;  4KD6 A;  3OC7 A;  3M6N A;  4QIJ A;  4B3J A;  3HP0 A;  5CTC A;  2ZL4 A;  3QWD A;  4JYJ A;  2A7S A;  3TT6 A;  4IZC A;  2HW5 A;  4ZDB A;  5DUF A;  4U18 A;  5G1R A;  3VIV A;  1NZY B;  3LKE A;  4GHN A;  4WCZ A;  4RCN A;  5ING A;  3K8X A;  3T88 A;  4U19 A;  3QK8 A;  1EF8 A;  4G2R A;  3TV5 A;  1EF9 A;  1J7X A;  3L3S A;  2X58 A;  3HRX A;  3QMJ A;  1O8U A;  4JCT A;  3TZ3 A;  2FZS A;  1Q51 A;  2NP9 A;  3IBB A;  2VSS E;  3IB9 A;  1K39 A;  4F47 A;  5KDR A;  3RST A;  2J5I A;  1YG6 A;  3R9Q A;  4FZW A;  3Q0J A;  1Y7O A;  3H81 A;  4U1A A;  3KTG A;  1WDM A;  4U0H A;  4ELX A;  3KTK A;  1OD2 A;  3Q1T A;  3MFM A;  1JXZ A;  3P2L A;  2D3T A;  3HE2 A;  4B3H A;  3STA A;  4Q0G A;  5DU4 A;  1XNY A;  2BZR A;  3KTI A;  2FW2 A;  3HLN 1;  4ZDF A;  4K29 A;  3U9S B;  4NAR A;  5INI A;  5E0S A;  2J5S A;  2VSU E;  4MOU A;  3NJB A;  3WG5 A;  4YLH A;  2J5G A;  1XNW A;  3H02 A;  5FIF A;  1NZY A;  4OG1 A;  1N6F A;  2J5G D;  4DI1 A;  4U0G A;  2A81 A;  3SLL A;  3OME A;  3U9R B;  4EML A;  4JJT A;  1XO6 A;  3GF7 A;  3KTH A;  3V5I A;  1MJ3 A;  3BPT A;  1XNV A;  1FCF A;  5DTW A;  2QQ3 A;  1HNO A;  5C9G A;  2W3P A;  4KPK A;  3R0O A;  5E0S H;  4JVT A;  5DL1 A;  4IZD A;  3ZW9 A;  2C8T A;  3BEZ A;  1TYF A;  4JCQ A;  3Q0G A;  4MXI A;  3ZWC A;  1UIY A;  3QXZ A;  3TLF A;  4RYF A;  2VRE A;  4U0G H;  2IEX A;  2F6Q A;  4WZ8 B;  5G1S A;  3PEA A;  4ZU2 A;  5G1Q A;  4L6W A;  1ON9 A;  4FB8 A;  3FF6 A;  2X24 A;  3DOR A;  1FC7 A;  2ZL3 A;  4ELW A;  4JOT A;  5KJP A;  1X0U A;  1RJM A;  1FC9 A;  4ELS A;  4KWB A;  2A7K A;  3FDU A;  4JFC A;  5DUC A;  2Q34 A;  4RYF H;  4NNQ A;  5CTB A;  3K50 A;  3PZK A;  3H0S A;  3MYB A;  5C90 A;  2PBP A;  4FJW D;  4K2N A;  2DUB A;  4FNB A;  3N6R B;  1W2X A;  1VRG A;  2YJG A;  3BF0 A;  5DTP A; 
#chains in the Genus database with same CATH homology
 3NJD A;  4FND A;  3I47 A;  4ZDD A;  5MGB A;  1YG8 A;  4ZDC A;  3Q7H A;  3JU1 A;  2VX2 A;  1SZO A;  1HNU A;  4QII A;  3ZW8 A;  5DKP A;  3ZWA A;  1OD4 A;  1N6D A;  4KNP A;  2F9I B;  2ZL2 A;  2CBY A;  5JBX A;  3QRE A;  4I42 A;  1Q52 A;  4Q1I A;  4FN7 A;  4JWV A;  2VSU C;  1ON3 A;  1XX4 A;  4OLQ A;  3DJA A;  5INF A;  3IAV A;  5DU8 A;  4LK5 A;  3TT7 A;  3LAO A;  3V5E A;  5DZK H;  2F6I A;  3ST9 A;  3T8B A;  3TRR A;  4EMM A;  2GTR A;  4JYL A;  3R9T A;  4K3W A;  3BPP A;  4J2U A;  4FN8 A;  1DCI A;  4EMP A;  1WDK A;  2VSS F;  3M6M A;  4Z0M A;  5HUQ A;  3T8A A;  4GM2 A;  2F9Y B;  3TVW A;  3GLM A;  3KQF A;  3U9T B;  3HIN A;  1WZ8 A;  3P85 A;  3T3W A;  1UYR A;  4OMR A;  3QYR A;  1PJH A;  4HNK A;  2J5I I;  1TG6 A;  4L8K A;  2Q35 A;  3PE8 A;  4ZDE A;  3SWX A;  2ZQQ A;  3RSI A;  4FZW C;  3RRV A;  3KTJ A;  3QXI A;  3G64 A;  3GKB A;  5IKL B;  3P5M A;  3H0U A;  3QKA A;  1HZD A;  3R6H A;  1EY3 A;  3GMA A;  2ZQR A;  2F9I A;  4I4Z A;  2PG8 A;  3OT6 A;  2VSS A;  4JSB A;  2EJ5 A;  4JCR A;  5JBW A;  2VSU F;  3GF3 A;  4WYO B;  2FBM A;  2ZL0 A;  3MOY A;  2CE3 A;  4HDT A;  3TVU A;  1DUB A;  4MI2 A;  5DZK A;  3T89 A;  2WTB A;  1UYT A;  1UYV A;  5KDR B;  3TDC A;  4I52 A;  2J5I B;  1K32 A;  4QFE A;  1UYS A;  2PPY A;  5E0N X;  4NEK A;  5DU6 A;  3ISA A;  1FC6 A;  3H0J A;  2Q2X A;  3PGQ A;  4ASI A;  4B3I A;  2F9Y A;  2UZF A;  4HC8 A;  3ZWB A;  3H0Q A;  3R9S A;  2VSU A;  1PIX A;  4JCS A;  1RJN A;  1WDL A;  2DEO A;  5FUS A;  3MT6 A;  1SG4 A;  4IZB A;  1N6E A;  4KD6 A;  3OC7 A;  3M6N A;  4QIJ A;  4B3J A;  3HP0 A;  5CTC A;  2ZL4 A;  3QWD A;  4JYJ A;  2A7S A;  3TT6 A;  4IZC A;  2HW5 A;  4ZDB A;  5DUF A;  4U18 A;  5G1R A;  3VIV A;  1NZY B;  3LKE A;  4GHN A;  4WCZ A;  4RCN A;  5ING A;  3K8X A;  3T88 A;  4U19 A;  3QK8 A;  1EF8 A;  4G2R A;  3TV5 A;  1EF9 A;  1J7X A;  3L3S A;  2X58 A;  3HRX A;  3QMJ A;  1O8U A;  4JCT A;  3TZ3 A;  2FZS A;  1Q51 A;  2NP9 A;  3IBB A;  2VSS E;  3IB9 A;  1K39 A;  4F47 A;  5KDR A;  3RST A;  2J5I A;  1YG6 A;  3R9Q A;  4FZW A;  3Q0J A;  1Y7O A;  3H81 A;  4U1A A;  3KTG A;  1WDM A;  4U0H A;  4ELX A;  3KTK A;  1OD2 A;  3Q1T A;  3MFM A;  1JXZ A;  3P2L A;  2D3T A;  3HE2 A;  4B3H A;  3STA A;  4Q0G A;  5DU4 A;  1XNY A;  2BZR A;  3KTI A;  2FW2 A;  3HLN 1;  4ZDF A;  4K29 A;  3U9S B;  4NAR A;  5INI A;  5E0S A;  2J5S A;  2VSU E;  4MOU A;  3NJB A;  3WG5 A;  4YLH A;  2J5G A;  1XNW A;  3H02 A;  5FIF A;  1NZY A;  4OG1 A;  1N6F A;  2J5G D;  4DI1 A;  4U0G A;  2A81 A;  3SLL A;  3OME A;  3U9R B;  4EML A;  4JJT A;  1XO6 A;  3GF7 A;  3KTH A;  3V5I A;  1MJ3 A;  3BPT A;  1XNV A;  1FCF A;  5DTW A;  2QQ3 A;  1HNO A;  5C9G A;  2W3P A;  4KPK A;  3R0O A;  5E0S H;  4JVT A;  5DL1 A;  4IZD A;  3ZW9 A;  2C8T A;  3BEZ A;  1TYF A;  4JCQ A;  3Q0G A;  4MXI A;  3ZWC A;  1UIY A;  3QXZ A;  3TLF A;  4RYF A;  2VRE A;  4U0G H;  2IEX A;  2F6Q A;  4WZ8 B;  5G1S A;  3PEA A;  4ZU2 A;  5G1Q A;  4L6W A;  1ON9 A;  4FB8 A;  3FF6 A;  2X24 A;  3DOR A;  1FC7 A;  2ZL3 A;  4ELW A;  4JOT A;  5KJP A;  1X0U A;  1RJM A;  1FC9 A;  4ELS A;  4KWB A;  2A7K A;  3FDU A;  4JFC A;  5DUC A;  2Q34 A;  4RYF H;  4NNQ A;  5CTB A;  3K50 A;  3PZK A;  3H0S A;  3MYB A;  5C90 A;  2PBP A;  4FJW D;  4K2N A;  2DUB A;  4FNB A;  3N6R B;  1W2X A;  1VRG A;  2YJG A;  3BF0 A;  5DTP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...