3QRGH

Crystal structure of antirsvf fab b21m
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
220
structure length
220
Chain Sequence
b'EITLKESGPTLVKPTQTLTLTCTFSGFSLSTSGMGVSWIRQPPGKALEWLAHIYWDDDKRYNPSLKSRLTITKDTSKNQVVLTMTNMDPVDTATYYCARLYGFTYGFAYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKAEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab light chain
publication title Crystal structure anti-RSV Fab B21m
rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 46
structure length 220
sequence length 220
ec nomenclature
pdb deposition date 2011-02-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qrgH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qrgH01
4QEGA 4E0RA 3KPRA 2GUOB 3GMNA 4P9HC 2X1XR 1DCLA 3P73A 4GMSL 3AROA 5H35B 4IIQB 4R2GD 4R4FH 4Y4KC 3U0PA 5JIPA 4ZNCD 3BGAA 2X1OA 4PJEE 1VGKA 1L6ZA 5LJYH 2V2XA 4NFCA 5I75B 1KN4H 4GUPA 5TQ0H 5FV1L 15C8L 2IBZX 4OAWA 2J4WH 3BPCA 1N6QL 2W65A 1LEKA 3N85L 4PJ9B 1ZA3A 4BZ1H 1FZKA 1AE6L 3ARFB 4HV8B 1OQXA 2VDLL 1NLDL 4NZJA 3NTCL 3RL2B 1AIFB 3U1SL 5F96L 4QKXB 3TYGL 4X6DF 4QHMA 5FB8B 3FTGB 2EDFA 2NR6C 4F2MB 1EUTA 3CVIH 2CIIB 1UJ3B 4U1HB 3QJHB 4J2XA 3SKNB 4O00A 5GGQL 2YWYA 2YEZB 1IAIM 5E56A 2QADC 3Q0HA 5F9WC 3W39B 4OZFH 4LLVA 3O4LA 1KIRB 3I2CH 7FABH 4MD4B 3QO0A 4EIZC 4KK9C 1UFUA 4UTBL 3FB5A 4NNXB 1AO7B 4IRZH 1CTNA 5D6CA 1DQQA 3C9NA 5GRUH 1MRCH 1XF2B 3QDGE 2KQNA 2X4NA 2B2XL 1FVCA 3FO2A 3DO3A 3VGAB 5CS7A 4JO4H 3S9DB 4JE4B 5FYKU 4NKMA 1SJXA 5DRNA 4P3DA 4Q9BA 4JM2F 2IPUG 4RAHA 4G7VL 3S35H 2K9UA 1A1OA 2OXGA 4POZC 5ACZB 1PD6A 2R4RH 5F6IB 3CFIC 1KGCD 1QFHA 4Y1AA 4I0KA 1LE9B 4G43B 4PJBE 5D7LD 1NGWB 4R4FL 2DDQL 4I0CC 4RNRB 5L2KE 4JANA 1H3UA 3ZTJH 1NAMA 4XVSH 3PP3H 5HYJE 2DIAA 5C07A 5TQ0L 4ZUUB 5IFHH 5IVXA 3VFTA 5JOPD 3O45A 5I1IL 5HVHC 3RDTC 4UUJA 3UJTL 1KIUA 3AXLA 2J4WL 3FFDB 5FYJU 4FQCL 4PJFE 5EN2B 3MNVA 4WW2B 5C0BB 4PREA 5JHLL 3NACH 4RGNC 3JVGA 5DHYA 5DWUH 3TCLB 5JQHC 4CAGA 2Z31A 4PLKD 3MREB 1DR9A 2ADGA 3OMZA 1UB5B 5MEPA 1T7VA 5FM5O 4LGSB 4P4RB 3CVIL 1JF6A 2W0PA 3I9GH 5C0AA 3L3IB 4FXKA 4PR5B 2XZZA 3RWEB 3BP6B 3WL9B 2AKRA 2RIKA 3BDYH 3KPOA 3ZSTA 2EC9U 3V5DB 5F1OB 5EU6D 3ZKSD 5FOJA 3QUKA 1ZT7B 2DI8A 1UWGL 2M8XA 3BOVA 3QQNA 2DQGL 3BYTA 4LVOC 4DKFL 3QPQC 1XH3A 1C16A 1I7ZA 2ZUXA 1KTLA 1WT5A 4MCZA 5IVOA 3OPZH 4NRZA 4OZGF 3VGEA 4P46A 4IRZL 3UBXB 1JGDB 5GRUL 2GK0A 1CDIA 3MUJA 4AZ8A 2ID5A 5D7KE 4JO4L 4WCYL 1F2XK 1QG3A 2JIXB 2ICES 3H42L 4Y7MA 3S35L 4HCRH 4DCQB 4WY7L 2R4RL 4W70A 1FVDB 5FUZL 2UZYB 4YHKH 3NGBB 1AC6A 1PX4A 1MAMH 3CK0L 4LVEA 5DZNA 3VXOA 4KI5F 2BSED 5IMOB 1ODAA 3V6FB 3UPRB 2ZUVA 3K80A 1PSKH 5I8EB 5DYOA 1SBSH 1HHGA 3UTTB 1NAKH 4R9HA 1CQKA 4WFFD 4MA7H 4XVSL 1DANT 1J12A 5T1MA 4P5MB 3SJVE 4X5WA 5T1LB 3W82A 1VGEH 3TPUA 1VFBB 1Z3GH 4J4PD 4RRPA 2DF3A 1ZV5A 2ZOKB 3NACL 5DWUL 3LRSB 1GGBH 4X7SH 1FZOA 5K9QG 1JGVH 2YPLE 5D72L 1T1YA 1U8NB 4KDTA 3LKSB 1EJ6A 3LRGA 3PV6B 3P0GB 4Q0XH 1K4CA 3I9GL 4LBEA 3P40A 2EKJA 1L9MA 2F53D 3F7RA 4E41D 3F7QA 2HT2C 3PJSA 1P6FA 1KBGH 5SWSA 1UKTA 2VDRH 3VFVA 1H3XA 2DBLL 3CDYA 1U8OB 1EGJA 3NIDF 4JZJB 3QB7C 3OPZL 4MHHI 3GHBH 4NJAL 3V52L 2W0FB 3LN5A 4H1LB 3C09B 3V6OE 1I3RA 3SPVA 4DUXA 2UV3A 2WQ8A 3X13A 4AEHH 1CD9B 4PGEA 2FHBA 3MLVH 5DQJB 4YE4L 1OWRM 1NEZB 4ZUSA 5L0QB 1BIIB 4JM2D 1SY6L 3HRPA 4MD0B 4U0QB 4K3JL 5C0CE 5GIRA 3N1PC 3VRLE 5DSCA 1HQRB 3JVGC 1IZKA 3VA6A 4NQCA 4MWFB 3QCTL 4HS8L 1AD0B 3FB7A 4MA3B 4M61B 5CGYD 1U42A 4LCUB 5E2TH 1SBSL 3P9WB 2C1PB 4OCMC 5C0JA 5TDOA 3QI9D 3TF7C 5D7JA 1GYAA 2FWOA 2EXWC 1HEZB 4I5BB 4HC1L 2FO1A 3V5HA 4GSDH 4JFED 3B5HA 1LO2L 2A77L 2GSIA 4Q9RH 1I4FB 4FFVC 1MQ8A 1Z3GL 3WIFB 7CGTA 1BZ9B 1YEJL 3PQYA 3Q5TA 4ZDHA 1GGBL 2R9HC 1F4YH 5DJ0A 1WT5C 4ZXBD 1T3FA 2NCMA 4X7SL 2VLRA 1HNGA 4P46C 2AJSH 4PRHB 4X6EB 4YO0A 1QBBA 2GEEA 2OZ4H 5F8QC 3LKOB 2QQNH 3NFNA 4GRLD 4QXTB 4NQUA 4LLUA 1KBGL 3OF6A 2FLBT 3CCHB 5J3HC 3GSUA 1QRNE 3MLXH 5GS1A 1XGUB 3GHBL 1FHGA 5IM7B 1PX3A 2W9LA 3RPIB 4DKDC 5IQ9B 1CLOH 3V6ZA 3L7EA 4XP5L 2R0LH 3PWPA 3U7AA 3MUY1 3MLVL 3X12A 1FYTD 5C0IB 4L8BA 4G8EB 3SGJC 5D5MA 2E5EA 4NUJA 4PRBB 5F93C 3WV0A 4KI5D 2V9QA 3VFMB 2DLEA 3SKUD 1N4XH 4YBQD 1CS6A 4KDTC 5F89B 2W9DH 5E2TL 3QPXH 4GW1B 4Z7UB 5MEOB 3HE7A 4GSDL 2VIRB 4PRDA 1YEKL 4XWGL 4Q9RL 1HCFX 4H1LG 4NUGH 2FX8H 5DD1L 3MRKA 1UGNA 4BK5A 4Z7OE 4NQDE 3WIHA 2WIIA 4LHQB 4MD5B 2PYFA 1NEZG 1T4KA 4TVPH 2ORBH 4CJ0A 1LHZA 4LARH 4OJFL 3J7HA 3G6AB 4K7PH 3ZO0A 1KB5H 4UIKH 5A2FA 4TUKL 2NR6D 2OZ4L 4MHHG 5DMKB 4NZUH 2QQNL 3B6SA 2OJEA 3DUSA 1FV1A 3A6CL 1IZJA 4NHUB 1MFBL 3EIFA 2HAZA 2DLHA 2HH0L 3FQXA 1NCBH 4ZYKA 4MNGB 3L5WA 1KLGA 1ONQB 5B39A 1U91B 2BJMH 2X70A 3UJIL 4NO0D 1BJ8A 1FORH 3O6LH 3QXTA 4R2GB 4LDLB 2VXTL 4HAGA 2Z35A 5J6HB 2W38A 5L2JB 4P2RD 3NPSB 4WTXA 5H37G 5IB1B 4MNQB 3EJYD 5D7JC 4P49A 2H3NA 5D6DC 4XXDB 2X40A 1RJYA 1II4E 1FIGH 5FHBH 4ODUB 1BP3B 1NGYB 2Y7QB 4M1DH 4MA1B 5A40E 4OTXH 2BVEA 2EXYC 3GJEB 1Z0MA 4J3XA 4X5LA 1MCWM 4YUEH 2A73B 4HWBA 3U30B 3HNSH 3LV3B 4L8DB 3ORJA 2AK1L 4OCYH 1UQSA 1RIUH 4PRAA 1U58A 3SGEH 4KFZC 2ENSA 1JK8B 2DLIA 1OTUD 4Y2DA 2YPVH 1T5XA 2DQTL 4F15B 3OKDB 3QPXL 4LF3A 1AGFA 3S4SB 1P1ZA 3ZYOA 4TN9A 5LAXB 3QG7H 5FDWB 3T4AA 2IH3A 5DJYA 2FX8L 1KPVB 4CNIA 4G7YL 3N1MC 5ISZE 5GS1C 4OZIE 1DBJH 4L3CB 3K1KC 2VMFA 2G5RA 3MJ7B 3M1BA 4MXWL 3HNTH 4LARL 2I9LB 3C2SA 3CC5B 4LOUC 5DC0A 5AAMA 1KB5L 4UIKL 5HHOD 3HZKB 4FZEH 4NZUL 5EZLB 4PJAA 5F7DA 2QQKH 1KV3A 4LPVA 1YUHA 5K9KB 5GGSY 5I1JH 1KT2B 1NCBL 3MYZA 3IDNA 1RZKH 4FQJH 1KENH 4CVZB 1AXSA 3G5YA 3SY0A 1WGOA 4P2QA 2BJML 5KSBA 3KPRD 4HUUB 1TTUA 5ID0A 4OUUB 5CSBA 3H9SA 1FORL 4MSWA 1NCAH 1S7XB 4U0RB 4JY6A 1J0HA 1FFRA 1N0LA 3HC3L 4Z95H 3GIVA 2BXYA 4R4BA 5IV2B 3W0WA 5EZOL 1FIGL 3HE7C 5FHBL 2HFTA 4ORZC 5J11B 1D3CA 3S5LA 4M6MH 1A14H 3EYSH 2AJYH 5D93C 1VACA 1CLCA 8FABB 2GAZB 4OCYL 1FNSH 5HGAB 4M7ZB 5KJRH 1RIUL 4V1DD 5I8CB 5C0BE 5HHXH 1ED3A 1FYHB 4OLYH 4XZUA 3TZVB 3ES6B 3IU4H 3VWJB 3LB6D 2HVJA 5BO1L 4RZCB 1ZT4B 4GXUN 3ZZ1A 2P44B 5F1IB 2K3TA 4PJIB 1MWAL 2KQMA 1JYVA 4XVJH 1F4WH 1M71B 3D3VB 1Q94A 2XWTA 1A7OL 1OGAA 1N3NA 3RWFB 2ITCA 4XX1G 3VXNA 5HYQB 3BI9X 1P7HL 3HNTL 2VAJA 3VG9C 4L3EB 4ZSOE 2VL5A 4LSUH 4FZEL 4OKVA 1JHLL 5EORL 4HUKB 4JGJA 4PJXF 4NWTH 1IGJB 4RQQA 1BFVH 4MLSA 3EO1A 1T21A 5I1JL 1BECA 3EFDL 4XP1H 1MFNA 4F37F 4FQJL 4N9GB 4XBGB 2DWEA 3S4SG 3EYFB 1LEIA 2DQEH 4YPGA 2OXHA 1RHFA 1A7QH 5BW7A 1JGLH 4OBSA 1OSZA 1QFPA 2D03L 4XBPA 5T5NG 1NCNA 1QFWI 4QYOA 2CO6B 5D7IA 4IS6B 3LKRB 3UTPE 4XAKE 3ZDZF 1LO5B 3VFWA 3Q5OA 4WHDA 1RQ5A 4L5FH 2HRPH 5FIEA 3TNNB 1DLHB 2AJYL 1M6OB 2ARJB 2KZ1B 4KQ4H 5KJRL 5HYIA 1HZHL 2UWEA 2Z31D 2FD6H 3DSFH 4OLYL 1JWUB 1OB1A 4JLRA 4K9EC 4DN3H 4NKIH 43C9A 3BXNA 2F53B 4PJCA 1S7RB 4ZNEA 1RK0A 2BSRB 4U1GB 5C0AD 1A9EB 5C0EB 4XCNA 2R1XA 2IMMA 5D1XD 4N8VB 1N59A 1FGVH 1F4WL 4WTZG 1G9MH 3PGDA 1L4IA 5FDYA 3VD3A 3N9GH 3ZT5A 1H0DA 2FIKA 3ZE0F 4KRMB 3C8DA 1PZ5A 3OGCB 1KEML 4P46D 3VI3E 3GO1L 1KIQA 3G6JE 5TDNB 4LRNL 2EE6A 1BFVL 4HQQH 4XP1L 5MEQA 4XNZB 3L3KA 4WU7B 43CAA 4NN5B 4IDJH 1KCKA 4N8CL 2VDKH 2X4OA 3HAEA 5FO7A 4JFFA 1T7YA 1ORQA 2A2QT 2ED7A 4JFEB 5T3ZH 3O2WH 1BBJB 5L7XH 5EU7E 1KXQE 1NFDF 5A3IC 1EUUA 5AYQA 3VFUA 3HPJB 1F6FB 4FG6D 4C56E 4L5FL 4TYUA 5JDJA 5KVGH 3EFFA 3FT4A 4NOFA 3TIEA 1IC5H 3ZKMD 1ZWIB 4KQ4L 1CFTA 3SDAB 3DSFL 1DL7H 3WYRA 1HDMB 4DKEH 3BIKB 4DN3L 4N5ED 2BNRE 4O9HH 3UTZB 5I8OH 4S2SA 3MRFB 2FECI 2DM3A 4G9DB 5HY9A 3RUGF 2QQLH 1NC4A 3B9VA 1Q9LA 5SWSD 4ELME 4PP2A 4YHML 1FGVL 1A6ZB 1G9ML 2EE9A 1IGIH 4BH8B 5ITBH 2J7LA 5DDHB 5BW7C 2Y23A 4KKNA 1QSEB 5E94A 4JM4H 1M7IB 3WJJA 2DD8H 4OLEA 2X4QA 5DMIL 5EPMB 3QWOB 2P8LB 1NBYA 2X1QA 4HKXB 1T66C 3P4NA 5CSZA 2KPNA 4IDJL 4QTHB 2VDKL 2NLJB 5HD8C 4WFEE 3BWAA 4OZHE 3BMVA 3DTXA 3BUYB 1FZJA 1DQTA 1X5YA 4Y4KB 3QIWA 4N8VG 4NQCD 3RAJH 1UXWB 3MRLB 3V5KB 3MV8D 3VFSA 1FFQA 1QLRB 4NP4H 4UDUB 5EO0A 1ACYH 5T3ZL 5L7XL 5CBAA 2HFEB 1NCCH 1UM6H 4U1NA 1ZVSA 2E7HA 2DMBA 4H1LH 2DQIH 4FP8H 3K2MC 4Z7UE 3VXPB 3E3QC 4XNYH 1HK6A 4FMFA 5GGTH 2FX7H 2R8SL 1XT5A 3BP7A 3DHMA 4M9OA 2J6EA 5SV3A 3AAZB 2M1KA 3NOIA 2PO6D 1G84A 2V5RA 2VLRD 5FA3A 4KJWC 4NCC1 1V3JA 2R2EB 3OKNB 2BOBA 4YHPB 4ZAKA 3UTSA 4O9HL 2HJLB 5I8OL 5IQ7H 1Z5LB 3PWLA 4LLMA 5F9WB 2QADB 3EYVB 3KNBA 4Z7NF 3GM8A 4NPYB 2R0ZH 5F72S 1SJVA 3OF6D 1Q9KA 5SX4I 1CDBA 1C7TA 1OSPL 4MNGE 2BVQA 1KXVC 2VERN 4PJHB 4UDTA 5JA9A 3G04B 5DEFA 4GBXA 4RFNC 1KIPA 5KSUB 3BVNB 3LQZA 5H37H 3WFHA 1MOEA 1MI5B 1PG7H 1U8HA 4AH2B 3HI1A 3PWPD 3AY4C 1A3LH 3BSZH 4KJQC 1AGDB 2AP2A 3PXHA 5T3ZD 5ICZA 3CX5K 4PPTA 1CFQA 3UP1A 3OG6B 4KKBC 3UAJD 5JW3H 1NFKA 2YUWA 2GKIA 2VLLB 1BFTA 4MB3A 4C54A 3MYJA 5GJTH 4X4YB 4ZG1A 1G7IB 1HHJB 4GW4A 2CRYA 3UZQA 1H8SA 4ZTPH 1NEUA 1ACYL 1B9ZA 4X7TB 1UM6L 4LCWB 5HVHB 3RDTB 1T03L 1CZ8L 3UO1H 3HE7D 1D5MB 2DQIL 4ACPA 4JRYB 4FP8L 4RGNB 2Q7YA 3C8KA 1IVLA 3MXVH 2EYTA 3FAXA 5GGTL 1KULA 1QHPA 2FX7L 1NDGA 3H2WA 4S11A 1D9KD 4U6HA 1KLUB 4U1IA 3MLSH 3T0EA 2XQYG 2DYPA 3ARGA 3U79A 2F74A 3ARPA 3QRGH 4R0LC 3WJJC 1CXFA 2VDMH 5IQ7L 1NC2B 3KYMB 1FCGA 3RWJA 4WEMB 5C0FB 2I27N 4ORGB 5I1HH 1CXHA 4WEUD 4OIAA 1LO3L 3VH8B 4E0RB 2DQDL 2R0ZL 4LVOB 5FV2A 5JXAL 3F7VA 3GMNB 5DD6B 1KGCE 5DLML 3ELAT 1EIBA 1LO0H 1Q38A 3EGSA 4PJ7E 5I18L 5D7LE 3WN5C 3B8SA 1X5LA 3QIWC 5H2BA 5EO1A 1N26A 4WWKD 1O7VA 1GC1H 1VGKB 4UNVA 5JUEH 4YXLH 3PWUA 3E6FA 3KYAA 2IBGA 3VD9A 4ONFL 3S37L 3MGOA 3NA9L 2NZ9C 1QSZA 1YNTA 4OAWB 3BPCB 5JOPE 2W65B 1QPXA 4HKBB 4IOIB 1ZA3B 4HPOH 1FZKB 1FNGB 2P47B 4QGYA 4M48L 4UT9H 1I1CA 1GHFL 4MZ2A 3CFJA 2B39A 2UWEF 4HF5H 5HHMB 1QRKA 4S1DD 2QHLA 5KAQF 4UU9A 4ZAKC 4ZTPL 1GGIH 4Y2DD 4ONHA 4BKLA 2O61A 1RY7B 2NW2B 1SEBB 5IBTL 1GRWA 5T1KB 3RRQA 5AG8A 5EU6E 4QRSB 2DKSA 4DN4H 4LLVB 4XPBH 3O4LB 2DJUA 4TTGA 3QO0B 1UH4A 1GGYA 3MLRH 1CD1A 4U3CA 3AMKA 3FB5B 4XC3H 2E9JA 5D6CB 1DQQB 2PTTB 3C9NB 4GBXC 1I9IL 3QRGL 1PZUB 1FVCB 3FO2B 2VDML 4BUHA 3WNMA 4NSKA 1S9KC 4NKMB 5CEZL 4CMHC 4L3EE 2DJ4A 1UZ8B 1VA9A 5CIPH 2AV7B 3S6CA 5DFWH 2FH6A 4Y1AB 4OCNC 3DVGA 1BD2B 4I4WA 4P2QD 4WO4A 1LO0L 5MERA 2P1YA 3H9SD 2C1OA 3T4YB 4N1HB 1GC1L 5E5MA 1RZGA 1NAMB 5JUEL 2CLVA 3LPFA 5ITFA 4WFFE 5C07B 5C3LD 5IVXB 3VFTB 3W0WD 2P5EA 1UM5H 3O45B 4G80A 4UUJB 2QQQA 3AXLB 2XZCL 1OAUH 4UILH 4FHBD 3RNKA 3MNVB 3TP4A 3TBTA 5F88A 5DHYB 3U0WH 4HZLA 4JFZH 5D70H 2XG4A 4YXKL 5FAAA 5B4MC 3JV0A 2ADGB 3T0EC 5MEPB 3VH8G 1FCCA 3ARGC 2CD0A 5JORB 1FG2A 4NJ9H 5DURB 4FXKB 1GGIL 4J1UB 4PY7A 2AKRB 3KPOB 2JK5A 5A3ID 2F53E 4E41E 3QUKB 4ZFOA 5CEZD 3ET9F 1XH3B 1C16B 1I7ZB 4XPBL 4PJDF 4MCZB 4NRZB 3ZLQC 3MLRL 1OGAD 4XC3L 4P46B 3IS0X 4PY8J 3FOMA 3FMGH 4KQ3H 4YFLI 4OD1L 2GK0B 4JQVA 2XKUA 3D85A 3EDJA 4K3GA 2Y6SC 3BKMH 3CUPA 3BKJH 4KZDH 1LNUA 4KV5E 1C1EL 3O3EB 2FIRT 3FQTA 1PKQA 2COQA 4AK1A 2OP4L 3O0RL 2W60B 4RGOL 4KRPD 4ODXA 5TE7H 4UINH 2APFA 3VXOB 1GH7A 1TJHL 3HC4L 1QUNA 3MC0A 2ZNXA 3T1WA 1ZHKA 3H8NA 4WHYG 2X9WA 3MZGB 3HS0B 1IGYA 3OBAA 4OGYH 1HHGB 1YEGH 4KMQA 1Y0LB 2H32A 3MBEA 4QHKJ 4HKZA 3EKCA 4EN3A 4K07A 1UEMA 5T1MB 4MA8H 4Y4HA 1UM5L 5AZ2H 1MLCA 1T0MA 4I18C 4OCLC 3T8XA 3TPUB 1R5WB 3ZKQD 1MUJA 1OAUL 1LD9A 4JFEE 4UILL 1J1XL 5B38G 1I1RA 2EDKA 3JWOC 2BMKA 2ICWI 4O51A 3VA2C 4GLRI 5HDQH 2J8HA 4WDIA 5HD8D 5CHNA 2MCG1 5E4EC 4MDIA 5L8LB 1NLBH 3V8OA 4H0HB 2X44D 3T08A 5D2NA 1K4CB 3DUHA 2XFXA 2VE6B 2O5ZL 4NJ9L 4APQA 2GQHA 1QACA 3PJSB 1V5JA 3QIUB 4PRIA 4JY5L 4G9FA 5ILTH 4WU5A 3W2DL 1EPFA 1XEDA 5FUCC 2NY1C 1DE4A 3QH3A 1W2KT 3O8XB 3SKJH 4WO4C 5E24E 3T09A 3LN5B 3RNQB 3FMGL 4KQ3L 2Q86A 3H6JA 1I3RB 3SPVB 2HTKD 3X13B 5SWQA 4PGEB 4KJWD 1YECH 1GZQA 5C6TH 5EZJA 1WCBA 4LL9A 3BKML 4KZDL 4ZUSB 3RU8H 2Y1VA 1FYTE 5GIRB 1OOAA 4K7FA 5DSCB 4UINL 2CUHA 2X4UA 1KJMA 5MENB 2VUYA 3FB7B 4KI5E 1OVZA 1ZHNB 5C09B 3V7AG 2XNAB 4OGYL 5C0JB 2F8OA 4PYGA 5TDOB 5D7JB 1X5JA 2XIDA 1TFHA 3QUZD 4G6AD 4MA8L 5CJBA 4NM4L 1QLFA 3V5HB 2GSIB 5AZ2L 1KXTB 3KGRA 2KDGA 3HR5A 1RVFH 3EO0A 3WUWG 3HG1A 3PQYB 4ZDHB 2Z8WC 5DJ0B 1X7QA 1T3FB 3FONA 1NUDA 3TWCH 1QNZH 1HQ4A 2VLRB 5F1SA 1J87A 1OWWA 4FMKA 5ANMA 3CXDH 4JFQA 3ROOA 4JQVC 1G9NC 3OKEA 3BZ4B 3NFNB 5BJTB 4EIGB 3SCMB 2ATPA 5FXCH 4PJ5B 1BHGA 4RBPK 5SX5K 3ULVC 5CCKH 4H25A 2VR4A 3MZTA 2CJUH 1KCLA 3GSUB 1NC4D 3D69A 4NNYB 1IC4H 2B8OT 5GS1B 2ZUSA 3RVUC 2EKSA 2CO7B 1MFAH 2VSCA 3RIAK 1T83C 5A2IH 1HH6A 4GKNB 4PS4H 5KVMC 1J05A 1OY3B 2V5TA 5GPRA 3UDWA 3V6ZB 3L7EB 2VXUH 4JR9L 4P2RE 3PWPB 4F58H 3SDXF 3MBEC 5SWZA 1TETH 4K94H 3X12B 4EN3C 3CMOH 4KK6C 1MCSA 4Y4HC 3RU8L 2WP3O 5GISL 1RZJH 4CW1B 4FQ2H 5D5MB 5E2JA 1QFWL 3ZKNC 4NUJB 4W6WB 4OI7A 3BO8A 2X10A 5D8JH 2RJMA 3SKOA 4U3XA 4PLJC 2YUVA 4XPGH 5D2NC 1FFNA 4NQSA 4APQC 1K6QH 3HE7B 4EI5A 4PRDB 4KHXH 1YYLH 4AMKL 3MODH 2NZ9D 1F2QA 2WAHA 5E6IA 4ZFFA 4YBHA 1QSFA 5D93B 2WIIB 1PYWA 2PYFB 4G42A 1T4KB 1T1WA 2P5WA 4MYWB 2D3VA 5IB3A 3A67H 4P9HH 2OL3A 3BEVA 2C3VA 5GSVA 2VDNH 3EO9L 4I3SH 3ULUC 4DUVA 5FO8A 1KJ3L 4L9LA 4H8WC 3U83A 3KYNA 3DUSB 1FV1B 5HHOE 3UTSD 3DOSA 2HJFB 2FJFA 4MQSB 3FQXB 4ZYKB 4JQXA 3L5WB 1KLGB 3MJ8A 2CJUL 2FATH 3NFPA 3O6FA 5B39B 1DEDA 4U4BA 2X70B 4L9DA 4FFWD 3H3PH 5JDSA 1WBYA 1MFAL 3KPRE 2Z35B 5IVZA 3VG9B 3BRFA 4N0YH 2EYSA 3A6BH 2WLYA 4GBXD 2PKDA 2VXUL 1CBVH 4M4PA 4F58L 3LZFL 1TETL 4K94L 4JY4A 2H3NB 1WZLA 4RAUA 1RJYB 1ZGLP 2FNBA 2V5YA 1RZJL 1UZ6E 4FQ2L 1NL0H 4DZ8A 2VZSA 4R6UA 2G75A 3INUH 4S1QL 1CCZA 5IB5A 4ZODA 1CICD 5F9DC 3HUJF 4PRAB 4EUPB 1U58B 1XCTA 4ZO6A 2JJUA 3KXFD 4V1DE 4ODTH 3RVWC 2ZCKL 3ECBA 4U6YA 1T5XB 4DFIA 4LF3B 1AGFB 2XWBA 1P1ZB 3FO1A 2Z4QA 2YD3A 3PHQA 3QFJA 2P46B 4HLJA 3T4AB 2IH3B 3BIBX 5BVPH 1K6QL 4FQHB 5DJYB 3D1MC 4R26H 4KHXL 3MODL 4DW2L 3GJFH 4KGLA 2P49B 4HFWA 3C6SA 3FQWA 2FECL 4XMPH 2AV1A 3M1BB 1NGZA 2F58H 4UOJA 1U8MA 2OR7A 4DGIH 5B4MD 1M1SA 3A67L 4NZRH 4UTAL 2VDNL 4I3SL 3T0ED 3SHSA 2DYPD 3UDWC 1H8NA 5EOTB 4YQXH 4JZNB 4DUWA 4WI6A 3RA7H 4PJAB 2BK8A 1FL3A 1YUHB 5KS9A 5CSGA 4G6JH 3IDNB 5EU5A 2FATL 5E2VL 2IH1A 4Z9KB 3G5YB 5IHLB 1V05A 3WLBA 5KSBB 5ID0B 3H3PL 4MSWB 4U1LA 1NJ9A 4U6VL 5JTWA 4JY6B 4I2XA 2EDNA 4N0YL 3GIVB 3PGCA 1E4WH 2CK0H 2CKBA 5BV7C 3QJFA 3GSOA 5C8JA 4R4BB 5IG7A 4WNQA 1CBVL 5F8RC 4MGXA 4M43L 1WBZA 2EEBA 4Y5YA 4F7TA 3MRCB 4QXGL 5DVKA 1NL0L 1T20A 3T2NH 5D4QA 4I77L 5C07E 1HYSD 1J5OL 4OD3L 5TPWH 3INUL 1VACB 5FA4B 3U9UA 2FO4B 1JYNA 4XCCH 3U4BL 3QUMB 3IJHA 5IEKA 1RZFL 5EUOF 4XZUB 2ZOLA 5B39G 3DBXB 1R5VA 1LDPH 4JAMB 4D0CA 5F1NA 5D7SL 4L9LC 1K5NA 2ZCHH 1YJDC 1T2QL 2RFXA 4JB9L 2YD6A 3UEZA 5C0AE 4IHOA 4QRPD 4JQXC 3CSYA 1YDPA 1YPZA 5C9JA 2R56L 1DQDH 2P8PA 1Q94B 3O6FC 2FL5A 4YH6A 4AY0A 3C08H 1OGAB 4XMPL 3EOBA 1N3NB 2Y36H 1MHEA 4Q2ZA 4XNXH 4NZRL 5HSFA 4R4NC 4PJEA 5ETUB 1EBPA 4OT1H 2VL5B 4JN2B 4OLVH 4L4TD 1BMGA 1A6WL 4EUPG 1FH5H 3EO1B 1T21B 4ZFOL 3IDUA 3MXWH 3QNZA 1MCRA 3QEQA 2DWEB 1AXIB 5C86A 1T80A 2LVEA 5ERWA 2NY1D 1IFHH 3RHWK 3GMQA 3BT2L 1K8IB 1U0QA 4WHYH 5I1EH 4I9WE 4RISH 3AS0A 4JPWH 2CK0L 4XBPB 3VXMD 4K23H 3P4OA 2J8UF 1B6DA 3Q1SH 4QYOB 5D7IB 1RPQA 3S96B 4KKLD 2XRAH 3QR2A 2J3SA 1U8JA 3VFWB 4UBDD 4NWUH 2P5ED 1RIHL 5H8DA 4MJ6A 1JGUH 4P57B 1U8LB 4BQ8A 4MB4A 4QGTA 1G6RA 2EDWA 4M7LH 3QDGA 43C9B 3BXNB 4HMEA 4PJCB 3LSOA 1RK0B 2ZCHL 5LQBH 4MMXC 4XP6L 4YZFF 2R1XB 2GTWA 3WDIA 1NAMH 1AD9A 1N59B 1CN4A 4P23D 4XMLH 1UXSB 1DQDL 1IEBA 4R7NA 4PJBA 3C08L 5SWSE 3F65A 2BRRL 3PGDB 4AIZA 1H0DB 2FIKB 1S9VB 2Y36L 4XNXL 1PZ5B 4J3UA 2BP3A 5L2KA 5LKNA 3D25A 5J8OA 4OLVL 3TO4B 3VG0H 2HMIC 3VXSA 2PXYA 3D85D 1E6OH 1SM3L 1DBBH 1FH5L 3S36H 4BSWA 4E42B 4Y5YC 3LRHA 1F11A 4NGHH 3HKFA 3OAZK 3TJHD 4PJFA 3VFNA 43CAB 5FCUL 1MF2H 2X4OB 5FHAL 3HAEB 5BRZA 4QOKB 3RVUD 5I1EL 5FO7B 2HTLC 4RISL 4RFNB 4F7MA 2KZWA 1FGNL 4JPWL 4JFFB 4M8QA 1YEFH 4K23L 1J1OL 4DZBA 4ZOCA 4NQCE 1BM3L 1K2DA 4W4OA 2MCPH 3MV8E 2VITA 5JW5A 3FT2A 1D6VH 5FK9A 2NY0D 3CFDA 1BVKA 2F8VA 3MBED 4HIIA 3RIFF 2XRAL 3VFUB 3EJZD 1ZHLB 2AJXH 4NWUL 5JOFA 3EFFB 2OQJB 4LPXA 4YFLF 4XNQB 1CD8A 3TIEB 3LY6A 3X3FH 2BDNH 2CUIA 2HKFL 4NIKB 2R1YB 5I73C 3BH8A 3BW9A 3KJ4C 1JPFA 4M7LL 4Y2OA 3GUTB 3HI5L 4KDVA 4M1CC 2VLRE 2QKIA 3D39A 1B3JA 1YY9D 2CQVA 1EFQA 5LQBL 5HY9B 4NKQB 5CP7A 5IMLA 4PRID 4F9LA 4PP2B 4JFDD 1B6UA 1R3KA 1H15A 2X9YA 4MX7A 1JIBA 3OB0K 4A6YL 1HE7A 2JF1A 3H7BA 4WW1B 3DPBA 1OPGL 3RBGA 4R0LB 4TQEH 3ZE0E 3MPCA 3NCCB 3PABA 4G5ZH 3VG0L 2IAMD 4EXKA 2W9EL 3IKCB 2EH7H 2X4QB 5HGGS 1E6OL 4O58L 1KB9K 3SJVA 1A2YA 2E7CA 3C5ZD 3S35X 5GGRA 5GZND 3NFSH 3PWPE 3NAAL 1C5BL 2A1WH 1RK1A 2IPKA 4NGHL 1Q0YH 2C3WA 4AIOA 4HMDA 5CSZB 1SJHA 5KSAD 1DDHB 1MF2L 5MHSD 3DTXB 5IJKA 5D5ME 1JJUA 1FZJB 1I1YA 3DXAD 3WN5B 2YPLA 3QIWB 2MHAA 4QNPF 1A6TA 4NKOA 1YEFL 4HGKC 1RUPL 2AABH 1KEGL 4Q58C 3ALXA 1JZ7A 1S9YB 1QZ1A 1Y18A 5EO0B 4KUCF 4HULB 1YN7B 5CP3A 3WHE1 3G9VA 3VXRA 4U1NB 1ZVSB 2W0LA 5BS0B 3DRQA 1YYML 5IF0A 3OXRA 2CSPA 1NFDE 4HT1H 1TLKA 3WHXA 5E2WH 2ZKHH 2ZJSL 1UC6A 2IG2H 2HYMA 2BDNL 3HG1D 2QTEA 3BP7B 5E8EA 3KLDA 4FNLL 4FQQB 1TNMA 1AI1H 2PTVA 3IRZA 3UJJH 2NY3D 1JPSL 3V6OA 3HB3C 1A5FH 4ZTOH 4ZAKB 3HAEG 3MRGB 1R24B 4LNRA 2PXYC 4UNTA 3OAUH 1IKFH 3KNBB 3N0PB 5DGQA 3CFCL 5GSRA 1JZ2A 4X99A 1N5AB 3SN6N 2LAAA 5DJ8A 3MJ9A 5KS9F 4J23A 3RUGE 1Q9KB 3G9AB 3GRWA 4HAFA 1N7MH 3VDCA 1TCMA 2BY0A 2BVQB 2OL3L 4UDTB 1UEYA 3D18A 5J4MA 5DEFB 4GBXB 5JHDA 3FAWA 2Q6WA 3LQZB 4YHYB 3WFHB 1RV6X 3VJ6A 4W4OC 3UX9B 1U8HB 3FQUA 3NA4A 3HI1B 4FZ8L 4CMHB 2GCYA 5SWZD 4PJ8D 1X9QA 1CG9A 3NFSL 2XN9A 2ENYA 5ICZB 1Q0YL 1CFQB 3P0VH 2NTFA 5T3XL 3V79C 1TPXC 4HUXA 3I6GA 4OUOA 1FZMA 4C4KO 1BEYH 1H3VA 1CIUA 1EXUA 5IJVB 3RGVA 4Z6AT 4ONOA 5KVDL 2F54B 3LEYH 3MYJB 1MY5A 1U8QA 3OJDB 3CLEH 3DX6B 3DWTA 4ISVA 4EI5D 1QQDA 4JCLA 4F9LC 3C8KB 1QRNA 2Q7YB 2ZKHL 4P48A 2EYTB 3M8OL 2L4OA 1NDGB 5E6ID 4DGVL 1QSFD 4U6HB 3UC0L 4U1IB 4WFHD 2IALB 3TO2A 3CVHA 4KVNL 5I1LB 3T0EB 2FBOJ 2DYPB 3ARGB 2YRPA 1AI1L 4ZFZA 3UJJL 5C6PB 4X0KA 2EDRA 1A5FL 4ZTOL 2P8MA 3W5NA 2BHZA 1T1XA 3L3OA 3REWA 3OAUL 4GAJH 3RWJB 4M5ZH 1HSBA 1EEYA 1HSAA 3ZTNH 4PJAE 3MOAL 3F7VB 2YA1A 1DUYA 4Q74A 4DKAA 3D0LA 4M7LT 1S7QA 1RAMA 3O6FD 3EGSB 4GKOA 5IJKC 1H5BA 1K8DA 3B2UC 1PQZA 5H2BB 5T3XD 4HIEA 4P2QE 5KSBE 3WIHH 3X17A 3H9SE 3M17B 3PP4L 4I0PA 4KMTL 3PWUB 3GNMH 3E6FB 1S7UB 1P5VA 2VNCA 4QXUL 3MGOB 1QR1A 1D5ZB 5DRZA 1NCWH 4M5YH 1A1MA 1YNTB 3W0WE 5B21A 2K7PA 3P0VL 1JZ3A 4ESKA 3P11H 1Z6JT 1G7JA 5DMGC 1BEYL 2E8ZA 4GRMA 1V7ML 4IDLA 1DUZA 3FN9A 3N1QC 3CFJB 4XVTH 5DD3L 3DX7A 3TT1L 2FRGP 4ZOAA 1DZBA 3V6OC 4UU9B 4ZFGL 2ADFL 4GKZB 1Q8MA 4KUCD 3O2VH 3LVEA 2O61B 4I18B 4KVCL 3QFJD 6CGTA 1E27A 4J12A 5F7KC 5IR1A 1XAUA 1MCOH 2JKXA 4OLUH 2YD8A 5IBLD 5GRZA 5CEZE 1NKOA 1DSFH 2VXSH 3SGKA 1NANI 5E4EB 4HWEL 1U2HA 1CT8A 1N8ZA 2IJ0C 4HS6A 1OGAE 4HWBH 3K3QA 3SGDH 2CDEA 4U7KA 1S7VB 3RWDA 5ESVA 1BQHB 4EUPH 5I2IB 4GAJL 4NKDA 4HIJA 5CJQH 3TT3L 3ZTNL 3O3UN 5C08D 4TNWK 3ARQA 4Z77A 3CFBA 2DLFH 3HMXH 3DVGB 3QUYA 4NHCH 1WC7A 4I4WB 3IAGC 4WO4B 1S7WA 1CF8H 5MERB 5I19H 4FQPA 2C1OB 3TBYA 2NNAA 3TH4T 1JL8A 3RGVC 2FR4A 4MAYD 5E5MB 1OAXL 1RZGB 2OR8A 4HH8A 3U48A 2CLVB 1QFOA 5ITFB 2OSLA 5LWYH 3DYPA 4QTIL 1WZKA 1N2RA 2P5EB 5DI8B 4G80B 4R8WH 1EFXD 1NCWL 4M5YL 1CLZH 4AL8H 5D7IE 3RNKB 3CD4A 4IJ3C 5DD5H 3TBTB 5F88B 1JYWA 4XPTL 5ISZA 5T1DL 1OTTC 4OZIA 3IFLL 3P11L 2AJVL 4LAQH 4RX4D 1J1PL 3TESA 1OM3H 2AQ3A 4PGBA 2HTLD 4XTRC 3ZYZA 2XTJC 4C57C 3OR7A 1XF5B 2UWEE 1FG2B 1ETZA 4PY7B 3O2VL 1IT9H 5E99H 2V2TB 2JK5B 2FLRT 3QZWG 4G8GB 4ZNEE 4OLUL 5DFVC 3JWNC 3P3YA 1BBDL 2Q1EA 4JKPH 3K1DA 4YGVA 5DUML 3O9WA 2VXSL 4LCYA 3E3QE 5DC9B 3IDGA 1JNNH 3FOMB 2X42A 3O81A 4TUJA 5A16A 2VRAA 3D85B 4I0PC 4Y89A 3QUMH 3CUPB 3MUZ1 5FKAA 4XAWH 1FFOA 5EFIA 3RTQA 1NCUA 3WEXA 3FQTB 3L7FA 3VDAA 1PKQB 4BFIB 3HZYA 5I15L 2Z93B 2DLFL 4NQXB 4Y4FA 3QEQD 4TTDC 5BXFB 4NHCL 5FYKH 4HIHB 1ZHKB 5C92A 5I19L 2P43B 4NBXB 1IGYB 3SQBA 2R0WH 1HIMH 4JRXD 2D0GA 3KLAA 4HKZB 3RKPA 4EN3B 3OWEA 4PJGB 3DYMA 4Y4HB 3RIAF 4N0FB 3T8XB 1T0MB 5C0RH 3D2UA 4M3KB 1CLZL 4AL8L 1MUJB 2W59A 1LD9B 1WEJH 5DD5L 1P4BH 1BQHG 1U41A 2RGSA 4O51B 4RBPH 1F6AA 5SX5H 4LAQL 5CHNB 1OM3L 2NZIA 2AK4A 3SE8L 3SGKC 3MROA 2H2PC 3P0YH 4MDIB 4EQ3A 5FYJH 3X3GL 4J3SA 1B2WH 3WO4C 4ZSOA 4O2EA 4Y0GA 3TIDA 2VDQH 4APQB 4HS3A 1INEH 4PRIB 5DS8B 2JLLA 4G9FB 4WU5B 3P77A 4P4KD 4H0GA 3HZVA 3IJSB 3QUYC 4JKPL 3DV6B 3OG4B 4PJDE 3P9LA 3BKCH 3CSGA 3FN3A 2Q86B 4KC3B 3KYKH 4JHZA 4GRWB 1HXMB 4HPYH 5SWQB 1GZQB 1WCBB 3HB3D 2GJ6D 3SEPA 3HTLX 3IRPX 3E8UH 5DEGA 3VXSD 4KTEH 2PXYD 5JZ7D 4X98B 4LPTA 3DGGB 4G6KH 1DQLL 3BGFC 5FCSH 2WBKA 4K7FB 2X4UB 5C7XH 2OTWB 5GZOC 1E4XH 4LSSH 4XHQA 1U92A 3GMRA 1RIVL 5BRZD 2I25N 2WWKO 3FFCB 1IAII 3PF2A 3TNMA 1TQCC 3P2TA 2VABB 5DJ2B 3JTTA 1QLFB 5C0RL 1DQJA 3S88L 3IDJB 4PBWD 3EO0B 5TE4H 4DAGL 5IMKA 1A7NH 3TA3C 3HG1B 2ZCLH 1P4BL 2CMRH 2OMNA 1X7QB 2E7MA 5EH1A 3MRRB 5HHVL 3O9WC 5M7QA 3QCUH 5ANMB 3DMMA 1EHNA 1YEHH 3P0YL 4ZS7H 1NDMA 5FKPA 3ROOB 1FLRH 4X6BA 5CEYB 1KYOK 3OKEB 5BOZG 1P4LB 2VDQL 1OP3H 4HEPG 2ATPB 1INEL 2Q87A 3D39D 1EAPA 5F3HA 3B9DA 2DLTA 3CXHK 3OXSA 4X9FA 4GG8A 4H25B 3RTQC 2EDLA 5F7NC 3UTSE 4M7JH 3IU3B 3D69B 2NYYC 4Y4FC 1A47A 2EKSB 3P9MA 1HH6B 4NN7B 1ZANH 1J05B 3KYKL 1CL7I 3WNNA 3ZHKA 4HPYL 4XVUC 5EO9A 1N6VA 3E8UL 4YEFA 3EOAA 2VUOA 4FQXA 4KTEL 2ZUQC 2APBA 4C56A 2IQAB 3GMMB 4FQLH 4G6KL 4U7MA 3RY6A 1PKOA 3GSXA 4N90E 3PDDA 2VAAB 5C7XL 2EO1A 5IMMB 3SKOB 2D2OA 4LSSL 5GS2H 3B2UD 3IAQA 5BV7B 1NGXA 4JKMA 4X7CC 1CK0L 3KXFE 2BNRA 1FFNB 3C87A 4NQSB 4XPHH 1OW0A 4M03A 5DMYA 5ENWA 3VXRD 2J5LC 1VDGA 1A7NL 1SYSA 3IDIA 4ELMA 2ZCLL 1QSFB 1A64A 1PYWB 1TZHB 1MCLA 3L5XH 4G42B 4XB7A 1FAKT 1T1WB 4IRSA 2P5WB 3QCUL 5IB3B 1FJ1A 3KJ6H 3BEVB 2C3VB 5GSVB 4ZS7L 3C60A 1EO5A 5FO8B 4WUKH 3T0EE 5I1DA 4OCRL 3KYNB 4UOW1 1ZT1A 3QEGL 5TH2A 5IW6A 4PY8I 2RCSH 2KL6A 2FHFA 3ALPA 1URLA 3GSNB 4M7JL 3DO7A 1UKQA 4D8PA 3WIIH 3NFPB 3O6FB 2K1MA 5F71A 3RPKA 1H3TA 5JDSB 4OZHA 1WBYB 3VXQA 5KN5A 5IVZB 3UYRH 1PLGH 1FC2D 5T33H 1EAJA 5GRJL 3SKMA 1ZANL 1QFUH 2EYSB 5JHDD 3F58L 5CJ8A 1TCRA 4JY4B 4RAUB 2R2BA 4PG9A 2HLFC 5FYLH 5EBMA 3UTQA 3WUZA 4DZ8B 5ALBL 3JWDC 2XN9D 3WE6A 4QHKI 2X4RB 3GZKA 5DTFA 1I75A 1L7IH 1UG9A 1MJJA 4X4XA 4UT6H 1DBKL 1XCTB 3BQUA 3GFUA 4W4NA 4FFZH 3DMMC 3I02B 4P2YA 5FEBA 4GXVH 3RGVD 4U6YB 1NGQL 1TNNA 2XWBB 3LHPL 3FO1B 3PHQB 5T5FH 4WHCA 3RHWF 5D1ZA 2VQUA 4JKKA 1OL0A 1IRAY 5D2LA 3EYQD 4QRPE 3FQWB 3L5XL 2F19H 1FQ9C 2AV1B 1NGZB 4JCMA 1U8MB 5EU3A 1KFAH 4LDEB 3S7GA 4WFGD 2Q8BH 1CDJA 4OB5L 3TBWA 1Q9WB 5DUBA 1ZAGA 2XTJD 1G7PA 4WUKL 2BVTA 1F3RB 5DO2C 4WGWB 3SOBH 1IAKA 4G6ML 1FL3B 4L4TE 4QCIA 4FQXC 4W6XB 1P2CA 2B4CH 1QTYT 1L6XA 1PGRB 3GMLB 5EC1B 5EU5B 4KROD 3WIIL 2IH1B 3RY6C 5MP6H 3WLBB 1RZ8A 1UA6H 1WFUA 3FOLA 1NJ9B 4LU5H 5TGBB 3FQNA 3UYRL 4I2XB 4NZDA 4ODVH 2CKBB 3UYOD 3QJFB 3GSOB 5IG7B 3IVKA 3LQMA 3R0NA 4I0PD 1WBZB 1EHXA 3C5JA 1S78C 5EOQL 1OW0C 4Y5YB 5FYLL 3KYOA 4XB8A 5DJAA 2X2YA 1GGTA 1T20B 2EC9T 2IANA 4LQFH 3IDMA 3U9UB 2P5EE 3W9DA 1L7IL 2OJZH 4UT6L 3IJHB 1S3KL 1I1FA 3BYYA 4FFZL 1XMWA 2ZOLB 3T3PF 3HUJE 5F44A 4TVSa 5GGRY 3C60C 5INCA 1A1NA 1AJ7H 1R5VB 4WEBH 1FAIL 4D0CB 5F1NB 3MFFA 1K5NB 4NDMA 4A2LA 4KJPC 4IM8A 5CUSL 2RFXB 4IHOB 2I07A 1I3VA 1YDPB 1YPZB 3ARTA 2P8PB 2FL5B 2F19L 2J88L 3J8F7 3EOBB 1B4RA 3W11D 5I73B 3DVNA 4OKDA 2NY5C 3OAZH 4PJ7A 3KJ4B 5D7LA 4WVRA 4WV1C 1MHEB 2H1PH 4Q2ZB 1AGBA 4Y5XA 2Q8BL 3S3SA 1WIOA 3KWWA 4PJEB 4MJ4A 4U1MA 4Z7WA 5DJZA 3CDGB 4P2OC 5F9OL 2B4CL 4KHTH 2R29L 1Q1JH 3QNZB 4TOYH 2DQFA 4TUOA 4YGAB 5MP6L 2Z92B 5ERWB 2FBJL 4OIBA 3GMQB 1A6AB 3ISWA 1PKQE 3QUYD 3ZL4L 3SE3A 1UJTA 3JWOH 3BQUC 1JVKA 4URTB 2X1WL 4TNVF 2YUXA 5FM4A 4ODVL 3SO3B 3WHE0 3P4OB 5DJXA 3WSQL 5CGMA 3S37X 1IM9A 1EVUA 1CGTA 5D1ZC 4G8FA 1MQKH 1T0PB 3VD4A 3MLUL 4Z7VA 4MJ6B 5EU6A 2DLGA 3NCMA 4LQFL 1NGPL 2V6HA 4JG0H 3GSRA 4YWGH 2OJZL 1CGWA 3NIFE 1G6RB 3WFDH 5IFAH 1TZGH 1LK3H 4JN1L 5LCVH 1SEQL 4JFHD 3QDGB 3RVTD 5EUOE 1RURL 3OB0H 1AJ7L 4RA0C 4WEBL 5IROA 3LSOB 1CXEA 3SQOH 1NANH 1YMMA 1W8OA 4HWUA 5D2NE 1SBBA 2GTWB 5TDPA 4N0CC 2J1KA 3B83A 4JHAH 6FABH 1WZ1L 3S98A 1FO0L 1EA9C 3S3JA 5B3JF 1IEBB 4R7NB 2E7LC 2P42B 4XMKH 4PJBB 4PRIE 1AFVH 2VXQH 3V4PH 4JFDE 4UB0H 3MV9D 4E5XA 2H1PL 4LFHG 3BZDA 4WUUD 5D9SA 3O9WD 5L2KB 3D25B 5HXMA 4JG1L 4KAQL 1DBMH 1JGEA 5H94B 3K4AA 4L4VA 2XICA 1IC1A 4MZ3A 3ZE2E 4ZPVA 1CFNB 4CU8A 3CAFA 1WWAX 1HYRC 4PV9B 1I8MA 4LCCC 3ARYA 1OTSD 5CLTA 5HYJB 4GRWE 3MGTA 4OIIH 5IWLA 1Q9OA 1Q1JL 2W92A 2W0KA 5ADOH 3KPSD 3PWNA 4PJFB 2B5IC 1AY1L 3VXUA 2BVYA 3OL2A 3MCKA 1L7TH 1JNHA 3VFPA 5I9QC 3K74B 1HH9A 4JDTH 5MHSE 1KUMA 2ZSVB 1IE5A 1F97A 2OR9H 4XCFH 3DXAE 3ZDYF 4DZBB 1K2DB 4GAYA 1AKJD 5IKCB 2Y25A 4X6DA 5IOPB 2VITB 3FT2B 5FK9B 5HJ3B 5F9AC 3CFDB 1BVKB 4HIIB 4S0TD 4N1CA 5DK0A 2IQ9H 3AU1A 1G0DA 5IW1A 4GAFB 1YEIH 4UV7H 1EJOH 1MQKL 1G9NH 4E41A 2NXYC 4X8XA 3KR3H 4JHWH 1TPXB 4YDIL 3QXDA 4HSQA 4YWGL 5B8CA 1DTUA 3BH8B 3HG1E 4PGDB 5IFAL 3WFDL 1TZGL 1LK3L 1JPFB 2D9QB 2R39A 1VEOA 2AK4D 3FN0H 4Y5XC 3G08A 3HPLB 2XPGA 3DNKA 3PNWA 2QKIB 3SQOL 4C59B 1YQVH 5CD3A 4HDIA 5CP7B 5CAYB 4OI8A 1OP5H 4JHAL 1P84K 5IMLB 6FABL 3B43A 1QEWA 1Z9OA 3O3DA 4YZFE 3S8WA 1R3KB 1B0GA 4XMKL 1YN6A 4M6NH 1H15B 1AFVL 2VXQL 5DRWA 4MX7B 2EIBA 2JCCA 3QUXB 3H7BB 3SE3C 1DBAH 4PLKC 1NPUA 3MLYL 4JO2L 3V4VH 1DBML 3ULSA 1MHHB 4Q9QL 3PABB 3MCG1 4QRUB 3V2AR 3GK8H 3SJVB 3I75A 1A2YB 2VLKD 4NN6C 4OIIL 3QDAA 5SWZE 2IPKB 3QWQB 1ZGLA 1SJHB 1KCRH 4LMQI 3ZDXF 2YPLB 2MHAB 1PW3A 1A6TB 4ZXBA 4JFPA 4XCFL 3B8YA 3RKDD 1Y18B 5IROC 4K3EL 2YMXH 1R3HA 4KK5D 4GRLA 1EJOL 3DRQB 1BZQK 3FRUB 3OXRB 2Z8RA 5IF0B 3ULUH 4GG6F 1JPGA 2V17H 5JMOC 1TENA 4MS8D 4Y8AA 3I50H 1MIMH 2CKNA 2XY1A 2QBWA 3PL6A 4PP1D 3QNXA 5E8EB 3FCTB 3PE9A 1X4XA 1SY6A 1QSFE 3W81A 4U05A 4WFHE 4MB5A 4OZGA 5KTEH 1Z9MA 1U3HA 3FN0L 2XG5A 3ZE1F 2QHRH 1R3IH 4QO1A 4ZO9A 4LNRB 4M00A 2LU4A 4JPVL 3KHOA 1YQVL 5L9DH 4X99B 2F8XC 2A9NL 5IWLC 5DJ8B 5EC2B 1PEWA 1PY9A 1FYTA 3PGFH 1O5DT 1OLZA 1HCVA 1MCEA 4M6NL 5L8KB 4HC1A 4XH2B 3U7WL 5LGJB 3QFDA 1UYWL 2BY3A 1DBAL 2Q6WB 5AD0A 5T3XE 2BNUB 2DQJH 3IGAA 3LDBC 3VJ6B 3U9PL 1JZ8A 2R69L 1WUNT 3GB7A 2DMCA 3FQUB 2AGJH 3GK8L 2ILLA 5DO2D 1LP9F 5E00B 4FQXD 2XN9B 3C6LD 3HFMH 2NTFB 2LU7A 2PW1B 4GXUM 4HUXB 4MXVF 1KCRL 3I6GB 5EBLA 4OLZL 4TRPH 1FZMB 5B8CC 3SGEI 5EA0H 1EXUB 3L3HA 4HLZG 4PRNA 4PGCA 4NO2A 1I8IA 5EOCH 5CLWA 3RX7A 2BNQA 4LIQH 1KACB 3DRTA 4QNPE 2BVUA 3DURA 4LPWA 4NCDA 2CXKA 4R96A 5BMFL 1QBLL 4UIMA 2PN5A 1EZVY 4ISVB 2OK0H 5C9KA 3JV4B 3PHOA 4NO5A 1QQDB 2V17L 2MQ3A 4IJ3B 1UACH 3QFJE 1QRNB 5ESAA 4LKXB 4JM2C 4JO1H 5HI5D 3TO2B 3CVHB 3GDBA 2WNGA 2V5MA 1ULVA 3L5IA 4ZFZB 3VRIA 4IRSD 3O6MH 3QDMA 5E08H 2XTJB 3VDBA 5KTEL 2N4IA 1TZIB 4UQ2A 2BCKA 2QHRL 1R3IL 2P8MB 3IFPA 4DVRL 5IUSA 1NBVH 3R0MA 4P2RA 1UH2A 4BK4A 1WJ3A 3QQ3A 3CX5J 1HSBB 3QI9C 5BV7H 3UZVB 2IPTH 1HSAB 4KJPD 1B0RB 1S7TA 2MKLC 3PGFL 1DUYB 1LE5B 3D0LB 4POUB 1U93A 5C08E 2WUCH 5KS9E 2UZIH 3LQAL 1K8DB 1RZIA 2MSPA 2V2WA 4HIEB 1RJLA 4XHJC 4ZXBC 4DK3A 1WVZA 3WXWH 2XWJA 4I0PB 4ZMAT 1B0WA 2DQJL 1WFTA 5J56B 4I2XE 1AXTH 3VGGA 3T65A 5DQ9A 1OAZL 4FABH 3AMLA 1QR1B 4TSBH 4GRLC 1S5IH 5DRZB 5F7EH 4Z7QE 1A1MB 2DTMH 4KXZH 2CRZA 2J12B 1IAIL 3EZJB 3MLWH 2OZ4A 4Z7VF 1YJDH 2A38A 1QBAA 4OF5A 2GW5A 4EXPX 3NVQA 3PL6C 1G7JB 4NZTL 2N7AA 5DVNA 4GRMB 3GSNH 5EA0L 1DUZB 1W72L 3DX7B 5EBWB 2C3XA 5DHVA 5EOCL 3STZA 2CUMA 2MPAL 5CZKA 5HPMA 1GSMA 1P4IL 3CFKA 4HUVA 1XF4A 3ME0A 2WMPA 3GSQB 1PEZA 2R23B 2EH8L 1Q0XL 1S9WA 5HHOA 2UUDK 5CJXA 1LQSR 5KANG 4BZ2L 2OK0L 1U3JA 1CDHA 1E27B 3PIQA 2LAGB 3U36A 3EHBC 4JO1L 4X6CF 3MJ6A 1BLNA 2GFBB 3Q2CA 5E9DA 3EOTH 1YPZE 2RR3A 1CT8B 1N8ZB 2VN7A 3O6ML 4HS6B 4KI5C 3T0WA 5E08L 1HI6A 3WO4B 3MV7D 1R5IA 4YBQC 1NBVL 2CDEB 2PF6A 4LKCA 5ESVB 4JFOA 3MNWA 2XI9A 3RWDB 3TH3T 3KPNA 3MRPA 4NQVA 4PRPA 4NKDB 4WGVB 4HIJB 2AJZA 1CL7L 4JHBA 5E5UB 5DT1H 2D0HA 4N0CD 4Z77B 5JW4Q 3CFBB 4D3CL 4NQEA 3QUYB 2WUCL 4K2UH 3MRNA 3FKUS 4EEEA 3QEQE 5I1GH 4KKCC 3VCLA 2AI0H 4X8JA 2NMSA 2AXGA 4KTYA 3TBYB 2NNAB 3MBXH 4V1DA 1YEEH 1VENA 2P24A 3MRHA 1GL4B 1EV2E 4JRXE 5I1KL 1INDH 2CGRH 2Z91A 2Q8AH 1N2RB 1C08A 2VR5A 4TSBL 1S5IL 3IT8D 5EULV 2FH8A 4D0DA 2N1KA 5F7EL 3BGFB 2VKWA 4ZUTA 1WFOA 2Y07H 2YK1H 1KB5A 2WUBH 3MLWL 4YC2C 4ZS6D 5ISZB 4OZIB 2IAND 4J6RH 5K9QI 1HINH 4WHTA 2CDFA 4PGBB 3TBVA 1HWHB 3VXTB 4YDVA 1YQ2A 2D0FA 1QLEH 1TQCB 2YKLH 3LN4B 5GRVL 3MRBA 3STLA 1ETZB 4LVNC 3VWKD 4ZO8A 4HK0A 4HWZA 5GS0H 1X5XA 4XGZA 3EJYC 3MLTB 3TA3B 1OF2A 1QO3A 1RUQL 1UADC 2MKWA 2NXYD 4IRJD 1CXKA 1TVBA 5FO9A 4FQ1L 4OQTL 5FGRA 1CFSB 3CSPA 4LCYB 2R2HA 4JRWA 3ARXA 3IDGB 2JCCF 1JUFA 4TUJB 2A6DB 1G7LA 5J1SC 2PYED 5AEAA 3CNKA 1R0AH 3EAKA 4JJ5A 5FKAB 4KJYA 1OTUC 5DJ6A 2CIKA 3RQ3A 3RTQB 1OCWH 5AAWA 5KVEH 3BD4A 3VXSE 5DT1L 2YR3A 1ZLVH 3HZYB 1KN4L 3LKQA 4M7KH 4Y4FB 4CVUA 3ALWA 4K2UL 2EICA 3DROB 5E1AA 1KJ2H 2HWZH 1MWAA 3QISA 4WI3A 3MBXL 4YXHH 4BZ1L 1J0KA 3K8KA 1YEEL 5IFJA 5BRZE 3KLAB 1D5BA 4HJJH 5E2UH 2CPCA 3UBXI 1INDL 2ZUQB 1KTDA 5CJXC 3JTSB 4LP4A 3D2UB 1IM9D 2YC1A 5TFSH 2Y07L 3ARBB 2YK1L 2WUBL 1ZSDA 2IEPA 1F6AB 5D1XA 2L0DA 4Y8DC 3WJLA 3H7LA 4BFEA 2AK4B 3RI5K 4G8IB 3MROB 4LVHC 4UOW0 2Y5TA 3I2CL 7FABL 4ZSOB 5I8KH 3T0BA 3TIDB 3DV4A 1EHAA 1AP2A 4HS3B 1MRCL 2DL9A 3NN8A 4ODSH 4GOSA 4DQOH 5GS0L 2X6MA 3HE6B 1NCTA 1AC0A 1YMMD 2J5LB 4X4ME 1RUAH 3D39E 2EZ0D 3HZMA 1IKNA 4HG4K 3QXUA 3JZ7A 3O3BA 4O02H 1MFCH 3UYPA 5C0ND 5D96C 4BELD 3ARZA 1IQDA 3P9LB 4AJ0A 5JR1H 1SYVB 3VI4F 1AQKH 2H8PA 4XNUH 1R0AL 2YSSB 4L4VD 3LB6C 1G6RH 5DEGB 1IILE 1OCWL 2GUOA 3ROLB 3OQ3B 3JV6A 1M05B 3OKKA 1MVFA 5K59E 4M7KL 1QBMH 1S5HB 5IFHL 2AJUH 2EO9A 3MR9B 3WD5H 3Q6FB 4FTVD 3VXUD 2A9MH 1J7VR 3GMRB 1KJ2L 4XWOD 2HWZL 1CFVH 4YXHL 2JJTA 5CZXD 4U6XB 1U8IA 2E3VA 4CDHA 2NXZB 3IB4A 3JTTB 1X6LA 1JI2A 3TN0D 1WWCA 1DQJB 4XCEA 4LGPB 5IMKB 4QWWC 3T0AA 3VXRE 3BDYL 3CZFB 3P4LA 2FSEA 2BFVH 4GAGH 3DMMB 1UJ3A 4OGXH 5FKPB 3GMOA 4O4YH 1MCJA 4J7RA 4X6BB 1X4ZA 2MFNA 2YEZA 3HCVB 4JGUA 2QSQA 3G6JB 1EAPB 4K55A 5F3HB 4ODSL 3OXSB 4X5XB 4DQOL 4GG8B 5IK3B 1MNUH 3CH1A 1RUAL 4PJXA 4BSVB 1KIRA 1EMTH 5I30H 4CRPA 3CLFH 4X4ZA 3V4UH 4OCXH 1MFCL 3SDCA 4NNXA 4HCRL 5HHPA 4XPFH 3P9MB 4YHKL 4H20H 1MAML 3MACH 5JR1L 4ZUWA 3WFEH 3FL7A 5GHWH 1CGSH 2Z31C 2ZPKH 5CINH 4XNUL 2JELH 3MV8A 5JHDE 5EO9B 1A3RH 1PSKL 4FQXB 3CH8A 2G60H 1NAKL 4C56B 4MA7L 4Y19A 3GSXB 1NGWA 3LCYA 1QBML 3UBXG 5D1XC 5FGCE 2RBLA 1VGEL 2AJUL 2JB6A 2XN9E 3WJLC 2QSVA 3VGHA 2XV6B 2Y5EA 4HLZH 2A9ML 4Z0XB 3Q5YA 3U4AA 1NGXB 2SEBA 4XHJD 4EKXA 1JGVL 2PO6A 2BNRB 1VPOH 2EECA 3N50A 5ENWB 5EN2A 4Q0XL 1SYSB 3IDIB 4ELMB 1IKNC 2JJSA 2R4SH 3LS4H 1UB5A 2VDRL 3PL6D 1FJ1B 4OGXL 4RAVB 3C60B 4O4YL 3ZSSA 3VFGH 1AH1A 4WFGE 1U3HD 5I1DB 3DX8A 3I85A 4GW5B 3V5DA 2A6JA 1ZT1B 2XTJE 5TH2B 5IW6B 3FRPA 4AEHL 1MNUL 1JN6B 4RWYH 1A6PA 2FHCA 5I76B 3B9KD 4FG6C 5I30L 4RFOH 3EHBD 4YAQA 4OZHB 4XPFL 3VXQB 5KN5B 4WV1B 3ZKMC 5HTSA 3MACL 3WFEL 3G5VA 4HMCA 1CGSL 2E8YA 4NM8H 2JJTC 2WBJB 3ARVA 2JIXA 2ESVD 1D5XB 1A3RL 3C8HA 3VRLF 1MJUH 4BFBD 4P2OB 2F5AH 4N5EC 1UB6A 5EBMB 4CGTA 2VN4A 2OTPA 5DQDH 3ZKXC 1NFDA 3QULA 5IGXH 5EG6C 2L7JA 2OS7A 5IMOA 3V6FA 5DTFB 5A2LH 2UVEA 1MJJB 4X4XB 4TULH 5I8EA 5KZCD 5EBGA 5AYUH 3IETA 3BQUB 3WNPA 3MJ9H 1D9KA 3UTTA 4KKCD 3BN9D 1F4YL 1QVOA 2AEIT 4P5MA 2BNQD 5ESQB 4AENA 1A02N 1KJVA 2AJSL 5JO5B 5D1ZB 1ZTXH 5J06A 3QDHA 5D2LB 4O2CB 1DVFA 3B3IA 2QJDA 2C3HA 3BJLA 3RUGA 5CFHA 3LS4L 3SDCC 3MCLH 5EU3B 3MLXL 2CLZA 5FOBB 5K33A 4OF0A 2DOCA 3QDMD 2LVCA 1G7PB 4WWKA 3F5WA 1E28A 4ODHH 3BE1H 1IGFH 4XPAH 1CLOL 4ZQKB 1P2CB 1B88A 2R0LL 4RWYL 1TVHB 4XNMA 3CGTA 2E6JA 1QA9B 3OV6A 3EDEA 2GJJA 1B90A 1HN1A 1RZ8B 4RFOL 4ENED 5F7LB 5HGDA 3U7YH 3FQNB 5D7KD 3QNYA 5JW4N 3T2PA 5D71H 2E6PA 2H45A 1T2JA 4LPCA 3TCXA 5GGTA 2OCFD 1G9MC 2PO6C 1NEZA 2XY2A 1N4XL 4LCCB 3C5JB 2XQBH 2X4SA 1RZ7H 2W9DL 3KYOB 5DJAB 5DQDL 4FQIH 1V8HA 1FE8H 2B5IB 5I17A 1VEMA 3IDMB 1AD0A 2JJSC 1TTFA 5I9QB 3W9DB 4WI2A 4NUGL 2YA2A 4QRTB 4TULL 4M61A 4OFPA 1XF3B 5I6XC 4LCUA 2A6IB 1G9EA 4MJIA 5DJDA 5I74C 1I7UB 1A1NB 4TVPL 2ORBL 4I5BA 4JFHE 3MFFB 4P2CG 4Z7OF 4NDMB 3GI9H 1MCKA 3QXVA 2G9HB 4K7PL 1BZ9A 3WIFA 5JPMA 2I07B 2NXYB 3R06B 1P9MA 2BY1A 1OD7A 4WI4A 2HRLA 5E8PA 4PRHA 4PJ7B 5I16A 4OBRA 5D7LB 3UAJC 1AGBB 5E9DD 4LHUD 4Y5XB 5KVFH 2EIDA 3KWWB 1FFPA 3O6LL 3ETBF 2C4FU 4WUUE 2D4DA 1OAYH 4Z7WB 3NZ8B 5CMAA 1H3WM 4ODHL 3BE1L 1IGFL 5IBUB 4YHNB 4PRPD 1I8KA 2EDXA 3MSPA 1BAFH 3IXAA 4NC1E 3KPSE 4M1DL 3V8CA 1U8PB 4NQED 1MPAH 4OTXL 5IQ9A 3BDXA 2MMXA 1J88A 1D9KC 2B7DT 5D71L 4YUEL 3IF1B 3HNSL 5DJXB 3RJQB 2CDGB 1G6VK 3S3PA 3V0VA 4PV8A 1G7QB 3QIBD 5C0IA 4G8EA 2XQBL 1IM9B 1RZ7L 4NN6B 4TVPD 1EDQA 4Q97A 3O41A 2YPVL 4PRBA 4FQIL 1BREA 3QG7L 5EU6B 4M6OH 1V3LA 1DVFC 4YX2H 3U46B 2YBRB 2APTA 1DBJL 3ZYJA 4QHLB 3RWCA 1NFIA 2AK4E 1U3YA 2VIRA 4WWKC 1YMMB 3GI9L 4EVNA 1XGPA 2HKHH 4X6FB 4JEGB 3K8MA 5TDPB 1KSRA 3TVMD 2G2RB 2VKXA 2BOCA 3BPNB 2QQKL 4QWWD 2VXVH 5I1CH 1A4KB 5E1HB 1RZKL 1D5IH 1KENL 4R90H 4E5XB 1IM3A 3WLWD 5KVFL 1JGEB 4L8CA 4L4VB 2MQ0A 1NCAL 4NHUA 1OAYL 4BSJA 4ZPVB 3FO9B 3QYCA 4Z95L 1I8MB 3O2DH 5IHZB 3K2UH 4S1DC 1WLHA 3MGTB 1ONQA 3EYUH 4DTGH 1Q9OB 4Y2DC 1FLTX 2VLKE 1EEZA 3ARED 3PWNB 3ILQD 2HT3D 3VXUB 3VE0A 5J6HA 3BPLC 1JNHB 1MPAL 3MCKB 3VFPB 2CR3A 4HX1B 1HH9B 1JPTH 4M6ML 1A14L 3EYSL 1Z9LA 5E95B 5IB1A 5HBBA 2V7NA 3RZCA 3GIZH 3LDBB 1FNSL 4GAYB 4J8RB 3MGAA 4OM1H 4XXDA 5HHXL 4U6TA 1NGYA 2E6QA 5DK0B 3T2QA 4CVXA 3AU1B 3IU4L 5IW1B 2BSTA 1P5UA 4E41B 1TJGH 1MREH 1BWMA 4WW2F 5MI0C 1H3GA 4YX2L 5IBUG 5B8CB 5DK3A 4XVJL 5CIPA 5J1AA 4NYLA 3S4SA 1EH9A 2HFGH 5GGVH 4OFKA 3RX5A 2XPGB 3B5GA 1HKLH 2A74A 3MLZH 3Q6GH 1XCQA 2HKHL 1KG0A 5CD3B 5C0DB 3QO1B 4HDIB 3MOBH 1X5HA 2BVPB 4LEXH 4LSUL 4P3CH 3O3DB 4JM2B 4LSVH 1B0GB 4NWTL 2VXVL 2ZSWB 4JVUA 1KCVH 2YPKB 3LPGA 1WBXA 2I9LA 3NIGF 4R90L 4OCWH 5TF0A 1FL5A 2DQEL 5IB2A 3HZKA 3ULSB 1BZ7A 1A7QL 1JGLL 1F4XH 3O2DL 2P4AB 3K2UL 3QI9B 3QDJD 1ZLSH 3DJ9A 4AT6A 4CVZA 3QUZA 5INDA 3RWGA 1T7XA 1ZGLB 1FL6A 1JFQH 4B41A 2APWA 2HRPL 1W0VA 1ADQH 1JPTL 4KWUA 2HT4C 4ZXBB 4JFPB 4DVBA 4CU6A 5JQ6H 5GGSB 3GIZL 3RWHA 4WTZA 5JLZB 4EI6B 4X9IA 3ZDYE 2FD6L 1KOAA 1R3HB 4K8RH 2B1AH 4LCIH 2ERJC 4GRLB 4NKIL 3MRJB 1NH6A 1JPGB 1TJGL 5I0ZA 1MREL 1OAKH 1GC1C 8FABA 4YR6B 2BY2A 3ARFD 5I8CA 4AG4H 4XCYA 3O3AA 3QNXB 4KRPC 3TZVA 1A6UH 3LKPA 3IDXH 4PJDA 3VWJA 1GPOH 1ZEAH 1K4DA 1LGVA 3NMEA 4OZGB 4L1DA 5GJSH 3PWVA 2HFGL 1KB9J 3REVA 2ATKB 3N9GL 4K7PY 2FYYB 2VOTA 4ERSH 1HKLL 4PJIA 3DIFA 2MQCA 2VLMD 3MOBL 4P3CL 1VFAB 5LGKA 1IEHA 1M7DA 2X4TB 1FYTB 2EDEA 2OTUA 5IVNA 4HQQL 3BEWB 3SDCD 3UTOA 3QFDB 1AO7D 4OCWL 3NPSC 3JWDH 5AD0B 2E7BA 1MRDH 3RZCC 4UQ3A 3IGAB 2VQ1B 4B7LA 1IGJA 3TFKD 2VB5A 1K85A 3LMJH 4MA1C 4N9GA 1ZLSL 4XBGA 4JPIA 4F7EA 3G6DH 1T5WA 2VZVA 5CKAA 3O2WL 1L0YA 1ZKAA 1CGUA 1EHLH 1JFQL 4Y19D 3QHZH 1ADQL 5F70A 1BQUA 3KPLB 3L3HB 5KVGL 3NABH 4MNHA 4F7PA 4HXBH 4PGCB 4UT7H 4D9RD 1IC5L 1I9RH 4NO2B 3TJEH 5JQ6L 4D2NA 5ID1A 4ONGH 4IS6A 3LKRA 3T04D 4QF1A 1FNEA 3ARSA 1DL7L 1BX2A 3E6HB 4DKEL 2HTKC 4K8RL 4UIMB 2B1AL 4I8DA 1MEXH 3TNNA 4AIXA 3PHOB 2AXFA 1S9XA 1WTLA 2ARJA 2P7TA 4YC2B 5BZDB 1IARB 1MLBB 3AGVA 2QQLL 2AXHA 5D2LE 1A6UL 4NO0B 1ZEAL 3VRIB 3QDMB 5GJSL 1IGIL 1S7RA 4UQ2B 5ITBL 5HPOA 2BCKB 3IFPB 3HMWH 2FDBP 4OGAD 4P2RB 4LVNB 4ERSL 5F9JB 4G3YH 5C0EA 3MV7E 3ZE1E 3QQ3B 4JM4L 2H26B 5DFTA 2DD8L 3QUZC 5ICXA 3OR6A 3RX8A 4G6AC 2C7UA 1S7TB 4X9BA 3QQ9C 5DF0A 3HHRB 4NFDA 1U93B 2BXZA 1CDGA 2D31A 1RZIB 4O5LH 1CICA 2R0KH 2V2WB 1RJLB 4PBVC 4PTUA 5I0DA 5CBEA 4CMMA 2XWJB 2WSKA 2VJXA 3KXFA 5KOVC 2XZQH 3RAJL 3T65B 2JIXD 3WFZA 3LMJL 1NQBA 1W0WB 1KN2H 3CX2A 4M1GH 1A8JH 4NP4L 4WU7A 1VFMA 2X41A 4WI5A 1CIDA 1NCCL 2E9WA 1EHLL 2MJWA 3TM6A 1RULH 1LEGB 4LEOA 3QHZL 1MELA 2IANE 4AYFA 2HVKA 3ABZA 3NABL 4HXBL 4XNYL 1JI1A 5DHVB 3TJEL 3OB8A 3STZB 2CXGA 2GK2A 4ONGL 3UTTD 5HPMB 5J89A 4HUVB 1BJ1H 1XF4B 2NY5H 4Z7UF 5HHOB 4DK6A 3SE9H 5T1LD 4YDJB 4N0RA 5GGUB 3T3MF 3PIQB 4D0BB 1F58H 4MVBC 3F8UB 3SDAA 3RL1A 1P69B 1DVFD 1BLNB 4F37K 1DLFH 3KPRB 2DN7A 5KSVA 1ZLWK 3BIKA 1HI6B 3P73B 4ODBD 3HMWL 1R5IB 4JFOB 3MNWB 1G7MA 5J9PA 4G3YL 3KPNB 3MRPB 4G9DA 4PRPB 4M8VA 3U0PB 2PYEE 3H3BC 4ZD3H 1TIUA 3H9HA 4MLIA 4XXCA 3SDXA 2IFFH 3BH9A 1GAFH 4Z7WE 1PG7L 2V2XB 4GUPB 1A3LL 3BSZL 2BSSA 5D96B 3VCLB 3DYOA 4O5LL 2AXGB 1LEKB 3RVVD 1JP5A 4KRLB 4V1DB 4TSAH 2P24B 5JW3L 3D0VA 1Z0NA 2APVA 5EPMA 1BJMA 4HGWA 2XZQL 5KW9H 4QHMB 5J57B 2Z91B 3FB8A 1U6AH 4HKXA 5F7MC 3DGCR 1AHWA 2I5YH 1KN2L 5GJTL 4KI1A 5EOCJ 1A7PH 1JF5A 2J2ZA 2WINA 4ZUTB 1KB5B 1J10A 2NLJA 5JPNA 1F45A 2N56A 5HVFB 1A0QH 4QRPA 5TQ2H 1RULL 2EDBA 4Z7VE 1KCSH 1UXWA 3MRLA 3UO1L 4WHTB 3RFZC 2CDFB 4OV6F 4FFWC 3MXVL 3TBVB 3IAPA 1UWXK 3PUCA 1OD9A 4UDUA 4MJID 3MLSL 3STLB 35C8H 3MRBB 5DD0H 4KY1H 1JRHH 4HK0B 4FS0A 4HWZB 2X4NB 3MRMA 4L4TA 4LLAA 4P0DA 4P59H 4XGZB 3GSVA 1IGCH 5L88H 3JUZA 3OKMA 4Y5VA 4XP9H 1YMME 1WTGT 5DRNB 1F58L 4P3DB 5E7BA 5T5NF 4D9LH 5I1HL 1TVBB 5FO9B 5FUOH 4FXLA 1A1OB 1DLFL 3AAZA 3HC0A 2R2HB 3MTRA 4PRHD 1JUFB 1CICC 3LEXA 3CFEA 1LILA 1K3ZA 2HJLA 1H8OA 1Z5LA 2DL2A 3VXMA 5I1AA 3LN9A 4JJ5B 2EDHA 5DJ6B 32C2A 4NPYA 2CIKB 4JANB 3QWRA 4L4VE 1SVCP 2ZUTA 2FGZA 1GAFL 4YXLL 2LV4A 4NN5C 3LKQB 4K3HA 4GS7C 5DVMA 4HBCH 3BZFA 4H88H 5BQ7A 1EO7A 3D87B 4PREB 2P45B 1MI5A 1MWAB 1U95A 4FTVE 4U1KA 3HUJA 4NFBA 4HPOL 3GJFA 2Z31B 3QHTC 4TSAL 3VXUE 5IFJB 1NBQA 4AH2A 1JV5A 4UT9L 1D5BB 15C8H 2IGFH 4HF5L 5CGTA 1KTDB 1N6QH 2I5YL 2LABA 3RGHA 2YC1B 1A7PL 4X6DE 4YIQA 3BGMA 5C0AB 4Z8FH 3X14A 2VDLH 3LPWA 4EBQH 1A0QL 5D1XB 2XOTA 3LEVH 3U1SH 3SDAC 4P23A 4K94C 1XGTA 2VLLA 1RZJC 4DN4L 4X4YA 4X9HA 5HDOA 1KTLB 2HT4D 3HR6A 3DV4B 5GGQH 2E27H 35C8L 3BKYH 1AP2B 3T0VA 5DD0L 4D9QD 1CVRA 4P59L 4PJIF 5LVEA 4JRYA 4PB0H 4XXCC 1C5DA 3HZMB 1RSFA 4BQCA 3MUHL 4XP9L 5AZEH 1JYXA 2YZ1A 4GMTH 3OAYK 4UTBH 1SVZA 1FNAA 2FEEI 1J0YA 1CQYA 1HYSC 3GBMH 5F6HJ 1IQDB 1MCNA 4ZOBA 1NC2A 2JCCE 2FJHA 4ORGA 3AUVA 5DYOB 3VH8A 4BQ6A 2D7TH 4YHLH 1AHWC 5C0GA 5DD6A 5E4IA 1V3MA 3JV6B 4CJ1A 3OKKB 5F1KC 3FB6A 2JE8A 4I3GA 4X5WB 4HBCL 4OFIA 4H88L 2DDQH 2DQHH 2ZUUA 5TJWK 4RMUA 3U0WL 3CJJA 4JFZL 5D70L 3MLPA 5EUOA 1FZOB 5K9OA 4MNQD 1U8IB 3RZCD 3OKLA 2M26A 1T1YB 1XFPA 5I1IH 2IGFL 1MFEH 3UJTH 3N1FC 4FQCH 2Z8VC 3BWUC 4HGMA 4HKBA 4IOIA 4GQ9H 4LBEB 4XCEB 3ZKXB 5JHLH 4Z8FL 4WIQA 1EZVX 4Y5VC 1FNGA 2V9TA 4EBQL 3LEVL 2FSEB 5SWSB 1VSCA 4JFDA 1I9EA 3VFVB 5HGBA 1O7SA 3GGWA 4UI2A 5DXWA 4O2FA 4LLDA 1KLFA 3GMOB 5ALCH 2YN5A 1QD0A 4EJ1C 3BFOA 2E27L 3DI3B 3BKYL 2NW2A 1SEBA 5T1KA 4OZGE 4PD4K 2BRQA 2IAMA 1UWGH 2DQGH 4PB0L 3CH1B 4KDWA 4DKFH 5DEZA 4PJXB 4QRSA 1J8HA 4KKLC 3C5ZA 1XR8A 3BKJL 5AZEL 1AR1D 4GMTL 3SDCB 4OFYA 4YK4C 4UBDC 5HHPB 4KKAC 2IFGA 2PTTA 5KSAA 2DBJA 3GBML 4K3DH 1CXLA 2DWDA 5TE7L 4ZUWB 5B38A 1T1ZA 3DXAA 4KV5F 4WCYH 4NQCB 1ZE3C 1BVLA 3H42H 3MV8B 1MCFA 1UZ8A 3VI4E 2J8UA 4MQ7A 1IQWH 2ESVE 2AV7A 4WY7H 5DRXA 5FUZH 3PHSA 2D7TL 4YHLL 1RHHA 1YEGL 4QHNA 3CK0H 2FWOB 4Y19B 4HH9A 3BP4A 1BD2A 2WWMD 5I66A 4WJ5A 3QQ9D 2JB6B 2DQHL 4P23C 1KELH 3GM0A 3T4YA 4HIXH 2NPLX 1KYOJ 4LSTH 3JXAA 4POYA 3MMEA 2SEBB 5HDQL 2FEDD 3CXHJ 2CRIA 2PO6B 4YO0B 1MFEL 2BNQE 12E8H 4A6YA 1NLBL 3ESUF 2HLAA 4GQ9L 1BFSA 2RQ8A 4LLUB 5D72H 3MA9H 5ILTL 3TJHC 5I6XB 3R8QA 1AQDA 3TZVD 5I74B 5JORA 3VWJD 5ALCL 3SKJL 4J1UA 3NIDE 3DX8B 4QT5A 4YHOH 2A6JB 1ZVHA 4RRPG 3QDME 3T77A 3QXAA 1UVQA 2DBLH 1YECL 2NY0C 5C6TL 4PJ8A 3EJZC 3D3VD 3WO3B 4NJAH 4L8BB 1DFBH 1X5IA 2EEDA 4YAQB 3V52H 4GT7A 4MVBD 4OFVA 5ADPH 1CR9H 4K3DL 1A3QA 3GKWH 3WUWA 4F9PA 3G5VB 4YDKH 4MJ5A 4L3ED 1F5WA 4YE4H 3VMOA 1T7WA 3O3EA 1SY6H 1IQWL 1MFDH 1UB6B 4K3JH 3W5MA 2W60A 1YY9C 1NFDB 1CYGA 3QULB 4LHJB 2ITDA 4LLQA 3QCTH 4HS8H 1RVFL 3HS0A 3MO1A 1KELL 3MRKB 3IETB 4HIXL 4LSTL 1D9KB 1Y0LA 4OFDA 4LNVA 1QVOB 1AR2A 2QV2A 3FHQA 3TWCL 1QNZL 3LAFA 4AENB 4HC1H 1KJVB 1LO2H 2A77H 3CXDL 3SGJA 1R5WA 12E8L 5F7FA 3V0AC 2IAMC 1YEJH 3T0DA 5TF1H 1WFNA 3R1GH 3BHBA 4IMLA 3B6SB 2OJEB 3L3DA 3L5HA 3C5ZC 1DVFB 3B3IB 5E7FA 3RUGB 5GZNC 3MA9L 5CCKL 2R1WA 2H2SC 5KSAC 1MHCA 3WFBH 2CLZB 1IC4L 2EDJA 3I84A 5EIVA 2VE6A 3SGDI 5KBNC 1QP1A 5E9DE 3QEHA 4JQIH 4WWKB 3F5WB 4YHOL 3QIUA 1E28B 4PS4L 3K46A 5CD5D 1I8LA 4XNMB 2ICWA 1G0YR 4PRPE 4LMQE 3O8XA 3CMOL 3N06B 1DFBL 5HGDB 4PJHF 3RNQA 4OD2A 5ADPL 1CR9L 1OP9A 3QNYB 3GKWL 4NQEE 4DWHA 4XP5H 2A6KA 5D8JL 1MY7A 1KF9B 4YDKL 1UWEH 1UQSB 3W9EA 4C58B 2NY3C 2X4SB 1MFDL 1NMCC 4XPGL 4Y2DB 4TVPE 4RMWA 2WK2A 3Q3GA 5I17B 3S97C 5MENA 1NUGA 3BPLB 5J13C 3C5SA 3FRPG 1YYLL 1ZHNA 5C09A 2D7QA 1DP0A 2XNAA 4CNIB 4MJIB 1MCQA 5DJDB 4HXAH 2OX5A 5D6DA 4N0UE 1JNLH 4XWGH 1YEKH 4TPRH 4P9HL 4PTTA 3UROR 5DD1H 2C26A 4HUNB 4RMVA 5TF1L 5JPMB 2VO5A 3R1GL 4ELKA 2PCPA 5F7DB 4AQ1B 4PJ8C 2YN3A 5MI0B 5C08A 5E8PB 4OJFH 5I16B 3SDAD 1PBYA 1AXSB 3MQIA 3WFBL 4PFEA 3SY0B 4DFHA 5A2KH 4P2QB 1MSPA 4TUKH 3L9RA 4F9PC 3BZ4A 1FFPB 3H9SB 2CRMA 5BJTA 1MCCA 3A6CH 3SCMA 4F7CA 1MFBH 4JQIL 4PJ5A 1ZGLM 4MAYA 2HH0H 3VU2A 3KG5A 1Z9SA 3NCJH 5CMAB 3A6BL 5DHVH 1I8KB 1RMFH 1NMAH 4NNYA 2YXFA 3IXAB 1I3UA 2A83A 3UJIH 3W0WB 3I3EA 1EFXA 3ILPA 4D94A 4OV5A 2VXTH 1X5AA 4EI5C 1BF2A 3DETC 4GKNA 4QRQA 3S5LB 2YS4A 4F80A 2W91A 1QSED 5E6IC 4RX4A 2NY4C 1UWEL 1UZ6F 3VGFA 1G7HA 4PV8B 3V0VB 1ED3B 1CLYH 4CW1A 1XGRA 4ODTL 4WTWA 2HVJB 3O41B 1FIEA 4U1JA 5CILH 2AK1H 5BVPL 3NCYP 3NBNA 4M6AA 1YA5A 5HGHA 4R26L 4Y4KD 5TE6H 2XWTB 2DQTH 5HYSA 5AG9A 4W6YB 4HXAL 2ITCB 2F58L 1JNLL 4KU1A 3RWCB 4X7FC 3VXNB 4DGIL 1NFIB 1NUNB 4TPRL 1BPVA 3QIUC 4EVNB 1XGPB 2ERJB 1I8LC 5F3BA 4YQXL 4G7YH 4OKVB 5FM5M 3RA7L 2BOCB 1B4JH 1ZOXA 3O8XC 4MXWH 4RQQB 2GY5A 4G6JL 4KRPB 3L3JA 1IM3B 1LEIB 5EUKA 1UCTA 4YPGB 4L8CB 3BRDA 2HJFA 4RMSA 1JZ5A 1OSZB 3NCJL 4JRXA 1E4WL 2B1HH 2O26U 2QADD 2HJKA 1RMFL 1NMAL 1EEZB 2K7QA 3QDJE 1ZLUK 3QWRD 1L0QA 3V6BR 2YA0A 3VE0B 1E4XI 3HC3H 4GO6B 4KK9D 3T2NL 4KKAD 3QEUA 5IBLC 2V7NB 3EW3B 5TPWL 1ND0A