3QRGH

Crystal structure of antirsvf fab b21m
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
220
structure length
220
Chain Sequence
EITLKESGPTLVKPTQTLTLTCTFSGFSLSTSGMGVSWIRQPPGKALEWLAHIYWDDDKRYNPSLKSRLTITKDTSKNQVVLTMTNMDPVDTATYYCARLYGFTYGFAYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKAEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure anti-RSV Fab B21m
rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Fab light chain
total genus 46
structure length 220
sequence length 220
ec nomenclature
pdb deposition date 2011-02-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qrgH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qrgH01
2BX5A 4JY5H 4NQVB 3OKYA 4XP4H 1JGLH 5BZDB 3KYOA 3LRSA 3VWJA 5FYKD 1UKTA 3QB7C 4HPYH 5CEZE 1BFOA 1OTTD 4F7TA 1UM6H 3GHBH 5B3JE 2EE9A 1WAAF 3DBXA 4ZUWA 1ES0A 4U05A 3H3KA 1KYOK 5DMGD 5IBTH 1JHLH 1IAIM 2XXCB 1GSMA 2DRUA 1ZGLP 1FDLL 4NO2A 1FRGL 3NCFB 3F8UB 4ODTH 3W39B 4DZ8A 3PG2A 4LGSB 3VCLA 5EFIB 4N5ED 4PJ5B 1A14L 1AH1A 3CVHB 3QEGL 4HUXB 1D6EA 3MV7D 5J1AB 3T8XB 1AGCA 2UWEA 4YQXL 1LD9A 2GSGA 4DW2L 5FCUL 1K4DA 5I66A 3MRIB 1W2KT 5K9QI 1FNEB 3PL6B 2AV1B 4JRYA 3NIDE 5FUOL 5E2UH 5L7XH 3W82A 3B2UC 4LPUA 3ZDXE 5T1MA 1NJ9B 1EPFA 1YNLL 3SEPA 3O9WB 2YMXH 4ONOA 4YH6A 4OCSH 3LKSA 3K1DA 4NQSA 1F3DH 1A1NB 4XAKD 3JV4A 1EEUA 1UKQA 1VCAA 4K2UH 4LF3B 1QQDA 4HPYL 8FABB 3IDXH 1OAUL 3RWDB 3RDTC 2Y06H 5KSVA 1FZJA 3ZTJH 1U8HB 4CN1A 4LHUG 4OT1H 4EUPH 2PXYB 3BHBB 3PV6B 1H5BA 1FAIL 5J56B 2OTWA 4N8VA 3W0WD 4K3DH 3MOAL 3F6IA 3BKYL 3EOYG 2F53D 1C5BH 4MXQC 2Y7QA 1OPGL 2ATPA 5SWZB 1FYTD 3HG1A 5DUPL 1T1WA 2XTJE 1UB6B 3ZDYF 2DQFA 5EU6E 3TT1L 1I9EA 1QUNA 4X9HA 4G3YL 3IFNH 4I4WB 3QAZB 3RWGA 4KY1L 5L0QB 5F1KC 4P2QE 1RJYB 1U0QA 4RAVA 3LPFA 4O02L 2DWDB 1CXFA 5JOPE 4OLYH 4QHKI 1QFUH 3DXAD 1N6QH 4O5LH 3WNMA 4LEXH 5IMMA 3IDGB 2YUZA 2E6PA 1PY4A 5AWNH 1I7ZA 1I7RA 3MOBL 1MJUL 3BWUC 4DFHA 5DD5L 1W0VA 3RUGB 5DA4A 3CDYA 1I1FB 5I1CL 2APVA 4W68A 1WZMA 2DYPD 3C6LB 4LSDA 5AG8A 3IKCB 1PY9A 4PGDB 1NMCB 2YWZA 2CD0A 3O6MH 4HQQL 4K23H 4NQED 5DO2C 1MFAH 1N64H 4HAGA 4Z7QE 1OQOA 1A7NL 2BNRA 3QIBD 2RFXB 5DJ8A 1JNJA 4G43A 5HI3C 5CUSL 4WEBL 4DK6A 3K8LA 3VXQB 2HVKA 2ZOKB 3X14B 4Q9RH 3CSYB 4P4RB 2JJSC 1JN6A 3J7HA 1RY7B 4HEPG 3IFLL 2XFXB 4BYHA 4JPWL 2AK1L 4EN3C 2NZ9C 3HG1E 1F8TL 1FNLA 5K9OA 3F5WA 2RGSA 4NQDB 5E5UB 2V7HB 3RU8L 5J1TC 1UWXK 4DVBB 4XXDB 2VQ1B 4AEEA 5L9DH 2AEPL 2XFXA 3MO1B 5IROA 2R8SH 3LD8C 5C07B 1KJMA 1D5ZB 4HK3J 4UOW0 5FDYA 5IVZB 2AV7A 4PJFF 1S7TB 5IHUL 4MSWB 2CLZB 3QEQE 1V05A 4P3DB 4GUPA 3DX8A 1MJJA 1NMAH 5HBBA 2CUIA 1NCTA 4ZAKD 3GSXA 2WQRA 5T3ZD 2YZ8A 3BP5A 4ODSL 5KN5B 3TBSA 5I6XC 2X2YA 3PHQB 5TH2B 4MJ2A 4ZFOB 5D2NE 4EVNB 4O5LL 3M45A 4HUUA 1T5WA 4NGHH 2ATKA 5D7JD 5DHVH 3MRRB 5B3JF 5DJ2B 2ZUUA 2IPTH 4YPGA 1WZ1L 3MV8B 4BSWA 3LN4A 1LO0H 5L0QC 2W9EL 2MHAA 4FQ2L 4HX1B 5JHLL 3DRQB 2EDKA 3ARFD 3TA3B 4QRRB 4CN4A 1EJ6A 4HBCL 2BSED 3MRJB 4PFEA 4YR6B 5JIHA 3RHWF 1CICD 4KI5E 3SGJC 1BZ7A 1NEZA 1UB6A 4NN7B 2LABA 2A73B 1XF5B 4LCYB 5T1LA 5C8JB 5GS0H 3VXPB 4HIHB 2Q8BH 2VR5A 2A83A 1BOYA 4YDJB 4NQEA 4KGJA 4GMSL 4EDWL 5HYFA 5E70A 1HSAA 4XHQA 4N8VB 2VNCA 5I2IB 2A1WL 2F8XC 2M1KA 3D0VA 4R26H 1D6VH 1K8DB 4U1KB 4UIKH 4QHNB 2FYYA 2AEQH 4FFWC 4WFFE 2PCPB 3C09B 5DGRA 1BJ1J 1MNUL 4Z0XB 5IVXB 1M7DA 1P53A 5J57B 2APTA 2WIIB 5HSFA 3C2AH 1R5IB 3VXMA 4GS7B 5T3ZE 2B8OT 5CJ5A 3RUGE 3QUXD 3BZFB 1E4XL 4O2EB 5FGCE 4O2FA 1A4KA 5I30L 2NR6D 3MRCA 5BV7L 3VE0B 4D9QD 3OBAA 3CNKA 4G7YH 2DM3A 5FKPB 3VXRE 3MRLA 1X4XA 5ANMA 1W8NA 3BXNB 4JB9H 4R9HA 3QDGA 4FQHA 4Y16C 4GKNA 1ZKAA 4XVJH 3ZMRA 2YA2A 5BO1L 1XR8B 4LP4A 4E0RB 3ALWA 1FE8H 3EYFA 4LEOB 1NGQL 4AM0A 2P45B 1A6UL 2ZSWB 4HC1L 4U3HA 1BD2E 3L3IB 5HYIA 1CF8L 5HPMB 2KQMA 1I3GH 4TULL 4ZXBB 5T5FH 3QFJD 4LCCA 3MGAA 4FFZH 1YUHA 3MNZA 3S3PA 3CXHJ 1OGAB 2IAMA 5FFLA 4U2ZA 5MEND 4NQEE 3U4AA 1N8ZA 4WO4C 1ZK9A 3OGCA 1QLFB 2DQEH 3SKNA 2FECL 3V7AG 1SMOA 3KJ6H 2H2PC 4NWUL 2F15A 4WTZA 3MLSH 5CJOH 3MJ9A 2LTQC 3MLTA 5E1AA 5DFVC 1ZS8A 5FA4B 4LSSL 2GJZA 3TYFA 4CW1A 5LWYL 2YOCA 1XGUB 3GNML 1ZHKA 5DDHB 1K8IB 4U1GB 3UDWC 2SEBB 4DFIA 3TJHD 4WI2A 5KZCD 2OQJA 1IC5H 1A7RL 1U3HB 4M43H 4XVUC 2JIXB 4YK4C 2RBLA 4PLJD 4ALAL 1WCQA 1RZKC 1JJUA 4B0MM 3P2TA 1I3RA 3MFFA 3IS0X 3CFIC 2PYED 4E41B 4X7TA 2O5YH 3QA3A 5CD3A 3HFML 1S9YB 3QIWD 4RAUB 5ICYB 3S88L 5JW4Q 2VIRA 1W72L 3QDHA 2DQUL 3RKDC 4WY7L 43C9B 4YE4H 4YHLL 5D6DA 5CD3B 3FJTA 2J8UA 1A6UH 4L3EA 1U8PB 4UAOC 4JFDB 3ARPA 2JB6B 5EZJA 3L9RA 1Q9OB 4LDEB 2HN7B 4I3GA 2NXYD 2BXYA 1FGNL 3QCTH 3SJVD 4YHZL 4M5ZH 3Q5TA 4UT6H 2Q8AL 3QQ9C 1DQLL 5DT1H 1YJDH 4LASH 2HKHH 4NBZB 1KULA 3PGCA 3BMWA 4YNYA 3QPXL 5EORH 3B6SB 4KRLB 1CR9L 1CXIA 1REIA 3MBED 3S6CA 5DQDH 4JQIH 4MA3A 3RQ3A 3MCG1 1S5IH 3LN5A 1J8HA 2P7TB 3C60C 3GMNA 4WWKD 1MCPL 5CINL 4JO2H 5C0RL 4PJAB 2QSTA 2ZOLB 3TYGL 3ROLA 3VXSE 1CI5A 4F58L 5IB4A 4XMLL 2DQGL 4FG6D 4ZXBA 3NA9L 4G5ZL 4UINH 1C16B 3H7LA 1N5YL 1J8KA 3LD8B 4FG6C 5EU4A 4JO1L 2CH8A 3GMPA 1CGTA 1QD0A 3BI9X 2D9QB 3BEWA 4WFGE 4LAJH 1IC4H 4PRHA 2GITA 1RAMA 4LLDB 3D85B 4F37K 4AH2B 4PGDA 3TO4A 4NFBA 3PNWB 5EO9B 1S9VB 3C6LA 35C8H 1RIVL 1TXKA 5JW5B 3RUGF 3TBTA 4NZJA 4R4FH 1ZE3C 5F6IC 1JIBA 1WFTA 1F90L 1OGAE 1KTDB 1OSPL 2CMRL 2NNAB 3VFVA 1FP5A 2R4RH 3S34H 3P4MA 3QNYA 4WGVB 3O4LB 1DBBL 4EIGB 4P0DA 2YPLB 5F88A 1V7ML 1B0RA 1AR1C 1UZ6F 2DM7A 4L8SC 3VFWA 3K1KC 4J4PA 2FBOJ 2BHZA 4JFDE 1D9KC 4DGIL 1NCDL 4PLNC 2GI7A 4ODSH 1AC0A 2J12B 1JBJA 5DHYB 2XV6B 3RA7H 4XGZB 5JUEH 3MLRL 3OV6A 5I8OL 1MY7A 4NUJB 4WFGD 4IRZH 5MI0B 3MO1A 2V17H 3WMSA 3SGEH 3MUGA 1QLRA 5DLML 2LV4A 4JFEE 2WAHA 3R06B 4EBQL 4OCYH 1LVEA 2EYTA 3BPNB 4F58H 3D3VA 4QYOB 5CP3A 5CEZD 3T0AA 1NEZB 3PL6C 4RX4A 3DVFA 4GRLB 4GRWF 1GAFL 2GJ6A 4X4ME 2D7OA 4LQFL 3UBXB 3IFOA 2GCYB 4UV7L 4HJ0C 4Z77B 2DQTL 1JF1A 2W9DL 3SGDH 1QBML 2BSRA 3JTSB 1WTLA 3T08A 4H8WL 2R4RL 3S34L 2E7LC 2MQ0A 1U6AH 3M8OH 5HY9A 5SWZE 3PWLA 5IMOA 2VE6B 1QSFD 4QXTA 1GIGH 1HXMA 2AXFA 3TBSB 1CTOA 1E4KA 2QV2A 4PJDE 4U6XB 1MHPL 3GSOA 4LLWA 1WC7B 2DIBA 3GSNL 4XC1H 4KRMB 2GHWB 4KK9D 2NW2A 4ZDHB 5E94B 3EO9L 1RZ7H 3V0VA 5GGQH 3TLRA 2EIBA 3KNBA 1U8JB 4YXLH 2VABB 1EZVY 4OGXL 4KJQD 3CFKB 2PR4L 5BZWB 1TZHA 5AZEH 2DBLL 4YHOL 5BJTB 4HPOL 1BVKA 1BOGA 3DWTA 4M43L 5IIEA 1EHLL 3B3IB 5EU5A 4P4RA 1JWMA 4ZOAA 1NDGA 5E8DL 1H3PL 2MCG1 1ZGLB 4JN2B 4IJ3B 3CK0L 3CDCA 4BFIB 4ODWA 1Y18B 4DCQB 1FL3B 4ODBD 1DP0A 4ZO9A 1AO7B 5F1SA 2HVKB 5FGCB 4FZEH 3DYOA 3DVNA 5L7XL 1TCRA 2VN4A 1Z3GL 1PG7W 1XIWD 5FM5O 3K8MA 3RVUC 1J1XH 4Z7WB 4FP8H 4B50A 3TBVA 1SVZA 4NN5B 4PJ5E 4E42B 3QEHB 4ETYA 5L8JB 4R7DA 1IGFH 5JPMB 1RHHB 3N1GC 4FNLL 5GGVH 1FJ1B 5EU6D 1MCFA 4OZHF 4YHZH 4R7DB 5EIIB 1YY9C 1XF3B 1WF5A 2BHYA 3CH1B 4NHUA 3L3OB 5GPRA 1GC1L 1YPZF 5KSBF 1OW0C 4UQ2A 4EN3B 3AS0A 3VXMD 1R3IH 5H94A 4U7KA 5KSBA 5DRZB 2EDEA 4Y8AA 5HHOD 1CR9H 2WW8A 5J9PA 1YNLH 5ACZA 4U33A 4IS6B 4HIXH 2X4SA 2UUDK 1VFBB 2WBJC 2ICWI 1IM9D 4HFUL 4HBQA 2R2HB 1WTGT 3VU2A 5HYEA 4QRPA 2DQIH 4OFYA 4CN6A 1QLRB 3OL2A 5C0BA 4AEHL 1CD9B 1QYGH 3CU7A 2HRLA 4JCMA 1I8IB 3GSWA 4YEFA 1K2DB 5DRXB 4EOWH 5C0JB 4XNXH 4B5EA 5A16B 4APQA 2L7UA 5D71L 5KSVB 1RZKL 1UACL 4XCCH 5LJYH 3DMMB 3HZVA 5D7IF 1K2DA 4YFLI 5E7BA 3RI5K 1VA9A 4DOHB 2RIKA 1LILA 1UEMA 2YD1A 5GGVL 4P5TA 2PW2B 1CGXA 1PAMA 4UAOB 1MI5B 2YD9A 3BP7A 1T3FB 25C8H 4CDGC 1RFDH 3ARDC 1PKQE 2FSEB 3O6FC 1W8OA 5MEOB 3L3DB 1M1SA 5I8EA 1LO5B 5T1DH 3DI3B 1L4IA 3N1FC 3OXRB 1XGRA 1KJ2L 2DQHL 5D5ME 2R0ZL 4C56E 4PJCA 4PJ9C 2BNQD 3LQZA 2YUWA 3SE4A 4APQB 5A16A 4TNWF 4DUWA 1QPPA 3EHBC 1KJ2B 1NPUA 2PO6C 3CLFH 4JN2A 2ID5A 1QEWA 1JGEA 2FNBA 4X6CA 2HVJA 2X1QA 3KHQA 4ZSOA 3OWEA 2VXQH 4WTWA 3HZMB 2OCFD 5KS9B 2C1PA 4OCYL 5F7FA 3WJJC 4HWEL 5BVPH 5KW9L 1RUQH 2VLKE 1M05A 2DMCA 1IMHC 3VJ6B 1AR2A 5I71C 4LAQL 4XI5C 2DWEA 3ARRA 3L6FB 4FQQB 1NCBH 3FQXB 4PJEE 3VWKD 1DBAL 3SDXF 1Z0MA 2E5EA 3VFUA 1TTUA 2COQA 3FO2B 3UCRA 5M7QA 5IQ9A 3MLSL 3QJHB 1I9JH 1QOKA 1T0NB 2BVPB 1XZ0A 2BXZA 4K3HA 1P2CA 1JVKA 4KK5C 2CKBL 4I2XB 4NRXB 1T04B 2IADA 3QXWA 1CFNA 5FB8B 4OM1L 3QEUA 5MEPB 5D7KE 3ULVF 4M93C 3BUYB 5TE4L 2D4FA 3OHXB 2N56A 1BFVL 3HZYB 3MCLH 4WNQA 4AK1A 3B9DA 1V3JA 2BOCA 4QXGL 1RUKL 1KN2H 2VMFA 3QXDA 5FO8B 3TO4B 2D31B 3FO1A 3VXUB 1HYSC 2B0SH 1JUFA 2XTJC 3UYOD 2CUMA 2OL3A 2P8PB 4X6EB 3GJFH 4UU9A 3P77A 1U2HA 5E2VL 1ZLUK 2X4NA 3WLBB 1UZ6E 3REWA 2Z0BA 2OLDA 3CGTA 5GJTH 1OSZB 5AZEL 2JJWA 1JNLH 5DK2A 4RZCA 4Y5VC 4F3FA 2OTUA 5FOBA 4M9OA 2BSSA 2B1HL 1PGRB 4Z6AT 5D2NB 1Y6KR 5IK3B 2X6MA 1E4WL 3I85A 5EUOA 3PJSA 3S7GA 1TQCC 4I77L 3RX5A 2FJGB 1F4YL 2GTZB 4GW5B 4D0BA 1CGWA 2F74A 4WNQB 2GT9B 5SV3A 3U7WL 1DQJA 2E9JA 3BGFB 4NCDA 1ZTXL 3AY4C 4X5WB 5EU3A 1FVDB 3BKML 1MLCA 3TNNB 3QI9C 5EUOF 2EYTB 2BVTA 1JHKL 4F15C 4BQ8A 1A1OA 1PYWA 3OXSB 1XGYL 5IBLC 5I9QC 5FO7A 4CNIA 2VLKA 4R26L 2B5IB 4S0SD 4Y19E 1ZOXA 1FLRH 1G7QB 2ZPKL 3INUL 2VWEE 3MLZL 1U58B 4K3DL 2V5MA 4OD3L 4DTGL 4JFQB 3QQ3B 4ZUSA 4Y5YC 1RURH 2UWEF 3IFLH 1T2QH 3QRGL 3AMKA 1UWXH 1V3KA 4U31A 1CXEA 3ARFC 2X7LA 2GJ6D 1ND0A 1FSKC 4HT1H 4P49A 5D5MA 3KLHD 5FDWA 1QBBA 4HZLB 5I1GH 4X6CE 3MRNA 3DYPA 4WW2B 2ADJA 1NMBH 4ZQKB 4ZFFA 5FM5M 4MAYB 3KR3L 3DVGB 4P5TB 2DYPB 3C6LD 1U3HA 1M7IB 4KV5F 1FH5L 3NACH 3RVXD 1A4KB 3EDFA 5KVEL 4J3TA 4NSKB 3JXAA 2GSIB 4PJAA 2DOCA 1DVFA 2WBWB 4A6YL 4EXKA 3H9SA 2OTPA 3F7YB 2HMID 4FFWD 2OI9C 2W60B 3JWDC 3OQ3B 5DHXB 2DWEB 1IRAY 1MJ8L 1WIPA 3D39D 3E3QE 3WFDH 1INEH 5I76A 4XWGH 4YLQT 3TT3H 1DUYB 1AP2A 1DBJL 4FXKB 4NWUH 1DN2A 3VFWB 1QBAA 4Y2DD 2KZWA 4W6YB 1FRGH 4FQCL 4ZSOB 2P46B 3QJHA 2NR6C 3VH8B 1AQKL 4P4KA 5DTFA 4Y1AA 1Q0YH 1EUUA 5T3XE 4MJ5A 2ED7A 5ACZB 1AJ7H 3B9KA 4TNVK 2AXGA 3B9KC 5I8CA 3ESUF 2Z93A 4NZTH 2IBZX 4LL9A 3VFOB 1CXLA 4XBPB 4ZUVA 4X9BA 1OCWL 4PS4L 5LGJB 2VQTA 2AVGA 4ZAKB 3EYOA 4OF6A 2BSSB 2VDOH 5CUSH 3WLWD 4F8TA 1U2CA 5I16A 2O5YL 1BECA 3CZFB 2UYLB 2I25N 5ANMB 2YMXL 3FN9A 2H9GA 5TF1H 1SEBA 2H41A 3WLBA 1J18A 2L0DA 3BT2H 1XF4A 1SJHB 4P9MH 4WUUD 4FMKA 3V4UH 4URTB 1AY1L 3MRQA 2GJZB 3X13B 4CW1B 4M6ML 4GO6B 3G5VB 4BKLB 1IBGL 3MLTB 3NFNB 4LVEA 4M1DL 5F1NB 2XA3A 3MFFB 5T5NF 3VFNB 1MCHA 1EJOH 5IEKA 3QCUL 3QIUD 2HT2D 3K4AA 4F9PC 1QSFE 1YN6B 5IEHA 2E9IA 5I1EH 2HT2C 4DEPB 3TFKD 5C0BB 3MA7A 5HTSA 5D7LD 5DZNA 2OR8A 1IGFL 3BPOC 1NC2A 3KNBB 1YEGL 3H9HA 3UBXI 4HXBH 3CVIH 1KJ2H 2BOBA 5GS0L 4JG0L 1KNOA 3UZVB 1GC1H 1YDPB 1EK3A 1J1PL 4PS4H 3BZEA 1WEJH 4FHBD 1DBML 4M7LH 4R90L 4KKAD 5KS9A 2NY4D 3I3BA 3QH3B 4KKAC 1S9WA 1U91A 1RJLA 3G6DH 4V1DD 1I9IH 3G6JB 1FG9C 1U8JA 1JGUL 5ABDE 4KAQL 4NOFA 1AY1H 4LCWA 2I07A 4Z7WA 3HNVH 4JN1H 4NP4L 6FABH 3FT3A 4PJ8A 3L5WB 5C86A 3FO9A 1ITBB 1NBZB 5K9JH 1DQMH 3O6KL 4UB0H 3WFHA 2YPKA 5JIIA 1BQLH 3QFJB 1AC6A 1RHHA 2AI0L 2FYYB 2R9HD 2FX8H 2DTML 5T3XL 3EYVB 3L3HB 4K3EL 1E4XH 4JY4B 2FDBP 3D3VE 4ZFZA 4ESKA 5LKNA 4X4YB 3FQRB 4XHJC 4X7DC 1FVEA 4PLOB 1XF1A 3CUPA 2ZP0T 5D1ZC 1CFSA 1G7PB 3FN0L 3EFFA 1JN6B 2OS7A 4L8CA 2JCCB 5F3BA 5JOPD 1CFVH 3IAGC 5DK3A 2E9BA 5C9KA 3GM8A 1RK1A 2FLRT 3BDBA 2C7UB 5IVXA 2CR6A 2YPLA 3SDAB 3RTQB 3KPSE 3D9AH 3VI3E 4ELKB 5MP6H 2IPTL 1I1YA 5E2JA 4D3CH 3MCKB 3GSQA 2JJUA 5BZWA 1XR8A 5D96B 3ZE0F 3KPLB 2VZ3A 5DXWA 4A6YA 3HTLX 4UUJB 3OX8A 5A2FA 3MRPB 1OAXH 1L7IL 3G5YB 1A7PL 1G7LA 3VXSD 1YEIL 4IDJH 5I1HL 5I73C 4HHAB 2FZ3A 3EDJA 3U7WH 4RDQF 4GQPH 1KPUA 1Q72L 1OP5H 4GLRI 2R2CA 5KSBB 4PB9H 4NM8L 3VMOA 3EDKA 4XC3H 4YBLC 5BS0A 2KBGA 2P5WE 5F96L 1G7LB 3DIFA 1DE4A 2AV7B 3GI9L 5FK9B 2R1WA 1OM3H 1JYNA 5GGTH 5ALBL 3SKMB 4HHAA 1N5AB 5DR5L 1CQKA 4HUUB 4Y4KA 3P4OB 2Z31B 2Z91B 4UDTB 4DVBA 5DO2D 3SQBA 3STBA 3O41A 3KPLA 4H26A 1YNKH 5TDPA 4YHPB 4RGMC 4YGVB 5JW3L 3QIBC 1MFCL 3UP1A 3MPCA 3J8F7 5CGTA 1T7ZA 1Z9OA 5IV2B 3MRHB 4HH8A 3H2WA 3D9AL 1SY6A 1KNOB 2HLAB 2Z35A 5IFHH 4X0KA 2XRAH 3RL1B 4C56B 3MLPA 3PWVB 5FA3A 4D94A 2GQHA 1Z9SA 4OLWH 1ZLVH 1AXSB 2G5BA 4YGVA 4PUBL 4ZS6C 1GCFA 5FYJH 3UTZA 1ZVYA 3KPRB 2FB4H 3T0EA 2NTFB 2W0FA 2O93L 3CVHL 3SGKA 3QCVL 5C0RH 3G6JA 3TBWA 3OB8A 3MROB 3WHE0 3V0WH 1AGDA 3P0YL 5CSGA 5AYUL 1WC7A 5JW4R 3L3JB 3SDAC 3TPUB 5HXMA 4JCLA 4PJCF 1J1OH 5DJ0A 4RAVB 5DK0B 2VB5A 3C9NB 1XF2A 4ZPTB 1OAQL 4FFYL 1PKQA 3NA4A 4HUKB 4WU7A 5H2BB 1LMKA 5T33H 2AEIT 4L3EE 3RGVD 2XZAL 5SX4H 4H20L 4HS8H 4XPHL 5CINH 1T1WB 3EDEA 4FOMA 4YBHA 3RGVC 3WUZA 3LPWA 3Q6GH 1NFIB 2YZ1A 3KPRA 3CVIL 2X4UB 1BIIB 1JV5B 1FO0B 4DJMA 2EH8H 1T03H 1I1YB 5FYLE 1ONQA 2EYSA 3S88H 3KYOB 4UBDC 4ONGH 1XCTA 4WO4B 3KYMA 2QQLH 4WWKA 4Z7VE 3LH2H 4KUZL 2AJZB 4W6XB 2HYMA 1N59B 3QSKB 4CU8A 1A6PA 4W4OA 5J11B 4DN3L 1MAML 2BC4B 2Y36H 2Z4QB 2PW1A 3EAKA 3IXTA 1FFRA 4ALAH 2EDFA 4Y1AB 3H7BB 3Q2CA 5SV4A 1MLBB 1MOEA 3DPBA 4UDUA 3NCEB 3RGVA 5HHMB 1BLNB 4MA7L 4MCZA 3QDMB 3P4OA 4Z7VB 1UM6L 1LK2B 2FGWL 5E9DD 4OIIL 1AGCB 5JDSA 5LGJA 1BD2A 3RY5A 2OR9L 4BKLA 1BP3B 2HLFD 2NY3B 1R5VB 2FH8A 3O6KH 1U8OA 1G6RB 1KPVB 2IQAB 4GRWE 2X4OB 3S8WA 2HLFC 1UVQA 4XMLH 2NY5C 5HYJD 4YDKL 4LMQI 5SWQA 1NGZA 1YEGH 3FOMA 5L8LB 4HXBL 1XF4B 4LLAA 5L88H 4L3EB 1HOCA 5IMLA 4G6JH 5D1QB 4LSSH 2SEBA 4MLIA 5E00B 4AEIL 5EO1A 4MWFA 2VL5A 2D4DA 4GG6E 2BSTB 3VXRA 2PETA 4NM4H 5ICYA 4H20H 4LP5A 1MCBA 5DQDL 4G9DB 4YIQB 2O26U 4OFYD 2M26A 4JR9L 1HHJB 1OT2A 1IQDA 4WV1A 3VG0L 2J1KA 3GBML 5ERWB 1CCZA 1GRWA 5E5MB 3E6HA 4Z7VA 4Z95L 2WWKO 3BZEB 2Y36L 3UAJD 3C60D 4D0DB 4ZPVA 1NFDB 4UI2A 3LDBC 2FBJH 3BGAA 3UAJC 3U0PB 3KPRE 3VRLE 1MJ8H 5CBEA 2DBJA 3O9WA 4G42B 4OFVA 5FUOH 1AHWA 4ENEC 5T1LB 5C8JA 4O58L 2JF1A 1KB5B 5HPOA 5TF1L 1G6VK 2X05A 1SBSL 1GGBH 2AV1A 1G9MH 4JRYB 4MA3B 1XGQB 1CFTA 3VMPA 5C0IB 2PCPA 3O2WH 2YPKB 1UQSB 2GT9A 2ZSVA 4XWGL 1ND0B 1PSKL 5ADPL 1TPXC 3I50L 2YD6A 1G6RH 4FZEL 4BSWB 4QRUB 1HHIB 3BPOB 2VYRE 4ZOBA 4B41A 4HIHA 2GSIA 4ZNEA 4Y19D 3FT3B 1NAKH 3GHEH 2KQNA 3TH2T 3MJ7B 2DLTA 3ME0A 1P84K 4OZ4A 3PWPD 5L6YH 2DI8A 4XX1G 3GHBL 1EVTC 4FQLH 4MXVE 4E5XB 4NRYB 3M1BA 1UXWB 1XF2B 2XKSA 1TIUA 1KENH 1U92A 2P5ED 7FABH 1V5JA 5I1AA 1RUPH 4PTUA 3VXMB 3HE6B 1BBJA 2IH3A 3L3JA 5ESQA 3IJYB 4PJBA 1XGYH 2FHCA 1SYSA 2DLHA 3RNQB 3M17B 3QEQA 2JJTC 1AE6L 2XRAL 5B3NA 3EGSA 4WUKL 4LCIH 2H32B 1MRFH 4HF5L 2VLRB 3QDMA 4IRZL 1ZLVK 3SKUD 4JPIB 3KPMB 5ID0A 1RK0B 4OD3H 1WAAE 3U82B 5I1HH 2IADB 4JY6A 2GY7B 1S7UA 3H7BA 4XPTH 3KPNA 3HZKB 3ULUH 1E4WH 5I1GL 1IE5A 1GVIA 3PL6D 1GPOH 4KDTA 4Z7UB 3AM8A 4I3SH 4JANA 4UV7H 5EU7E 1NUFA 4NC2B 2JK5A 1HKFA 4WI3A 5IBUB 2JCCE 4CVWA 4OLEA 4DGVH 2OL3B 2P8PA 4DZBB 3T65A 3VXUA 1XH3B 3UJJH 1Q0XH 3V6BR 2ZJSH 5J12B 4HJJL 1HYSD 4PV9B 3SE9L 3OAYK 5E4IA 3MRRA 5IVOA 2ATKB 5EZLB 1CVSC 3LQMA 4WW1A 3B2VH 3VFRB 4HGWB 4N0YH 3P4LA 3IRPX 3WS6C 5CZKA 3L3IA 2R1WB 1A0QL 2EZ0C 2PXYD 3RWEB 4QKXB 4QRRA 5IFHL 2F5AL 1FO0H 1CFBA 2XN9B 3NPSB 3TF7C 5F72S 2QADC 2FO4A 4U3CA 1GZQA 3AS2A 4PY8J 3NCBB 3OKNA 4NGHL 4PRPD 3JWOL 1AFVH 4GFTB 1NCWH 3VD5A 4AG4H 5C0EB 4XRCA 3BN9C 4OF7A 2J88H 5CMAB 5D9SA 1MCPH 3RZCD 5F7DB 2DQCL 1HWGB 4L8BB 2PW2A 2HJKB 4L4TB 3C8KB 5AWNL 5CBEB 3MOBH 4KJWC 5C08A 4D9QE 5A2JH 3UPRA 4JKWA 4WI6A 1T6WA 4E9LA 5TFSL 3RWDA 1I7TB 1FFNA 2Z35B 2FX7L 3EYSH 1NFDA 3AUVA 5EC1A 2VITB 5MHSD 3ULUL 2ADGA 5I17B 3F12A 4HS3A 1HQRB 1W72A 1SJVA 3JSSA 2IPKA 3QIBB 3KPPB 4M93B 2ORBH 3OJDB 3N50A 2B2XL 1GGCL 3QFDA 4KKNA 1I7ZB 2YXFA 1U36A 4MNGA 2JELL 3WKML 1S5IL 3UBXG 4LF3A 3WN5B 4TNVF 1HNFA 4JFYA 3PGFL 4RMUA 4Q6IB 5AD0A 3BIKB 5TE6H 1A21A 5E4EC 5T3ZH 3W11C 5I8EB 1IAMA 1JPFA 1S5HB 1IAII 4ZO6A 1BIHA 4B7IA 2PTVA 3PXHA 5HGDB 5D1XA 3EFDL 5AUMB 3P9LB 1IILE 1F42A 3C5ZD 5J8OA 3B43A 4I5BB 3RWHB 3LHPL 5HHNA 4QRSA 4LRNL 5IT2L 4JVPA 4RMRA 4S2SB 1MCWM 3MRPA 3O4LE 1S7RB 5AAWA 3OHXA 4P59L 1ZA6A 5J3HC 5TPWL 4YZFF 4GAJL 4JQXC 3BESR 5J3HD 1KCUL 4MDJB 3GSNB 2VDLH 1I8MB 3IXTB 3QQNA 3MLYH 4D8PB 4G9FA 1QZ1A 4TSAH 3PP3K 2AP2A 2G60H 1QHOA 3AM8C 1BWWA 5IVXF 5GGSA 4OD1L 1WZKA 5IQ7L 1U8MB 1A7QH 4TULH 3UC0H 1CD0A 3O3EB 1IEAA 4Q9QL 3MR9B 4QRRD 1G9MC 3HAEA 5HHNB 2X4SB 1ZHBA 3IDMA 2R29L 4KWUA 5C0DB 1KIQB 4HCRA 3RBSA 3UTSD 1UH2A 4LFHD 1NBVH 3O8XD 1D6EB 3RWCA 4RWHA 2UY7A 3GMOA 4P5MB 1J1PH 5J9PB 1YEFH 4PJHA 4AIZA 4NKMB 1OGTB 3V9FA 3EHBD 1VEMA 3RVVC 5LQBH 1S7XB 1KEMH 3HRZA 4YQXH 1X4YA 2AK4A 4XBGA 3RVVD 4EDXA 5EBGA 4Z7NE 2QQKH 1FV1A 3PHOA 1BAFH 5F7HA 3L3KB 3LHPH 1K85A 3C2SA 2H1PL 4LRNH 1DR9A 3WIHL 1JNNL 3T8XA 5DI8B 1NGWA 2A6IB 3F12B 4P3CL 5D2LE 5E8DH 5DHVA 1H3PH 5JNYB 3QHFH 8CGTA 1DN0B 2HTKD 1BD2D 1DQDL 3TH4T 3MLXH 2YKLH 3CIQA 5LCVL 2FR4B 4KTEL 5GGVY 2NW2B 1ZHLB 1OARL 5HYJA 2CDEB 2VC2H 3TIDB 1FO0A 1OL0A 4KPHL 5DI8A 4KRPD 4XH2B 1T7XA 4GT7A 5DD0L 1JGDB 1PZ5B 1UADC 4MD4B 3U0TA 3NFSL 4OCXL 1SQ2N 1VENA 1OP5K 3VXRD 5HY9B 1JPTH 2C1PB 4JFFA 5DFWH 3BQUB 5KANG 3AU1B 2XKUA 1BJMA 4EEEA 3QUZB 1FZJB 4NC1C 4EQ2A 4KKCC 4WFEE 1FH5H 2HFFA 1LEKA 5ID1A 5IROC 1G7HB 2EDWA 1MNUH 3QQ4B 4ZDHA 4GRWB 4HG4K 3JV0A 2G2RB 2GK0B 5HGDA 5F44A 1FCGA 5HYSB 1P84J 4OJFH 5E9DA 2AXFB 4R0LC 4OCMC 3BP6A 4MDIA 5DSCB 3AXLB 2V2XA 2JJSA 2E8YA 3RPIA 1YEJH 1MVUB 4JREC 1SJEB 2DJSA 4P23C 5TJWK 5HHME 3L7EB 4WWID 3GSQB 1GH7A 4Y0GA 2X4TA 3PGDA 3QO1B 4P2OB 2NY6B 4OGYH 1S9VA 3GSUA 4L8SB 4MB5A 4GBXC 3LS5L 4M48L 3T2NL 1EMTL 2YXMA 1G7JA 3ULUD 3FOLB 3P4NB 3O45A 2P8LA 1LO2L 4UQ3A 1F8TH 1U8QA 2LTQB 2PO6D 3F7VB 1RUKH 1ZLSH 1AD9A 3LEXB 4QOKA 1EFXD 4HXAH 4BFIA 2YHGA 4XMPH 4PG9A 1OQXA 5EPMB 3CUPB 3LB6C 2CK2A 5JQ6L 1ZT1B 5D7LB 4U1HA 3EO0A 4QEGA 3FFCA 1E4JA 4FQIL 1QBMH 4HC1A 3WNKA 4W4OC 1QTYT 3ARED 3CFCH 4KZDL 2X9YA 5I15L 5IM7B 5E2TL 1MFCH 4QRPB 3IF1A 1RULL 3QUML 4TSCH 5LGHL 3PABA 3QDAA 4NT6B 2J8HA 4D0BB 4JFPB 4PJ9A 3TCXA 1SMAA 4G9DA 5E2WH 2NX5A 1QRNA 5IESL 3ARGB 4OFDA 2BVQA 4MWFB 3DO7B 1T5XB 5T3XD 4CL7A 3X17A 5IVXE 1KGCE 4U0RC 3T1WA 3INUH 5INDB 3MBXL 4QTHA 5L2KA 4V1DB 3RWEA 2YC1A 1UM5L 3OKKB 3T09A 4F57L 4ZTPH 1GIGL 4MAYA 1JZ4A 2VQUA 2W9EH 5JHLH 5CEZL 2I5YL 3S4SB 3QDJE 2QR0A 3D39E 5ISZA 5D5MB 3FFDA 3IT8D 1I1AC 2DJ4A 3H8NA 3IFOB 3NA9H 4UINL 4EI6A 1RIUL 5I9QB 4JO3L 4R2GD 1CTNA 4GXVH 1QRNE 1R3LB 2ADGB 5HGHA 1KENL 3T1FA 3QQ3A 7FABL 3ARBC 5F7EH 2ITDA 4QXUH 1U58A 1IC7H 6FABL 5IJVA 5FYLH 1EMTH 1A02N 3B6SA 4N8VG 2GW5A 5E99L 4HLZG 1S7WA 3MFGB 4L3CA 4LQ1A 4OV5B 3SJVE 2LVEA 1A6ZA 4G6MH 5C9JB 2F8OA 3D85D 1WIOA 3OXSA 1MRFL 3OAZK 4LAQH 1I85C 2PYFB 1JWMB 1TNMA 5CEYA 1CZ8H 3BEVB 1F4WH 4P46A 5E2TH 2HN7A 4IRJB 3MV9E 4OQTH 3DGGA 3B9KD 2Q8AH 1IT9H 4NZRL 3LEYH 4MAYC 3TV3L 5E7FA 1J8HB 2P7TA 3D0LA 1D9KB 2IALB 3I3EA 3OKEA 1BM3H 5CP3H 1MCRA 3M17A 2X4UA 3QEQB 1F00I 4PRIE 3SDAD 4X4XA 3HZKA 1A7PH 3OMZA 3IXAA 4A2LA 1PFCA 5KVDL 5I1AB 4Y4KC 2J6EA 4TRPH 1YMMB 3S35L 2NPLX 1IGIH 1KCRL 2I60L 1HQ4A 1YUHB 2A77H 5MP6L 2ICES 3ZHKA 2QQNL 4UT7L 4QCIA 3LDBB 3EYOB 4J23A 4F9LC 3HC4L 2R0KL 2YPVL 4D9LH 5IB3A 1CBVH 4YX2L 3KPSB 1VEPA 1MF2L 5F7YC 1QSFA 3DUSB 5FO8A 4I0CC 3KLHC 3BMVA 1P4BH 3A0OA 1TQBC 1U95A 5T1KA 3OKEB 5CS7A 1SM3L 2ESVA 2F58L 3QJFA 4P3WA 5B8CB 5ICZA 2XWBA 1L7TH 5FB8A 3O2DA 5L88L 4GRLD 2Z31D 3N1PC 4GBXA 4NQCB 4EI5B 3O11B 4GBXB 1YEFL 2ARJA 1TDQA 2D7TH 2OSLB 3QFJE 4LCWD 4P23A 1NGPL 1MHEA 1ZVSB 4D0DA 5MENE 3P3YA 1KYOJ 1MAJA 4FQXD 3WXVL 2IAMB 4Y2DC 3R1GH 4FQXC 2M8XA 5HD8C 1AGFA 5ISZB 5DRNA 4H88H 1B0WA 3PWNB 1LK3H 1SEBB 1P4IL 1EEZB 4B53A 2AQ3A 4HKBA 3UTTB 2RCSH 4O4YL 4KROB 4M7LL 3ARDB 5GIRB 5F9DC 3PWNA 1BZ7B 3FT2B 4QRQA 1P6AB 4JM2F 5DF0A 4L9LA 1YY8A 5HYQB 1G0YR 1YEKH 4YHKL 1GJIA 1RZKH 1T7VA 3ILQD 3O3AA 4CAGA 4IOIB 1SM3H 1I4FA 2XQBL 3RY6A 2QJDA 2MHAB 5DC0A 1CLCA 5FO9B 4ZUUB 4KVNH 1OOAA 5CJQH 1DDHA 5DJDA 4PJXB 3JUYA 2AKRA 4X5LA 3SDDB 5EN2B 1O7SA 5JIKA 4OZIE 5CGYD 5C92A 3LV3A 4LSUH 3D2UD 1MCIA 5CIPB 1L7TL 1HINL 1R0AH 5F71A 3NH7H 4P59H 1UM4L 3HUJE 5TQ2H 3TNNA 2R29H 2Q20A 4O2EA 5IJKC 3IXAB 5FV1L 1XT5A 4L8DB 1SHMA 1SYVA 4GW4A 4XT1C 4N9GB 4WO4D 1DLFH 1ONQB 3H3PH 3C6SB 3V0WL 2ESVE 1IGJA 3T1FB 2H2PD 1D9KA 4MVBD 3TPKA 1RZ7L 1T21A 3MA9L 3TFKC 1T22A 1OWRM 3QI9B 5FYLD 4M6OL 5DFVD 3BZDA 5I1JL 3EJZC 3RWFA 1RZGB 3LH2L 4KUZH 4U1IA 5HHOB 2YSSA 5GRYA 1MCNA 3I84A 2AJXL 4W6WB 4F9PA 4HLZH 5T5NG 4JDTH 5DSCA 2YRPA 1JNHA 4MGXA 3STZA 1H3XA 1JV5A 1KXVC 1FPTH 4G43B 3SPVA 4JLRB 4UQ2B 1I9RH 3GM0A 2EO1A 5FYJL 3QUYB 3UTSA 5C7XL 5DMKA 5LBSH 3RKDD 3Q6FA 1PG7H 3D5OF 1M71A 4UNVA 4A6YB 5IM7A 3MLWH 5D1QD 3NCYS 1KC5L 3GMLB 3QUMH 4BQ9A 4XXDA 1MAKA 2EH7L 3B8YA 3DTXB 1DVFD 5E8EB 5I19L 2R8SL 4KJPC 4ZS7H 4LVHC 1OB1B 4LHQB 1T5XA 2ZUYA 2ZPKH 5DEFA 2EC8A 2EYSB 1KB5H 4PRDA 5INCA 4DKDC 2F54B 5CJ8A 1RUML 1KIRA 3GSUB 4QNPF 2VQ1A 2OK0H 1MJ7H 4Z0BH 4X99B 1I1AB 1SBBA 1OGAA 3O41B 1BJ1H 3HUJB 2F54A 1WIUA 2D7NA 5I1JH 4FQJL 1OTSC 5DHYA 2HP4A 3LEXA 2DKUA 1YECL 2FRGP 3QRGH 3JV6A 4JHAH 1IKNC 4O9HH 1KEGH 2NZIA 1LWRA 5B38G 5INDA 2A9NL 1QHPA 3GJFK 5HGHB 4YJZL 2GTWB 2O5XH 2EIZB 1NGYB 2P24B 5JOFB 4N90E 4N0UE 1HCFX 3LS5H 4M48H 3T2NH 3VWKB 5F9WC 1HSBB 3BKCH 4Y88A 5I71B 1UJ3B 4RFOH 4POZC 3AU1A 2VXUH 3VWKA 4POZD 3V5KB 1BBDL 3BVNB 5KTEL 4RBPH 1T21B 4PJIF 2NXZC 1CFQA 2BNUA 1MRCL 4L9LB 2GK0A 4MNHB 1INQA 1N7MH 5CFHA 3L5XL 1P4LB 1O5DT 2ATPB 4JKKA 3JV4B 3BAEL 2WNGA 2OK0L 1EAPA 4GW1B 3UYPA 3V4VL 2DQFB 1EHAA 2ICWA 3TH3T 2Y06L 3OKDB 3TO4D 3LY6A 3RWFB 3A6BL 2OJZH 2WLYA 3QUXA 1CFVL 1HZHH 3FQRA 4X4YA 3DARA 2Y6SD 1PZ5A 4P9HC 2NY1D 1KGCD 3MRMB 4XPTL 5HGAA 1KOAA 3WS6A 1SJEA 4EIZC 4KV5E 3BDYL 1VFMA 5E0QA 4GG8B 4PJBF 4UILH 3TVMB 2P8LB 4IRSD 2F5BL 4TVPH 1INDH 3REVA 4IRSC 4P5KB 1HKLL 3P4MB 3QNYB 4OF8A 2XA8L 3KG5A 4NPYB 3O6LH 3OX8B 4HJ0D 5DUPH 1CLYH 4UUJA 3WSQH 3OAYH 3ROOB 5FHBL 1XGPB 2VDRL 1NC4B 3VRJB 1W0VB 3FL7A 5C0NC 2BRQA 5EOCJ 1NANI 1IBGH 2FLBT 2H26B 3VG0H 3RKPA 1OP9A 4TSBL 2OL3H 3DSFL 4L1DA 5C09D 4PRPB 3QHFL 5EZIL 1VGKA 3G5XA 2BRRL 2A0LC 2P47B 5IVZA 5E08H 1TETL 4PD4J 1VHPA 5IW3A 3LQAH 2XI9A 1JGLL 5DRNB 3GSNA 5HDBF 3MQIA 2VAJA 2JTDA 3QPQC 4JM4L 4L4TD 4XPAL 3HAEB 5ILTL 4OLUL 5B21A 5E9DE 1S3KH 5JORA 5ETUB 1CD1A 2B5IC 3PHOB 5DYOA 1FV1B 3KXFD 1MHEB 3EW3B 2AK4E 3HMXL 1NH6A 2CR3A 5IT2H 4P2RD 4X6BA 2P4AB 1I3GL 1IZJA 1FBIH 5IB1A 2OP4H 1NC2B 4IRJA 1E28B 1TTFA 4Z8FL 2VLLA 4MQSB 2OTUB 4ONFH 2WUBL 3X3GL 2JB5H 5A43C 4ZNEE 1NGWB 3RVUD 4S1RL 1WFOA 5EOTB 4OCSL 1MCLA 4P2YA 3FMGL 3CC5B 1S8DA 1P4BL 4WW2A 1ZGLM 1YC8A 4WVRA 3D39B 2ITDB 1GGTA 1K3IA 1EXUA 3HAEH 4NZDA 2Q6WB 1VFAB 3WKMH 4NHCH 1C08A 4O51B 4Y4FC 2HWZL 4JM2B 3HCVB 5SWSD 3HE7B 3QULB 1T83A 4NKMA 1HIML 4HS3B 3O9WC 4JFQA 3L1OL 1VB9A 4U6HB 2QL1A 4MA1C 1T20A 1DBKH 3RY4A 1RUAL 3MYJB 4QGTA 3Q3GB 4FTVB 1KT2A 3T2PA 2CRIA 3GB7B 4WUUE 4KXZI 4FQPA 1OCWH 1IVLA 1XR9A 1YMHB 4WV1C 1A0QH 3FB8B 4U1IB 5HHOA 3DOSA 4X8JA 5FF6B 1IARB 4AIOA 4MZ3A 2ILLA 1KCSL 1X44A 4RNRB 5SWZA 3WS3B 1S7WB 3GO1L 3RVWD 4YZFE 4MA7H 1T22B 3THML 1YQVH 2FL5B 1D5IL 1C7TA 2VZOA 1CE6B 1MFDH 4MYWB 5GS2H 3C6SA 1H8NA 1NAMA 3QDGE 2WV3A 2BCKB 3H9SB 2IMNA 3VGAC 1ED3A 1WBZB 4PJFB 5GGUA 1ZHNB 2ZUQC 3MLWL 1RULH 2E6JA 4P4KB 1XMWA 4X80L 3W0WB 3ELAT 1FG2B 3RWJB 3S36L 2NY2B 3GBNH 4PBWD 5IP4A 1CE1L 4BSJA 1FYTE 1UCBL 4BELD 2EDJA 1RZJL 1FYTB 3QXAB 3S36X 3OPZL 4N0UB 5ICZB 4HW6A 3CZFA 3QP3A 5BV7H 4RGNE 3LIZH 3U1SL 3GJEA 5KTEH 2R69L 4KHTH 5E99H 2WBKA 3HMXA 5JO5B 3PNWA 1U9KA 3SDYL 3UTPE 5BMFL 2XOTA 1NCDH 3VI3F 4BSVA 5D93B 4ODVL 3IF1B 3BN9D 3BUYA 4PGCA 2G9HA 1N64L 4JANB 2N7AA 4PJ9D 3AB0C 4LK4A 3ZSTA 4L29B 3KXFA 4NO2B 3IFPA 3IU4L 2HH0H 1ZT1A 3BP5B 2AJSL 1BVLB 3EZJB 3ZE0E 4L8BA 3OF6D 4PV9A 1J87A 2NY4B 4YAQB 1NCWL 3HI1B 4AG4L 4GUPB 1TVHB 2PUQT 1YZZA 4EJ1C 4NN6C 3VFTB 5GGTL 5D2LF 3ALPA 1ADQL 4XPBH 5CZVL 1FVDA 4HGMA 2VISA 3HC0A 4O2CB 1U3YA 3SO5A 5I17A 3M07A 5EBLA 2UY6A 1M4KA 4ISVB 5DVKA 5D2NA 4NO3B 1MRDH 2VXUL 3D0VB 3BKJL 1UENA 3BD5A 1JGVH 3MRBB 3NIDF 3QZWG 1EFQA 3KAAA 2PYFA 4R8WH 3PUCA 2W9DH 1DQML 4UT9H 1QLEH 1QFWM 4HKXB 2VL5B 4XH2A 4OGYL 5B39G 4LCYA 2VLJD 3UYRL 3QUZD 1XR9B 2AJUL 3IFPB 1RZJH 2J8UB 2HG5B 3UJTL 2DJUA 3BE1H 5IMKA 3O3DB 3MJ8B 4XP5H 2X7LB 3W11D 3KYKL 5KVFH 2NY0D 2WP3T 3TA3A 1NAKL 3GHEL 4CU6A 4OI7A 2FSEA 5I0DA 4KDVA 4YK4B 1F6FB 1JMZA 1RMFL 1DQLH 3ARSA 1KPRB 2H6PB 3DRTA 2CUHA 1C08B 4O51A 5EBWA 3O3DA 1FIGH 1L9MA 4W70A 1SY6H 3CC5A 4GSDL 3SN6N 3I6GB 2MPAL 4JZJC 3FO0L 3QXAA 1YEEL 4MNQD 4MHHG 2Y07L 5IQ9B 1W0WB 1HN1A 2DWDA 1FVCA 1AE6H 1TMCB 5I0ZA 1T0NA 3F58L 2BY3A 3BDXA 3ULVD 2MNUA 4HMCA 5CSBA 4ZS7L 1CICB 3V6ZA 4PJFA 2AXHA 5GGUB 3U2SB 1SYSB 1S7SA 3ULVH 4M62L 1GGIL 4C57C 5F9JA 3OR7A 5BJTA 4EI5C 1BBJB 4XXCC 4GQ9H 2EDRA 2WWMD 4Q58C 4XMPL 4HDIB 12E8H 2BJMH 3LKQB 2EDQA 3K81A 4J6RH 4KJWD 4OZFH 5GHWH 4GAYA 3KLAB 3MSPA 4PJ8D 1I8LA 2VTFA 2OI9B 4WTXA 3U7YL 3P77B 4MD5A 4JQVC 4HV8A 3FOLA 3TVMC 2QSCH 2BVOB 3KXFE 1P7KB 1ZV5A 3SOBL 1WQVT 1MIMH 5FIEA 4C59B 1G6RA 2IQAA 1I3UA 4EZMA 1QFWH 3IFNL 3L3OA 4N5UA 3VGGA 1AD0A 4ACPA 3TT1H 1JFQL 4F7PA 2NY5L 4OCWH 2A6JB 2DQIL 1S3KL 1T04A 4G8FB 3EOTH 3HRZB 3ZDZF 1X6LA 4F7CB 3C6LC 2UVFA 3KLSA 4UTBL 1MLBA 5DJ6B 4PJHB 5I1LA 1T1ZA 3U6RB 3GI8L 4GRLA 3RHWK 1S7VB 1X5YA 2CRMA 4YHYC 3MLXL 2A74A 4PG2C 5C6WH 6CGTA 1HZHL 4KI1A 5TGBB 4ZMAT 4NT6A 3C5ZC 1KN4H 2DIJA 1JPTL 1JNNH 2VLJA 3ETBF 5DUBB 5D2LA 1MREH 3QNXA 1OF2B 5HDBE 4KHXH 1EBAA 2Y7QB 5F93C 2HWZH 3OB0K 1GGCH 2ZUSA 3MUY1 2XXMB 2Z31A 2Z91A 2ARJQ 2E8ZA 4YBQD 5BQ7A 4PRNB 4CVXA 1J0ZA 5EH1A 7CGTA 3TJEL 4Y4FB 1B6DA 3NTCL 3TZVB 5FK9A 4M61A 2VDPH 1KT2B 3MRJA 3U36A 3P40A 4QXWA 1DEEA 1U6AL 4KTYA 5DHVB 4XBEL 2XZQL 5ACMA 4WV1B 5HHOE 3TPUA 4HIIB 1FN4A 1F6AB 1H8SA 4J1UA 3PQYE 5KZCB 3G08A 3MROA 2AABL 3FQTA 3DROA 1KTLB 1U8IB 5F89A 5M94B 2W0FB 1YEDA 3UJIH 2C3GA 5D6DC 4XPAH 2IPKB 2VL4A 4AMKH 1IGCH 2ICCA 4ZPTA 3LMJH 4C83B 2YD8A 4M6AA 1X5FA 3BIKA 4BZ2H 3RFZC 1JP5A 4JJHA 3VMNA 1WGOA 5DMIL 2R1YB 3MRMA 1U93A 4ODHL 4BFBD 1XCTB 4GAJH 5ANME 4LNVA 1Y18A 3QFDB 1N3NA 3QIUC 1A6WH 4NDMA 3ROLB 4TUOA 3SJVB 4HS8L 4XPHH 4ELME 4F33B 3EDDA 1FYHB 3W5NA 2V9TA 3UYRH 4X7SH 4TUOB 2E9WA 4NOBA 2R56L 4NKQB 2FATL 1TZGH 1J88A 1WLHA 2C3HA 4HC1H 2UZIL 3NZ8B 1G9NL 5DEFB 4RGND 3AREA 3VFPA 1EO8L 1FL5A 4HWBL 4UZGA 5SWSE 4WO4A 4WWKB 4PBVC 2D7PA 4KRPC 3G9VA 1VACB 1S7UB 3GMLA 1P9MC 2FJFA 2KH2B 4QOKD 1ZWIB 5B38A 2QHRL 3WEXA 4KFZC 4RAHA 5HGGS 3IETB 2ZUWA 3NAAL 2DQJL 2VLRA 3QDJD 4MQ7A 3VRJA 2ADFL 4KDWA 5EULV 4OUUA 5J6HA 2MPAH 5HJ3A 4MD0A 5CCKH 5KVGH 4FQ1H 3WL9B 1GZQB 4Q6IC 3MCKA 1QBLH 4Q2ZA 1OAZL 3VD7A 2H3NB 1NUNB 4N0CD 2EC9T 2XICA 1MHHB 4NNXA 4C58B 4LGPB 4N0CC 1TJGH 4K23L 2X4RA 2FZ3B 1PDKA 4FXGB 4JKMA 2B4CC 3WDJA 4YHPA 2GCYA 3BE1L 3WE6A 2ICEA 2VDNH 4H25B 4HEME 5F7WC 1BWMA 3R06A 2YPLD 3I9GL 5LCVH 4ZYKA 5BXFA 4XHJD 4DVRH 1JYVA 3HPLA 1N5AA 1OTSD 1MCWW 4X0KB 3ZT7A 3V52H 1F11A 1FZMB 1AQDA 5CJXC 1DBMH 1XGQA 3EO1B 5F9OH 1FL6B 1CL7H 2I9TA 3U9PH 4Z7OF 3MLRH 3QI9D 4Q7DA 2EE3A 2WM0A 1WFNA 4V2BA 1DSFL 2DL2A 1LEIB 3BZ4B 2EYRA 4Y5YA 5FM8A 3DVIA 4PJXA 2DQHH 2Q86A 4M3KB 3I02B 3WHXB 2R4SH 4I77H 3HNVL 4H8WC 43C9A 5HHPB 1HDMA 3FRUB 3I6KA 4MXVF 1RJLB 3WFHB 1CGYA 3TM6A 4M1CD 4QRUA 3CMOL 3QA3B 4MNQE 1Z0NA 1OAYL 5E08L 2A9ML 1BMGA 2VLKD 4M1CC 3SDCB 4Y19A 2VSDA 4NKDA 1YEJL 2YA1A 5BVPL 2NMSA 3QUMB 5BW7A 1SEQH 5KW9H 4M7KH 5HDLA 3JVGA 4K9EL 1A5FH 4MJIE 5GSVA 3VI4F 2YBRA 1PEWA 5CZXC 4MA8L 1FPTL 4N0UA 3BEWB 4MXWL 4M3JA 3BH8B 3HMXH 3BGFC 3CZJA 5EU4B 5DTFB 2ADIB 1WAAA 2K1MA 1MQKH 3BO8A 2FX8L 2YSSB 4WCYL 4HCRH 4L4VD 4NO0A 4YC2C 2G60L 3C5JB 5FCUH 4YXKH 1HXYB 5CHNB 4AY0A 3W81A 1YJDL 2EDTA 2GITB 3ARBD 4TVPD 5I76B 3U2SA 3MRKA 3WIIH 2CIIA 4U6YB 4NQVA 2P8MA 3BKYH 4UOJA 2IH1A 3GFUA 5HD8D 5D7IB 1C1EL 3MMEA 2DB8A 3MNZB 3LZFL 3VFVB 4MAUL 4NQXA 2RB8A 4X8JB 2Q76A 1LE5A 5B8CA 4QLRA 3BD3A 4NKIL 1UB5A 5GSVB 3AAZB 2ESVB 1NSNL 4Z7WE 4HWUA 4Y16D 1YN6A 4M6NL 4ZOEA 4F7PB 4JGUA 5JHDD 1AO7D 3MLVH 1FGNH 4HKJA 3EBAA 5CJOL 3ILQC 2QBWA 4NJ9H 5C0ND 4R4BB 2UWEB 2R0LH 4ZAKA 4BM7A 4NUGL 3DURA 2DLIA 4K3GA 5I75C 4K94H 4G6AC 2N7BA 1C5DB 4KVNL 1RZFL 4JG1H 5K59F 4FP8L 5IMKB 1CU4L 3T77B 1JI2A 3GIVA 4YXHL 4WJ5B 1K5NB 5BCAA 1S8DB 4JRYE 1UYWH 1JWSB 4YHNA 3WDHA 3KDMB 1AGFB 3IJSA 1YJDC 4TUJB 1IEBB 5C0CB 2VIRB 1O7VA 1BZ9B 2EDXA 2YKLL 1BGXH 4E41A 1BFOB 4F7TB 2BJML 1LK3L 1PX4A 3BPNC 2K9UA 4MVBC 4PGZA 1DFBH 2YN5A 4XVJL 3D69A 2P5EE 1T2QL 5E8NA 2VO5A 5LWYH 2VDQL 4O58H 2I24N 1FVCB 2Z31C 4RMTA 1H9VA 3ABZA 4PJ5D 2QQKL 5C08D 3ARUA 4UILL 3N1MC 3VXPA 1N7ML 4C4KO 2UVEA 4KRNA 3IKKA 4U6TA 1CT8B 2YD5A 4M8QA 4NO0D 5CEYB 4C56A 2DL9A 3O6FA 2NY1B 4PLJC 4PUBH 3C5ZB 1JFQH 3LV3B 3RDTA 2G75A 1A14H 1NL0L 2VXSL 1V7NH 4J8RB 3ARXA 3MRNB 1WBXA 4OKVB 1FNAA 3P30H 1ZSDA 1QFPA 1KG0A 1CLYL 3WSQL 1HXYA 5CHNA 2ZG3A 2QSCL 4HJGA 3O9WD 3T3PE 2GIYA 5I18H 2XZAH 4OZIA 3TV3H 4JO4L 3VWJD 4APQC 2CKBA 4HFWA 1YMMA 2X4PA 4MJ5B 5KVMC 2DI7A 2EH7H 4RMWA 3PIQB 3MLZH 3MREB 3RTQC 3RP1A 5D5MF 4YDIL 1DBJH 4YHIA 4UTAL 2IH1B 3CX2A 4OGXH 4LEOA 4I1NB 1CXHA 3CFCL 1KJ3H 2QQLL 1KCRH 2I60H 5SWZD 3SQOH 3TVMA 5C1MB 2BCKA 4U1MA 2OL3L 3DSFH 2Y23A 2CK0H 4XC1L 3OGCB 2BDNH 5J89A 4X98A 1WZ1H 2WIIA 4CADB 3WXWH 2W60A 5FKPA 1EGJL 1YMME 2R9HC 1YPZE 2A6KB 3O8XB 4LSPL 3D0LB 3TN0A 1IGMH 2APBA 1M6OB 3UJTH 3N9GL 4OB5H 2B4CL 3H9SE 2AW2A 3EYQD 4OZHE 1T7YA 3MBXH 3L5HA 3WD5H 1MHCA 1A2YB 4Y4HC 5D1ZD 3H6JA 4NQCA 1T2JA 2PW1B 3HNTH 4X9GA 4ENED 4EI5A 3O6LL 1PQZA 5GGRY 1UM5H 5JHDE 4UIMA 3VXQA 3X14A 3P4NA 3DV4A 3V5HA 1PLGL 1FNSH 3CJJA 5ITBL 4QHKJ 1HHHA 1A22B 1KC5H 2DBLH 1UWGH 3MGTA 4RQQB 3D25A 2V5TA 5BS0B 4HWBA 3T4YB 4YFDB 4P2OA 3EYFB 1A7OL 4CBPA 2FJGA 4AIXA 2WP3O 2ZUTA 3BD4A 5E95B 3E8UH 5F7EL 4OUUB 3TN0C 1GL4B 3SO3C 5FYKU 2A73A 3G6JF 3TN0D 3S4SA 5DK2B 4OGZA 5E6ZA 4M7LT 2FD6H 1HI6A 3PWJB 4JM2D 2E7BA 4BK5A 4HKXA 4TSCL 5E8OA 4XCYA 2CLZA 2EEDA 4HK0B 5KN5A 3VXUD 5CEXA 1ZLWK 1MLCB 3S36H 9CGTA 1M7DB 3LS4L 1V3LA 3JBG7 2R56H 4QTIL 5C07D 4O2CA 4PREB 1S7TA 4QWWD 3KYNA 3SQOL 5BXFB 3MA9H 2B4CH 5C0JA 2WWKT 1CD1B 1A9EB 1G7QA 4U1GC 3U1SH 1OD9A 1QKZH 3UTZB 3CDFA 4NZUL 1LEIA 3GSXB 5K59E 4CVZA 1CK0L 5MEQA 5FO7B 2ARWA 3MC0A 2NY1C 3ECBB 1VKXB 4WEBH 1MFBH 3BKCL 1JPGA 3FB7A 1NBYA 1KIPA 5LVEA 1G0XA 4KQ3L 4PJDA 2CDEA 5F97E 1U41A 1MWAH 5FXCH 3SCMA 3KWWB 4Z7OE 3CLFL 5ITBH 4B7LA 2X70B 1XGRB 5D71H 3C5SA 2JLLA 2HH0L 5J13B 2I07B 4ZFZB 3SJVA 4U0RB 1CD8A 1Q9WA 4QO1A 2A6IA 1JI1A 2X89D 1KLUB 4X6CF 5CAYB 5KAQG 1S9WB 1U91B 3OSKA 4OT1L 3IDGA 4CUCA 4K71C 3B2UD 2DD8L 5B38B 5CILL 3VI4E 2AGJH 4KTDH 4Y4HA 3F7RA 3C9NA 4ODTL 2YPLE 3ZE1E 3TP4A 4AL8H 3T0WA 1G7HA 3IYLW 4JZOB 3JTTB 2YR3A 3HR6A 3ALXA 1N0XH 3AREB 3ULVC 3TC9A 4DCQA 3ULUF 1QFOA 1UACH 3KLAA 4P5TD 1CN4A 4J3SA 5T1DL 1CE6A 1ES0B 3QPQD 2AJ3B 3AB0B 3VG9B 4J4PC 4XAWL 3GK8L 4X6FA 3QUXB 4HF5H 2QQNH 4R97C 4UT7H 4K7PX 1BQLL 3VFGH 3B9VA 1B6UA 4J4PD 4LHUA 1N3NB 2NXZD 1NCCL 2AQ1A 1FLTX 2NX5D 4X6FB 1N5YH 1MFNA 3EO0B 3RTQA 2WZPD 3TWCL 5LBSL 3V6OC 4ZSOE 4PGEB 2Z93B 3ILPA 3P30L 5GRJH 4JG1L 4F2MA 1EX0A 5C0FB 2OP4L 4IS6A 2JCCA 5F3BB 5ILTH 1YEKL 2DIAA 4RBPK 1KB9K 3TJEH 1U3JA 4I18A 1I8IA 3GSWB 3TO4C 2F53E 5IFJB 4K3EH 1HH9B 4R2GB 4ORGB 3QO1A 1JPSH 1A4JB 2HJLA 1N4XH 3QNXB 2FWOA 2L7JA 2P44B 2BNQA 2R2HA 2W07A 5ICXA 5JXAH 1LNUB 2HJFB 4NQCE 5KSUA 2P42B 1I1RA 2APFA 3ULVL 3R1GL 1NGXB 2AEWA 3LRGA 4HFUH 1DEEB 1AI1H 4PJCB 3DLQR 3GDBA 4XAKE 1R3KA 2Q1EA 4P9ML 4PRBA 5DD3L 43CAB 1OY3B 3CFDA 4HUXA 4IRJD 4ELMB 4I9WE 4Y4FA 4G7VL 4GAFB 2WBJD 1DSFH 3FT2A 4QRQB 3WFZA 2IANB 1YEHH 3BPLC 1KIPB 3VFGL 4AZ8A 3EKCA 3MRBA 3QH3A 1F6AA 4M62H 2WK2A 2BVYA 1WEJL 1NBQA 1QRND 5C0BE 4JVWA 1IGIL 3ARVA 1RU9H 1Q9LA 1CF8H 3QR2A 4M6MH 1YDPA 3TIDA 1CGSH 3WUWG 3V4VH 3S37L 1ETZA 1A1NA 3HHRB 3KWWA 1X7QA 1OLLA 3PP3H 4JFFE 2MCPL 4ODWB 1ETZB 4PP1D 5FYLL 4JZOA 4H5SB 5MENA 2BVEA 2IPUG 3S5LG 2JKXA 2Z8RA 5F1IA 5SX5H 1PBYA 1TVBA 4PP1C 5I1EL 5F7DA 4P9HH 4G80B 4GAGH 5FKAB 5IMOB 3PWLB 4A2MA 3FHAA 1QA9A 5HYJE 4CVZB 1G7IB 3HUJF 5FYKE 4AT6B 5AUMA 2ORBL 4U1JB 3M8OL 15C8L 5JW4N 4LBEA 4DKEH 3VFMA 4QRSB 1NDMA 4Y2OA 5B8CC 1KELH 2NXYB 5ESVB 3L5JA 3NZHL 3P9MA 3SKOA 3D85A 1ZEAL 3I9GH 3O3BB 2P5EA 2BZDA 4R96A 4LRIA 3OAUL 4U1NA 1JNHB 5HHXL 4QCIB 2HAZA 5GZOD 4OZFA 4K94L 4DVRL 2CPCA 4AQ1B 3FB5B 4HUVB 5HYSG 1ZGLA 2PR4H 4X6DB 1KACB 5HI4D 1TJGL 2N4IA 4Q0XL 3WFDL 4ZFOL 5C0GB 1MCDA 3RIAK 3ZT6A 5HI4C 3UROR 1X5JA 1NLDH 4M8VA 4OZGF 1O0VA 2DQTH 1IEAB 2JK5B 2WQ8A 2VDKL 4LSQL 5IFJA 1FLRL 4A6YH 3VXME 4M7ZB 4DZBA 1KXTB 5DVOA 3PDDA 4KROD 4K7PH 2A9NH 1OP3H 3QZWA 1MJ7L 5E6IC 5BW7C 1LO3L 2AI0H 1BFVH 4G6KH 4UIMB 3N0PB 5F9OL 4WDIA 5B39A 4FQJH 5D93C 1NMBL 3DUUA 4N0YL 2Y5TB 2MOVA 4IJ3C 4X5WA 3SY0A 3EYUH 4OLXL 1F4YH 1WBYA 1MRDL 1CVRA 3LRHA 3SDDD 4JO2L 4Z7QF 2FIRT 1ZTXH 1JK8A 1RHFA 1DL7L 3OKNB 35C8L 3OAUH 5HYQA 1YY8B 1ZAGA 1Y0LA 3A6OA 1MUJA 3QIUA 1KF9B 4XCYB 3O4LA 4HGWA 5DJXB 1QFUL 4WHTA 1OSZA 3UO1L 5EOTA 5E24E 4K8RD 2V5SA 3S35X 3FQUA 4WHTB 1F4AA 5I74B 2BMKA 2V17L 2BSRB 5FDWB 4DEPC 2PYEE 3HMWL 1RURL 1IKFH 4ONHA 3DECA 2XACC 3LQAC 1IC7L 1U8LB 1BFSA 3CXDH 5E8NB 1F97A 1MEXL 2AAVA 2IJ0C 5IG7B 4N9GA 4GW4B 3UTQB 1T80A 1KCLA 3CSGA 4YNYB 2G75B 3LMJL 3D3VB 2BHUA 2BDNL 4LLVA 1Q1JL 2PF6A 3FB7B 1OSPH 4G80A 5FKAA 1YMHA 3U0PA 3V4PH 3VGFA 4LLQB 2HVJB 4OI8A 5E2VH 4HAFA 2EEAA 5DJZB 1VPOL 4FTVE 1F58H 1AHWB 1KJ2A 4Z78A 1R0AL 2VKXA 3QUYD 2X9WA 4JFDA 2HTLC 3GMNB 2GJ6E 2WINB 1A9EA 4NNYA 4CRPA 1IL1B 3MV9D 5DMYA 4AMKL 1KXQE 3L6FA 4FQQA 1K6QL 2XWTA 2ZSWA 1A8JH 4ONHB 1DVFB 2XKNB 4NRYA 4I0PC 4G7VH 4H0IA 2EKJA 3MZGB 1D5IH 3HZMA 4PTUB 1OLZA 3FB8A 5DUMH 2FHFA 3PP4L 3T4AB 1ZT4B 1LQSR 3MJ9L 3PIQA 2EXYC 5F9AC 3LQAL 5HHQB 5EOCL 4Y5XB 3C5ZA 2X4NB 3MYJA 3BH9B 4OSUL 4LLUB 3TYGH 1FG2A 1KN4L 3BW9B 1OVZA 4NQXB 4NZTL 3ZKNC 1AKJB 4N8CL 5DQJB 2QLVB 3FO1B 2HMIC 5CSZB 2CXKA 2O5ZH 1CGSL 4GKSA 1DBAH 1CDBA 1I1AD 3WFEH 4HJGB 4HD9A 4U0QB 4AH2A 2HFEB 2P8MB 4MJIB 1EA9C 3FB6B 1NLBH 4U6YA 1AGEB 4HKJB 4G9FD 3RGVB 5CLTA 2YA0A 4PRIB 1NFDF 2IG2H 3QYCA 2MMXA 3U30B 1DFBL 3HLAA 4MQTB 1XZ0B 3KVQA 1BZ9A 4G6FB 4S1RH 4YBQC 3W0WA 4LHUD 2VXVL 5FGRA 1HWHB 3BWAA 4U6VL 1GXEA 3NIFE 4JPVH 5EU6B 3VFSA 1WCBB 4GW5A 4KMQA 4G6JL 2DQDL 5EG6C 4IOIA 5CSZA 1UA6H 2D2OA 1TETH 5DQ9B 4UNTA 1CL7I 1NEUA 4G6AD 4LVOC 3LN4B 4AL8L 4EUPB 3NTCH 4YIQA 1AGBA 3BPLB 3L3KA 1TENA 2DKMA 4MMXC 4YXKL 3QDMD 4M7JH 3ZHLA 3VXSA 3F7PC 1F3DJ 5E00A 1ZVHA 2W1NA 5BO1H 1MH5B 5BRZB 3WIHH 3T04D 2IANA 3OR6B 4W4NA 3P0GB 4ELMA 2GKIA 3E2HB 5GQBA 5EU7C 3IDYB 5TE7H 4OSUH 4KKLC 2UV3A 3I75B 4HIXL 4YO0B 3BRFA 3GGWA 3MXVH 5D8JH 4GG6B 3FAXA 4KI5F 4L9LC 1Q0YL 4S1QH 4KKLD 4Q9QH 5IW1A 3SCMC 3EO1A 1VFOA 2CDFB 3CFEB 2HJFA 1RIHL 5E8PB 1I3RB 2V7NA 2WIMA 4XNQB 5CWSA 3SCMD 3BP7B 5I74C 4O00A 3CPLA 5EB9A 4PG2A 1PVHA 1AXSA 2G5BB 3RDTB 3UEZA 3DMMD 3H42L 1GHFL 2IFFH 3CFKA 5KS9F 3T0EB 4GRLC 4M8QB 1PJ9A 3WE6B 3HZVB 2CIKA 1J1OL 4X9IA 4RGNC 3BZFA 5IV2A 2CJUH 2KKQA 1R3IL 3SO3B 3SDXB 4OIAA 5I73B 1KTKE 3LKRB 4IIQB 3V4UL 1DTUA 5F7UA 3BISA 2CIIB 4Z0XA 4JDVA 4NKDB 5DWUL 4OBSA 5ESAB 1ORSB 3RPKA 3DX6A 4G8GA 4KJYA 3HI6L 1DUZB 4OLZH 5IB3B 3GJFA 1G1YA 4FXLA 1HK6A 2ICWB 3VD9A 3G6AB 4MJ4A 1D7FA 2AJYH 1T2XA 2OJZL 2ESVD 5DLMH 2EH8L 2GFBB 1QEWB 4X6CB 3X11B 4APQD 4OAWB 3FRPA 1FFQA 1BF2A 3RWHA 5JW4M 4FABH 3P9LA 2UUDH 4PJ7B 3K80A 4P5KA 5JA8B 5MI0C 3WJLC 3ULSB 1JCKA 5JDJA 1A1MA 4F9LA 4KK8D 3VXTB 4Y19B 3O3UN 1BVZA 2R1XB 3LCYA 1FL5B 1XGPA 3LSOA 3MLYL 3B83A 4K94C 5E6IB 5HI5D 1T03L 4NYLB 2FWOB 1TJHH 4EDWH 4Z5RB 5C6TH 1N6VA 3OB0H 3U4EB 1HILA 4G8GB 1NC2D 4G8IB 3I2CL 5IF0A 4OZGE 3Q6GL 1CXKA 3HE6D 3A67H 4JZJA 4I18B 4OZGB 5F8RC 2DMBA 4LLDA 4PRDB 3QWRA 5BMFH 1CK0H 4FN0A 5ENWB 1U8QB 4YWGH 4M7KL 4RFNB 4CDHA 3ULUC 1J12A 1MFBL 2OR7A 3PQYB 1A9BA 1AIFB 3PWUA 2RAMA 4JZJB 3RJQB 2E27L 2FCBA 4XCEB 5SWSB 1A2YA 3HE7D 1R3HB 4MA1B 3G6JE 1X5XA 1J05A 4Y4KB 1I85A 2P48B 4LKXB 5HHVL 5MEQB 4FFVD 4MXQD 1ADQH 1N2RA 5J6HB 4XGZA 5INCB 5D72H 5B4MD 4P2RA 1SVCP 4WI8A 5GS1A 3QHZH 1Q72H 1K4DB 2VH5H 5B4MC 4Q9BA 5GSRB 4JREB 2W59A 4JHAL 3TNMA 5FECA 3BGMA 5CEXB 3DIFB 1XGTB 1YQVL 4ZO7A 2NW3A 3NCJL 3GMOB 3GI9H 2VE6A 4OM1H 1B2WL 5D7JA 2OM5A 3HNTL 5EZJB 3IU3B 5FM4A 4YUEL 4L3AA 1WK0A 4HG4J 4TTGA 3BKMH 4PRNA 1KTLA 5E1HB 1LO4L 1DUZA 3DROB 3W5MA 1R3HA 2P5WB 3MNWB 4ERSH 4PBXA 1OT1A 1T83C 2XN9D 2E7MA 4M4PA 1TZGL 3T0EE 2A38A 1H5BB 5I8KH 1U8HA 2BOBB 1AO7A 5HI3D 1WUNT 5DD6A 5TQ2L 2Y1VA 3RWGB 4FS0A 1TNNA 1OWWA 4PY8I 2W0KA 5JXAL 3GEWB 3FHQA 3GRWH 4NM8H 1QFWI 5AZ2L 4HS6B 5GJTL 3ECBA 1VADA 1IC5L 1TZHB 3UO1H 4NWTH 5DD1L 4XNZB 4BZ1H 4XPFH 1KIUA 3LN5B 2J7LA 2IWGA 1BX2B 1HILB 5JLZB 3E8UL 4MAYD 5BRZE 4KQ4L 1NBZA 1OD7A 5HDQL 4U1MB 4JN1L 4NP4H 1VERA 3BP6B 3KPSA 3WFCL 4JDTL 3MRGA 4NO5B 2ERJB 4QHMB 1F13A 1WWAX 3G5VA 1I9IL 4QRRE 4M5YL 4ZAKC 4F7EB 3MJ6A 5D7KD 1FNFA 1MI5E 4N9OB 2NNAA 4NN6B 4PJ7A 2F54E 4WY7H 4DOHE 3MOAH 4XNUL 3S9DB 4XPGH 3QUYA 4X6DF 4R0LA 4P2QA 4ORGA 1K9TA 1F4HA 4YEEA 5A2LH 3ZHDA 3EUUA 3FT4B 2HKFL 3G6DL 3W9DA 3HKFA 1NEZG 5EU6A 2AXGB 1VACA 4LDLB 3AVEA 2EIEA 2VLJB 3JUZA 1MCEA 1F2XK 1MCCA 5DT1L 1QLFA 2KPNA 3B5TA 4KHXL 4DKFL 1RZ8B 2ARJB 4BJLA 4DZ8B 3NCMA 4QYOA 3BSZL 4NJ9L 3DV4B 4K71B 3LEVL 3VFPB 5E4EB 2A77L 2Q7NA 3E0GA 5EOQH 5JNYA 2UZYB 2EEBA 2J6EH 3IGAB 2MCPH 3TIEA 4IRSA 4YHML 1ZHKB 4KK5D 2VUOA 5DDHA 2PYEA 1II4E 3H0TB 2GYSA 2J8UE 5DJDB 3QDME 1JRHL 3CX5K 3QRFM 4L4TE 4NWTL 4YFEA 1RU9L 2PXYA 3T3ME 2ZUXA 2CLRA 3GKWL 1U8LA 4OM0H 1F3JB 3NVQA 1MCQA 3SKNB 5JXED 3IDYC 3DNKA 4N1HB 8FABA 2XTLA 1WFUA 4KH2A 5IFAL 3QUXC 3TO2B 1KCKA 2H1PH 3HB3D 5IWLC 4H1LH 2XTJD 4IRJC 5EFIA 2ITCA 3HB3C 3MRQB 1AJ7L 4HKBB 4WW2F 1IQWL 2DDQL 3UTTA 3IAQA 1JWSA 4JR9H 2ADJB 2WUCL 3CMOH 4OIIH 4QTHB 3T0BA 1MUJB 3QIUB 3CD4A 4ZUUA 5KOVC 3S96A 3DVGA 3SBWC 4PPTA 5CIPH 3OKOA 4ZFFB 5C0BD 3FFCD 4GMTH 3S3SA 3UPAA 3UX9B 1W72B 4K9EH 3DXAB 1VSCA 1FZOA 3KJ6L 4DKFH 2NLJA 1QVOB 3QCUH 4F15B 4J12A 4LCWE 5KS9E 4Y89A 4OKVA 5F21B 3S5LB 4HIJA 2FEDC 4YPGB 2VDOL 3U79A 4WHYH 4LDOB 4U1KA 3WFEL 3KPQB 2X9XA 2AXJA 5GS0C 5EC1B 3I02A 2A0LD 2XY1A 4KC3B 3O2DH 4NQEB 4JRWA 4PY7B 4NIKB 3X12B 3MRCB 3F65A 3P9WB 4OV5A 3PDOA 4L3CB 3S98A 3BDYH 3CVHH 4X4XB 4Q74A 3ORJA 4D2NA 4MJ6A 4UQ3B 3KHOA 4MX7A 1X5KA 4S11A 4YDVA 3TWCH 4FXKA 2F5BH 1QO3B 3KPOB 2Q87A 2R0KH 1CBVL 1QNZL 5KBNC 2ERJC 1CICA 3MOQA 4KRPB 3F6LA 5AEAA 3MYZA 4NQDD 2BNRD 4JQXA 3P0VH 2QADB 4Q6IA 4X8XA 5ECJE 5K9OB 4RMSA 4GKOA 1TQCB 2ADIA 1CG9B 3RPIB 3GJEB 3BQUD 4OZFB 3GUTB 5GZOC 4K7PY 4QRTA 3QJFB 1IGML 5DEZA 4WI5A 2IC2A 4PV8B 3REWB 3IDJA 4FQCH 1HHGB 4WUKH 1PD6A 5J11C 2DLGA 3U30C 5BOPA 1X3DA 4NC0B 4UB0L 3GSVA 3T65B 1KB5L 5HHVH 3HMWH 3VGEA 1JTTA 4HT1L 4OZHA 5KSAA 2FHBA 1BHGA 4JJ5A 3RI5F 4FQ1L 1H15A 3AAZA 4FZ8H 3MV8D 1TVHA 1UKSA 5D7LA 3RTQD 2VH5L 3QG7H 2NXYC 2P1YA 4P48A 3LKNA 2NY6D 3CFJA 1NCBL 3ARFB 4KJPD 3QQ9D 3TBYA 5D7SH 3ES6A 2NY6C 5IJVB 1LDPL 4X6DE 5L8KB 2XYCA 1RUQL 1FL6A 4HJJH 3DYMA 3PABB 4ISVA 3U4BH 1D6VL 3SDDC 2PO6B 5ERWA 2A9MH 1DQJB 4EI6B 1EFXB 1WT5A 4NQUA 3V8OA 2J4WL 3QG6A 4HXAL 5H35B 2DQCH 1DZBA 5DMJB 2XZCH 4RZCB 1FGVL 1NAML 2BSTA 2A83B 5TDOA 1L7IH 1RJCA 1UWEH 3IS1X 2AK4B 3ZE2F 3OKKA 1IKNA 4QRPD 4F37F 3MJ7A 3UJJL 2E3VA 4WRLA 2Z8VC 4Y8DC 5CJBA 2W65B 5DD5H 1A6VH 1TZIB 1TJHL 3LKSB 1HHKA 4MCYA 3S97C 1JWUB 2ZCLL 4FRWA 5CBAB 5CEZH 1NGXA 3L3DA 3LKPA 1XIWA 1E28A 2CGRH 4ZUTB 1RZIB 2ZSVB 2UZIH 4CMMA 3SKOB 4ZFGH 2XZQH 3HE7A 2FX9L 2KL6A 4D3CL 4FQHB 1EIBA 2EXWC 3BQUA 1G7IA 4ZUSB 5GISL 3RZCC 1YN7B 4NKOB 4NM4L 2VDKH 4LSQH 4OUOA 5JLZA 5FHAL 3NZHH 4OB5L 4EVNA 4DUXA 3O6FB 3SHSA 1JZ2A 3HI5H 4FABL 5IMMB 4X5XB 4JFFD 1P5VA 2BVPA 3RWJA 1FNSL 1OM3L 4K9EC 5F1IB 2APWA 3K8KA 2N1KA 1D5XA 1LEKB 3NH7L 4X4MA 3C08L 3QDJB 3W9EB 5F96H 3RNQA 5IFAH 2NYYC 1IAKB 3NZ8A 1XAUA 3NFPB 1M05B 2MQ3A 5DEGB 3SDXE 1J7VR 3CFBB 2IH3B 1FDLH 4PJAF 3WYRA 5GRVL 4I0PD 3PHSA 1H0DA 2NY4C 4LPVA 4PJGA 4MHHI 1UXWA 1HHGA 5BV7C 3M1BB 2R23A 4RNRA 25C8L 3WS3A 4XCNA 1H3TA 3PXJA 4QRTB 5DD3H 4OCRH 1E27A 1UCBH 5L2KE 4BFEA 3O45B 4PJEB 4NUGH 4WU7B 3MRFA 1IAIH 2XWJA 2QQQA 1JZ6A 1C12B 3QEQD 1JHTB 5GGSY 1RSFA 1GYAA 3N85L 1S7VA 4K3JH 4LLMA 4U1LB 3RZWA 1YQ2A 1JHTA 1Q9KB 4GRMA 4WHCA 4LCUA 4WFED 4L4JA 4PRBB 1NSNH 1YEHL 3Q48A 3CSBA 4MS8C 4PJEA 5C0DA 1FJ1A 3ZKMD 3DO3A 4R90H 1E27B 4M7ZC 1U3HD 4MAUH 3IKCA 2JIXD 4ZO8A 2YK1L 4NHUB 4DW2H 4PJXF 2IGFL 5TPWH 4UTBH 3FKUS 2HRPL 5GZNC 1AI1L 1Y6MR 1UEYA 3IETA 3U0WL 4PD4K 4HWEH 5E03A 4ZUWB 4LOUC 2PYEB 4XVTH 4LKXA 3MLVL 1G0DA 4PJIB 5IVNA 3PWVA 5FA3B 2Z4QA 4WU5B 1P69B 4LNRB 4RFEA 5GGSB 5HHMD 1CIDA 2Y4SA 1AIFA 1JTOA 3PWUB 3IAPA 3W39A 3G5XB 4D9RE 5IB1B 5DRXA 1I7TA 5JQHC 1I1CA 4RFEB 1TQBB 5C0CE 3E6HB 1A64A 4OCNC 5J6GA 1ACYL 3F62A 5FYKH 2I26N 1KUMA 4NQCD 4EI5D 1S9KC 1KSRA 4N90D 3S37H 4JO4H 2WWMC 3IJHA 3KYNB 1FFPA 1QP1A 3T3MF 5HYJB 5IMLB 3SKMA 3ZKQD 2LU4A 4M03A 2EDOA 1RVFL 2UWEE 3N85H 1RJZA 2OR9H 5CP7A 3FQNA 4QT5B 2LAGB 2IPUK 4CMHC 5ACLA 4LIQE 4P46C 4I8DA 1VDGA 2VDPL 4NRZA 3TEUA 1RMFH 4BH8B 3WXVH 1WISA 3KYAA 4JFYB 3TA3C 2XPGB 3L5XH 4Y2DA 1AGDB 3CXDL 2YK1H 1CZ8L 5T1MB 3ZYIA 1CS6A 4D0CB 1V3MA 1MRCH 1YEDB 1CLOL 3I6KB 3ARBB 4OV6F 3UTTD 1VFAA 2Q6WA 2CRYA 4HKZA 5DS8A 5HGAB 2B1HH 4I5BA 3ARBA 2Q86B 2H6PA 4GJTB 1KPRA 1H0DB 1UJ3A 3DMMC 4RDQG 5IB2B 4D0CA 3GJFB 5KG9B 4PJGF 4ZUTA 4AQOA 3DVNB 2XPGA 5T1LD 2FB4L 3PP4H 1F58L 3R8QA 4WENB 4I48A 4HULB 4ETQB 4ZTOH 3T3PF 4IIQA 2DKSA 2XWJB 3MRFB 4JGMA 4JRYD 3HN3A 3QNZA 4KMTL 1NDGB 3KYMB 3QUKB 4PRID 4L8CB 4I0KA 1BOGB 5F6IB 3U9UA 3BP4A 1FVEB 3O4LD 3MNWA 5IUSA 2OTWB 3KJ4C 4JKPL 5DJAA 3IDIB 4LHUB 1E6JH 3B4NA 3V8CA 1IKFL 4U7SA 4H0HB 4KKCD 1KJVB 1V7MH 1B2WH 3LRSB 1X5IA 2AJ3A 5EZOL 1IEHA 1QFWL 3OZ9H 4PJHE 5C0CD 3VXTA 2H3NA 2R0WL 2W9LA 4OQTL 4DTGH 2FJHB 2Y25A 4OI9A 5I1LB 3CX5J 1J0YA 5GISH 5GGRB 4WHDA 2QHRH 3G5YA 4K55A 1BQHG 1MF2H 3PWJA 4KZDH 4PJAE 5EIIA 1HNGA 2C5DC 1J9CT 1QSED 2QKIB 5L2JA 5L2KD 4HPOH 1WWBX 4OGAD 1ZWIA 2C4FT 2FJFB 4BSVB 3LS4H 3GMQB 1FNGB 3HE6C 4KXZH 1KIRB 1HH6B 4TTDD 4CU7A 3SDAA 4PJ5A 2NW3B 4JZNA 1MEXH 4Z7UA 3MLUH 1LO2H 2V5RA 2LU7A 5IR1A 1YYLL 4V2CB 1C5BL 1R6VA 3ES6B 1WJ3A 5FUCC 4FQLL 1KBGL 3EOAB 4ZTPL 2B1AL 3C8KA 3MUGB 4S1DD 5L6YL