3QRGH

Crystal structure of antirsvf fab b21m
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
220
structure length
220
Chain Sequence
EITLKESGPTLVKPTQTLTLTCTFSGFSLSTSGMGVSWIRQPPGKALEWLAHIYWDDDKRYNPSLKSRLTITKDTSKNQVVLTMTNMDPVDTATYYCARLYGFTYGFAYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKAEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab light chain
publication title Crystal structure anti-RSV Fab B21m
rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 46
structure length 220
sequence length 220
ec nomenclature
pdb deposition date 2011-02-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qrgH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qrgH01
5GS0H 1F4YH 4CNIB 1SVZA 5I1DA 1RZ7H 1ETZA 3FQUA 5IFJA 4ZO8A 4WTZA 2V9QA 3VMNA 2AKRA 3NPZB 1A7PH 3TH2T 4YUEH 4WV1A 4XC3H 4U1NB 1ZGLM 1UM4L 1YMME 5KSAD 4F9LA 2C1PB 3N9GL 2HFGH 5D7SH 1VGEL 3CFBA 2G5RA 4TQEH 3L6FB 5C08B 1FLRL 1DN0B 1NJ9A 1JZ6A 5ADPH 1T22B 3G9AB 2ZOLB 1MSPA 1ZHNA 1CG9A 5GS1A 4WI3A 3BZDA 4Z7UA 2KPNA 1GSMA 3DXAB 1U3YA 1ZSDA 2E7CA 2V2XB 1PZ5A 3O6FD 4MMXC 3IFPB 1DANU 1RHHB 3HPJA 3TVMB 1FL6B 3V0VA 1KOAA 3GUTA 3OKYA 5EOQH 3V6FA 1HHKA 3HMXA 2PETA 3RZCC 2DQFA 4N1HB 4AMKH 4EDXA 2BNUA 3FOLB 3OKOB 2EYRA 3ARGD 2A6DA 4LCYB 3AAZA 4M8VA 1P7QB 5SWSE 5EO1A 2JELH 4CJ1A 1OAKL 1YN6B 3MREB 2EE9A 2C3GA 1NL0H 4N0CC 2A9ML 2VLRB 1NAKH 2JLLA 2VSCA 3LN4A 3QDGE 3HI5L 5D2NC 4M8QA 1ITCA 3EYVB 3BP6A 3MNWA 4U1HA 1KBGL 3SY0B 3LPFA 1OGAA 4GQ9L 3IB4A 2YKLL 1XGUB 1WV7T 1BFTA 2CLZB 1K4DB 4HFWB 3MRCB 3WDIA 4U7SA 4XXDB 2YBRB 2AEPH 1LDSA 4XT1C 4HQQL 1M7IA 3EW3B 3GMRB 4W4OA 3W9EA 43C9A 3CD4A 3RAJL 1X44A 3TJEL 4TSAL 3BQUB 5JQHC 5C9KA 3HMXH 2F53D 2ADGB 2F19H 2ZJSL 3VFNA 4MJ6A 4WI2A 5DRZB 1G6RA 2FB4H 2CRIA 1R3LA 1IT9L 3T0WA 3UTTD 2J4WL 2VLKB 4ZXBD 5I2IB 1F4XL 2EXYD 1KELH 1FNSH 1RMFL 2ZZUT 1R5VA 5GGQH 1D5ZA 5GJSH 4JFPB 4PUBH 3QI9A 4MNQD 1AC0A 4RGND 4HUUB 4PTTA 4N90E 5ICZB 1P1ZA 2VDOH 5HI5D 4X7TB 3PDGA 1S5HA 4XCCL 2DI9A 2HWZH 1RU9H 1MFAL 4IOIB 5I1LA 1OP5K 5JW3L 4LASH 5BMFL 4KAQL 1S3KH 4OAWA 2BMKB 4R97C 1F4AA 1PGRB 1A1OA 5KOMC 2VXVL 3QIUA 5C2BH 5AEAA 1ZLSL 3IKCB 4DKEH 5E5MA 1KUMA 4MNGE 1KXQE 4K8RD 4ZTPL 2YPVL 4LSQL 4EQ3A 2FIKB 1HNGA 4XPAL 4BH8A 1G6RH 3DSFH 2IFFH 5KS9F 1CICD 1ZT1A 3CJJA 4PJAF 3P9LB 3QPXL 2IBGA 2DQIH 4LHUG 2BHUA 2XKSA 3FKUS 4R26H 1BD2E 2V5MA 5TH2B 3BDYL 2BSSA 4UV4H 3L5XH 4PJ8D 4OF5A 4HX1B 5C0CB 4X6FB 4PRDA 1GZQA 1J10A 4KQ4H 4PY7B 2FO1A 2YR3A 4WFED 3PUCA 2EKJA 5A43C 1X5ZA 4NQVA 3ARTA 4WUKH 2AVGA 3QXAB 4HUMB 2WIIB 2EH8L 4NPYB 3PXJA 3MRMA 2UYLB 3VGDA 5GRJH 4PJFB 1NMBH 4XNMA 5C0FB 4U31A 4KTYA 1H8NA 3RHWK 4CNIA 5CBAB 3SE8L 3SDXE 4X7DC 4NJAH 3BN9D 2F54E 2W9DH 1A4KA 5IBUG 4X5WA 4H26A 3V4VH 1T1XB 3EO0B 3V7AE 4DEPC 2V5SA 2IJ0C 4JJ5B 3MXVL 2CKNA 4XH2B 1UQSA 3I3BA 1DUZA 2C1PA 4PGZA 1MNUH 4AIXA 5A2JH 3O8XB 1QTYT 2NY4D 3O3DB 3KYOB 5C08A 1DN0A 5J57B 2LVCA 1T22A 3EZ8A 4WUUB 3MLXL 1KB5B 3U7YL 3K81A 4FFVC 2J3SA 4OZHF 3DXAA 2V2XA 3NCYP 1W72L 5IK3B 3TPUB 1GXEA 3KYNB 3IFPA 3NIGE 3TVMA 1TTGA 1XF3B 2SEBB 4NM8H 5BVJA 1MCWW 4WU7B 5GRYA 4M7LH 5K93A 3FOLA 4LCYA 2I07A 4BZ1H 1MWAA 5K9OB 3BHBB 3VXSD 3LS4H 1YN6A 3MREA 4FTVD 5D93B 1CGVA 2VKXA 1NCAL 2HTLD 4OF6A 4M5ZH 3H7LA 1MIEH 3CFCH 4LPTA 2VLRA 1JF1B 1T04A 3DPBA 3QXTA 5FV2A 3IGAA 3F58L 4PGJA 5AAWA 3P0YL 3EZJB 3SY0A 3TT1L 5DJCB 5I1HL 1PG7W 3U4EB 1NMAH 1ZVSB 5D8JL 5J11C 2HH0H 4U0QB 4HFWA 2O93L 3THMH 5KVGL 3MRCA 5FUZH 4XXDA 2YBRA 5DJAA 4RBPH 4UT7H 4NN5C 1EEZB 3C8DA 4X6DE 4ODHL 1DQLL 4WEBL 3BQUA 1NGPH 3U9PH 2ADGA 1G7QB 5DK2B 2AK1H 2AK4B 5DRZA 1WIPA 1SEQL 1AO7B 4YGAB 5T3XE 2VLKA 2XYCA 2AJ3A 3STZA 5I2IA 3ZE2F 1IC1A 2BDNH 5K9JH 4G3YL 1B0RB 2GSGB 3HZKA 4RMTA 3AY4C 1KEMH 4JFPA 5SWZB 3CDGB 1NCWL 3RGVB 1P2CB 4HUUA 1KTLB 1INDL 4HUXB 4X7TA 4FXGA 4IOIA 1F5WA 3LPGA 2BMKA 4P2OD 3INUL 4OI7A 4ISVB 4O4YL 1C08B 3IKCA 4JEGB 5LVEA 1RJCA 4ZODA 3N85H 1QKZH 1MAKA 1R24A 2FIKA 4IOFD 1OTSD 3P9LA 1PG7L 3VGEA 3KHQA 4P4KD 2ARJA 4QRSA 5TH2A 3GSXA 3MRPA 5FCUH 1IKFL 4J4PD 4ETYA 4M6NL 2HKFL 3WV0A 4HX1A 5C0CA 3ULVF 4KTEL 2WAHA 4PY7A 4MXWH 4PJIA 1CBVH 3CMOH 5CJBA 3T04D 2MCPL 4MQSB 3QXAA 4NPYA 2WIIA 2ID5A 2UYLA 1E27B 4Y2DC 4P57B 1WEJH 4NM4L 2UZYB 3MACL 3T2NH 2BXZA 2GT9B 5C0FA 1IGTB 1NC2D 2EZ0C 1IC5H 3JWOC 5HDQL 1FFPB 4EUPG 1MCLA 3TJHC 5IVXB 5CBAA 3ZDYE 4LVHC 2VISB 4JPKH 3VXRB 3ULUL 1OSPH 5KVDH 1KYOJ 3MODL 4FS0A 3HRPA 4EOWL 5LCVH 2GUOB 1T1XA 2HFEB 4M48L 1ZLWH 5BVPH 5IEKB 1KCLA 4KKNA 2G75B 4JJ5A 5TDNA 3MXWL 4MMZC 5EU7E 2B1AH 5BXFB 2VITB 3GJFK 3O8XA 2YD1A 2YWZA 4GRWB 4H0HB 5J7CC 3O3DA 2LQRA 3KYOA 1F3RB 5IROA 4NQXB 3MYJB 1HHIB 4HCRL 4WUUA 5DZLA 2F5AH 2QSVA 1O7SA 4QRUB 1IC7H 1N59B 2IPTL 3V52L 5FYJH 4YFLF 2FR4B 5DGRA 1HQ4B 5IK3A 4LGRB 3KYNA 1FCCA 3IS0X 1IAIH 4QGTA 5E6ZA 2FEDD 1G9EA 4I77H 3EOTH 1IM9D 1XF3A 1ONQB 4JQXA 4YBLC 2SEBA 2IANB 4KROB 4V1DB 4LP4A 4XP9L 3JVGA 3DMMD 1NUNB 1RY7B 4KFZC 5CJ5A 2DLIA 5K9OA 5C6PB 3WNOA 1T4KB 3BHBA 4XXCA 2VZ1A 3MFFA 4X7CC 5C7XH 1MLCA 1WIUA 3VI3F 3GKZA 4KV5F 4RQQB 2VXTH 2APFA 4D94A 4JFFA 1P9MC 1BOYA 1XIWC 1UC6A 1DQDL 5D7KD 1WBXB 4JZJC 4ZUUB 1LP9B 5ILTL 1CTOA 5CSZB 4NO5A 4XBEH 1QSFB 3ULUC 4JY4B 3VWKB 1KB5H 3VXME 3MQIA 5GZOD 4JQIH 1FNGB 1EEZA 4P5TB 4RDQF 4BZYA 3OAYK 4NUGH 1DQJA 1G7QA 5DK2A 1OAUH 3AB0C 1RUPH 2NW3B 2A77L 3SEPA 3LKOB 1AO7A 1I7UB 1NCBL 4KXZH 1AI1L 1PQZA 1RK1B 4MXVF 3RWCA 2CDFB 1B0RA 2GSGA 4Q2ZB 3O9WD 5EOCH 5HI4D 3QPQC 1EXUB 1FYTB 5IJKC 3MOQA 5SWZA 4ZS6C 2HVJB 1P2CA 1XT5A 1KTLA 5T1DL 1GIGH 3HMWL 1N6QH 1L7TH 2N7BA 4HUXA 5LGHL 3E8UL 1CXEA 5F9AC 3QDJE 2OYPA 2FX7L 4LSRL 1NCDH 2D4FA 5K59E 4N0UE 4WWKB 5D7IE 3IETB 3IDGB 3C5ZB 1VFBA 1MFEH 1A21A 2LU7A 3L3KB 3LN5B 3C9NA 4OQ1A 3OZ9L 5C09E 2R0ZL 1FN4B 1WZLA 1JNJA 3M8OH 3ME0A 4BA8A 1TZIA 2RFXA 2BSRB 1VENA 3EFDH 5D7LE 2GQHA 3AXLB 4YHNA 1I3RA 4MZ3A 4Z7OE 5E94A 5LWYH 3IFNH 3BSZL 2GTZA 1NH6A 5EUOB 1QBLH 4Z7UF 1LQSR 4P2CG 1D6VL 3GMQB 1HE7A 5DLML 4D9RE 5CEZD 5B8CC 2VKWA 4QTHB 5EUKB 2ICEA 2OCFD 5T5NG 4QKXB 1CGWA 3WXWL 3VFWB 1JZ3A 3BIBX 3CZJA 1U95B 4MA7H 5F7EL 4POZC 2P5EE 1E27A 3QO0A 4GXVH 1OTTD 1WFOA 2BCKB 4P57A 4C54A 4HH8A 5C07D 3QNZB 3W0WE 1OLLA 2GT9A 4FQHB 1IGTA 5I1KL 1FFPA 1U8QA 4MGXA 1D9KB 2VISA 2AW2A 4YHIA 3VXRA 1D5IL 1WQVT 4QWWD 2VLJE 1MHHB 4KDTC 3LKSB 5AYUH 3RGHA 3S98A 1YEFL 1XAUA 2GUOA 2WLYA 2HFEA 5IEKA 1Q8MA 5JOPE 2G75A 5CJXA 3JZ7A 1KG0B 3WHE0 4Y4FB 2KZWA 4E42B 1A4JB 2P5WB 2VQUA 3MPCA 2VITA 2WNGA 4H1LG 3QWRD 2N4IA 4UZGA 3WIFA 1ERNA 4NQXA 1FV1B 3MYJA 4JGUA 1IL1B 1Q9KB 4XPHL 4UT9L 5J06A 1HQ4A 2B4CH 4QXTB 5CZXC 2FZ3B 4C58B 4AY0A 3OXRA 1NLBL 5IMLB 3C5JB 1ONQA 4PJHA 4AYFA 4YBQC 4V1DA 2YUWA 1YJDC 5E8DH 3U1SH 5I18L 1YQVH 5I9QB 4LSSL 1VACA 3PGFH 3GI9H 4FQLL 4RQQA 2EDJA 2FYYB 2Y5TB 5FA4B 2YD5A 4LOUD 4GRWH 1MH5B 4ZUUA 1BIIB 5CSZA 2QHLA 4J23A 3HZMB 4E41B 4JY4A 3VWKA 1HNFA 3I3DA 5IV2B 1AE6H 5JXED 2HJLA 2QL1A 1ORSB 1DN2A 4AEHL 5KSAC 1FNGA 2NY1B 3VE0B 1Q72H 3VGAB 4P5TA 1JHKL 2MTPA 2VAAB 4IIQB 3RDTC 2R1WA 2YS4A 1JPSL 3IDYB 3SDDB 1KB9J 2GK2A 4KPHL 1LILA 2GSIB 3RI5F 4XNYL 2RB8A 4ALAL 4ZFOB 5IESL 1KSRA 1I7UA 3HRZB 1CVRA 2QR0B 1MCRA 3TH4T 3ZKXC 1F3DJ 3PQYE 4Q2ZA 2QQLH 1TDQA 4GLRH 1EXUA 4MDJB 3BD3A 3KPNA 1FVDB 4M1CD 4WI9A 2ZSWB 3ARGC 4R7NA 3T1WA 2FX8L 3IFLH 5FEBA 1Q9WB 3NTCH 4UV7L 1NCCH 1S78D 2B0SH 1UJTA 4QXGL 1NEZA 1T20B 2EE3A 3I6KB 3IKKA 3F7VB 4WWKA 3UTSB 5E9DB 4N8CL 2GJ6D 2OXGA 3IDGA 1ZANH 2CK0H 3C5ZA 3B9VA 4M9OA 2LAAA 5GGVL 4NQEB 1FN4A 2NY7H 1I9JH 4G9FA 4LLWB 5EZOL 4C56B 1WWAX 4JPWL 4EI5D 1BP3B 1UEMA 4HWZA 3WD5L 1JV5A 5LGKA 3AXLA 2V17L 1UWGL 3MOBH 4ZFGL 4MB5A 2NTSP 2B2XL 1QG3A 5D2NE 5HVFB 4AG4L 1B88A 3HHRB 4GFTB 3SE9L 5KSVB 4P99A 5EUOA 5C2UB 4DN4H 3WFDH 1DBKH 1YQ2A 4K7FB 2YEZB 4NZRL 3I6LE 2YPLA 4U2ZA 2OL3L 4PY8J 3HG1E 2N7AA 3VH8A 5L88L 4QTHA 5EUKA 2VIRB 4ZXBC 5JQ6H 1YNKH 4BUHA 4TN9A 5ACMA 4OIIL 2FHBA 1U95A 1LE9A 1EMTL 4XHJD 4N0FA 3LMJH 4V2BA 1M6OB 2BCKA 4PD4K 4RGNC 3O6ML 3SBWC 3QNZA 3UJTH 1CLYL 4FQHA 4XI5D 4TSBH 5DMKB 1JGEB 3VI4F 3ZYZA 1MHPH 2FO4B 5D1XD 4U1KB 4BUGA 3KYKH 3MV8E 2DL9A 1D9KA 4IRSC 2CKBB 3L3JB 4UQ2B 2Y7QB 5CIPB 2VN7A 3CFDB 4FFYH 3WHE1 3LKSA 5JOFB 5ISZB 5I8OL 4PYHA 3GNML 1GAFH 1KG0A 4FOMA 4OQTL 3MLTB 4E42A 1GGCH 1A4JA 2E9BA 2P5WA 4U3XA 1UENA 4K71C 4CN4A 5KW9L 15C8H 3VFPB 2FJHB 1FV1A 1MPAH 4EN3B 1A7QL 1IL1A 1Q9KA 4PJ8C 3DJ9A 1EBPA 3VMOA 3DRQB 3IJHB 4QXTA 3RWFA 2VR4A 5F97E 1HSBB 2YPKB 2EECA 5IMLA 3C5JA 4PRHB 3SO5A 1MCNA 1YEIL 1QQDB 4JKKA 2Z8WC 4H25B 5DWUL 1OWWA 4G5ZL 5EPMB 1Y18A 1FSKB 2AV7B 1AJ7L 1U3HD 2UUDH 1SBSL 4W81A 4CDGC 4DGYH 2FYYA 2Y5TA 3QUXD 1EJOH 5FA4A 3QUKA 3MUGB 5CILH 1O5DT 4XCNB 2PW2B 1BIIA 4NBXB 1J7VR 4K3JL 1IAMA 4E41A 1JTTA 2WBJB 1K5NB 5IV2A 3UC0H 2FBJL 1ORSA 1QZ1A 4P23D 1N5YL 5D2LB 4P59H 3JWDH 2X7LB 4RMQA 1Z0MA 4IIQA 1WBYA 1MFCL 3UTOA 4HS6B 1IGIL 1OB1A 3SDDA 2GSIA 4ZFOA 3P4OB 3HRZA 2QR0A 3AS3A 4LHQB 1JFQL 2FGWL 1U2HA 3ZSTA 3PGCA 1UJ3C 2DMBA 4YE4L 3EAKA 4UTBH 2AJSH 5LQBH 2ZCKH 4JANB 4MDJA 1QBBA 2HYMA 1HCFX 1FVDA 3RNKA 5MERA 1NSNL 1D5BB 1KTKE 4OLZH 1Q9WA 4HIJB 4JKWA 1RIUH 3A67L 2HTLC 3I6KA 3OF6D 3F7VA 2I27N 3UTSA 1QBML 3S35H 2B7DT 1N5AA 4LAJH 5IVZB 5BS0D 4P9MH 2Q8AH 1DE4B 1QOKA 4GMTH 4LLWA 5I1CL 3NCCB 4C56A 1EO5A 2E7MA 2P8PA 5LXGL 5F89B 5KZCB 8FABB 1GH7A 3TPKA 1BVLB 4PJCE 1FLTX 5E6YA 1JNLH 4FZEH 1DVFC 2RHEA 2GY5A 4MQ7B 4BZ2L 4YEFA 2EXWD 1IE5A 4GAFB 4OM1L 2DM7A 5FYLD 4OLUH 1QSVA 4ODVL 3QJHA 2OP4L 3UO1L 1L7IL 5ERWB 4Q9RL 3DROB 3NFPA 1NBVH 1LEKA 3QZWB 4M7KH 1T7YA 5C1MB 1M6OA 3O2DL 4OF8A 1HCVA 2AEQH 4JDZA 3TNNB 5DMKA 4HGMA 1JGEA 3G5VB 4QY8B 4O02L 3CDCA 2FO4A 4XPFH 4U1KA 1HK6A 2UZIL 5BOZG 3WJLA 3L3JA 2Y7QA 3MJ7B 5CIPA 1G7LB 3CFDA 3OKKB 3I2CH 5DUBA 5JOFA 4U1IA 4KJQD 4TVPL 5I1IH 4K23L 4CVWA 4RMVA 3G6DL 1IAII 3QXVA 4Y19B 1JPTH 3WIIL 3BGMB 3MLTA 4IOFC 1OTSC 2IADB 4KJWD 1G9ML 2HA1A 3F5WA 3PL6B 5GZNC 3VFPA 4Z7VB 3P30H 1A6ZA 3O41B 3QJFB 3ULVL 2I5YH 3KLSA 4J4PC 3TNMA 4EN3A 3RIFF 4L3AA 2HLAB 3OGCB 4KY1L 1J1PH 4U1LB 4HC1L 1WZ1L 1HSBA 2YPKA 1I85A 3E2HB 1Q0XH 2F5BL 5MI0B 4PRHA 2CKBH 1EBAA 3QAZB 5CIPH 1QQDA 2VDQL 4TNWF 2F58H 3VXUB 5BRZB 5I1AB 3B9DA 4JHWH 3FN9A 4QT5B 1QFWI 1JNHB 3EYFB 3KJ6H 2AV7A 1I3GH 2QQNH 1J87A 2VDRH 4RCAA 3OWEA 2C5DC 4JFFD 3Q5TA 3C60A 5J6HB 2ICWJ 3MUGA 4LDOB 2B1HH 1TENA 1TJHL 4XCNA 2PW2A 1AXTL 1HH6A 3L7FB 2MKWA 4JFEE 4KXZI 4OLYH 5K33A 2DQTL 1MRFH 3HS0A 3QUYD 4PRBB 3T77B 4L8BB 3U2SB 1MJUH 4M7ZC 2BX5A 5GIRA 4JFDB 4HS6A 4MD5A 3V7AG 4XMKH 1TVDA 3OGOE 5GPRA 3ULVC 5KANI 3P4OA 4RRPG 5CHNB 4LGSB 4HFUL 4U49A 1CR9H 5C71A 3E6FB 2R0WL 2FEDC 4MVBD 5TE7H 1PY4A 1XGTA 4GMSL 4J3VA 3VD9A 5JPNB 4JANA 3RY6C 1PZUB 4OFPA 3U0TB 4NN6C 1FG9C 2XTJC 3DMMC 2HG5B 5CD5D 5DEGB 1NGYA 4XAKE 4HIJA 2ORBL 5IVXF 3LQAC 3SDAD 4FRWA 5IVZA 3D6GA 2XZCH 4WCYH 4NQDD 1MCPH 5GS0L 1F4YL 1DE4A 1RUKH 4JZOB 4XCEB 5B39G 3FN3A 3BKYH 2VL4A 1PBYA 5F89A 1A7PL 4GRWF 4ODXB 8FABA 4YUEL 3VCLA 1BVLA 3RZWA 3VXPB 4QNPE 3NABH 3QCVH 5FXCH 4NHUB 5D6DA 3PV6A 4MQ7A 2HFGL 1AKJA 2IGFH 3HE6D 1M1SA 4XVUD 5E4EC 1DZBA 1EDQA 2AJUH 4HH9B 3BO8A 5ADPL 5J6GB 3WJJA 5JW5B 4K3DH 2EE2A 4PJHF 4LCUB 5EA0H 5EU3B 5ERWA 3O9WC 5HI4C 3DROA 4HIEB 4JRXE 3VGGA 3QZWA 5EO0B 4AT6A 5KG9A 3S4SB 4NUJB 4P3DB 4PRPD 3TNNA 1V3KA 4G8IB 4LLUB 4WHTB 1JF6A 3LRSB 3EFFA 1G0DA 4HK3N 3MV7A 3UPRB 2JELL 1G7LA 3OKKA 4WU5B 5J13B 3QHZH 3RTQC 2WWMD 2CQVA 3SDYH 4MB3A 3BD4A 4JN1H 4Y19A 3IYLW 3MUZ1 3BGMA 3ZKQD 1TVHB 3PL6A 4G6ML 4BQ9A 2V6HA 4HW6A 4Z7VA 3T2OA 3QJFA 5HVHB 3TGXA 2AEPL 1F42A 2R9HD 2QSTA 5DGQA 2OR8A 2HLAA 3BIKA 3FQTB 4FFWD 3RVVD 2VJXA 3OGCA 3BH9A 1BIHA 3OB8A 3HMXL 4U1LA 5AUMA 3WBDA 4Y1AB 4LEXH 4HG4K 3SOBH 4U6XB 4X8JB 4R2GC 5D96C 1H9VA 4TRPH 5HYSG 3VFUB 2GK0B 2FB4L 4WFGE 2GTWB 1EFXB 3QFJB 5DZNA 5BRZA 3CPLB 3HC3H 5BV7B 5I1AA 4S11A 4EDWL 1KELL 3B9AA 1FNSL 2NLJB 1JNHA 3EYFA 1ZT4B 4NQCA 2Q86B 4L4VD 5GGQL 2BY3A 4FFZH 5F88B 5GJSL 4LMQI 4PUBL 4H0IA 5JOEA 2APVA 3P4NB 3O81A 1S8DB 4RFNC 2VDOL 2DS4A 4QWWC 1JPFB 2BZDA 2HWZL 3D1MC 1IEBA 1RU9L 3GM0A 4HWEH 3VWKD 4HKBB 4LASL 3L7FA 4O5LH 1S3KL 4WV1C 1RFDH 4G9DA 4PLKD 1MQKL 3OAZK 5C2BL 4F9LC 5C92A 3MSPA 4OFVA 4DKEL 3T77A 5AYQA 1NBYB 4FQPA 4L8BA 1P4BL 1AQDA 3U2SA 5HBBA 1G6RL 2IFFL 3PWJB 3MROB 5EUOF 2VLME 3NIDE 4KGJA 4PRAB 4MQTB 4R26L 5HXMA 1LDPH 1G6VK 3G5ZB 4X6CE 5FYKH 4UV4L 2EDKA 4Y5XB 3L5XL 5HTSA 2XPGB 3LEYH 1RURH 3E6FA 3S5LB 1HQRB 4JKMA 2BK8A 5FGBA 4P4RB 5E70A 4HKJA 3OKNB 1QFUH 1BBJB 3U0TA 5B3NA 3VWJA 2HG5A 4WUKL 5LKNA 1CDUA 5FHAL 4YX2L 3T3ME 1S7XA 4MYWB 4WY7H 3O4LB 5GRJL 3DYOA 4TULH 2Z35A 1FFNB 3RY4A 4LOUC 2HTKC 5EULV 2CIKB 4ZYKB 2NY3C 9CGTA 1CGXA 1UWXH 1L0QA 5GISH 4G9FD 4QOKD 2HFFB 4G80B 1NLDH 4JZOA 4XCEA 5FGCE 4S2SB 5L0QB 3RU8H 3JV0A 3ISWA 1URLA 5DJ8B 2MWCA 2YUXA 4LHUB 4Y5YA 3V4VL 4ODXA 2X09A 5GS2H 4DQOH 2DBJA 4HXBH 5CMAB 5IM7B 1MNUL 1DR9A 2NXYC 4UUJA 2YPLD 3B9EA 3SQOL 3QISA 4ELMB 5J6GA 2VZUA 5E1HB 2DWEB 1I7TB 5ITBL 4LCUA 5EU3A 1DEEB 2R29H 2WBKA 4HIEA 5GGVY 1U91B 4B41A 2VXSL 4RFEB 2DJUA 5HDLA 4U05A 3S4SA 4NUJA 4P3DA 1OAYL 3KPSA 1F6FB 3IU4H 4NM8L 2MCG1 4G8IA 2Y07L 1S78C 4LLUA 2EDTA 1MCQA 2VDKH 4CVZB 4OD1L 1HXMB 3GHEL 3CXHK 3UPRA 5T3ZH 3QBTB 1J8HB 3KG5A 3ARED 4N68A 4M5ZL 1MIEL 3CFCL 4PBWD 3HR6A 1KCSH 4YZFF 3EDKA 3PDOB 4LU5L 1QRNB 3MRLB 5L8JB 1PEWA 3OHXB 1X5KA 1TVHA 1NMAL 2HH0L 1A9BB 4D0BB 3THML 2IC2A 5FUZL 1Q0YH 4ZNEA 3OKMB 3CFJA 2XWTA 1BGXH 3U7WH 5I19H 1KCVH 2XN9B 4M6OH 3RWEB 4X9BA 1NGPL 3ARPA 2D7NA 4U6XA 2IBZY 3CK0H 3BFOA 4X8JA 1U3JA 3HPLB 2ATPA 1RIHH 2G60H 2GK0A 3U4BH 4X80H 2GTWA 1EFXA 5GQBA 1MOEA 3QFJA 3CPLA 2DLFH 2NNAB 3O3AB 3UAJD 1HDMB 2BDNL 4Y4KB 5K9JL 2NLJA 1ZT4A 4NFCA 4XI5C 3UTTE 5HHQB 3WNLA 1FVEB 3V7MA 3P4NA 1L4IA 4CU8A 1S8DA 2ZWLT 5HHMD 5ENWB 5EN2A 1JPFA 4CMMB 1AR1D 4MNQE 5GGRY 4RGNE 2NTFB 2DQUH 4JREC 1OP5H 1XZ0A 5DUPL 4LRNH 4YEEA 1NBYA 2ZCHL 3GIZH 3N85L 3QRFM 4HWBA 3PWJA 3AS2A 5ACLA 5DK0B 4KI5D 5BV7H 1MCHA 4JR9H 4WO4D 5FCUL 5DHXB 4ONHA 4XGZA 4Y5XA 4P2QD 2XPGA 1DDHB 3S5LA 1A8JH 3FN0H 4P4RA 5A1AA 4MJ5B 3BEVB 4MXWL 1BBJA 3EO1B 4YHOH 5HHOB 4ODTH 1T0MB 3O4OB 4TPRH 3AC0A 4NO0D 3KYMB 3GJFB 2D0FA 3BN3B 4JRYB 1IQDB 4WFEE 4WWID 1JWMB 3O4LA 1WEJL 2H6PB 3T2NL 1MIMH 1FFNA 4X5LA 4HGKC 4MB4A 4ZYKA 5IGXH 3PWPD 2R2HB 5FM5O 1REIA 5A2LH 4HWBH 4Y7MA 2VABA 4EBQH 2OQJB 3A6OA 3SGEH 4G80A 4MS8C 3OB0K 4JPKL 4WEUD 1OSPL 2ESVD 2XWJB 3QUMA 3H7BB 4S2SA 5C6WH 1QA9B 3RIAF 2V2TA 5DJ8A 1A0QL 4S1DD 3SKOB 4OZIE 3NCFB 2YRPA 5BVPL 5A3ID 5IOPB 4I13B 3T0DA 3BQUC 2YRZA 3LH2H 5CMAA 1BVZA 1W8OA 2B1AL 2XRAH 5E8OA 3DV6A 3CFEA 2F15A 4PP2A 1LK3H 3BT2H 1CF8L 1V05A 1QSEB 2NY6D 5C3LD 1T89A 4LLYB 2O5ZH 2F5AL 4HV8B 4GBXA 4PJAE 1AXSB 3S37X 4UINH 5F6IC 2D7QA 4NJ9H 5FYJL 1DEEA 2C1OB 1IAIL 4RFEA 3TBTB 1WWCA 3TBYB 4I77L 3EOTL 5FOBB 4PJGE 3S6CA 1MVUB 4Q58C 3QUMH 1K4CB 3HNVH 4YHZH 1RAMA 1BQUA 4Y16B 2X2YA 4IJ3C 1Z9MA 1HXMA 2H2PD 3QXWA 1YY8B 4HMEA 5C7XL 2XIDA 3KPPB 2EEAA 3UBXB 4JY5H 1CLCA 1KTDA 2ZUUA 1KJ3H 3PDOA 3VXSE 3BPNB 2ZP0T 3MRLA 5D2LF 4UNUA 3OHXA 4XBEL 1INEH 2DB8A 1PLGH 2EH7H 3D39B 3TZVB 1KB5L 4D0BA 1QFWL 3EYOB 4JQIL 3L3HB 1I9IH 3OKMA 5KN5B 2XN9A 3RWEA 3D48R 1J0HA 3EOBB 5F3BB 2LE9A 1QO3A 2OJZH 4A2MA 2HLFC 3HPLA 1XCTB 1NUGA 1HKFA 4LKXA 5FB8B 4APQA 4N8PA 3FOMB 3SJVA 5JIKA 4CKVX 4WFHD 3FQNB 4NDMB 2NNAA 1HDMA 4Y4KA 5MEOB 5EIQA 1UA6H 4OZHE 3M17B 5EOCL 4NKIH 1B2WL 4B53A 3ARWA 4U4BA 4YGVB 3BP5A 4I5BB 5HHQA 4OFYA 1FVEA 1J0YA 3C60D 1GIGL 1P5UA 5E5RB 4RA0C 4ZQKB 3QEQA 3AUVA 3X17A 4JO2L 4XNZC 4P2RA 4CMMA 1NCDL 1SJXA 5JO5B 2MOVA 3FFCD 1VEMA 2NTFA 1J0JA 1MFEL 4JN2A 3H9SD 5FM8A 2B39A 3O8XC 4WHYG 3M8OL 3FJTA 5FDYA 4KJWC 2J8OA 3X3FH 3TN0B 1MRDH 1ORQB 2NXZD 1CFNA 3QNXA 4CAGA 5ICXB 4YDKH 1I9EA 3EFDL 4KZDH 5D1ZD 5DK0A 3PWNA 4N9GA 4YJZL 5HGHB 4RAUB 5LWYL 4FP8H 3EJYD 1QBLL 1DDHA 4OCYH 5C0RH 5IIEB 4Q6IB 1KENH 4ETQB 3ZKSD 4JQXC 5DJ2B 4MJ5A 3BEVA 4MLIA 1WCBA 5M94B 2P43B 3EO1A 4X6EB 4LBEA 5HHOA 4JVWA 2IH1A 5FUCE 3DX8B 3ZHKA 4OUOA 1B9ZA 2MHAA 1CDGA 2PYED 3GJFA 3GSUB 4JRYA 5CSGA 1IQDA 1ZV5A 1JWMA 4M3JA 2H6PA 4XVJL 1KULA 3UPAA 4G43A 1OARH 4QRPB 1DL7H 1KN2H 3MLUH 1EPFA 1AFVH 2OQJA 3LDBC 1JN6B 4MSWB 5IMKB 2JCCE 1ZK9A 4GRMA 4OCRH 2XWJA 3BDXA 3H7BA 4H5SB 5AYUL 3SKOA 4FNLL 3QULB 5D70H 4OZFB 3BWAB 4HEME 4Z7VF 5IOPA 5FDWB 1ZAGA 1WF5A 1VEPA 1EFQA 3MRNB 1AKJD 3MGTB 3PHOB 1P7HL 1ZLUK 1OAXH 1QSEA 4LLYA 3VXNB 4HV8A 4O2EB 3GJFH 3QR2A 1AXSA 1IEAB 4QCIB 5ALBH 3VG9C 2W07A 4JB9H 2XA3A 4MVBC 3UX9B 1JGVH 1DBJH 4ZAKB 4ZUTB 1FNEB 4PGCB 1G9NL 2B4CL 2NZ9D 2C1OA 4IRJB 3MCKB 2AJVH 4WJ5B 4YO0A 3NIFF 4WTWA 3TBTA 3FO2B 5KJRH 3RVTD 5CD5C 3DX9B 1T03H 5C9JB 5FOBA 5I0ZA 1EO8L 1FIEA 2BOCA 1ZHBB 1HINH 1K4CA 2MPAL 4Y16A 5E8DL 5F9OH 4KZEL 3CH8A 4RGOH 1YC8A 1YQVL 3MV7D 3S7GA 3SDAC 1V3MA 1YY8A 1MLBB 3H0TB 2IAMB 5D71L 1CYGA 2OR9H 3MA9L 2VL5B 1H3XA 4DAGH 4DUXA 3TYGH 5HHVH 2UWEE 1BEYH 4GKZB 2VR5A 4OLXH 5GSVA 4H1LB 5SX5K 3NH7L 4KQ3H 5D7KE 4YWGH 2IWGA 3BRFA 2Y4SA 4L3EB 2MQCA 1Q72L 3L3HA 5DA4A 5KN5A 3OKEB 4NRXB 4XVUC 5F7FA 2ZOKB 4PTUB 2X70B 3MRKB 1P6AB 2LV4A 3V95A 5IVNA 4ZUWA 3ARZA 1ZEAH 1S7TB 3OAYH 1C12B 3FOMA 4LLAA 4NZUH 1OAZL 4NDMA 1LO3H 4NQCD 3C2AH 2Q8BH 3PGDB 5FYKD 3M17A 4MD4B 2B4CC 1FCGA 1IGCH 4KC3B 4OBRA 5E8NB 5IB1B 4X7EC 4YGVA 5D4QA 1HIMH 4YC2C 2HP4A 3IFLL 4U6YB 4ZQKA 3G6JE 4HIIB 3KLDA 3NTCL 4NWTH 1NCCL 1FAKT 1JNNH 5IEHA 4EIZC 5JO5A 3P4MB 3UZVB 1P4IH 3I02B 3QIWB 1BBDH 1J1OL 5CJXC 3U6RB 2YXMA 4FG6D 4CMHB 3R4DA 5D6CB 4FQ1H 3VI3E 1IC4H 1V3LA 1YA5A 4HBQA 1FIGH 4HUNB 1ORQA 5GSRB 1LMKA 4Z77B 3STBA 3P9WB 1CQYA 5IHZB 3MOBL 2R9HC 3T09A 4FFWC 4KHTH 1BF2A 4KUCD 3LIZL 4RAUA 3LRHA 3FB6B 5HGHA 5JW4N 4RGMC 5GS2D 3WFDL 1DBKL 3U83A 2P45B 4M62H 5IIEA 4Q6IA 1VADB 4ETQA 1QR1B 2VWEC 1FO0L 5JQ6L 2DLHA 3NN8B 3VWJD 4X6EA 2X9WA 1YNKL 4PB0H 5CEZE 3RJQB 2HKHH 2DMCA 2AI0H 3D2UD 3GSUA 1A7OL 5DJZB 3LMJL 3UJTL 4QRPA 3QUZB 4TSBL 5CP7B 1MHPL 4IHOB 3C6LB 3BH8B 4YHYC 2XI9A 3KYKL 5GGSY 4MSWA 2Z4QB 1JN6A 5IMKA 5C07E 3VWKC 1GGBH 3SCMB 4PLKC 4FFYL 5A2KH 1ZA6B 4OZFA 1S7WB 4CADA 1LEIB 5FDWA 1P84J 1UH4A 1INQA 5IUSA 3CUPB 3MRNA 5HYQA 3MGTA 4J8RB 3PHOA 5TQ0L 3HI5H 2ZG3A 2E3VA 4DKFH 1HWHB 1UH2A 5DI8B 5HGBB 15C8L 3RBSA 1LNUA 3VXNA 2CO6B 2XZQH 4O2EA 4GQ9H 4QCIA 1IEAA 3MRIB 2YKLH 4PJXE 1UACL 3Q6FB 3ETBF 4ZAKA 4ZUTA 1FNEA 4PGCA 2DBLH 2A73A 2V2WA 4HQQH 4IRJA 4EQ2A 1TNNA 3MCKA 3NFSH 4WJ5A 1DLFH 3RAJH 4Z7UE 3DX9A 3KPSD 4TSAH 5C9JA 4PG9B 4K9EH 3MTRA 4WWKC 5DD6A 3ARDB 1Z3GL 4OZFH 2J4WH 5CEYA 1MLBA 3H0TA 2IAMA 5KVFH 1P4LA 1F4XH 4DGYL 2NCMA 1TPXB 1E4WH 1EJOL 2VL5A 1RMFH 3QEGH 3AGVA 4GKZA 3I75A 2DQJH 2EO1A 4KKCD 2YD9A 1G7PB 4MA3B 4MZ2A 1BLNB 5DR5L 3ZLQC 3ESUF 5JW3H 1OGAE 1S7RB 3ARRA 3OKEA 4TTGA 4NRXA 3JWDL 2V5RA 3QXDB 1Q1JH 2WBWB 2ZOKA 4PTUA 3V6OA 2OR7A 3MRKA 4ZTPH 3DOSA 5I74B 2YPVH 1JRHI 1GHFH 4Q9QL 5TE4H 1S7TA 1C12A 5ELIA 3VD7A 1VEOA 3WFEH 3PGDA 4UTBL 3BDYH 2E6JA 4MD4A 2AJSL 2UZXB 4PYGA 5LQBL 1N4XH 5E8NA 4U1GC 5IB1A 3SDCD 1K3IA 4WI4A 3NFNB 3HC0A 3VFSB 3MO1B 3DO7A 1NCTA 4HIIA 4HK0B 3AREC 5EBWB 5EBLB 1PVHA 1RIUL 5DURD 4B7IA 5HY9A 3P4MA 3I02A 3QIWA 4MCYB 3S35L 1CD1B 3U6RA 1L0XA 4P9ML 1A64A 5D6CA 5E1AB 2QEJA 2Q8AL 1NGWB 4HLZG 3K46A 2GJ6E 3NA9L 1XEDA 4M7JL 4R4NC 5GSRA 4NKOB 5E08L 1NGZB 4L8SB 5CZKA 4ZFOL 5IHZA 1YMMB 4OSUH 3FB6A 4BQ6A 3GK8H 3JWDC 3SE3A 4PJ9A 1CE1L 2Z8SA 1TTFA 1A1MB 1WAAA 1ZVYA 3LOWA 1T5WB 3C8KB 1QR1A 1C5CH 1WBZA 1KIRB 3SGEI 3W81A 3ABZA 3BMVA 4YBHA 3KPOA 2DI8A 5I9QC 4YDIH 2J5LB 4RAVB 3PWUB 3CNKA 5EC2B 4L4TD 5DJZA 4Q7DA 2RGSA 2NY2B 4FXLA 4LRIA 2AEQL 1RJLB 1TQCB 4FQQB 4F80A 2PCPB 5CP7A 4IHOA 4W68A 3BH8A 3SKNB 1OLZA 1AR1C 3IAQA 5SWSB 3SCMA 3VFMB 2AQ2A 4PRID 3I2CL 5E5UB 5EU6D 4P49A 3VGAC 4H20L 3QDGB 1S7WA 5I1IL 4PP1C 2EIDA 4IIQC 5ANMB 1I75A 1JPTL 3VFTB 3CUPA 2ZKHH 3IDYC 3SDDC 1M7DB 4KI5C 5HGBA 5J3HD 3MBED 1A47A 3P30L 3JWNC 5EWIH 2I5YL 4LVNB 4GBXD 1UCTA 4NCDA 3DGCR 3TT1H 5I1HH 5T1MA 4OGAD 5EH1A 1T2XA 3Q6FA 4PJDE 1NC4B 1KPUB 1GL4B 1J1PL 2RBLA 4KRNA 4QXUH 3NZ8B 4WEBH 1Q0XL 4MJIB 1NDMB 2CKBL 4PG9A 4Y4HB 1Z2KA 3ORJA 1IJ9A 5KBNC 5KSBE 2PF6A 2R4SH 4JHWL 5DTFA 4JG1H 3ARDA 4MHHG 2NW2A 1SEQH 1UYWH 2R56H 4NQSB 2CUIA 4GG8B 2VDRL 3CFKA 5F8QC 2Z92B 2X4RB 4JVPA 2B5IB 1J0ZA 1DBML 3L3GA 2B1HL 4UAOC 3MFGB 1G7PA 1EHXA 2OTPA 3ARUA 4MA3A 1INDH 1V3JA 3GSRB 5A3IC 2CDGA 1YEKL 4YIQB 4ELKA 1OP3K 3TIDB 1AP2B 4OLYL 3UEZA 2DTSA 4W6YB 1U8MB 1YPZE 4GAGL 2BVEA 1MRFL 1S7RA 4OLEA 2WSKA 4M7LT 1F4WH 2XN9D 3W39A 1KCUH 1KYOK 3INUH 3QXDA 1IFHH 2YD6A 1MJUL 1YN7B 2NY6C 1BD2B 2R2CA 1X5GA 1PKQA 4XMKL 2CR6A 4Z7NF 1G0XA 4M61B 4APQD 1S9XB 3SJVD 1WTLA 1JWUA 1CR9L 5JUEH 5MEPB 1IKFH 1FORH 4XMLH 2HKFH 2NY0D 1S5IH 3W11D 2QADD 3WJLC 3VFSA 2C26A 2AXFA 3DURA 3QEQD 4TYUA 4E5XB 3QA3B 3BPLB 4UB0L 2P5ED 4P2RD 5DVNA 5EBLA 5EBWA 5GRWA 1CL7H 3LKPB 4WW1B 1LEGB 1CD1A 1U9KA 3F7PC 2XZCL 1MCPL 4M3KB 5E1AA 1XCQB 3SDXB 4HIHB 1GZPA 1NGWA 2OXHA 1X7QB 2F54B 1RUKL 1Y6MR 2R0LH 2E7HA 2KZ1B 4GKSB 5KVEH 5BS0E 4NKOA 5KAQF 1NGZA 4QHKI 4ACPA 1GOGA 3JSSA 4EN3C 4JRWA 5B38G 4IMLB 4MLSA 3B5HA 3QCVL 2YK1H 4EOWH 1CDYA 1YEDB 2IGFL 1I85C 3MNVB 2J8HA 2VQTA 2AJUL 1A1MA 2Q7YB 5M7QA 3BE1L 3OL2A 1T5WA 3C8KA 1ZS8B 1ULVA 2YMXL 1R3HA 2HN7B 5C0CE 4K3DL 4Y8DC 35C8H 4G8GB 3PWUA 5F7LB 1TLKA 3P9MB 4LPCA 4WDIA 5EC2A 5FYLE 2PW1B 4PJIE 2WK2A 2VYRE 5L2KD 3C60C 4OF3A 1RJLA 2PCPA 2OK0H 1F58L 5B39B 2XWBB 4D0DA 1D6EB 4F33A 1PSKH 3QB7C 1M05A 3O3BA 3QHZL 1H8SA 2VMFA 3N1QC 5T1LD 3SDYL 2XTLA 5ANMA 2PTUA 4AH2B 1ZVHA 4JN1L 2NXZC 3VFTA 1TJIH 2WUCH 4XTRC 3PDDA 5C0BB 5F1NB 32C2B 1IQWH 4NBZB 1DQDH 1M7DA 5F9WB 4M5YL 3V0WH 3LZFL 3VXTB 5ILTH 2GFBB 3V2AR 1T1ZB 5BZWB 4OT1L 3T0EB 4DTGL 5IQ7H 1NC4A 3N1FC 4WUUE 1N2RB 1Q94B 4LEXL 5TPWL 2FSEB 1NDMA 4MJIA 4X98B 3X13B 2D03H 4Y4HA 4F58H 1CGSH 3L95B 1HKLH 3HC3L 2EYTB 4PJBA 4FFZL 1NCBH 1F6AA 4XBGB 2X4RA 1AI1H 5B3JE 3CVHB 3L3OB 1UADC 2NR6D 4XCYB 1VB9A 1X5XA 3BW9A 3CVIH 5D1QB 4JFFE 4HWEL 4ONGH 1RFDL 2B20A 2DWDA 4YIQA 5LGHH 3TIDA 3E8UH 3TBSB 1AP2A 5D6DC 3WO4C 2FX7H 4LSRH 3UBXI 2EIZB 1FZKA 3ET9F 4JFQB 2AQ1A 1LO2L 3OZ9H 4N0CD 1TZGH 2R0ZH 4D0CB 3RVWC 3WJJC 2LFGA 4Y2OA 1BD2A 3Q2CA 1LDPL 1UCBL 4M61A 1HI6A 3H2WA 2DQEH 3SGJA 4BSVB 5IMOB 3SGKA 3ZT5A 1JCKA 2DKUA 5DFWH 2NZ9C 3LEYL 1RURL 1TCRB 4PGBB 2CMRL 2WQRA 4PG2A 1Q9LB 3I6LD 3MJGX 4OZGE 1QFUL 4ZOEA 4XHQA 4LK4A 5DLMH 2QBWA 3ZTJG 4YHPB 4E5XA 3QA3A 2OI9B 5LG1A 1AGEB 1PKOA 4WY7L 3LKPA 1ZHLB 2XKUA 4FN0A 5JR1H 4QTIL 3D3VD 4WW1A 1F6LL 1YYML 3CZFB 2NY5H 1QEWB 3E0GA 5DK3A 4ZOBA 5F7EH 1XCQA 3SDXA 5GISL 3MV8D 4HUVB 1SMOA 1OTUC 1OQOA 2FX9H 3UXFA 1NLDL 3PL6C 3RWIB 3D0VA 4LDLB 3NCYS 3VRIB 3RU8L 3DETC 1VGKB 3VGHA 5FHBL 1PDKA 1RIVH 4IMLA 3QQ3B 2C7UB 3B2UD 1D5IH 1VKXB 4DQOL 4HXBL 3HI1B 4XBPA 5C0EA 2PR4H 1YEFH 1YEDA 3MNVA 3E2HC 4I0PB 1MCOL 5MI0C 5EB9A 3UTQB 4NKDB 1ZS8A 4KRPD 3FFDB 4MAYB 4JLRB 1ZWIA 2VAJA 3QDHA 2HN7A 1C7TA 3PHQB 4DZBA 4G8GA 3PNWA 1FC2D 2J88L 2DYPD 4XP6H 2R29L 1CCZA 1KB9K 2PW1A 1TETH 1YEEL 1QYGL 4XPHH 3QCUL 3FT3B 3B9KB 3IU4L 1C5BL 2A9NH 3N50A 4C4KO 2VDKL 5E95B 4BSJA 1YEHH 3BKCH 1X9QA 5EOTB 4MD0B 4PFEA 2IMMA 2XWBA 1D6EA 5T3ZL 4PRPE 3SKMB 4FG6C 5HYJD 4R7DB 4HZLB 5I18H 3A0OA 1BWMA 1KCSL 4XP1H 4AH2A 5ID0B 1E4KA 3P4LA 3QHTC 3U0WL 4Q9CA 5C0BA 5F1NA 2JTDA 32C2A 3VXMB 2EIBA 2DM4A 5D7JB 3VXTA 2Y5EA 2GFBA 3Q48A 1RULH 2XXMB 1T1ZA 4RMRA 5BZWA 3S9DB 1KCRH 1BGXL 3T0EA 3U7WL 5I19L 5FGBC 1KCVL 4M6OL 2V9TA 2FECI 1CE6A 1CTNA 1N2RA 1Q94A 5KVMC 3MJ9L 3CK0L 1JHKH 3VWJC 3X13A 5JNYB 3D5OF 1RIHL 5F21B 2G60L 3U4BL 3AU1B 1KV3A 1UZ6F 4W70A 1JPSH 3L95A 1JWSA 4LPXA 2DLFL 3DIFA 4ODSL 4PJHE 1RZKH 2E9WA 3SE4A 4ALAH 1IMHC 2VWEE 4NO3A 5HVGB 1FZMB 1DBBH 1T80A 3FB5B 3LS5L 4XBGA 4FFVD 2HT3D 4AZ8A 3CVHA 4RMUA 3L3OA 4L4VE 4XCYA 5ESVB 1JRHL 4N0UB 2PXYB 4Y5YC 2ILLA 5JA9A 5D7IB 3LY6A 1LD9B 1SVCP 1AY1L 3TBSA 1NUDA 4UV7H 5C09B 1X5YA 1J9CT 1WIOA 2OLDA 3R1GH 1DBAH 4BQBA 4LRNL 2EIZA 1KPRB 1J1XH 3KS0J 3WFBH 2I60H 4R96B 3NA4A 3OAZH 4D0CA 1HN1A 1B4JH 3F6LA 5SX4I 4PJ7B 1KIQA 5D7LB 3RVUC 5I1JH 5BV7L 3O6KL 1JZ7A 4OGZA 1WAAF 1I7RB 4JR9L 1QFPA 5IMOA 2P46B 5L9DH 3TF7C 4ZSOA 4PGBA 2ZUVA 2ADJA 2FJGB 1F11B 1RZJL 3CVHH 1C5DA 1VFAB 2C3VB 3G08B 3HLAB 4YHOL 2OSLB 2PUQT 4NZRH 4ODTL 5JHDD 4YHPA 3L5WB 1NFIB 5JIPA 4TPRL 3CCHA 2WW8A 1Z9SA 5J13C 1AGEA 4QHMA 3CSPA 5JLZB 3W0WB 5JXAL 1MIML 2IEPA 3E3QC 1F00I 1EUTA 1LVEA 1EMTH 1A7NL 1QEWA 3GJEA 3CSYA 4XRCA 5IGXL 4OTXL 4KKCC 3WXVH 5SWQA 4EBQL 3QWOB 4HUVA 3HCVA 1CLYH 4NKMB 3IDMA 2VLJB 1Y0LB 3MV9D 3WFHB 2P42B 4M6MH 4G9FE 3T1FA 4ZTOL 5DC4B 3RX7A 5DVMA 4N5ED 2C7UA 1VKXA 2XXCB 3LKRA 3LQZB 3ZE1F 3DECA 1MFDL 4PJ9D 2XRAL 1SQ2N 1CGTA 4S1RH 2ZNXA 3GNMH 4I0PA 3BT2L 3GSWB 3UTQA 4NKDA 1S9KC 5IHLB 2O5ZL 5BV7C 3FFDA 4MAYA 5EUOE 1WZKA 2ZNWA 5DMGC 3PHQA 1I8LA 4NJ9L 2YPLE 2FH8A 4NCC1 1F13A 5FYJU 1FNAA 1A7QH 5IB4B 1XF5B 4NWUL 5DJXA 1M7XA 3V5HB 3VFRB 3FT3A 3TO4B 1OP9A 3HAEB 1XGYH 3HNVL 4YHZL 2BP3A 4BFEA 5C0AB 5EOTA 4MD0A 5F7NC 3REWB 1TJGL 2XY2A 3SKMA 1A3RH 4R7DA 4HZLA 4JY5L 5D5MB 1AJ7H 1KJ3L 3ZDXF 4JM4H 5ID0A 5JW4R 4HHAB 3RY5A 1INEL 2EDFA 2W65B 1NFDA 2C4FT 4G6FD 3WDHA 4PRNB 1GVIA 1X4ZA 4Y5XC 4ZG1A 4ZUSB 5HJ3B 1I9IL 3FHAA 4LCWA 1ZXQA 2FBJH 2ZUQB 2YA0A 1CS6A 2OJZL 3U79A 4BKLA 1OF2A 1NCUA 3OJMB 3O2WH 1MFCH 3AU1A 3BESR 3R06B 4KJPC 5DFVD 3WUWG 2P8LA 1IGIH 3PQYB 3ARDD 4LQFH 3FB8B 3MRQB 1FZMA 3FB5A 4HPOH 3VRLE 3QNYB 2FGWH 3SGDI 3GZKA 1RD6A 1WTGT 1T0PB 5L0QC 5ESVA 1ACYH 1I8MB 3NCJH 4JO4H 2PXYA 4MJ2A 4N0UA 1NSNH 1LD9A 2Z8RA 4P46A 1A6UL 1F3JA 4HK3J 1RUAL 5FK9B 3RZCB 4L3CB 1A5FH 1Q9OB 2A6IB 5HHME 4WFFD 3EJZD 4E41E 5DQDL 2IH3A 4NHCH 3NCMA 2DLEA 1KPRA 4R96A 3X3FL 5ACZB 1T89C 3DYMA 4PJ7A 2BERA 2MKLC 4GBXC 4YDKL 2H26B 3G04B 1QSZA 5I1CH 3RX8A 4OGAC 5D2NB 4DCQB 2I9LA 1I7RA 1FH5L 2E6PA 4WTZG 1VESA 4LARH 5JIHA 3HC4H 4FP8L 3ULUD 4XWOC 3QEUB 3EDEA 4KI5E 4OCYL 5C0RL 1F11A 1KENL 4R90H 3HG1B 2EDYA 2G2RB 1VFAA 2C3VA 4P2QE 3QQ9D 5FF6A 5IBLD 3IS1X 2OSLA 3BZ4B 3VFOA 3L5WA 1NFIA 1E28B 2NZIA 4PGEA 1FQ9C 1EJ6A 4ODVH 1JHLL 5JLZA 4JM2D 2XQBH 3UO1H 4JKLA 1NPUA 3T8XB 4HUWB 4F2MB 4DN3L 1DL7L 1KN2L 1GRWA 3MLUL 3UTSE 1Z5LB 1AFVL 3QWOA 3ARFA 4NKMA 3MLSH 2E7LA 4OCRL 2VLJA 1Y0LA 4OF7A 3PWPE 5D70L 1K8IB 2W91A 2R0KH 3OB0H 2P24B 1CWVA 5FV1L 3LQZA 4UOW0 1CFTB 5TDOB 4G6JH 3F8UB 2D4DA 3O11B 4TVPH 2QHRH 4G8EB 1YEJL 4Y89A 1OAXL 3JV6B 5ALCL 2E5EA 1XMWA 2A83B 3VA2C 3GSWA 4APQC 3WN5C 5ALBL 3D85A 4BYHA 3DVIA 4JB9L 4X4YB 1X5IA 5TFSL 1DBJL 3GB7B 2M8XA 5J1SC 1DQMH 2CIIB 2NY0C 1LE5B 2AJVL 3SO3C 3W11C 2QADC 1QP1A 2AABH 3V5HA 3VFRA 4WFGD 1WWBX 1BJ1H 2R23B 1T03L 1NKRA 4YK4C 3HAEA 1YNTB 2D31A 4CRPA 5F9OL 1K2DB 1TVBB 5C0AA 4FQJH 4RGOL 3REWA 2YN5A 3RUGA 2VDQH 3O45A 3WSQL 3BVNA 2OR9L 2XNAB 2FIRT 3MGOB 5D5MA 5CGYD 1W8NA 4DAGL 1FVCB 3TYGL 3H6JA 4GKNB 5HHVL 2PYFB 1WC7B 2GYSA 4LP5A 4OLXL 5DUML 3CXDL 2W65A 5SV3A 2GHWB 2HMIC 4YWGL 4JAMA 3T0XA 4PRNA 1VFUA 5EZIL 1RQ5A 4GRLB 2DIJA 4ZUSA 2YA1A 4GXUM 1MREL 1CD0A 4DFIA 1YUHB 2ZSVA 4YDJB 3TA3A 4XNQB 2YN3A 4RISH 4LSUH 3HAEH 4HJ0C 1ZEAL 3O4OC 2YC1A 2L0DA 3KXFB 4NSKB 2VDNH 4LNRA 1JZ4A 4NZUL 4HXAH 1LO3L 1MCKA 1QVOB 3Q6GL 3X11B 4EXKA 3C2AL 2Q8BL 1CGYA 4J3UA 1SBBA 3TLRA 5IMMA 4FQIH 4KHXH 3QNYA 1HIML 1RZFH 4MDIB 2R0WH 4WFHE 2FL5B 4KMTL 4I48B 4NWTL 3SDXF 2LTQC 5CZXD 1I8MA 1FGVL 1UM6H 2CGRH 1P4IL 4O2FB 2IG2H 5FK9A 4L3CA 4QRRA 1KEGH 2ORBH 2A6IA 1CDJA 5MEND 1KCKA 5MP6H 4OCXH 4OB5H 5CBEB 2XICA 4YFEA 4O00A 3FFCE 4MJ4A 3DX6B 2VDLL 1FIGL 3BKML 2Y6SD 3UYPA 3VD5A 1I1FA 3H9SE 2H26A 3G04A 4LCCB 2NX5A 3AS1A 5D2NA 4PJCB 1YECH 3QDMB 4KHTL 4LSTL 3W2DH 4WGWB 7CGTA 2Y25A 4FQXB 4U1JB 3QEUA 3DBXB 4M62L 1IGMH 1CXIA 3HG1A 3U7AA 4NN5B 2G2RA 1R3JB 4Y16C 2RIKA 1HHGB 2AERT 2VXQL 3C6SA 4PB0L 3BZ4A 3RDTD 3O0RH 2HKHL 1E28A 2AI0L 3K8LA 2BNRA 5BZDB 4F7MB 5L2JA 4G7VH 2C4FU 2IQ9L 3T8XA 2F74A 4HUWA 3W9DB 5IB2B 2NR6C 2PYEE 1A7BA 2Z31B 5DRNB 2R69H 4P3WA 1Z5LA 2H32B 1GGBL 2BVOB 4LKCB 4JDVB 2IBBA 3ZKND 4PR5B 3IJYA 3G5XA 5J56B 3IDIB 4R0LB 1K8IA 3VXOB 4N5UA 1MHCB 2P24A 1CFTA 3BOVA 5TDOA 5TDPB 3O11A 4G8EA 4ZUVB 4DKFL 3JV6A 2A83A 4JCLA 3G9VA 2XZQL 1T83A 4G6MH 1ZLUH 3TFKD 4K2UL 1H15B 3GB7A 1I4FB 2DBLL 2H8PB 5E8EB 5I8KH 3NFSL 1S7QB 1LE5A 1DLFL 5CWSB 4WHYH 2HJKA 4F3FB 4W6WB 4OFDA 4X5XB 4K9EL 2ITDB 1JZ2A 1T7VA 3KPRD 3LV3B 1IILE 1TVBA 2HVKB 1PG7X 2XY1A 2YRLA 3K2UH 2GITA 4LGPB 2FNBA 2X9YA 5GGSA 3IDJB 4DGIH 3DGGA 5KVFL 2FECL 4IM8A 4EDWH 3MRFA 2XNAA 3MGOA 1T1WB 1E4WL 3MV7E 3QEGL 4GKNA 2PYFA 2JIXB 1WC7A 2DQJL 2X42A 3MLRH 4JFEB 3B2UC 1W0WB 4RBPK 4GRLA 1PX3A 4XMPL 1N8ZB 4IRSD 5JPMA 4Q6IC 2DJ4A 5F3HB 1MQKH 1Q1JL 4YDJA 4XNQA 1PFCA 4KRPC 5IR1B 1VFMA 1P4BH 1GHFL 3BGAA 5TE4L 5DJ0B 3KXFA 2DICA 4NSKA 5E24E 1TZHB 2R2EB 1QVOA 3WFEL 3X11A 4JO3L 1LWRA 5BRZE 1N4XL 3NIFE 4K9EC 5J89A 1HILB 2VR9A 1LO0L 4NQCE 5FYKE 4H8WH 3K2MC 4I18A 1ZA3B 2AJXL 2V7NA 4I48A 5AZ2H 2Z93B 5JA8B 4O51A 3S36H 2ARJQ 4ZO9A 1JK8A 4V2CB 5FHAH 3BIAX 4L8DB 4O2FA 4YBLB 5IFAH 4YX2H 1BOGA 3P0GB 1U8HA 3WE6B 3FO9A 1WUNT 5CBEA 1IAKA 2ADFL 3OXSB 1NGXA 4F7TB 2J2ZA 4JPVL 5JHLH 1XIWB 4LCCA 3C8HA 3M1BB 4X9IA 4ZAKC 1IGJB 3QDMA 4OSUL 4IRJC 3GK8L 4TOYH 4FQXA 4U1JA 3DBXA 3RL1B 3BX7C 4U1NA 1DFBH 3DNKA 1C5CL 1R0AH 5IF0B 1R3JA 4MA8L 5T1KB 1HHGA 3L6FA 2FH6A 4GW1B 3SQOH 4YDIL 2ZOLA 4JHZA 2Q3ZA 5BZDA 1BHGA 1X4YA 3AB0B 5J12B 1A1NB 5IW1B 5ITBH 4F7MA 2HT3C 3V4UL 1SYVB 2F8VA 3A6BH 4JFYB 4X4XB 3W9DA 5IB2A 2Z31A 1J88A 5DRNA 1ES0B 2VXSH 1RHHA 4HEPG 1FL6A 2H32A 2BVOA 1OAYH 1QLRB 2V7HB 3PP4L 4LKCA 1A9EB 1DSFH 1L9NA 2Y07H 4PR5A 1UWEL 1AQKH 3OKOA 1ZLWK 1NFDF 1AD9B 3IDIA 4OD1H 4R0LA 3GHEH 1P7QA 1J0IA 3VXOA 8CGTA 2A74B 2H9GB 2P47B 2BHYA 1RUML 1EHLH 2ZKHL 2VZSA 2QJDA 3BUTA 3UP1A 4ZUVA 4LU5H 3EYVA 1AC6A 3HE7B 5EWIL 2R4RH 4POYA 1XGUA 3BXNB 4ZS7L 2CLZA 1K4DA 2DQHL 5KANG 3IXTB 1H15A 3KNBB 1I4FA 2H8PA 3VMPA 1FZJB 1S7QA 3GMRA 5CWSA 1T7WA 4QXUL 3ARBB 3MRGB 3BP4B 4UU9B 4X5XA 2H32H 1DVFD 2ITDA 3T0AA 1IZKA 2R4SL 1I1AB 2HVKA 3QIWC 4JG1L 4OV5B 2DI7A 4N0YH 3KPSE 4JY6B 5B8CB 4QHNB 3VU2A 4CMHC 1UKSA 1UYWL 2R56L 3WLBB 5K59F 2NYYD 3CX5J 4FZ8H 5D7IF 3ZL4L 2D0HA 1U58B 1T1WA 4HT1H 1ROWA 1KLFA 2JIXA 1GC1H 3MCLH 3O2VL 4WRLA 4DZ8B 4M1GH 4XPTH 4X9FA 2AQ3A 4JFEA 4N5EC 5F6HJ 5ICZA 2LAGB 3E3QE 1KN4L 5FM5M 1W0WA 4PJ7F 3HNTL 3SE3C 4PJ9C 3WMSA 1GPOH 4K7PL 3D0LB 4LCWD 1F4WL 2BVPB 3QIBB 1KCUL 5F3HA 5CKGA 1BFOB 1IFHL 43CAB 1TNMA 5DUPH 4RZCB 5IR1A 3VG0H 1F90L 2ZCHH 2K1MA 4AM0B 3BZFB 4X6CB 5DJ0A 3NCBB 1TZHA 2R2EA 5JUEL 5GZND 5E2VL 1P7KB 1RK0B 1FORL 4PBXA 3LVEA 4XMLL 1OD9A 5E8PB 3GSQB 1F8TH 1S5IL 4X6FA 1SM3H 3LCYA 3SCMC 1ZA3A 1CL7L 4AL8H 2BNQB 4P46D 1I8IB 4RA3A 3V5DB 4KVNL 3T08A 2Q87A 4WW2B 1UXSB 5F1IB 3WE6A 5CJQL 4PJFA 1X5LA 5HHPB 3OXSA 3RIFK 2R0LL 2WP3O 1I1RA 5KVEL 4J3WA 1XIWA 3M1BA 1II4E 3UDWA 2YK1L 1A0QH 3PIQB 4JDTH 4L29B 5IBTL 25C8L 4TNWK 1MFBH 1CXHA 3EO0A 4P2YA 3C08H 1BMGA 3RL1A 1UGNA 5E56A 1EHAA 1KNOB 3RA7H 5KSAB 4XH2A 4TVPD 5DFVC 5T1KA 2EIEA 1HHHB 3ARDC 1FBIL 35C8L 4GW1A 1CF8H 1SMAA 5I75C 4PLOB 3BJ91 1KB5A 1RUQH 5F96H 1J0KA 5GS3A 5IW1A 4HSQA 1FL5B 4BK5A 1W0VB 3ULVD 3RUGF 4JFYA 4X4XA 1MI5D 5IVOA 3TPUA 3O6FB 1ES0A 3ZKXB 4L4TE 4WNQB 2OK0L 5D5MF 3ARFD 1FPTL 3X14B 2X40A 1QLRA 2V7HA 1T6VN 1PSKL 1JYVA 5INCB 4WU7A 2XTJD 3ARGB 3EJZC 3MLVL 5FKPB 3T4AB 5GHWH 1AD9A 4LIQE 1T66D 3WNNA 2A74A 2H9GA 1MRCL 4F15B 4PJ5D 4PRIE 1TJIL 5EU6E 2WUCL 1JF1A 1IQWL 3V0WL 4HBCH 4PPTA 3HE7A 3GM8A 3MLPA 3TYFB 3D85D 5DJCA 5BCAA 3U4EA 2JK5B 1ZVSA 1B0GB 3UTPD 5IQ7L 3G6AB 1QFWH 3KNBA 1FZJA 3QQ9C 5IBLC 3ARBA 3MRGA 4UU9A 5E2WH 1A6VL 3R8QA 2D03L 4F58L 1CGSL 2F53B 4LLVB 3GHBL 1HKLL 5HHNB 3RWDB 4YDVB 2AK4A 5C0AD 2DIAA 2CJUL 1I1AA 4JM2C 4JY6A 4QHNA 3UTTB 3WLBA 4ZXBB 5I6XB 3EDFA 1BECA 1B2WH 2O5XH 5MEQB 4BQCA 5IFHH 3CVIL 3OKDB 4KMQA 4MNQB 3CDGA 3EUUA 4RGNB 4U7MA 2CR3A 1VHPA 4ONGL 4KK6C 3RGVA 3WKMH 3DWTA 1FO0B 5ESAB 3VA6A 3ZTNL 4JO2H 1FNHA 1NEZG 4UILH 1BQHB 1FP5A 3D0LA 4YHMH 2BVPA 5GRVK 3QIBA 3PP3K 2VTFA 1OP3H 3TA3D 5DDHB 5JTWA 1OY3B 1TZGL 3QCTL 4ISVA 43CAA 3RTQD 2J8UE 1C08A 4RZCA 2IBZX 5E99H 2XN9E 3P40A 4AM0A 5GS0D 4P48A 2J5LC 1CICB 1TCMA 2DQEL 4FABH 2Q1EA 4K71B 5FYKU 4RX4A 5I1EL 2H1PL 1TQCC 3W82A 3PJSB 5AZEH 1T3FB 5IG7B 1RK0A 3SHSA 3SJVE 3MR9B 2IFGA 4DK6A 4PJ8B 5E8PA 4P0DA 3GSQA 2O61B 3CSGA 1G1YA 4KK5C 3VH8G 1UG9A 4PJEE 3R0NA 4R2GD 2BNQA 1I8IA 2DQGH 3V5DA 5JR1L 2X9XA 3UYRH 5CGYC 4B50A 3K74B 3QEQE 1IAIM 4QRRD 4WW2A 2NY5L 4YH6A 1UXSA 3KPMB 4HS8H 3DVNB 3EO9L 4P2RE 3DVFA 4XVJH 1MJ7H 5HHPA 2FX9L 2J6EL 1QR4A 4ODBD 5IVXA 4OZIB 2NX5D 3LD8C 1FZOB 1RIVL 2D9CA 3MOAL 5JDJA 3PIQA 4FNLH 4L29A 2PR4L 2ITCB 2AP2A 2D7MA 3NPSC 4Y4HC 3HUJE 3N1PC 3KR3H 2XZAH 5BXFA 1SY6A 2NY4B 1QFWM 4Z6AT 5K9KB 4Z7NE 2BNRD 4AQ1B 1HHIA 4XP6L 3WDJA 4QRUA 4U6HB 2P8MB 3MX0A 1N59A 1TETL 5AG8A 1FL5A 5HHOE 5C0ND 1W0VA 2KKQA 2IPUG 3DSNA 2KQNA 3JTTB 4K94H 4PJGB 2XQYG 2BSTB 5EIIB 2OX5A 1J5OH 2FR4A 1G9NH 3O6FA 2A9NL 4IMKA 4WNQA 2EKSB 4ERSH 1FE8H 1YEHL 3BKCL 4JCMA 4I0KA 5L2KE 3X14A 2YXFA 1EO8H 4Z78B 5C0JB 2IANA 1BZ9B 2M26A 2MPAH 5BW7A 5FKPA 4KZEH 1P53A 2NY5C 3VXSB 1T4KA 2VB5A 5DVLA 1KGCD 4FTVB 4XP1L 2Y6SC 1TXKA 5D71H 3KLHC 3MA9H 5M95B 2Y9RT 1SY6H 1WBXA 3IDUA 2HTKD 3NGBB 2NY3D 1LP9A 3SGJC 2X4SB 3SGKC 1RULL 1OGAD 4ESKA 3NH7H 1QSFA 3TYFA 5DEFB 1KCRL 1YNLH 2JK5A 1B0GA 4PG2C 5F7HA 2Y36H 3G6AA 1OAQH 3HNSL 3ECBB 5LGJB 3TO2B 5A2IH 4M93C 2WLZA 2F53A 3BPLC 4LLVA 5HHNA 3RWDA 4YDVA 3PWVB 2NXYD 2NW3A 4I0CC 4OZHB 4YPJA 3LKOA 1RZKL 4ORGB 3UTTA 3J7HA 3ILPB 1DBBL 4IS6B 3DUUB 1OAZH 3ULSB 5L8LB 1RK1A 3IAGC 2CDFA 4CVXB 2XV6B 3MGAA 3BAEL 4NGHH 3ZKNC 1FYTA 3QI9D 4ODUB 3OKDA 5DHYB 4MNQA 3BYYA 2HVJA 2FD6H 1PYWB 3EOAB 3Q5YA 1T7ZA 3O6LH 1FO0A 1AH1A 5IT2H 1JYXA 1BQHA 3R1GL 1DBAL 4WTXA 3OJ2C 2O5YH 3IETA 4P2OB 1J1XL 3IDXH 3WFBL 1J1OH 3WLWD 2I60L 3L3KA 3LN5A 3QIUD 4RWYH 4ZPTB 4HKXB 5DDHA 1XGQB 1B4JL 5T3XL 5I1JL 1N6VA 4AIOA 3B5TA 1P84K 4HLJA 3S3SA 2C9AA 4IDLA 1G7MB 3TFKC 1CICA 2BSRA 5L9DL 3EKCA 3MNZB 4P4KB 4AEFA 5IG7A 3CVHL 3LIZH 3L7EB 1MCSA 1DQTA 2C3WA 2O61A 4JG0L 4N8VB 3GMQA 1FO0H 3WNPA 3GBLA 2BVYA 3U30C 4IRZL 2JJVA 4DUVA 4DGVH 3VFWA 3H3PH 1V7MH 1A7OH 3KPMA 1E4KC 3GSVB 4NT6B 5DT1L 3DVNA 3WXVL 1RPQA 1FC1A 2JCCB 4G6KH 1NC2B 3D3VE 1EA9C 4K8RH 5DVKA 4M6ML 1FDLL 1FZOA 1FRGH 3T0EC 1CXFA 3QDMD 3GFUA 1MHHA 1KIPB 4N1CA 4FQXD 4U1MB 4S1RL 1ZOXA 4L9DA 1ZTXH 3ZHLA 1S9YB 4Y4FA 3ES6B 5TQ0H 2ZUXA 3HFMH 4X99B 5C08D 5K9KA 4JHAH 3SE4C 4M7ZB 4ENED 1ZGLB 3FTGB 1AGBB 1H5BC 2WWKT 2AEWA 4U6HA 2P8MA 3EYSH 3DXAD 1UACH 1AGFB 3JTTA 2BSTA 3QT2A 1XGYL 2CLRB 2EO9A 2FZ3A 2BOBB 2EKSA 3OKLB 3TVMD 1MELA 2VC2H 1IM9B 4QRPE 4JQVA 4Z78A 1D5XB 3HI6L 1FL3B 1QRKA 2W0FB 1A3RL 3DMMB 4QGYA 3H42L 1P7QD 2AS5M 1Z3GH 3CLEH 3VXSA 2UWEB 2X44D 4FTVA 4JM4L 5HYJE 2VLRD 1CFVH 4DK3A 1EV2E 2D2OA 1MH5A 4UIKH 2X4SA 3OG6B 1C16B 4HGWB 3REVB 3HZMA 1MY7A 4MS8D 5DEFA 5DR5H 5FECB 3ZE0E 2Q3AA 3T3PF 3VE0A 3ECBA 1V8HA 5LGJA 3TO2A 4JFOB 1KC5H 1XFPA 4HWUA 4OGYH 1FYHB 2VAAA 3BQUD 3O2WL 4HF5H 2OI9C 3WFCH 3GMPB 3OX8B 3PWVA 4LQFL 2BY0A 1JHTB 4Q9QH 2VLKD 4JE4B 4HPOL 3DUUA 2KH2B 3ULSA 2YD3A 4ZFFB 1ZT7B 3C5SB 2H3NB 3G6JB 4CVXA 2JIXD 1FNFA 1VA9A 4LL9A 1ACYL 4ODUA 5DHYA 5F9DC 3NCJL 4JO4L 1OGTB 1QFOA 1PAMA 4PJFF 2LABA 2ZSWA 5LBSH 3EOAA 3TEUA 5EU7C 1A5FL 3GKWH 5HSFA 1T20A 5FOJA 3GMMB 4NHCL 1XF1A 4QNPF 5E9DA 4I0PC 3ROOB 4P2OA 3NBNA 2MSPA 4L9LB 4HKXA 2K3TA 1XGQA 4NQEA 4MAYC 1EEYB 3EBAA 5B4MD 1I8LC 3NA9H 4M7JH 3X3GH 1G7MA 5E08H 4NC1C 3WUWB 4LARL 2R39A 1E0OB 3HC4L 3IFOB 2QLVB 4P4KA 3V0AC 4HS3B 4R90L 5KSVA 2QV2A 4I9WD 1CE1H 3NMEA 2ICWB 4Z7WE 1Y6KR 5C0CD 3LKNB 1RI8A 2CO7B 4K7FA 4N8VA 2YEZA 5EU5B 2HAZA 1I7ZB 1WFUA 2QSCH 2HLFD 2NYYC 2VIRA 3FO1B 3KDMB 2XQBL 4K7PY 5T33L 5JHDE 5K9QG 3BPOB 3OTTA 4NT6A 5EZJB 3GSVA 5CD3B 3QZWG 4DUWA 5BJTB 3H3BC 5C07B 5FYJD 2JCCA 1UB5B 5DRXB 5DD0L 4OI9A 4HUKB 3MLZH 2X4QB 3MLSL 4BFBD 5CS7A 3CX2A 5HGDB 2WV3A 3Q1SH 3FQUB 4YDLB 2E6QA 2PNDA 4GH7B 3S97C 2CKBA 1GGTA 2R0KL 4UQ2A 2OZ4A 4RFNB 1NMCB 2AXJA 3MV9E 2AKRB 4G6JL 4M6AA 4H20H 5ISZA 4M03A 1E4XH 2QHRL 2YD2A 2FHFA 3RWJB 1NBZB 1S9YA 3ES6A 3O8XD 4PJXB 2LVEA 2YSSB 1CIDA 4X99A 1WAAE 5FUOH 1EIBA 4GAJH 2FJHA 3FTGA 1ZHNB 4WUUD 1ZGLA 1AGBA 1DQML 4Z7UB 5DFTA 2UVFA 1ZSDB 4DKDC 2AABL 2JE8A 4GKOA 3BDBA 3DRQA 3IJHA 3BPCB 3QSKB 5DO2D 2CLRA 5F6HI 2YD8A 2PXYC 2BOBA 2ZUSA 3HPJB 3OKLA 5KOVC 3MZGB 5A16B 4P46C 4FQJL 3S3PA 3V6FB 1HHKB 4M4PA 2DQFB 3MBXH 3VFGL 2W38A 2EDBA 2OZ4H 5E03A 4EDXB 1D5XA 1FL3A 2W0FA 4H25A 4CDHA 4LFHD 3F7QA 5EPMA 3IAPA 3CAFA 2NPLX 2UWEA 2VDPH 2YD4A 1V7NH 5KTEL 2AJZB 1ZMYA 1I9RL 2KBGA 4W6XB 1DBMH 3NIDF 1K9TA 4Y8AA 5C86A 4OKVB 1C16A 4HGWA 3ILQC 2W0PA 2WBJA 1K5NA 1YEKH 4BJLA 5FECA 1KXTB 4RISL 4GAGH 1O7VA 2PTVA 5I30L 3BYTA 4LSUL 5D2LA 4JFOA 2X7LA 2FEEI 1R6VA 1T6WA 2A0LD 2VDNL 2BJML 2AK4D 4MJ6B 1G9MC 4HXAL 5C8JB 2D9QB 1JHTA 1AO7D 3BISA 3GRWL 3MC0A 2W9EH 4FQIL 4JO1L 4KHXL 4WI7A 1I1YB 1RZFL 3LQAH 4N9OB 4ZFFA 3ARFC 1JUFB 1ZT7A 3C5SA 5HHXL 1R5VB 2H3NA 4YXHH 4WW2F 3G6JA 4GSDH 3FRPA 3PV7A 5SWZD 3NOIA 3RGVD 3UCRA 1UM6L 3PWLB 2CGRL 3P77B 1D5BA 4X9GA 5JMOC 2IG2L 1T66C 3WIHL 1S5HB 1KEGL 4UB0H 4Z95H 2WIMA 5MP6L 4OCXL 4OAWB 4OB5L 2GJ6B 3QIBD 3ROOA 1NQBA 2IALB 4L9LA 2C3XA 4WFFE 2GAZB 1JP5A 2D7OA 3BKJL 4EI5B 4RMSA 4BH8B 3KHOA 1YECL 5CJ8A 3W2DL 1JF5A 1PKQE 4P9HH 4HS3A 5TE6H 1IGML 3DI3B 3SPVB 2ICWA 3ULUE 6FABH 5H37H 4PRDB 5EU5A 3O0RL 3BE1H 1I7ZA 5AG9A 5FIEA 2YMXH 4NQVB 2BNQD 2FGZA 4MHHI 3KDMA 5F93C 4G7VL 1HXYB 1EVTC 5BO1H 3MRMB 5DJYB 1UWXK 5CD3A 5EZJA 2R69L 5DS8B 1MCFA 4XNMB 3RWHB 1UB5A 5DRXA 5CLTA 3S4SG 1QACA 4ODWB 2X4QA 5CZVL 3G5VA 4QY8A 5D1XB 1F58H 5HGDA 1H8OA 1HOCB 3VXRD 3TV3L 1A4KB 3MJ7A 1LP9F 4X5WB 1L6XA 3OAUH 2ZUQC 3TA3C 4H26B 4P3CL 5E7FA 3T4YB 5LJYH 3OSKA 1TTUA 5GS0C 1UQSB 3RWJA 5CEZH 4A6YB 1DUZB 1NBZA 4JREB 3QWRA 4PJXA 2IADA 2YSSA 4M5YH 4PJDB 3LZFH 1FG2B 2JJTA 3LAFA 3O41A 1OD7A 5H2BB 5I8KL 4OT1H 1WCQA 4DTGH 4UNVA 2D0GA 1GGYA 5KSBB 3BPCA 4X7SL 4Z7QE 5TPWH 3TBWB 4KJYB 5A16A 1A22B 3AFLA 5BVJB 2IAND 3K2UL 4KROD 1DLHB 4XC1H 4V1DD 3VXUA 4DGIL 4LNVA 3STLB 1K8DB 4ONFH 2I07B 4QT5A 1ZLVK 1MWAB 1U3HB 4AENB 1T04B 2AJZA 3IGAB 1H0DB 3QUXB 3L1OH 5ID1B 5DMJB 5J6HA 3MLRL 1OW0A 5ANME 1H3PH 1YPZB 3MLWH 3P0VH 1QSFD 4OKVA 5J9PB 2YUVA 5JXEA 5DJAB 4X9HA 1AGDB 3LEXB 3MMEB 4P23B 3QRGL 1G7HB 4P5TD 4PRBA 1IARB 2ZUYA 2X89A 2CSPA 2H45A 1LO2H 5FGRA 5GS1C 4JFDA 4CGTA 2P4AB 4X0KB 4G42B 4MJIE 5C0NC 3RWGB 5C8JA 1UCBH 3RJDA 2AJ3B 5CHNA 3STZB 4EKXA 4PJBE 3ZDZE 1I1YA 1T7XA 3S5LG 5F6IB 1YYLH 2CMRH 1JUFA 1MAMH 3HZKB 2J12B 1CDBA 4H8WL 5JPNA 1FYTD 5AZ2L 2V5YA 3S36L 3PWLA 3P77A 4HD9A 5IFAL 5DEGA 4FXGB 4OZIF 3AROA 4IJ3B 4WWKD 2A6JB 5HDBE 4QTIH 2GJ6A 1YYMH 3C5ZD 2IALA 5BS0B 2FWOB 3BGFB 5MENE 2GAZA 4IOSD 4KH2A 3V9FA 2EEBA 4R9HA 4PLNC 5JHLL 2QQKH 4EI5A 1T83C 1R24B 1YY9D 5I8CB 2HRLA 1I8KB 3HB3C 3QG7H 3ZO0A 5FHBH 4W4OC 4TOYL 5F71A 2ARJB 4QRSB 4GT7A 1JIBA 3GMLB 3GSXB 5F7DB 2I9TB 3MRPB 1MCEA 4RWHA 3LKQB 5E7BA 4LSPH 3VXPA 4YHLL 1DFBL 4NHUA 4CU7A 3EOYG 1R0AL 3SPVA 4R4FH 1MCOH 4K55A 4PJGF 5GGTA 4HH9A 1QNZH 3VXQB 4PJIB 5JW5A 2IMNA 1HXYA 3B3IB 3A6BL 3DTXB 4FQCH 2J88H 4QO1A 5DJYA 1N6UA 3QI9C 3FZUD 5EO0A 1YEEH 1XR8B 3IT8D 5DS8A 1QYGH 3RWHA 5I71C 3QCUH 2VZVA 2APTA 4H8WC 1D5MB 4ODWA 2A6KB 3MJ9A 1C5BH 1DSFL 4OCSL 5D1XA 4GRLC 4WHTA 5DD1H 1AQKL 3U46B 1D9KD 3LRSA 1HOCA 2WWKO 4NNPH 2XT1B 5IBUB 3WLWC 3QIUC 5B22A 4WU5A 4XNZB 3KPLB 2VOTA 1BJMA 1EHLL 3T4YA 4U6TA 3V4PH 1SEBB 5TDNB 2IF7A 5GGTH 1UZ8B 4Y4FD 4A6YA 2P5WD 3U0WH 3S3JA 2UVEA 2R4RL 4PJDA 3B8SA 4R4ND 3RKPA 1FG2A 2ARWA 4AEIL 5H2BA 3OQ3B 4LSDA 3FQTA 4G8GE 4PS4H 1K3ZA 4I18C 5KSBA 1CFQB 4EZMA 2H2SC 4EVNB 4NP4H 4IEFB 4Y1AA 3MJ9H 3TBWA 4KJYA 3KJ4C 4N0YL 3VFUA 2VXUL 1JTPA 1DLHA 1I3UA 3STLA 3KPRE 1K8DA 4FZ8L 4ODSH 4HT1L 1CLOH 3MFFB 2Q86A 1MLCB 1U3HA 5F88A 3LS5H 1GC1L 4JFFB 4A6YH 3MCLL 2QTEA 1PJ9A 1QBAA 4AENA 4F57H 4LCCC 1H0DA 3QUXA 4Z9KB 4M1GL 2CXKA 5ID1A 2OM5A 2E27H 4TSCH 4XPTL 1KXVC 4M1DL 4U6VH 4DOHB 1YPZA 4L5FH 1JRHH 4NO5B 4E41D 3LDBB 5C0BE 4FQXC 5J9PA 4HKBA 4B7LA 1GPOL 3S88L 1AY1H 3DLQR 2DDQL 2NY1D 1AGDA 3LEXA 3MMEA 4P23A 1G7HA 3QUYB 2DKMA 4PY8I 3VG0L 3T0EE 1GOHA 4PP1D 1EZVX 3I9GH 1H3TA 2Y23A 4WI6A 2FBOJ 1DQJB 3GEWB 2Q6WB 4ENEC 3MROA 3SDDD 4PRAA 4X0KA 3O6KH 1BPVA 4G42A 1MWAH 3BJLA 1IVLA 3RWGA 2KUTA 3G5ZA 4OZGB 2Z31C 5JZ7D 4Z8FL 1CD9B 1H3VA 1HZHL 2PN5A 3VG9B 5DC9B 1PQZB 4PIRF 1F8TL 2ZG2A 1CIUA 3HR5B 1HQRA 4ONOA 3RWCB 3TVMC 1NKOA 3ALPA 4DVRL 1RZJH 1SM3L 1VPOH 4MA1B 3JWOL 4GG6B 3OKNA 1VCAA 2JCCF 4OLVH 4AL8L 1CI5A 4R0LC 1EEUA 2ZPKH 4NYLB 3OF6A 1JPST 3UTSD 5E9DD 2A6JA 3SDAB 1VFBB 5JXAH 4Q9BA 3C9NB 2OTUB 1V5JA 2CIKA 5BS0A 1GC1C 1A7NH 4NQDB 3R8BB 2FWOA 4ZFZB 4FHBD 4NQED 4OTXH 1XH3B 3GBMH 4C56D 2HFFA 1TZIB 4NZDA 2RFXB 5DZOA 5I8CA 4XVTH 1I8KA 3RVXD 2JJUA 4YHNB 4JDTL 4LHUA 1I3RB 4ZTOH 4XWGH 1MFBL 3MV11 3GMLA 5J8OA 1FAIL 5F7DA 3C08L 2I9TA 3RPIB 5E94B 2W9LA 3LKQA 4NFDA 4QF1B 3RA7L 3KPTA 1MFDH 2CH8A 4JFXB 4HJJH 2GTZB 5IM7A 5KAQG 4NQTA 1RVFH 4ZSOE 2PKDA 3HE6B 5EC1B 2L4OA 2ZCLL 5EOCJ 1QHPA 3VXQA 1ITBB 4ELMA 5KS9E 2ICEB 2DWEA 1I7TA 5F96L 1BM3H 1RUQL 3B3IA 3DTXA 4XZUB 4TTDD 1AR2A 4XX1E 3QO0B 1E4XI 1U91A 1OT2A 1XR8A 4NWUH 4D9QD 3RBGA 3ZYJA 1CFSB 1D5MA 2UWEF 4PRPB 3IRZA 4EUPB 1U8QB 2A6KA 5SV4A 5C70A 4YC2B 3U46A 4YHIB 4CVZA 5GHWL 1NDGB 2V5TA 1J8HA 1TJGH 3U48A 1L0YA 1WJ3A 3KPLA 5DD5H 5ISZD 3UBXG 3T2PA 1OHQA 5B4MC 1SEBA 2QSQA 5FO7B 1QRNA 1IAOB 1UZ8A 2ADIB 3F62A 4HBCL 4BFGA 1U3ZA 4KUZL 1F2XK 5FYLH 4POUB 3SKUD 3WIFB 2X4PB 1A9BA 1CXKA 1N26A 4I2XB 4F8TA 2Q76B 4EN3D 2RCSH 4BSWB 2GY7B 4S1QL 2M1KA 5E2WL 4RAHA 1CFQA 4NC1E 3LN9A 4LEOB 4EVNA 4GW4B 4RGMB 3OXRB 5EORL 4PJHB 3G6JF 4PRHD 4I3SL 3K4DA 1IKNA 2BHZA 3O3AA 5HI3D 4L4VB 3T2QA 2O5XL 1VACB 2FEEL 4D8PB 5IFHL 3WKML 3MA7B 3U82B 1E6JH 3UDWC 4MX7B 4YHYB 5ENWA