3QRJA

The crystal structure of human abl1 kinase domain t315i mutant in complex with dcc-2036
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
263
structure length
258
Chain Sequence
KWEMERTDITMKHKLGGGQYGEVYEGVWKKYSLTVAVKTLEVEEFLKEAAVMKEIKHPNLVQLLGVCTREPPFYIIIEFMTYGNLLDYLRECNRQEVNAVVLLYMATQISSAMEYLEKKNFIHRDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNKFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERPEGCPEKVYELMRACWQWNPSDRPSFAEIHQAFETM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational Control Inhibition of the BCR-ABL1 Tyrosine Kinase, Including the Gatekeeper T315I Mutant, by the Switch-Control Inhibitor DCC-2036.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Tyrosine-protein kinase ABL1
total genus 88
structure length 258
sequence length 263
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2011-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3qrjA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3qrjA01
4IC8A 1WFCA 2EUFB 3F3UA 5I4NA 1IG1A 1BMKA 2WPAA 3IQ7A 2CKPA 4BGHA 3ZEWA 4FODA 4FSYA 2YWPA 4QMPA 4TZRA 3ALNA 4ZIMA 1W8CA 5CEOA 4FKLA 4DFUA 4QRCA 3TIYA 2OJJA 3IO7A 3AT2A 3DAKA 3DBDA 2R64A 3FEGA 3RTPA 3RPYA 1YDSE 2OIBA 4UMRA 4BWXA 2C6MA 2G9XA 4YZNA 4BF2A 3KN6A 4C4GA 3MYGA 3P7AA 4GIIA 4JAIA 3LW0A 3K5UA 4Z55A 2OI4X 1U59A 3PRIA 4ZLYA 2EU9A 3DTWA 5AR4A 3BBWA 4MXXA 3GCUA 3FC1X 1CTPE 3L9MA 2VWBA 5AV3A 3FLQA 3ZFXA 4B8MA 2OH4A 2IZTA 3TN8A 5EYDA 3ZSGA 4U79A 1L3RE 1OITA 1VYZA 3HVCA 3MJ2A 1JSVA 4XG8A 3ZEPA 2YERA 1MQ4A 5BMSA 4TYJA 2Y4IB 5A3XA 3F88A 4OTRA 3KL8A 3I5ZA 3O8UA 2QKWB 4FT3A 4N6ZA 2R5TA 3RAHA 2WAJA 5FM3A 3CJFA 4EHVA 2XK6A 5E1EA 5I9UA 3CBLA 3ZC5A 1FVVA 3ORZA 4RLKA 3SD0A 4AN2A 5GZAA 3V5TA 3BBTB 2JIVA 2W5HA 5L6WL 4DFNA 3V5JA 5AAEA 4HYHA 2UVZA 3UYTA 4C4FA 4MF0A 4EOSA 2RKUA 4IQ6A 5ANIA 2W5AA 1VEBA 3BYSA 3CQWA 3Q5IA 4MCVA 4NM3A 2WQOA 4L7FA 1YW2A 2UW9A 2PE1A 2WQBA 4XBRA 3A99A 4JIAA 3RPVA 3U51A 3LCTA 3LCDA 5L6PA 2QR8A 2O2UA 4FE2A 5B0XA 2UUEA 2XNBA 3SA0A 3UOHA 3Q5ZA 5F4NA 3AGLA 3IGOA 3VBYA 4DBNA 3AQVA 2Z60A 1BYGA 1ATPE 2YIQA 3CTJA 2RFSA 5A54A 2BTSA 2IVVA 5EOLA 4AN3A 5HEZA 1TQPA 4I4EA 5FEEA 4AAAA 5HTIA 5KKRB 3DGKA 1ZOHA 4HGSA 4CMUA 1NA7A 2VZ6A 3LFAA 4JQEA 2JKMA 3FZSA 4LYNA 4PDPA 4XV2A 2CNUA 3I7BA 4II5A 4FL2A 4NIFB 5FTOA 1WCCA 2BDJA 3R83A 4FIHA 4WHZA 3HV3A 4BHZA 4U0IA 4GH2A 3L9NA 4H39A 2KTYA 2WMRA 3PA4A 3G9LX 2FSOX 3POZA 4GJ3A 2RF9A 4BDHA 4CT1A 1YOJA 4H3BA 5L2SA 3G0EA 5CVHA 3ATTA 1VJYA 4E6CA 3UZPA 4XV1A 4F4PA 1ZYCA 1SVHA 2UVYA 5HO7A 5FEQA 3F9NA 4C38A 2BILB 5I9YA 4U43A 1W0XC 3RK5A 3ZCLA 4MWIA 4CLJA 5HE1A 4EUUA 4V01A 4IWPA 5KMMA 3Q4ZA 1TKIA 5HVKA 2QCSA 1KOBA 3OW3A 3R1QA 5IA4A 1K2PA 3UNZA 2YABA 5DEYA 3V8TA 4DGLC 4BBFA 3PJ2A 3CKXA 4IADA 4K33A 3MV5A 5IA5A 3G90X 3V8WA 4O22A 4EH3A 4I0SA 2PU8A 3W1FA 3QRIA 4M68A 3U54A 4BYJA 1P2AA 4IZ5A 3FQSA 4KIOA 5IMEA 5FEDA 3RK9A 5AP3A 4FOCA 2GNHA 2DWBA 4IEBA 4JBVA 3ZDUA 4AW1A 4DTBA 4XX9A 3SHEA 3ZLYA 4D4SA 3ODYX 1Q62A 4DFXE 4YP8A 4OTGA 5CQWA 3W33A 3FQHA 4L52A 3HRCA 4JOAA 3ZXTA 3OROA 2XEZA 3K5VA 4YNEA 2VU3A 1M2QA 4O0XA 2QHNA 3KF4A 4R5YA 3C9WA 2ITXA 3LAUA 3WYYA 3DTCA 2C6KA 1SNXA 1U54A 3OEZA 2X7GA 5H2UA 4FKVA 2VN9A 2VTAA 4B9DA 4K8AA 5AR7A 1S9IA 3HAMA 1OPLA 3KRLA 5L2QA 3U55A 3BIZA 3OCGA 1WAKA 4NM0A 4OR5A 3EZRA 4DYMA 1I09A 4X3FA 2ZB1A 3H9RA 1CDKA 3MESA 1H28A 2AC3A 5AM7A 3CKWA 1SVEA 4R3RA 4S30A 2WTWA 3VQUA 1M17A 4AACA 3DDQA 3P79A 3HV5A 5E8XA 1REJA 4A9SA 3GCPA 3V6SA 2HXQA 5E7RA 2XZSA 3DZQA 4AN9A 3VWAA 1F3MC 2UVXA 2YCFA 4FKOA 4ITIA 4XG2A 2QONA 1PJKA 4B4LA 4F65A 2IWIA 5CQUA 3MA6A 4ID7A 5J1VA 3QYWA 4ZLZA 2W17A 4N57A 4I92A 3NUAA 4FVQA 5CSPA 2GNLA 3A61A 4AOTA 4FV0A 4IAAA 4P5QA 2VNWA 2UZOA 2FYSA 3TCPA 3BQCA 2UZBA 5L2WA 5CU4A 5DBXA 5EOBA 4BGGA 4GUBA 1JSTA 3KXGA 3IOPA 4O6EA 4F99A 4PV0A 5JFXA 4IM2A 3H9FA 4GKIA 4R3CA 4BYIA 4CLIA 3VBXA 5IH4A 3UQFA 4E26A 5L8KA 2Q83A 2SRCA 2UZWE 4FYNA 2CCHA 4DH1A 3PPZA 5ETCA 1MRUA 4FNYA 1OPKA 2C3KA 1UNLA 3KRWA 1FPUA 5ANGA 1U5QA 4ZEGA 4BCHA 4FF8A 2P33A 5DIAA 1UU9A 2ZM3A 3PSCA 1H07A 5IA1A 5EHLA 3GXLA 4QD6A 1LEZA 4NT4A 3ZHPC 2HZNA 3QXOA 3R9RA 2RFDA 2QOKA 3QALE 3PZEA 2IO6A 1GOLA 3TNQB 4V0GB 4TWCA 4RG0A 2JKOA 3FV8A 3I4BA 4EORA 3DXQA 2PVYA 3EN6A 3R7UA 2BUJA 4AZVA 4JT3A 3DK3A 3PPJA 4G5PA 3RCJA 3VBWA 3PY0A 3VS7A 3FMMA 2BHEA 3AC3A 3AGMA 3O0GA 3R02A 3QZFA 3BGPA 3WZJA 4Y5QA 4H05A 2W9ZB 4LRKA 2R3JA 2ITWA 4RQVA 4CCUA 2YFXA 3D7TA 4ASDA 2XKEA 3NUYA 3ACKA 3CC6A 2BRMA 4DEEA 2O63A 1M7NA 3CGOA 5AR3A 5EHYA 1BI7A 2YCQA 4BC6A 5CALA 2CNQA 4C59A 3UP7A 4DHFA 5DNRA 4BDDA 2OBJA 3MPTA 3RAIA 5CTPA 2NNWB 5LARA 3FSKA 3H4JA 5A4EA 4HPUE 2F7EE 5CEQA 4F9YA 2GNJA 2NPQA 2W5BA 5HICA 3S3IA 5J7BA 4ZSEA 2J9MA 3LPBA 4ASZA 3FDNA 1SNUA 4F1MA 4WUAA 5JH6A 3MFRA 4JQ7A 4O0TA 4PMMA 4EH6A 4QQ5A 4EOPA 4IAKA 3SGCA 4FV9A 1BX6A 4W4WA 3LOKA 3C0HA 1O6LA 1SZMA 4FICA 5AR5A 2Y6MA 1ZYJA 3UNKA 4ZMEA 1Y8GA 4NL0A 3CCNA 4DAWA 3V04A 2C6DA 1GIHA 4DA5A 2ITYA 3D94A 4EOMA 3LFQA 4DGOA 1Z9XA 5DRBA 5HNBA 3E87A 2QLUA 3DOGA 2QR7A 1RW8A 4BDGA 3TJCA 2QI8A 4L01A 4YPDA 3NUSA 2C5YA 1GY3A 3RNYA 1DI8A 3KEXA 3EFKA 4AE9A 4M69B 4O7RA 5FTQA 4F1OA 4O2PA 2YZAA 2QURA 3FJQE 4RA5A 3R01A 1OECA 3R22A 4Y85A 5K5NA 3NNXA 3LXNA 5GIPE 3VW8A 4U42A 3SXRA 3ATSA 1E1VA 3OCBA 4TN6A 3KK8A 4PPAA 3ZRKA 2OJFE 4UBAA 3VUTA 4TWOA 3KXNA 4D1ZA 2RSVA 2FGIA 3Q60A 2Z02A 1U46A 4BBMA 4DEAA 2GHLA 5JFVA 4H1JA 1XBCA 2QVSE 5KZIA 3EQHA 3ORPA 4RIOA 3LMGA 5E91A 3ZS5A 3S1HA 2GS7A 3F5UA 4HCUA 4EL9A 3HMOA 2JKKA 2HELA 3OXZA 3UIBA 1ZARA 1QL6A 4AQCA 2OZOA 3EQRA 5HCXA 5HG9A 3V3VA 3R9DA 3RJCA 1UKHA 2REIA 4OTWA 4IX3A 4YJNA 4FKGA 3QTXA 3D9VA 4RPVA 4GW8A 4DEGA 4BIEA 4YBJA 5CAPA 4WD5A 4X2JA 5AP6A 2FSTX 1OVEA 5CZHA 4QYEA 3NYXA 5G1XA 3C51A 1XH7A 3OXIA 5DWRA 4GU9A 2YDJA 4DG0E 3OP5A 2UZEA 1PRYA 4E4XA 3R6XA 4JX7A 2XK8A 4RIWA 4C0TA 4AGWA 1H24A 5LWNA 4FZDB 2I0VA 4U7ZA 3SKCA 4G1WA 3W32A 3DJ7A 4KINA 4LOQA 4D5KA 5M4UA 2C3LA 3FZPA 4ZSGA 1CM8A 3MVLA 1VYWA 1JBPE 4KB8A 4PUZA 4QMZA 4CFUA 3D2KA 3RZFA 4FEVA 4W9WA 4UB7A 1LP4A 2FB8A 3AG9A 2OIDA 3RBWA 3BE9A 3KMUA 2W4OA 5G6VA 5AUWA 4BDKA 3BU3A 4C4JA 4YURA 4EUTA 3PJ1A 4NJDA 5FDXA 5FBNC 3FMEA 5AUZA 4PTEA 2XCHA 1H0VA 4P5ZA 1QPJA 2C6EA 3HYHA 4LOPA 5L2TA 1UNHA 4ZTRA 5TR6A 1Z57A 1H25A 3QTRA 4IJPA 3G2FA 3FLYA 3R9NA 4C2WA 3N51A 4CFFA 4E93A 2BMCA 4UXLA 3QHWA 2VAGA 4BDCA 3LM0A 1JSUA 3UIXA 5EM7A 4RIYB 5KKRC 2ZM4A 3NUUA 2C5VA 4DF3A 1KWPA 4CXAA 2C4GA 2OFVA 3ZOSA 2I40A 3MWUA 4O96A 2AC5A 4FKPA 2FA2A 3FZTA 5DA3A 1E9HA 2WELA 4AUAA 1P5EA 1W84A 4E8AA 2JFMA 5B7VA 5M4FA 5TO8A 2OJ9A 3KRJA 3LXPA 4D4VA 3P78A 4LM5A 3QQJA 5A14A 3QA0A 2WXVA 2X39A 2A27A 5AP5A 3BYVA 4FV8A 4DITA 1NVQA 2YZLA 4FSNA 2BALA 2W05A 2J6MA 2P55A 4DEDA 4BCMA 2F7ZE 3EFWA 3SG9A 2QG7A 5C26A 2RGPA 3OVVA 2WFYA 4RX8A 4XNEA 3NW5A 5C03A 3SV0A 5C4KA 3TM0A 4FNXA 1UV5A 2VX1A 1OKZA 1Q4LA 1R1WA 4EWHA 4WNMA 4E4NA 5TF9A 3RAWA 2YAAA 3OWJA 1OGUA 3I6WA 3VS3A 4AOJA 4CFVA 1WBNA 2PZYA 4GFOA 3GGFA 4B99A 5LMKC 3PXZA 5LVNA 2X8DA 5J8IA 2GNGA 5AP2A 3P86A 2EVAA 2Y4IC 3QGYA 1WBVA 3C50A 2VD5A 3BV3A 3OY3A 4R8QA 4O6LA 2JDOA 3UOKA 4R77A 4BTMA 2QNJA 2EWAA 2ETRA 2XBJA 4U9AA 5LVPA 3LQ5A 3P7BA 4QP7A 3LQ8A 1STCE 4FV5A 4AW2A 4FZAB 4O0SA 5K0KA 2CLXA 4NWMA 3UPXA 4DLIA 3HAVA 2J50A 4FX3A 3S95A 4O0YA 1Q8WA 4RIWB 4EH8A 1J7IA 1PXJA 4O81A 3FSFA 3GC8A 3I0QA 2VX0A 4RGJA 4TRLA 2UZVA 2VGOA 3VJOA 3B2TA 5CU2A 3NYNA 3OUNB 3RGFA 4CMTA 4JLCA 4JRVA 3NVMB 4E6QA 3E64A 2I7QA 5BUIA 4G34A 5E92A 4A9RA 3NLBA 5AAFA 1P4OA 1S9JA 3O71A 4HOKA 4IFGA 4XCUA 4BCJA 3JS2A 4R7HA 4GL9A 3ZRMA 4JBOA 4G9RA 1GZOA 2I0YA 3GCVA 1A06A 4RFMA 2ACXA 5BNJA 4CKRA 2R9SA 2J5FA 4PQNA 2XIRA 5HNIX 3DFCB 5AUVA 2X2LA 4Z7HA 1TVOA 3LLTA 3TI1A 4GS6A 5EQYA 4QMUA 2HWOA 3GU8A 3EZVA 3ODZX 1OBGA 4U41A 4JG6A 5KE0A 3ZO2A 3FMKA 4EBWA 3GB2A 3D5VA 3P4KA 5GIOE 3F61A 1NXKA 3WIKA 4L8MA 5BUEA 4O7NA 1X8BA 3D15A 4LMUA 4RJ7A 2WGJA 4W4VA 3Q2MA 1DI9A 4MHAA 2W1IA 2X6DA 3L8PA 3QHRA 4PPBA 2YIRA 4WO5A 5IA3A 5EM8A 4R1VA 3ID6C 3ZYAA 1CKJA 3W18A 3LXKA 2X2KA 4EQCA 5DMZA 4OW8A 4IX5A 4ZZMA 4S2ZA 5LVOA 4N6YA 2XVDA 4OBQA 4DEIA 3PDTA 4O38A 3E62A 3GC7A 4NUSA 5EW9A 5FXQA 4F0IA 3OTVA 5IH6A 2HZIA 3HDNA 3NCZA 4H36A 3MY1A 4GEOA 4I5MA 5FM2A 3UODA 5M06A 3HECA 2VWVA 4FG9A 2GS6A 3OHTA 3Q04A 2Y7JA 3QD2B 2JC6A 3A7IA 4FIGA 3WZEA 4C3RA 4F7JA 4ZZOA 4I41A 2W4JA 3DNEA 3O7LB 2UW4A 4BTKA 3LFCA 3IDCA 5A4TA 3G15A 3PA5A 4YO6A 3C1XA 4M0ZA 5IZFA 3R8UA 2YCRA 4PX6A 3IONA 2XKCA 5FGKA 3WILA 4E5AX 1DM2A 4MXZA 2W1FA 2P4IA 2OLCA 5L3AA 3L8SA 3ZBFA 2WTKB 3I7CA 3CD3A 4XOYA 3T3UA 3RZBA 3ZLSA 3MFUA 1ERKA 2WIPA 4TYGA 3OC1A 1SYKA 5JRQA 2G2FA 3DK6A 1OIQA 5JFSA 1PXNA 1FGKA 3F7WA 1CMKE 4LUDA 3A60A 4YMJA 5AUTA 5HG7A 4HYSA 3EJ1A 3QF9A 3EQFA 4MBIA 4F9WA 2IW8A 2X81A 3A2CA 2VV9A 3BE2A 5AIKA 2ONLA 4RIXA 2Z7LA 4X3JA 3FI3A 4FT0A 5JT2A 3DT1A 4N70A 2PVFA 3ORLA 2FH9A 4Y83A 4CT2A 4YZMA 3QXPA 3UPZA 3R9OA 2GMXA 3JVRA 2Y0AA 4MKCA 3TNHA 3QFVA 2BPMA 4JI9A 2R2PA 3QRKA 2C5OA 4QP3A 3R1YA 4U5JA 2ZYBA 3W2RA 2XIKA 3KRRA 4FL1A 4MD9E 2X2MA 4G6NA 2XK3A 4G31A 2FSLX 4TKSA 4YC8A 3UG1A 3EQBA 3IDBA 3JYAA 3LJ2A 4DFYA 5JZJA 2J0MB 4BIDA 1XHAA 2OW3A 2PZIA 3ZUUA 2BZHB 3K3JA 3ERKA 3DKFA 1OIRA 4FTKA 3QQHA 2BHHA 4JDHA 1A9UA 3Q52A 4TL0A 2ITPA 2CLQA 4CVAA 3BU6A 4XHKB 4PMTA 5E8ZA 1CKIA 3F82A 5ETIA 4RWLA 1FMKA 2Y9QA 4W4YA 3LXLA 3TTJA 4CV8A 1OM1A 3HP2A 4BWPA 5BVDA 3QZIA 5HNGA 5CSHA 2ERKA 5L8JA 5AV0A 2OGVA 3Q96A 1Q24A 5GNKA 1WBSA 3D0EA 5AV1A 4V04A 4IZYA 1SM2A 4RJ8A 4U6RA 3R8ZA 1K9AA 2ZDUA 3HLLA 3PFQA 4CZUA 3DPKA 4FV7A 1VR2A 5LVMA 4RJ3A 5AADA 3T9TA 5IG1A 2JKQA 2CNVA 2GQSA 4PTCA 4I20A 5HLPA 4F6WA 5J79A 5JMSA 5K4JA 4EK3A 2UW8A 2XJ2A 2XYUA 5IDPA 5DRDA 4EOLA 3COKA 4BDFA 4F08A 4F0FA 2BZJA 3IPHA 2W9FB 4JS8A 3RNIA 4FT7A 4EEVA 4HCTA 2PUNA 4S31A 2OKRA 4XLVA 3L9PA 4YNOA 4DE4A 3BEAA 5CSWA 1E1XA 1R0EA 3OCSA 2QQ7A 4YJOA 4RMZA 5DGZA 4EOOA 4F9CA 4ZTSA 3D7TB 2R3GA 5A9UA 2W1HA 1G3NA 4NEUA 4EHEA 4DGMA 5CLPA 5FQDC 3HL7A 3FKLA 5CANA 4QMOA 3TJDA 5AV2A 4E4LA 3LM5A 3DJ6A 3CS9A 5D9HA 3E8EA 4ERWA 3W10A 3K54A 3KY2A 3NUPA 4E4MA 2JD5A 2RG6A 4RVTA 2XUUA 5HD7A 4QP1A 4O7TA 3W2CA 4L3LA 3TUBA 4RVMA 4UMPA 2E9PA 3HX4A 3GFWA 4TT7A 4ALUA 3R7OA 4O27B 2P0CA 5K3YA 5CAOA 3AT4A 5M55A 4YHFA 4W4XA 3FY0A 1XBAA 4CFNA 2CGVA 4BCNA 3R71A 4D1SA 2RFNA 4GFGA 2HWPA 4KA3A 4BIBA 5ANKA 5HO8A 1ZY5A 2F49A 4RIXB 1YWNA 3PIZA 3A7JA 3AMYA 3BX5A 3R63A 4J1RA 4GCJA 2UZTA 3FZRA 5ITAA 4ZS4A 2JAVA 4HYUA 4PRJA 4LGHA 3TV6A 4L7SA 4KWPA 3U4UA 4BKZA 3FI8A 1ZMVA 4F7LA 3KCKA 2R3KA 1SMHA 2PL0A 3GOPA 3OOGA 2R3QA 4RRVA 2BAKA 3RP9A 2VTSA 3NW7A 3V5LA 4CCBA 2RG5A 3PXFA 4AZEA 4WKQA 3QKKA 3MDYA 1ZY4A 3QLFA 4X7QA 3QUPA 4G3EA 5DE2A 1LPUA 4ARKA 1WZYA 2B9JA 2QC6A 3OOMA 3FLWA 4L44A 3PVBA 4M13A 4CD0A 4QMNA 4D2RA 1OUKA 4R7IA 3UE4A 5CT0A 1PHKA 4KSQA 4EK6A 5LOHA 3Q9XA 2WIHA 3GU6A 4XJ0A 4FTMA 3D83A 4D55A 4UXQA 1H08A 2JLDA 3PWDA 2QOBA 3ENHA 4FZFB 4FSUA 3EQPA 4JR3A 5KZ0A 5BVFA 2CKEA 3RI1A 4BCIA 3C0GA 2QO9A 4KIQA 4BICA 3R8MA 5IA2A 2BKZA 2WEIA 3QLGA 1PXOA 4UYAA 4XG4A 3NEWA 2PHKA 4D4YA 3MIAA 4M84A 5F94A 4JXFA 3MB6A 4XRJA 4BTJA 3TEIA 4CKIA 1B39A 1XH8A 4ANMA 4CNHA 2W1DA 3EL8A 3HV7A 4FI1A 4WRGA 5DOSA 5EK7A 2YN8A 4XH6A 2ITQA 2VTPA 5CENA 4C57A 4I6BA 5M09A 4EH9A 1TQMA 2YITA 1APME 4M97A 5A4QA 3E63A 3PG3A 4QMVA 3VULA 2YJSA 2CKQA 4I5CA 2YIXA 4WIHA 5JRSA 4KKGA 4JBQA 4KBCA 4IIRA 4X6QC 4YPSA 3MH3A 4TNBA 4IAFA 2J7TA 4O84A 2XNMA 2C6LA 4RWIA 3VHEA 4DLJA 1YXTA 5HVJA 3PG1A 5F9EA 2ZMDA 2BAQA 3R1SA 4UWBA 2FO0A 4MXOA 4YJPA 5GJDA 4IFCA 4FKUA 4PP7A 5BUJA 4CV9A 5AX9A 2C0OA 1YHSA 2XM9A 3L8XA 2Y4PA 3BELA 5IEVA 2IVSA 5J9YA 4OAUC 1P4FA 2GTNA 2JDRA 1FGIA 3MS9A 4J71A 2H96A 1UU8A 4XG3A 4DN5A 3O17A 5BVKA 4O7LA 3A62A 4FSMA 3Q3BA 1B6CB 2YM5A 3N9XA 4FEWA 2Z7SA 4I5PA 1GNGA 3JPVA 5HKMA 3PY1A 5CEMA 4ANQA 1JNKA 3KXZA 3FBVA 2XNOA 3JVSA 2YWVA 1UWJA 3Q6UA 5HZNA 3OY1A 4XUFA 3EFJA 2GDOA 3EH9A 2GFSA 4NTTA 2E9UA 3CQEA 4GU6A 5HX6A 4BFMA 3FHIA 2O64A 4LRJA 4LL0A 4DH8A 1OL5A 3CE3A 4K2RA 2EB2A 1GIJA 2BFYA 2EXCX 5ETFA 3KXXA 3R1NA 2IZSA 4FIFA 5BPYA 3TV7A 4E20A 4RX9A 4HW7A 2VWXA 4C37A 1Y6BA 3R73A 3PVGA 2PMLX 5HI2A 4RIYA 5FP5A 3KC3A 3FMJA 2BDFA 5T6KA 3MA3A 4FK3A 1YQJA 1YXXA 2KULA 3KN5A 4IXPA 2PVJA 2ZMCA 3PWYA 5ANEA 5CZIA 5KNJA 3RM6A 3BV2A 2XKFA 1PYXA 4H58A 1WBOA 5IA0A 3VO3A 3HMIA 5C1QB 2HY81 4OTQA 2HW7A 5K0XA 4L68A 1H1PA 1BL7A 3R2YA 3UJGA 4AFJA 1KE8A 4C33A 3NAXA 4I93A 3LFEA 5FTGA 4R5SA 3QQGA 1KE6A 2A0CX 2QOFA 2UW3A 3E7OA 2XA4A 3KULA 2H6DA 3NZ0A 4HGTA 3V5PA 4EK4A 4GUEA 3QTZA 3TXOA 3FY2A 1ZOEA 2WEVA 1OKYA 4BR3A 4P7EA 5AM6A 2P3GX 3QKMA 5E8WA 3IOKA 4IWOA 5HTBA 3EIDA 3PIYA 4EZ3A 2C3IB 3NR9A 3VUGA 5B2LA 4YR8A 5M53A 3GI3A 2EXMA 1RDQE 2WB8A 2BRBA 5K4IA 3TDWA 1KE7A 4C2VA 4MXAA 4X0MA 3II5A 4NH1A 4AF3A 2C0IA 3MB7A 5E8TA 4OT5A 4OTHA 5HIBA 3RHKA 1J7UA 4B0GA 3RHXA 3EN9A 2XS0A 3IECA 5KHWA 3TZ7A 3CY2A 1H1RA 4EWQA 3D5UA 4FG8A 5CNNA 4FKTA 5HLWA 4FIIA 4NTSA 4U8ZA 4X2KA 3VJNA 4OGRA 4GKHA 4FTQA 2OF4A 4UMUA 3DY7A 1EH4A 2W99B 2C47A 3IG7A 4ZP5A 3EL7A 3VHKA 4ZTNA 4DGNA 3QQFA 3EN5A 5GZ8A 4F0GA 2XK4A 2YDIA 3R00A 5EDPA 3W2PA 3WI6A 3EQGA 4QP9A 4PDYA 1Q5KA 4KS8A 4XP0A 4I22A 4WG5A 5BYYA 2RFEA 4MK0A 1AD5A 3P0MA 4NM7A 4BDEA 2A4LA 1OB3A 2XP2A 3NIEA 4RC2A 2OXYA 3TUDA 4ENXA 1KSWA 2QHMA 3O8PA 2W4KA 5HX8A 5DYJA 2VGPA 4DCEA 1JWHA 4FSQA 4TTHB 3K3IA 2O5KA 3G5DA 1HCLA 3C0IA 5EFQA 1PW2A 2GU8A 4FTUA 4TYEA 1PY5A 4ZJVA 4HNIA 5CS6A 3UIMA 3OF0A 3CTQA 4IB1A 4D2SA 4AS0A 3OBJA 1PMNA 5KMIA 3KXHA 4ACCA 5DT3A 2W96B 4J95A 4AOIA 2W0JA 2V7OA 3G51A 3FE3A 4I3ZA 2ZM1A 3AC4A 4B6LA 1UVRA 4RVKA 4CQEA 4M0YA 2YLFA 5J87A 2F2CB 4KRDA 5I9VA 3FLSA 3OCTA 1U5RA 4YC3A 3QRTA 4NYEA 1JKSA 2OFUA 1GZ8A 2YACA 3NRMA 4YZCA 3RK7A 4E1ZA 4IDVA 2IPXA 2HW6A 4QMTA 4FOBA 5EI2A 5M51A 2IG7A 3LFBA 4UMTA 3QTQA 3T8OA 2LGCA 3R8PA 4AW0A 3QQLA 1ZWSA 3QZGA 1PXMA 4FKQA 4CTCA 3FXXA 3R04A 1R3CA 4FVRA 3HZTA 3C4XA 4TYIA 4TY1A 4X3FC 1FINA 1OUYA 4ZJIA 3RPRA 5CT7A 3NUXA 3VF9A 4WSQA 3O7LD 2YISA 3LCKA 5AP4A 1J1CA 3NDMA 3R8LA 3S00A 1OL6A 5CF8A 5C01A 2PZ5A 4Y5HA 5HE0A 3RVGA 2NO3A 5EM6A 3TZ9A 2OWBA 5L2IA 4EI4A 4IMYA 4MAOA 5FD2A 1PXPA 2QO7A 2VWWA 2VTTA 5ANJA 3SX9A 4AWIA 2PZPA 4YTFA 3FMNA 4G2FA 2XYNA 3DBFA 3BCEA 4S34A 2C5XA 3I79A 1O6KA 2IJMA 5CAQA 3Q9ZA 4AG8A 4ACGA 3AMBA 1M2PA 4BCOA 5HU9A 1CSNA 3F3TA 3HUCA 4GT3A 3NMUF 3HMPA 5JN2A 4YC6A 5CWZA 3H10A 4C35A 2ZV8A 4PNIA 2X6EA 3V51A 5TOZA 2PTKA 3C5IA 2PSQA 4QOXA 1XR1A 5I9WA 5LQFA 3A8XA 4I21A 3TZ8A 2X4FA 4R7BA 3B8RA 3LFDA 4IBMA 2WHBA 3DKOA 3BWFA 5BYLA 3IW5A 3UO4A 2GQRA 4IB5A 1R0PA 4DEBA 3NNWA 3CLYA 3MPMA 1G8AA 3LKMA 2UZDA 4NU1A 2ZOQA 4GG5A 2VTMA 4UZHA 3QAME 3BHUA 1ZOGA 2AYPA 3OTUA 4MF1A 4BHNA 3QUDA 4F7NA 2O0UA 2WTDA 2C30A 4CTBA 1PMVA 3L9LA 4QMXA 5KMKA 3OUKA 1AQ1A 3Q4TA 4UWCA 4ACHA 4QYFA 4XOZA 2YEXA 2XRUA 5M44A 4UMQA 5IU2A 3DDPA 3IGGA 5TKDA 3F7ZA 4O0RA 3VAPA 2G01A 3NPCA 2DYLA 2PY3A 1PF8A 4HVSA 4AZFA 4QMWA 5IQCA 2WMUA 1CKPA 4IX4A 3VRZA 1WVWA 4WA9A 3S2PA 2QO2A 4FTOA 1PXLA 1YI4A 4ZOGA 4HVDA 3RAKA 3G6HA 3I1AA 4JX3A 3FXWA 3UC3A 5HU3A 5CVGA 4MYGA 4IDTA 2UZLA 3H0ZA 2X1NA 1ZAOA 1WBWA 2GCDA 3O96A 3ULIA 1B38A 5DG5A 4BDAA 1MRVA 1Q8YA 2I1MA 3FMDA 3DJ5A 4MH7A 5EDQA 4TYHB 4APPA 4HYIA 5HD4A 4M67A 3DBCA 3IKAA 1XWSA 4O7VA 1ZYLA 5JGBA 3AD6A 2PYWA 3ZC6A 3CPBA 3O23A 1IR3A 1W83A 3LJ0A 5EYCA 4QO9A 4LQMA 4CGAA 5CXHA 5A4CA 1OL7A 1QPCA 4USEA 1ZRZA 2PVRA 3TIZA 5LJJA 4F7SA 2HXLA 2OICA 3OW4A 3WE4A 4AGUA 4BN1A 3WF7A 4QTEA 4BWKA 3DB8A 3QRJA 5EI8A 1HOWA 4D9TA 5CNOA 2YAKA 3DA6A 3LFFA 1O6YA 4ZY5A 2WTJA 4JNWA 1JAMA 2IW6A 3D4QA 3G6GA 3R28A 1NY3A 4OBOA 3RWQA 4BZDA 4KS7A 4EZ7A 2B54A 4FUYA 3U6IA 3QCSA 3OEFX 4MNFA 2B53A 4EH7A 4GJ2A 1F0QA 5I9XA 4L46A 4XLIA 5AV4A 3LMHA 5GHVA 2Y8OA 4LV8A 5E8UA 1URCA 4I24A 1JVPP 4LUEA 2Z2WA 4M66A 3ZRLA 2XB7A 5M56A 3OWKA 2PUPA 4I5HA 2ZDTA 4YTIA 3ZO3A 2P2HA 1KOAA 4NIFA 2B1PA 4DGGA 4N0SA 1LUFA 4A9TA 3PLSA 4MX9A 1M2RA 3AXWA 5DH3A 5FWKK 5CU3A 3LQ3A 4EOJA 5EM5A 4GMYA 4CFWA 4F6UA 1Q3DA 4C3PA 3MSSA 4HGLA 3U87A 5GJGA 5JK3A 4O7SA 3UVQA 2J0IA 3GCQA 2F9GA 1UU7A 4KIKB 4TXCA 4DH3A 3I81A 5FP6A 5LXMA 5DVRA 3WZUA 2PVKA 4ASEA 4FV3A 3LIJA 1R78A 2B4SB 2DUVA 3H30A 5E9EA 4C36A 1NVSA 5AA9A 1IAHA 4Z9LA 5KMLA 4YTHA 3H0YA 1DS5A 4EZ5A 4OAVB 5L4QA 4EC8A 5FUTA 4ANOA 5FBOA 4WT6A 1BL6A 3BLHA 2IZUA 1H1WA 2VTIA 2H8HA 4IAIA 4ZY6A 5IUHA 1WMKA 2W1GA 1JLUE 2VWZA 5F1ZA 3DS6A 3W55A 2GPHA 4A9YA 3N4UA 1RJBA 2ZV2A 4TYHA 4F63A 2VTOA 4L3JA 5KUPA 4AA4A 5AX3A 3UZTA 2VTHA 5JKGA 2WTVA 3PSBA 5B2KA 2XM8A 1J91A 2GS2A 2UV2A 4NSTA 3ZUTA 1YVJA 4DINA 3NAYA 4BCGA 3UO6A 3SG8A 3P7CA 2GQGA 3PXYA 3OWLA 3SAYA 3FAAA 3C13A 3GNIB 5AWMA 3A4OX 4H3PA 5K5XA 4YZ9A 1BLXA 2E9OA 3QGWA 5EI6A 4EOQA 2RL5A 2R3RA 3EYGA 3SRVB 4ACDA 5L6OA 4FIJA 4IX6A 4PDSA 1IRKA 2ZV9A 4QNAA 3TTIA 2XNNA 2O3PA 3A7FA 3BRBA 4BCPA 2QODA 3LCSA 3U6JA 4DT8A 1PKGA 4EQMA 3I0OA 4C02A 4BBEA 2ITOA 2WU7A 5BX0A 2BR1A 3SOCA 3GCSA 3MH0A 3VUDA 1MP8A 3VN9A 3DAEA 5HHWA 2B9HA 2V22A 3GQIA 3HGKA 4FGBA 4FL3A 4FV1A 3ZXZA 5D1JA 3SXFA 4QNYA 3DKGA 5DHJA 3H9OA 3QCYA 5IQHA 3DAJA 2BIYA 3FMLA 4G6OA 2BAJA 3TV4A 4BDBA 4Q9ZA 4GT4A 4I4FA 5FDPA 1OL1A 3VUIA 2X0GA 4ACMA 4MTAA 3R7YA 4AA0A 3MFSA 3NNUA 4ZTLA 4NM5A 3VC4A 3NS9A 4TW9A 4ANSA 1YHWA 4LV5A 3W8LA 2NRYA 3QD4A 3AD5A 2BFXA 4K77A 5C9CA 3VS1A 4RVLA 3A8WA 2X8IA 4N4SA 1PXKA 2R3NA 4GSBA 5CI6A 3QC4A 4GK2A 4FTRA 3ZH8A 2X4ZA 2QKRA 5D7AA 5TE0A 4G16A 1UU3A 4DEHA 4D5HA 3R0TA 3NNVA 3LVPA 4FKRA 5J7HA 2YHVA 4P2KA 1H26A 2YM4A 1Q3WA 2CN8A 2WMTA 3EB0A 5LMAA 4BTFA 3F66A 4W8EA 3VBQA 3QX2A 3QUEA 2ITVA 2BKKA 3GC9A 4PL4A 3KMWA 4AXAA 3AD4A 4CYJA 4GFMA 4XP2A 3F3WA 5FLFA 3NWWA 4X3FB 3FPQA 4EH4A 4G3DA 1O9UA 5EG3A 2WO6A 5I3RA 3TKUA 5EKOA 1Q61A 4O21A 4U45A 4H3QA 5DEWA 3TZMA 4C61A 5AR8A 2FVDA 4RQKA 2WU6A 4M7IA 3R30A 3FPMA 5E8VA 5ACKA 2X7FA 3VUMA 4EYMA 4JL9A 4UWYA 4ZK5A 3KXMA 5JQ8A 3FHRA 2X9FA 5EQEA 4QMSA 5EYMA 4MXCA 4O7ZA 1BKXA 3BGQA 3BYUA 4L6QA 4D0XA 1NW1A 5HO6A 1V0OA 4QT1A 2A2AA 4CZTA 4IJ9A 2ZB0A 1P14A 5ACBC 2GNIA 3SOAA 2X7OA 4ZXTA 4AT3A 4NW6A 2HZ0A 3ZSIA 3M11A 4LGGA 2V7AA 2R3MA 4FT5A 2VX3A 3W16A 3S0OA 3WE8A 3HA8A 4AU8A 4JVGA 2I0EA 3ETAA 3FKNA 3QQUA 4USDA 1WVYA 2QG5A 4KAOA 5KO1A 3ZM4A 3MIYA 2C3JA 4CMOA 5DLSA 3OZ6A 4ORKA 1PMEA 2CJMA 2JEDA 4YBKA 5AUYA 5E8YA 3FMHA 4RWKA 3MTLA 3U9NA 4C4HA 4I0TA 3GUBA 4E73A 4Z3VA 1PMUA 2QU6A 4PNKA 3RPSA 3ZONA 1Y6AA 4EC9A 5ETAA 4F09A 4YUQA 2NRUA 5BMMA 4FT9A 5DN3A 5EH0A 1REKA 4GIHA 5M4IA 2VTLA 5KBQA 2B0QA 3LLAA 3HV4A 4KSPA 4PDOA 4WNOA 2IZRA 3DBQA 2VO7A 2WOTA 3VRYA 4FEUA 1U4DA 4D4RA 2ZAZA 5JEBA 1QPEA 3C4ZA 5AR2A 3B2WA 4AZWA 3BQRA 3WOWA 1OPJA 4U81A 4A4OA 2HZ4A 3EMGA 3MW1A 4M8TA 5D7VA 3MH2A 2QLQA 4GK4A 2HK5A 3DZOA 3CJGA 4O7YA 3UMXA 4BCFA 2ERZE 3R8VA 1PYEA 4ZS0A 4YLJA 1PKDA 1ZMWA 1OKVA 4YJUA 4R78A 4J52A 5T68A 4F70A 4J97A 5HE2A 4AE6A 1ZXEA 2E9VA 4ANNA 3FWQA 3POOA 3PXQA 2R3HA 4HJOA 1YI6A 1Q8ZA 4LMNA 4PY1A 4UZDA 3F5PA 3MBLA 4ENYA 3FC2A 4G17A 5JFWA 3QCQA 1NVRA 3F6XA 2J2IB 5C8KA 4O86A 2JAMA 3VS2A 2HAKA 5HTCA 2DS1A 3OXTA 4EJ7A 1H27A 4ZAUA 4HGEA 4IM0A 1MUOA 4FMQA 5KBRA 2PUIA 4C4EA 2C6TA 4BCKA 3KFAA 2VO3A 3TNPC 4QTCA 4O82A 4YJTA 3ORXA 4KRCA 3RKBA 2C68A 4R3PA 5DPVA 1XKKA 4MD7E 1WVXA 3QA8A 4BZOA 2GSFA 2OO8X 3FXZA 5I9ZA 3E3PA 2JFLA 2XBAA 2XNGA 1BUHA 1IEPA 4UX9A 4ZMFA 4YJSA 4FR4A 4FYOA 5A6OA 3CPCA 4BI0A 2XKDA 4EK8A 2Q0BA 3LCOA 2GFCA 5AP1A 3N4TA 3QTWA 4M15A 3EQIA 3UMWA 3VW6A 5KMOA 5A4LA 4O1OA 4YHJA 3PVUA 1YI3A 3ANRA 4DFZE 3A7HA 3F2AA 3FL5A 5D11A 5D12A 3KGAA 1YOMA 2JIIA 4KABA 4PPCA 4AA5A 2WMSA 3ZO1A 4Q5HA 5EKNA 3AOXA 2PVMA 2XIYA 4F64A 5DI1A 5AMNA 4DFBA 3UOLA 5AJQA 2JDSA 2PMNX 3KK9A 4GG7A 3UQGA 2B7AA 5KCVA 4W8DA 3TNIA 1JQHA 3G0FA 3QL8A 2PPQA 3OG7A 5CSVA 5CXZA 5I3OA 3QTSA 4FBXA 2ETKA 3DNDA 3EFLA 5CYIA 3W2QA 1XH9A 3KCFA 4I6FA 5CVFA 5C4LA 2CSNA 2OU7A 3O50A 2YM7A 3ZLXA 4D1XA 3MN3A 4BL1A 5H3QA 4RX5A 3M2WA 2R3IA 2HOGA 2LAVA 3WBLA 5CAUA 5LMBA 2PE0A 5IEXA 4QMLA 3C4FA 4EH5A 3UNJA 4NKSA 4C7TA 1ND4A 1G8SA 4GVJA 4BDJA 4LRMA 3H3CA 2BTRA 5FXSA 1XH4A 4RA4A 3JY0A 3OFMA 3QC9A 4CFXA 4KUJA 3KVXA 4EHGA 3PSDA 4QTBA 2YIYA 3LMIA 1FVRA 2XK9A 2WZJA 2CGWA 4XMOA 4MD8E 4IVCA 1F5QA 4FNWA 3NX8A 5IUIA 4QP2A 4O91A 2J51A 4D2PA 2B55A 2CMWA 2UW5A 4FTTA 3I60A 2A1AB 4PMPA 2YM8A 3TACA 1IASA 2C6OA 3MTFA 1LEWA 3QYZA 2YA9A 3UDBA 1FVTA 2B9FA 1JKLA 3VUKA 2QOOA 3EHAA 3Q32A 4G5JA 1M52A 4LG4A 4KIKA 4UYNA 3VS6A 4FUXA 3KREA 2V0DA 1YXVA 2QOLA 4JG7A 2H9VA 4WG3A 3G33A 4GRBA 1MRYA 2OJGA 4D28A 1GIIA 2BROA 5CX9A 3EN4A 4TWNA 5AAGA 4NFMA 4EOKA 3S4QA 5H9BA 3EKNA 3KKVA 2UZNA 4K18A 1ZZLA 3UO5A 3E8NA 3COHA 2B9IA 3GU5A 5GZ9A 4UN0C 4YSMA 2BZKB 3NSZA 4KD1A 5GJFA 4ITJA 4K11A 4Y8DA 3P23A 5J95A 4ZLOA 3C5UA 1Y57A 4FTJA 4IW0A 1H1SA 3KVWA 5KHXA 3I5NA 2C0TA 5AP7A 3ET7A 3K2LA 3IW4A 4ZTHA 2R3OA 2HENA 1YDRE 2UW6A 3PXKA 4FSRA 2F7XE 2HY0A 2XF0A 3E92A 4FNZA 5HESA 1YWRA 3BU5A 3UTOA 5CAVA 2QOQA 2C1BA 3MY5A 3G9NA 4R6VA 4JAJA 4TPTA 5HIDA 3IW8A 4ZSLA 3DB6A 3HMMA 2JDTA 2VO0A 2HCKA 5IQBA 5T3QA 3R7GA 4FV2A 4YZBA 4FTNA 4NW5A 3BGZA 3VS5A 4QTAA 3GU7A 4CRSA 4HZRA 4PL5A 3CP9A 1YKRA 3HNGA 5EW8A 4H1MA 4F9AA 4RX7A 4EYJA 4NKAA 4MWHA 2ONLC 4CKJA 2OF2A 4HZSA 4QP6A 1VZOA 4ITHA 3CSVA 3PPKA 2PVHA 4MXYA 5LCKA 4BI2A 5CEPA 2BRHA 4IWQA 2XJ1A 4YSJA 3QKLA 5HIEA 3ZMMA 2UZUE 3ANQA 4FSZA 3ORMA 3BHTA 5M07A 2VUWA 1W82A 3R7VA 3C4WA 1H4LA 4USFA 1TQIA 4FSTA 4IHPA 3LFNA 2OSCA 4IH8A 3QWJA 4FKSA 4EONA 3UP2A 2WQEA 2O8YA 4IE9A 2JDVA 3F3ZA 2OG8A 3VQHA 4V05A 2XNPA 4NCTA 5AP0A 1QMZA 3MVMA 3GVUA 3CD8A 2JBOA 3E3BX 3NVKI 4S32A 2YM3A 4JDJA 4QMQA 4DBXA 3V5QA 4IVBA 5FRIA 3PY3A 5BVWA 3VIDA 2O65A 4U80A 4LL5A 4NZWB 3BHHA 3R9HA 2R3FA 3TL8A 3JXWA 2V55A 5F95A 1I44A 5J9ZA 3F5XA 2VRXA 3LJ1A 2AUHA 4RBLA 4QQTA 4BI1A 3T3VA 2WTIA 3EN7A 5IQGA 1RQQA 5JGAA 4YJRA 5H8EA 4GYIA 5BVNA 4Z16A 3TG1A 2BRNA 3PZHA 4XS2A 3UGCA 4IM3A 3A4PA 4L9IA 4RZWA 3CR0A 4GYGA 5HLNA 4KBKA 4WOVA 3EKKA 4V0GA 4YHTA 5AUXA 1OKWA 2CGUA 3OBGA 2XIZA 4JJRA 4U40A 2G2IA 1G5SA 4WSYA 3FLNC 3NYVA 4FTCA 1BI8A 5IDNA 3M1SA 4UV0A 1GZKA 3KB7A 2CCIA 4IVDA 4XG7A 4ZJJA 3ZO4A 4A06A 4AX8A 2Y6OA 4P4CA 5J5SA 1H1QA 2GHMA 1DAWA 3F2NA 3Q2JA 2PK9A 3FYJX 3GENA 2BRGA 2CHLA 2PULA 3VNTA 4AW5A 3MY0A 4QPAA 3R7EA 2CN5A 3PTGA 3R2BA 2QOIA 3UQCA 1ZMUA 5HORA 1UWHA 3DFAA 4JQ8A 4XRLA 1WBTA 3QQKA 1T46A 5C8NA 4RJ4A 3DXNA 4I23A 4BKYA 1V1KA 4DH7A 4RFYA 4TWPA 1WBPA 3HKOA 1Q8UA 3PA3A 4KNBA 2A19B 4K9YA 4EBVA 4YTCA 5A6NA 5AFVA 4YJQA 4E5BA 2J0JA 4ANLA 4P90A 2ZJWA 5HCYA 3WF5A 2WMAA 1K3AA 3COMA 4C8BA 3QWKA 3GU4A 2WMVA 4XYFA 2C5NA 2VNYA 4CRLA 1KUTA 3RMFA 4B8LA 2XMYA 5IISA 4QMYA 4G3GA 2IW9A 5M4CA 1V0BA 2R3PA 2CPKE 2J90A 5CY3A 5IQAA 2DQ7X 1Z5MA 1H8FA 2F57A 4UEUA 2G2HA 2QU5A 3GEQA 4DFLA 1W98A 5C8MA 1A48A 4X6RA 5ICPA 2PVNA 3PIXA 1FQ1B 3JY9A 3IDPA 4KKHA 2PZRA 3UC4A 3F69A 4WUNA 5I5ZA 4RZVA 3BEGA 4XP3A 3SLSA 3SRVA 3EQCA 1KV1A 4IB0A 1JPAA 3VVHA 2VWIA 2PVLA 5AEPA 4YO4A 3BKBA 3Q4UA 3QTUA 4WBOA 4X2GA 4BGQA 5CEKA 1YDTE 4J8MA 3CEKA 2Z8CA 2ZV7A 5DR6A 4M3QA 3U9CA 3C4CA 3F5GA 4U44A 3RM7A 5D10A 2IN6A 3COIA 4Q9SA 4XV9A 5FG8A 4JIKA 4O0UA 4U3YA 2W06A 5LWMA 3U4WA 1FOTA 4EOIA 1H00A 4A7CA 4AFEA 1Y8YA 4EHZA 1OIUA 2PWLA 3ZTXA 4L3PA 5EHOA 4OTIA 3CY3A 4CEGA 4EJNA 3V8SA 3LZBA 3DU8A 3QU0A 3QTIA 4OTPA 4AZSA 4YLLA 4FC0A 2XK7A 3E5AA 3EYHA 3OD6X 2BCJA 4IZ7A 3GOKA 2W1EA 1XH6A 3P08A 3VBVA 3LFSA 4UALA 2C1AA 3V01A 3KMMA 5B2MA 3T9IA 5HBEA 4L42A 4QYHA 2IVTA 1V0PA 3D5XA 5HVYA 4F6SA 5J5TA 3HEGA 2HYYA 5LCJA 3F2RA 4FG7A 4J8NA 5HE3A 2J4ZA 3OMVA 2YLEA 3P5KA 3TWJA 4RSSA 2WTCA 3NCGA 3SDJA 1FMOE 3JUHA 3Q6WA 4Y73A 5HGIA 4A9UA 4ALWA 4L00A 5CF6A 2YM6A 3MH1A 3UG2A 2VTNA 4HCVA 2G15A 1XQZA 3P1AA 4APCA 4J99A 3R7IA 4G3CA 4PMSA 4JR7A 3AC1A 3BYOA 3HRFA 2X9EA 4M12A 3PVWA 1QCFA 1AGWA 2ESMA 4FTAA 3DCVA 4AT4A 2OZAB 5TT7A 5F20A 2ITZA 4NFNA 3AC2A 3ENMA 3MI9A 3NYOA 4FVPA 1UA2A 4QQJA 4RLLA 5E8SA 4JDIA 3ULZA 3ZDIA 3DLSA 3ZSHA 2BVAA 3EWHA 4BRXA 4IB3A 4FEQA 1UKIA 1U54B 3ORTA 2ETMA 1L8TA 3MVJA 1R39A 4PP9A 5C27A 1URWA 2OIQA 5HBJA 4FZ6A 5JSMA 3P9JA 2VTJA 3E8DA 4WG4A 4E6AA 1YXSA 5CEIA 5DFPA 2G1TA 3BLQA 3ZLWA 2YJRA 3DQXA 3PLAE 3WF8A 1OL2A 2R3LA 3HA6A 4DH5A 5KMJA 3BLRA 2ITNA 5AUUA 4A4XA 2FSMX 3ORNA 3ZUVA 4A07A 1JKTA 3E8CA 5CSXA 4XG6A 1OI9A 2XNEA 3NUNA 2WMWA 4I0RA 3OS3A 3FI4A 2OH0E 3M42A 3OT3A 4C34A 3PYYA 5BVOA 4J98A 3KQ7A 3MJ1A 4MNEA 4BY9E 4CSVA 4PWNA 3CXWA 4YZDA 3QBNA 2J0KA 2P2IA 4QYYA 3KF7A 2Z7RA 4IVAA 3OWPA 3KA0A 4QTDA 5CU6A 3EOCA 4ANBA 3W8QA 2I0HA 4B7TA 4RFZA 4QYGA 1H0WA 5CF4A 1OMWA 5CU0A 3L1SA 4O0VA 1YRPA 3WIGA 3EQDA 1DAYA 4O2ZA 2R4BA 4OTFA 5IQEA 3QRUA 4GV1A 4FV6A 2VTQA 3UIUA 5BVEA 4UY9A 3TT0A 4CZYB 4ZSAA 4A4LA 3PP0A 3SXSA 4MBLA 5HG8A 2WKMA 4FV4A 4HVHA 4QPSA 3QD0A 3OT8A 3RINA 3GQLA 4LFIA 4NCTC 3D2IA 3E88A 3UVRA 1XH5A 4D0WA 4F1TA 4JRNA 3SVVA 1M14A 2JBPA 3O2MA 4MQ1A 4DG3E 3FKOA 3E93A 4O1PA 4QP8A 3TDVA 4JG8A 4J7BA 3W2OA 3ZZWA 5CASA 4ERKA 2PE2A 3GT8A 5IF1A 2CKOA 4D2VA 3HRBA 1YOLA 4E6DA 5J9LA 3ZBXA 1PXIA 2PMOX 4X21A 4ASXA 4WNKA 3A7GA 5JZNA 3O8TA 3BYMA 2WOUA 5CF5A 1YHVA 5DT0A 5E90A 4KKEA 4EK5A 2CGXA 2YIWA 4BDIA 4YU2A 4R1YA 5DT4A 2JITA 5IUGA 1SVGA 1GZNA 3N4VA 3WYXA 3C7QA 3WF9A 3KU2A 5KMNA 2XRWA 1GAGA 2FUMA 2J0LA 4BVUA 3BHYA 2GTMA 4WNPA 3PE2A 3Q9WA 4O83A 5EDRA 1Q97A 3V6RA 3W2SA 4O7WA 2UW7A 5HOAA 5LMKA 2R7BA 3NIZA 3ZZEA 5IPJA 5M57A 4FKIA 4BKJA 3D14A 3IW7A 2B52A 4YGAA 3GC0A 4U97A 2RIOA 3FI2A 5L8LA 4MEDA 3TUCA 3L8VA 3Q53A 5ANDA 1J3HA 3ZM9A 4E7WA 2XJ0A 3CTHA 5HCZA 3BZ3A 3UZRA 2VWYA 2V62A 3SC1A 4BB4A 2WQNA 3KRXA 4MQ2A 1IAJA 3PJCA 4W9XA 1JKKA 2EXEA 2QOHA 4CG8A 4IZAA 3WZDA 4LGDA 4QP4A 1ZZ2A 4ZTQA 4WRSA 1Q8TA 4IANA 4Y46A 4FGRA 4CG9A 5JQ5A 5H8BA 4L53A 1H01A 3PP1A 3PUPA 4C3FA 2OZAA 3F3VA 4E3CA 4FIEA 3CGFA 2J5EA 4HPTE 1KE5A 5EQPA 3PXRA 3B8QA 4J96A 3UBDA 4AZTA 4E5WA 2YCSA 5AA8A 4IWDA 5M08A 3Q4CA 4FK6A 4L45A 5IMXA 4AGCA 1HCKA 3ORIA 4D58A 4WBBB 1J7LA 1FBNA 5IQDA 4JBPA 1W7HA 2BIKB 4XEYA 2OJIA 3NGAA 4G9CA 4IC7A 4S33A 2BDWA 2WNTA 2F4JA 5H8GA 2VWUA 1T45A 2WMQA 4PTGA 3U8WA 3NW6A 3VS0A 1OIYA 4CYIA 1IA9A 3TNWA 2XIXA 3ROYA 4FKJA 2VTRA 4OTDA 3JR1A 5AIRA 3BI6A 1UNGA 3RALA 4EKKA 2PUUA 4F9BA 2GNFA 4Y72A 3DQWA 2NP8A 4CQGA 2CDZA 3D5WA 1YWVA 3SQQA 4I6HA 4K1BA 1ZLTA 3HDMA 4L67A 3FYKX 3QZHA 4L43A 3I6UA 4I6QA 3QX4A 5D41A 4RJ5A 4ZZNA 1MQBA 4M69A 2ZVAA 2WD1A 3DBEA 4OT6A 4BCQA 5IEYA 4FTIA 5E4HA 4MVFA 4HVIA 2XCKA 3FLZA 3MGYA 5EYKA 2F2UA 2Z7QA 5A46A 2V5QA 4D2TA 1M7QA 4HNFA 4PL3A 2OXXA 3AC8A 2OXDA 3RPOA 4DG2E 3FUPA 4EQUA 2R7IA 3PE1A 3BWJA 2Q0NA 4FTLA 3ELJA 5DR9A 3V5WA 3U6HA 3HP5A 4PF4A 3KULB 5IKWA 3ROCA 4G6LA 4KIPA 5HBHA 3CIKA 4KBAA 4RT7A 4C62A 2YDKA 3CQUA 4Z7GA 3VBTA 2X8EA 3E7VA 3IK3A 4QMMA 2W7XA 4NJ3A 2ITTA 2R0IA 4X2NA 4ZTMA 3PJ8A 3O51A 3QCXA 4FEXA 2WMXA 1J1BA 4Q2AA 4DTKA 1YXUA 1XO2B 4C58A 2BZIB 3D7ZA 3LE6A 3REPA 4CFMA 3GP0A 4YJVA 3PRFA 5E1SA 4JDKA 1KV2A 3GBZA 3THBA 5LVLA 2GHGA 1JOWB 2H34A 3AT3A 3MPAA 4MNEB 4XV3A 2ITUA 3R21A 4K0YA 3SW4A 4EKLA 4IAZA 4U3ZA 1NT2A 4XG9A 3BHVA 2WTKC 1GJOA 3UYSA 2E9NA 3C4EA 3AC5A 4ONAA 4M14A 3GFEA 3BPRA 3DK7A 1QPDA 2E2BA 2QOCA 4XBUA 4FA2A 4ZSJA 3MFTA 3HV6A 3TKIA 3ZU7A 5GINE 3RCDA 3FL4A 4O0WA 4OUCA 4YLKA 2PMIA 4FZ7A 4Q5EA 4GT5A 3LHJA 4K6ZA 5BQ0A 4QQCA 4FSWA 4MBJA 5JGDA 2QD9A 1Q41A 3DLZA 3IW6A 4RJ6A 1OZ1A 3HMNA 5FXRA 1ZYSA 4AT5A 1RE8A 3IS5A 5IQIA 4RC3A 4ALVA 3FZOA 1Y91A 5HQ0A 5ANOA 4C4IA 3DV3A 1XJDA 2WQMA 3ACJA 3QD3A 4I1ZA 4J53A 1ZYDA 4AP7A 4EH2A 4DCAA 4DTAA 5IQFA 2JIUA 4GK3A 3WF6A 2I6LA 2XEYA 3SW7A 5DR2A 3FZ1A 5BYZA 5K9IA 3FQEA 5EW3A 3VF8A 4HVGA 2W1CA 5HG5A 4FKWA 4QPMA 2W1ZA 3UVPA 5CI7A 5KX8A 4LOOA 4NK9A 4X2FA 4IAYA 4Y95A 4D9UA 2JGZA 3DKCA 4RWJA 3PJ3A 3TKHA 3DXPA 1KE9A 3MVHA 1XBBA 4BZNA 4DT9A 4IACA 2IVUA 4RC4A 2OK1A 2C69A 5IH5A 4I94A 1LR4A 2R0UA 4TNDA 3VS4A 3Q9YA 3RWPA 2HIWA 1Q99A 3VUHA 3ORKA 4D2WA 2C6IA 4LI5A 2XH5A 3AMAA 3HUBA 4OBPA 3WZKA 2VO6A 3ZFYA 4GVAA 1OBDA 3UOJA 2EB3A 3ALOA 4AGDA 4OLIA 3ZFMA 2UW0A 2WMBA 5J1WA 1IA8A 3ITZA 4ZY4A 5I0BA 4G3FA 4DC2A 3WARA
chains in the Genus database with same CATH superfamily
4IC8A 1WFCA 2EUFB 3F3UA 5I4NA 1IG1A 1BMKA 2WPAA 3IQ7A 2CKPA 4BGHA 3ZEWA 4FODA 4FSYA 2YWPA 4QMPA 4TZRA 3ALNA 4ZIMA 1W8CA 5CEOA 4FKLA 4DFUA 4QRCA 3TIYA 2OJJA 3IO7A 3AT2A 3DAKA 3DBDA 2R64A 3FEGA 3RTPA 3RPYA 1YDSE 2OIBA 4UMRA 4BWXA 2C6MA 2G9XA 4YZNA 4BF2A 3KN6A 4C4GA 3MYGA 3P7AA 4GIIA 4JAIA 3LW0A 3K5UA 4Z55A 2OI4X 1U59A 3PRIA 4ZLYA 2EU9A 3DTWA 5AR4A 3BBWA 4MXXA 3GCUA 3FC1X 1CTPE 3L9MA 2VWBA 5AV3A 3FLQA 3ZFXA 4B8MA 2OH4A 2IZTA 3TN8A 5EYDA 3ZSGA 4U79A 1L3RE 1OITA 1VYZA 3HVCA 3MJ2A 1JSVA 4XG8A 3ZEPA 2YERA 1MQ4A 5BMSA 4TYJA 2Y4IB 5A3XA 3F88A 4OTRA 3KL8A 3I5ZA 3O8UA 2QKWB 4AQKA 4FT3A 4N6ZA 2R5TA 3RAHA 2WAJA 5FM3A 3CJFA 4EHVA 2XK6A 5E1EA 5I9UA 3CBLA 3ZC5A 1FVVA 3ORZA 4RLKA 3SD0A 4AN2A 5GZAA 3V5TA 3BBTB 2JIVA 2W5HA 5L6WL 4DFNA 3V5JA 5AAEA 4HYHA 2UVZA 3UYTA 4C4FA 4MF0A 4EOSA 2RKUA 4IQ6A 5ANIA 2W5AA 1VEBA 3BYSA 3CQWA 3Q5IA 4MCVA 4NM3A 2WQOA 4L7FA 1YW2A 2UW9A 2PE1A 2WQBA 4XBRA 3A99A 4JIAA 3RPVA 3U51A 3LCTA 3LCDA 5L6PA 2QR8A 2O2UA 4FE2A 5B0XA 2UUEA 2XNBA 3SA0A 3UOHA 3Q5ZA 5F4NA 3AGLA 3IGOA 3VBYA 4DBNA 3AQVA 2Z60A 1BYGA 1ATPE 2YIQA 3CTJA 2RFSA 5A54A 2BTSA 2IVVA 5EOLA 4AN3A 5HEZA 1TQPA 4I4EA 5FEEA 4AAAA 5HTIA 5KKRB 3DGKA 1ZOHA 4HGSA 4CMUA 1NA7A 2VZ6A 3LFAA 4JQEA 2JKMA 3FZSA 4LYNA 4PDPA 4XV2A 1TFFA 2CNUA 3I7BA 4II5A 4FL2A 4NIFB 5FTOA 1WCCA 2BDJA 3R83A 4FIHA 4WHZA 3HV3A 4BHZA 4U0IA 4GH2A 3L9NA 4H39A 2KTYA 2WMRA 3PA4A 1W2FA 3G9LX 4BJJA 2FSOX 3POZA 4GJ3A 2RF9A 4BDHA 4CT1A 1YOJA 4H3BA 5L2SA 3G0EA 5CVHA 3ATTA 1VJYA 4E6CA 3UZPA 4XV1A 4F4PA 1ZYCA 1SVHA 2UVYA 5HO7A 5FEQA 3F9NA 4C38A 2BILB 5I9YA 4U43A 1W0XC 3RK5A 3ZCLA 4MWIA 4CLJA 5HE1A 4EUUA 1OGYA 4V01A 4IWPA 5KMMA 3Q4ZA 1TKIA 5HVKA 2QCSA 1KOBA 3OW3A 3R1QA 5IA4A 1K2PA 3UNZA 2YABA 5DEYA 3V8TA 4DGLC 4BBFA 3PJ2A 3CKXA 4IADA 4K33A 3MV5A 5IA5A 3G90X 3V8WA 4O22A 4EH3A 4I0SA 1W2CA 2PU8A 3W1FA 3QRIA 4M68A 3U54A 4BYJA 1P2AA 4IZ5A 3FQSA 4KIOA 5IMEA 5FEDA 3RK9A 5AP3A 4FOCA 2GNHA 2DWBA 4IEBA 4JBVA 3ZDUA 4AW1A 4DTBA 4XX9A 3SHEA 3ZLYA 4D4SA 3ODYX 1Q62A 4DFXE 4YP8A 4OTGA 5CQWA 3W33A 3FQHA 4L52A 3HRCA 4JOAA 3ZXTA 3OROA 2XEZA 3K5VA 4YNEA 2VU3A 1M2QA 4O0XA 2QHNA 3KF4A 4R5YA 3C9WA 2ITXA 3LAUA 3WYYA 3DTCA 2C6KA 1SNXA 1U54A 3OEZA 2X7GA 5H2UA 4FKVA 2VN9A 2VTAA 4B9DA 4K8AA 5AR7A 1S9IA 3HAMA 1OPLA 3KRLA 5L2QA 3U55A 3BIZA 3OCGA 1WAKA 4NM0A 4OR5A 3EZRA 4DYMA 1I09A 4X3FA 2ZB1A 3H9RA 1CDKA 3MESA 1H28A 2AC3A 5AM7A 3CKWA 1SVEA 4R3RA 4S30A 2WTWA 3VQUA 1M17A 4AACA 3DDQA 3P79A 3HV5A 5E8XA 1REJA 2X0OA 3GCPA 3V6SA 4A9SA 2HXQA 5E7RA 2XZSA 3DZQA 4AN9A 3VWAA 1F3MC 2UVXA 2YCFA 4FKOA 4ITIA 4XG2A 2QONA 1PJKA 4B4LA 4F65A 2IWIA 5CQUA 3MA6A 4ID7A 5J1VA 3QYWA 4ZLZA 2W17A 4N57A 4I92A 3NUAA 3W0QA 4FVQA 5CSPA 2GNLA 3A61A 4AOTA 4FV0A 4IAAA 4P5QA 2VNWA 2UZOA 2FYSA 3TCPA 3BQCA 3VONA 2UZBA 5L2WA 5CU4A 5DBXA 5EOBA 4BGGA 4GUBA 1JSTA 3KXGA 3IOPA 4O6EA 4F99A 4PV0A 5JFXA 4IM2A 3H9FA 4GKIA 4R3CA 4BYIA 4CLIA 3VBXA 5IH4A 3UQFA 4E26A 5L8KA 2Q83A 2SRCA 2UZWE 4FYNA 2CCHA 4DH1A 3PPZA 5ETCA 1MRUA 4FNYA 1OPKA 2C3KA 1UNLA 3KRWA 1FPUA 5ANGA 1U5QA 4ZEGA 4BCHA 2XALA 4FF8A 2P33A 5DIAA 1UU9A 2ZM3A 3PSCA 1H07A 5IA1A 5EHLA 3GXLA 4QD6A 1LEZA 4NT4A 3ZHPC 2HZNA 3QXOA 3R9RA 2RFDA 2QOKA 3QALE 3PZEA 2IO6A 1GOLA 3TNQB 4V0GB 4TWCA 4RG0A 2JKOA 3FV8A 3I4BA 4EORA 3DXQA 2PVYA 3EN6A 3R7UA 2BUJA 4AZVA 4JT3A 3DK3A 3PPJA 4G5PA 3RCJA 3VBWA 3PY0A 3VS7A 3FMMA 3BLAA 2BHEA 3AC3A 3AGMA 3O0GA 3R02A 3QZFA 3BGPA 3WZJA 4Y5QA 4H05A 2W9ZB 4LRKA 2R3JA 2ITWA 4RQVA 4CCUA 2YFXA 3D7TA 4ASDA 2XKEA 3NUYA 3ACKA 3CC6A 2BRMA 4DEEA 2O63A 1M7NA 3CGOA 5AR3A 5EHYA 1BI7A 2YCQA 4BC6A 5CALA 2CNQA 4C59A 3UP7A 4DHFA 5DNRA 4BDDA 2OBJA 3MPTA 3RAIA 5CTPA 2NNWB 5LARA 3FSKA 3H4JA 5A4EA 4HPUE 2F7EE 5CEQA 4F9YA 2GNJA 2NPQA 2W5BA 5HICA 4DDIA 3S3IA 5J7BA 4ZSEA 2J9MA 3LPBA 4ASZA 3FDNA 1SNUA 4F1MA 4WUAA 5JH6A 3MFRA 4JQ7A 4O0TA 4PMMA 1TZDA 4EH6A 4QQ5A 4EOPA 4IAKA 3SGCA 4FV9A 1BX6A 4W4WA 3LOKA 3C0HA 1O6LA 1SZMA 4FICA 5AR5A 2Y6MA 1ZYJA 3UNKA 4ZMEA 1Y8GA 4NL0A 3CCNA 4DAWA 3V04A 2C6DA 1GIHA 4DA5A 2ITYA 3D94A 4EOMA 3LFQA 4DGOA 1Z9XA 5DRBA 5HNBA 3E87A 2QLUA 3UDSA 3DOGA 2QR7A 1RW8A 4BDGA 3TJCA 2QI8A 4L01A 4YPDA 3NUSA 2C5YA 1GY3A 3RNYA 1DI8A 3KEXA 3EFKA 4AE9A 4M69B 4O7RA 5FTQA 4F1OA 4O2PA 2YZAA 2QURA 3FJQE 4RA5A 3R01A 1OECA 3R22A 4Y85A 5K5NA 3NNXA 3LXNA 5GIPE 3VW8A 4U42A 3SXRA 3ATSA 1E1VA 3OCBA 4TN6A 3KK8A 4PPAA 3ZRKA 2OJFE 4UBAA 3VUTA 4TWOA 3KXNA 4D1ZA 2RSVA 2FGIA 3Q60A 2Z02A 1U46A 4BBMA 4DEAA 2GHLA 5JFVA 4H1JA 1XBCA 2QVSE 5KZIA 3EQHA 3ORPA 4RIOA 3LMGA 5E91A 3ZS5A 3S1HA 2GS7A 3F5UA 4HCUA 4EL9A 3HMOA 2JKKA 2HELA 3OXZA 3UIBA 1ZARA 1QL6A 4AQCA 2OZOA 3EQRA 5HCXA 5HG9A 3V3VA 3R9DA 3RJCA 1UKHA 2REIA 4OTWA 4IX3A 4YJNA 4FKGA 3QTXA 3D9VA 4RPVA 4GW8A 4DEGA 4BIEA 4YBJA 5CAPA 4WD5A 4X2JA 5AP6A 2FSTX 1OVEA 5CZHA 4QYEA 3NYXA 5G1XA 3C51A 1XH7A 3OXIA 5DWRA 4GU9A 2YDJA 4DG0E 3OP5A 2UZEA 1PRYA 4E4XA 3R6XA 4JX7A 2XK8A 4RIWA 4C0TA 4AGWA 1H24A 5LWNA 4FZDB 2I0VA 4U7ZA 3SKCA 4G1WA 3W32A 3DJ7A 4KINA 4LOQA 4D5KA 5M4UA 2C3LA 3FZPA 4ZSGA 1CM8A 3MVLA 1VYWA 1JBPE 4KB8A 4PUZA 4QMZA 4CFUA 3D2KA 3RZFA 4FEVA 4W9WA 4QDEA 4UB7A 1LP4A 2FB8A 3AG9A 2OIDA 3RBWA 3BE9A 3KMUA 2W4OA 5G6VA 5AUWA 4BDKA 3BU3A 4C4JA 4YURA 4EUTA 3PJ1A 4NJDA 5FDXA 5FBNC 3FMEA 5AUZA 4PTEA 2XCHA 1H0VA 4P5ZA 1QPJA 2C6EA 3HYHA 4LOPA 5L2TA 1UNHA 4ZTRA 5TR6A 1Z57A 1H25A 3QTRA 4IJPA 3G2FA 3FLYA 3R9NA 4C2WA 3N51A 4CFFA 4E93A 2BMCA 4UXLA 3QHWA 2VAGA 4BDCA 3LM0A 1JSUA 3UIXA 5EM7A 4RIYB 5KKRC 2ZM4A 3NUUA 2C5VA 4DF3A 1KWPA 4CXAA 2C4GA 2OFVA 3ZOSA 2I40A 2ZFYA 3MWUA 4O96A 2AC5A 4FKPA 2X0PA 2FA2A 4LV7A 3FZTA 5DA3A 1E9HA 2WELA 4AUAA 1P5EA 1W84A 4E8AA 2JFMA 5B7VA 5M4FA 5TO8A 2OJ9A 3KRJA 3LXPA 4D4VA 3P78A 4LM5A 3QQJA 5A14A 3QA0A 2WXVA 2X39A 2A27A 5AP5A 3BYVA 4FV8A 4DITA 1NVQA 2YZLA 4FSNA 2BALA 2W05A 2J6MA 2P55A 4DEDA 4BCMA 2F7ZE 3EFWA 3SG9A 2QG7A 5C26A 2RGPA 3OVVA 2WFYA 4RX8A 4XNEA 3NW5A 5C03A 3SV0A 5C4KA 3TM0A 4FNXA 1UV5A 2VX1A 1OKZA 1Q4LA 1R1WA 4EWHA 4WNMA 4E4NA 5TF9A 3RAWA 2YAAA 3OWJA 1OGUA 3I6WA 3VS3A 4AOJA 4CFVA 1WBNA 2PZYA 4GFOA 3GGFA 4B99A 5LMKC 3PXZA 5LVNA 2X8DA 5J8IA 2GNGA 5AP2A 3P86A 2EVAA 2Y4IC 3QGYA 1WBVA 3C50A 2VD5A 3BV3A 3OY3A 4R8QA 4O6LA 2JDOA 3UOKA 4R77A 4BTMA 2QNJA 2EWAA 2ETRA 2XBJA 4U9AA 5LVPA 3LQ5A 3P7BA 4QP7A 3LQ8A 4DHIB 1STCE 4FV5A 4AW2A 4FZAB 4O0SA 5K0KA 2CLXA 4NWMA 3UPXA 4DLIA 3HAVA 2J50A 4FX3A 3UDZA 3S95A 4O0YA 1Q8WA 4RIWB 4EH8A 1J7IA 1PXJA 4O81A 3FSFA 3GC8A 3I0QA 2VX0A 4RGJA 4TRLA 2UZVA 2VGOA 3VJOA 3B2TA 5CU2A 3NYNA 3OUNB 3RGFA 4CMTA 4JLCA 4JRVA 3NVMB 4E6QA 3E64A 2I7QA 5BUIA 4G34A 5E92A 4A9RA 3NLBA 5AAFA 1P4OA 1S9JA 3O71A 4HOKA 4IFGA 4XCUA 4BCJA 3JS2A 4R7HA 4GL9A 3ZRMA 4JBOA 4G9RA 1GZOA 2I0YA 3GCVA 1A06A 4RFMA 2ACXA 5BNJA 4CKRA 2R9SA 2J5FA 4PQNA 2XIRA 5HNIX 3DFCB 5AUVA 2X2LA 4Z7HA 1TVOA 3LLTA 3TI1A 4GS6A 5EQYA 4QMUA 2HWOA 3GU8A 3EZVA 3ODZX 1OBGA 4U41A 4JG6A 5KE0A 3ZO2A 3FMKA 4EBWA 3GB2A 3D5VA 3P4KA 5GIOE 3F61A 1NXKA 3WIKA 4L8MA 5BUEA 4O7NA 1X8BA 3D15A 4LMUA 4RJ7A 2WGJA 4W4VA 3Q2MA 1DI9A 4MHAA 2W1IA 2X6DA 3L8PA 3QHRA 4PPBA 2YIRA 4WO5A 5IA3A 5EM8A 4R1VA 3ID6C 3ZYAA 1CKJA 3W18A 3LXKA 2X2KA 4EQCA 5DMZA 4OW8A 4IX5A 4ZZMA 4S2ZA 4O4FA 5LVOA 3O5AA 4N6YA 2XVDA 4OBQA 4DEIA 3PDTA 4O38A 3E62A 3GC7A 4NUSA 5EW9A 5FXQA 4F0IA 3OTVA 5IH6A 2HZIA 3HDNA 3NCZA 4H36A 3MY1A 4GEOA 4I5MA 5FM2A 3UODA 5M06A 3HECA 2VWVA 4FG9A 2GS6A 3OHTA 3Q04A 2Y7JA 3QD2B 2JC6A 3A7IA 4FIGA 3WZEA 4C3RA 4F7JA 4ZZOA 4I41A 2W4JA 3DNEA 3O7LB 2UW4A 4BTKA 3LFCA 3IDCA 5A4TA 3G15A 3PA5A 4YO6A 3C1XA 4M0ZA 5IZFA 3R8UA 2YCRA 4PX6A 3IONA 2XKCA 5FGKA 3WILA 4E5AX 1DM2A 4MXZA 2W1FA 2P4IA 2OLCA 5L3AA 3L8SA 3ZBFA 3AKKA 2WTKB 3I7CA 3CD3A 4XOYA 3T3UA 3RZBA 3ZLSA 3MFUA 1ERKA 2WIPA 4TYGA 3OC1A 1SYKA 5JRQA 2G2FA 3DK6A 1OIQA 5JFSA 1PXNA 1FGKA 3F7WA 1CMKE 4LUDA 3A60A 4YMJA 5AUTA 5HG7A 4HYSA 3EJ1A 3QF9A 3EQFA 4MBIA 4F9WA 2IW8A 2X81A 3A2CA 2VV9A 3BE2A 5AIKA 2ONLA 4RIXA 2Z7LA 4X3JA 3FI3A 4FT0A 5JT2A 3DT1A 4N70A 2PVFA 3ORLA 2FH9A 4Y83A 4CT2A 4YZMA 3QXPA 3UPZA 3R9OA 2GMXA 3JVRA 2Y0AA 4MKCA 3TNHA 3QFVA 2BPMA 4JI9A 2R2PA 3QRKA 2C5OA 4QP3A 3R1YA 4U5JA 2ZYBA 3W2RA 2XIKA 3KRRA 4FL1A 4MD9E 2X2MA 4G6NA 2XK3A 4G31A 2FSLX 4TKSA 4YC8A 3UG1A 3EQBA 3IDBA 3JYAA 3LJ2A 4DFYA 5JZJA 2J0MB 4BIDA 1XHAA 2OW3A 2PZIA 3ZUUA 2BZHB 3K3JA 3ERKA 3DKFA 1OIRA 4FTKA 3QQHA 2BHHA 4JDHA 1A9UA 3Q52A 4TL0A 2ITPA 2CLQA 4CVAA 3BU6A 4XHKB 4PMTA 5E8ZA 1CKIA 3F82A 5ETIA 4RWLA 1FMKA 2Y9QA 4W4YA 3LXLA 3TTJA 4CV8A 1OM1A 3HP2A 4BWPA 5BVDA 3QZIA 5HNGA 5CSHA 2ERKA 5L8JA 5AV0A 2OGVA 3Q96A 1Q24A 5GNKA 1WBSA 3D0EA 5AV1A 4V04A 4IZYA 1SM2A 4RJ8A 4U6RA 3R8ZA 1K9AA 2ZDUA 3HLLA 3PFQA 4CZUA 3DPKA 4FV7A 1VR2A 5LVMA 4RJ3A 5AADA 3T9TA 5IG1A 2JKQA 2CNVA 2GQSA 4PTCA 4I20A 5HLPA 4F6WA 5J79A 5JMSA 5K4JA 4EK3A 2UW8A 2XJ2A 2XYUA 5IDPA 5DRDA 4EOLA 3COKA 4BDFA 4F08A 4F0FA 2BZJA 3IPHA 2W9FB 4JS8A 3RNIA 4FT7A 4EEVA 4HCTA 2PUNA 4S31A 2OKRA 4XLVA 3L9PA 4YNOA 4DE4A 3BEAA 5CSWA 1E1XA 1R0EA 3OCSA 2QQ7A 4YJOA 1G8KA 4RMZA 5DGZA 4EOOA 4F9CA 3AKLA 4ZTSA 3D7TB 2R3GA 5A9UA 2W1HA 1G3NA 4NEUA 4EHEA 4DGMA 5CLPA 5FQDC 3HL7A 3FKLA 5CANA 4QMOA 3TJDA 5AV2A 4E4LA 3LM5A 3DJ6A 3CS9A 5D9HA 3E8EA 4ERWA 3W10A 3K54A 3KY2A 3NUPA 4E4MA 2JD5A 2RG6A 4RVTA 2XUUA 5HD7A 4QP1A 4O7TA 3W2CA 4L3LA 3TUBA 4RVMA 4UMPA 2E9PA 3HX4A 3GFWA 4TT7A 4ALUA 3R7OA 4O27B 2P0CA 5K3YA 5CAOA 3AT4A 5M55A 4YHFA 4W4XA 3FY0A 1XBAA 4CFNA 2CGVA 4BCNA 3R71A 4D1SA 2RFNA 4GFGA 2HWPA 4KA3A 4BIBA 5ANKA 5HO8A 1ZY5A 2F49A 4RIXB 1YWNA 3PIZA 3A7JA 3AMYA 3BX5A 3R63A 4J1RA 4GCJA 2UZTA 3FZRA 5ITAA 4ZS4A 2JAVA 4HYUA 4PRJA 4LGHA 3TV6A 4L7SA 4KWPA 3U4UA 4BKZA 3FI8A 1ZMVA 4F7LA 3KCKA 2R3KA 1SMHA 2PL0A 3GOPA 3OOGA 2R3QA 4RRVA 2BAKA 3RP9A 2VTSA 3NW7A 3V5LA 4CCBA 2RG5A 3PXFA 4AZEA 4WKQA 3QKKA 3MDYA 1ZY4A 3QLFA 4X7QA 3QUPA 4G3EA 5DE2A 1LPUA 4ARKA 1WZYA 2B9JA 2QC6A 3OOMA 3FLWA 4L44A 3PVBA 4M13A 4CD0A 4QMNA 4D2RA 1OUKA 4R7IA 3UE4A 5CT0A 1PHKA 4KSQA 4EK6A 5LOHA 3Q9XA 2WIHA 3GU6A 4JMQA 4XJ0A 4FTMA 3D83A 4D55A 4UXQA 1H08A 2JLDA 3PWDA 2QOBA 3ENHA 4FZFB 4FSUA 3EQPA 4JR3A 5KZ0A 5BVFA 2CKEA 3RI1A 4BCIA 3C0GA 2QO9A 4KIQA 4BICA 3R8MA 5IA2A 2BKZA 2WEIA 3QLGA 1PXOA 4UYAA 4XG4A 3NEWA 2PHKA 4D4YA 3MIAA 4M84A 5F94A 4JXFA 3MB6A 4XRJA 4BTJA 3TEIA 4CKIA 1B39A 1XH8A 4ANMA 4CNHA 2W1DA 3EL8A 3HV7A 4FI1A 4WRGA 5DOSA 5EK7A 2YN8A 4XH6A 2ITQA 2VTPA 5CENA 4C57A 4I6BA 5M09A 4EH9A 1TQMA 2YITA 1APME 4M97A 5A4QA 3E63A 3PG3A 4QMVA 3VULA 2YJSA 2CKQA 4I5CA 2YIXA 4WIHA 5JRSA 4KKGA 4JBQA 4KBCA 4IIRA 4X6QC 4YPSA 3P5JC 3MH3A 4TNBA 4IAFA 2J7TA 4O84A 1VLRA 2XNMA 2C6LA 4RWIA 3VHEA 4DLJA 1YXTA 5HVJA 3PG1A 5F9EA 2ZMDA 2BAQA 3R1SA 4UWBA 2FO0A 4MXOA 4YJPA 5GJDA 4IFCA 4FKUA 4PP7A 5BUJA 4CV9A 5AX9A 2C0OA 1YHSA 2XM9A 3L8XA 2Y4PA 3BELA 5IEVA 2IVSA 5J9YA 4OAUC 1P4FA 2GTNA 2JDRA 1FGIA 3MS9A 4J71A 2H96A 1UU8A 4XG3A 4DN5A 3O17A 5BVKA 2IF8A 3A62A 4O7LA 4FSMA 3Q3BA 1B6CB 2YM5A 3N9XA 4FEWA 2Z7SA 4I5PA 1GNGA 3JPVA 5HKMA 3PY1A 5CEMA 4ANQA 1JNKA 3KXZA 3FBVA 2XNOA 3JVSA 2YWVA 1UWJA 3Q6UA 5HZNA 3OY1A 4XUFA 3EFJA 2GDOA 3EH9A 2GFSA 4NTTA 2E9UA 3CQEA 4GU6A 5HX6A 4BFMA 3FHIA 4LDTA 2O64A 4LRJA 4LL0A 4DH8A 1OL5A 3CE3A 4K2RA 2EB2A 1GIJA 2BFYA 2EXCX 5ETFA 3KXXA 3R1NA 2IZSA 4FIFA 5BPYA 3TV7A 4E20A 4RX9A 4HW7A 4AAYA 2VWXA 4C37A 1Y6BA 3R73A 3PVGA 2PMLX 3W0MA 5HI2A 4RIYA 5FP5A 3KC3A 3FMJA 2BDFA 5T6KA 3MA3A 4FK3A 1YQJA 3AKJA 1YXXA 2KULA 3KN5A 4IXPA 2PVJA 2ZMCA 3PWYA 5ANEA 5CZIA 5KNJA 3RM6A 3BV2A 2XKFA 1PYXA 4H58A 1WBOA 5IA0A 3VO3A 3HMIA 5C1QB 2HY81 4OTQA 2HW7A 5K0XA 4L68A 1H1PA 1BL7A 3R2YA 3UJGA 4AFJA 1KE8A 4C33A 3NAXA 4I93A 3LFEA 1ST4A 4R5SA 3QQGA 5FTGA 1KE6A 2A0CX 2QOFA 2UW3A 3E7OA 2XA4A 3KULA 2H6DA 3NZ0A 4HGTA 3V5PA 4EK4A 4GUEA 2XARA 3QTZA 3TXOA 3FY2A 1ZOEA 2WEVA 1OKYA 4BR3A 4P7EA 5AM6A 2P3GX 3QKMA 5E8WA 3IOKA 4IWOA 5HTBA 3EIDA 3PIYA 4EZ3A 2C3IB 3NR9A 3VUGA 5B2LA 4YR8A 5M53A 3GI3A 2EXMA 1RDQE 2WB8A 2BRBA 5K4IA 3TDWA 1KE7A 4C2VA 4MXAA 4X0MA 3II5A 4NH1A 4AF3A 2C0IA 3MB7A 5E8TA 4OT5A 4OTHA 5HIBA 3TMOA 3RHKA 1J7UA 4B0GA 3RHXA 3EN9A 2XS0A 3IECA 5KHWA 3TZ7A 3CY2A 1H1RA 4EWQA 3D5UA 4FG8A 5CNNA 4FKTA 5HLWA 4FIIA 4NTSA 4U8ZA 4X2KA 3VJNA 4OGRA 4GKHA 4FTQA 2OF4A 4UMUA 3DY7A 1EH4A 2W99B 2C47A 3IG7A 4ZP5A 3EL7A 3VHKA 4ZTNA 4DGNA 3QQFA 3EN5A 5GZ8A 4F0GA 2XK4A 2YDIA 3R00A 5EDPA 3W2PA 3WI6A 3EQGA 4QP9A 4PDYA 4BJJB 1Q5KA 4KS8A 4XP0A 4I22A 4WG5A 5BYYA 2RFEA 4MK0A 1AD5A 3P0MA 4NM7A 4BDEA 2A4LA 1OB3A 2XP2A 3NIEA 4RC2A 2OXYA 3TUDA 4ENXA 1KSWA 2QHMA 3O8PA 2W4KA 5HX8A 5DYJA 2VGPA 4DCEA 1JWHA 4FSQA 4TTHB 3K3IA 2O5KA 3G5DA 1HCLA 3C0IA 5EFQA 1PW2A 2GU8A 4FTUA 4TYEA 1PY5A 4ZJVA 4HNIA 5CS6A 3UIMA 3OF0A 3CTQA 4IB1A 4D2SA 4AS0A 3OBJA 1PMNA 5KMIA 3KXHA 4ACCA 5DT3A 2W96B 4J95A 4AOIA 2W0JA 2V7OA 3KIOC 3G51A 3FE3A 4I3ZA 2ZM1A 3AC4A 4B6LA 1UVRA 4RVKA 4CQEA 4M0YA 2YLFA 5J87A 2F2CB 4KRDA 5I9VA 3FLSA 3OCTA 1U5RA 4YC3A 3QRTA 4NYEA 1JKSA 2OFUA 1GZ8A 2YACA 3NRMA 4YZCA 4QEBA 3RK7A 4E1ZA 4IDVA 2IPXA 2HW6A 4QMTA 4FOBA 5EI2A 5M51A 2IG7A 3LFBA 4UMTA 3QTQA 3T8OA 2LGCA 3R8PA 4AW0A 3QQLA 1ZWSA 3QZGA 1PXMA 4FKQA 4CTCA 3FXXA 3R04A 1R3CA 4FVRA 3HZTA 3C4XA 4TYIA 4TY1A 4X3FC 1FINA 1OUYA 4ZJIA 3RPRA 5CT7A 3NUXA 3VF9A 4WSQA 3O7LD 2YISA 3LCKA 5AP4A 1J1CA 3NDMA 3R8LA 3S00A 1OL6A 5CF8A 5C01A 2PZ5A 4Y5HA 5HE0A 3RVGA 2NO3A 5EM6A 3TZ9A 2OWBA 5L2IA 4EI4A 4IMYA 4MAOA 5FD2A 1PXPA 2QO7A 2VWWA 2VTTA 5ANJA 3SX9A 4AWIA 2PZPA 4YTFA 3FMNA 4G2FA 2XYNA 3DBFA 3BCEA 4S34A 2C5XA 3I79A 1O6KA 2IJMA 5CAQA 3Q9ZA 4AG8A 4ACGA 3AMBA 1M2PA 4BCOA 5HU9A 1CSNA 3F3TA 3HUCA 4GT3A 3NMUF 3HMPA 5JN2A 4YC6A 5CWZA 3H10A 4C35A 2ZV8A 4PNIA 2X6EA 3V51A 5TOZA 2PTKA 3C5IA 2PSQA 4QOXA 1XR1A 5I9WA 5LQFA 3A8XA 4I21A 3TZ8A 2X4FA 4R7BA 3B8RA 3LFDA 4IBMA 2WHBA 3DKOA 3BWFA 5BYLA 3IW5A 3UO4A 2GQRA 4IB5A 1R0PA 4DEBA 3NNWA 3CLYA 3MPMA 1G8AA 3LKMA 2UZDA 4NU1A 2ZOQA 4GG5A 2VTMA 4UZHA 3QAME 3BHUA 1ZOGA 2AYPA 3OTUA 4MF1A 4BHNA 3QUDA 4F7NA 2O0UA 2WTDA 3NFFB 2C30