3QRJA

The crystal structure of human abl1 kinase domain t315i mutant in complex with dcc-2036
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
263
structure length
258
Chain Sequence
KWEMERTDITMKHKLGGGQYGEVYEGVWKKYSLTVAVKTLEVEEFLKEAAVMKEIKHPNLVQLLGVCTREPPFYIIIEFMTYGNLLDYLRECNRQEVNAVVLLYMATQISSAMEYLEKKNFIHRDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNKFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERPEGCPEKVYELMRACWQWNPSDRPSFAEIHQAFETM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tyrosine-protein kinase ABL1
publication title Conformational Control Inhibition of the BCR-ABL1 Tyrosine Kinase, Including the Gatekeeper T315I Mutant, by the Switch-Control Inhibitor DCC-2036.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 88
structure length 258
sequence length 263
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2011-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3qrjA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3qrjA01
2XNPA 2YJRA 3C4ZA 3RZFA 3PIXA 4GVAA 5KMMA 3UG1A 1M7NA 5E91A 3HECA 4FL1A 4JI9A 5IA2A 3CD8A 2P2IA 4TW9A 3TZMA 1CKJA 1HOWA 4M3QA 4UMPA 4DA5A 2CKEA 3MGYA 4RWLA 4R7BA 1BI7A 3HVCA 4JBQA 2HZIA 3PJ2A 2OFVA 5T6KA 3UIXA 4R3PA 5IUIA 3PXQA 2YIRA 4O27B 5D9HA 4ITIA 1ZLTA 1OKVA 2ONLA 2JFMA 4KIPA 3EN4A 4CMTA 4NL0A 2UZUE 3SG8A 3OT8A 3R7OA 3DXNA 1ZRZA 4WG4A 2R7IA 3IK3A 4DTKA 4EWHA 2F57A 1REJA 1Q8YA 1PJKA 4HGTA 4FOBA 3W2CA 3ZEPA 3FKLA 4EOKA 1REKA 4F7NA 1ZZLA 2Y4IB 3A8WA 3E63A 3VF8A 3KY2A 3QYZA 4I22A 5BVDA 3DXPA 5IQBA 3E92A 3KXHA 4R1YA 4QMUA 4JT3A 2PZRA 3ID6C 4ZMEA 5LCJA 4R8QA 3C4XA 4YNEA 3WF6A 4O83A 1ZMWA 2GHMA 1H0VA 3MTFA 4HYSA 4X0MA 3R9RA 4NJ3A 3OVVA 2PPQA 5HO6A 3ZTXA 1A06A 5BYZA 2HZ0A 5ANEA 2IZTA 3A62A 4I4EA 3GC7A 4N57A 4FUYA 5HIDA 3MJ1A 3PIYA 2VTQA 5C27A 3DBFA 4IZYA 5AAFA 2IO6A 4PL5A 1UU3A 5F4NA 4EORA 3QTRA 3D4QA 4CFMA 2R7BA 3AT4A 5AV2A 3MYGA 4QMSA 4DT9A 2XKFA 3PJ8A 5CWZA 3TNIA 2BFXA 4IX6A 2BHHA 1Y8GA 4YMJA 1OL5A 3R1SA 3DFCB 4ZS0A 2V5QA 2OSCA 4BGQA 3NW7A 3ORKA 5EM8A 4F9CA 2XM8A 4D2WA 4BZOA 2WOUA 1QPCA 1YOLA 3FXWA 3VAPA 4C3PA 3VJNA 2ETRA 4HVSA 4GT4A 2I0HA 3KK8A 2IVTA 3KEXA 4W4YA 4RZWA 4YJQA 2WO6A 4FTMA 5A3XA 3ZEWA 2AC3A 3WBLA 3HRFA 1MP8A 5EYMA 2CGXA 5CENA 4RLKA 2YM8A 5ANIA 4DH1A 2Z7LA 1H00A 3SOCA 3IW5A 4I3ZA 2P55A 2QNJA 4WO5A 3V5JA 4QP8A 3GBZA 2VO6A 4JDKA 4GT5A 5BUJA 4BI2A 4F6SA 5FTGA 3A7FA 4KA3A 5J87A 3O17A 1K9AA 3BLHA 5I9XA 4RIXB 5J9YA 1H01A 4YZCA 3V8TA 2R3MA 4IH8A 4RA4A 2WELA 4IWOA 1Y8YA 3AOXA 4N70A 4ZTMA 2C3KA 2Q83A 5JZNA 3AT2A 3P78A 3PVGA 4IANA 2ITTA 3OWKA 3GVUA 4I0SA 4UWCA 2B4SB 2W4KA 3MY5A 4ANMA 2XP2A 3OROA 3L8VA 2EXCX 2UW8A 1ATPE 2X0GA 2WMVA 4FYOA 5AIKA 3G6GA 3RM6A 2VWVA 5AUWA 4D58A 2WIPA 3G0EA 1JWHA 2AC5A 2JDTA 3EKNA 4I94A 4MBJA 5FM3A 5AWMA 5JEBA 4RX5A 3RAHA 5E90A 4MAOA 3VBXA 2VO0A 1YOMA 5JGBA 5AP7A 4KWPA 2P3GX 5AR4A 3GC8A 3RALA 3TV7A 4DBNA 4YTHA 4XX9A 5IUGA 1XWSA 3BYMA 4AN2A 4MNFA 3ZLSA 5BUEA 1Q8ZA 3R7VA 4KIKB 5F1ZA 1ZZ2A 5CSPA 3ROYA 3TKIA 3QHWA 1AQ1A 3KN5A 2QO2A 3ROCA 2C6LA 2ITYA 1FGKA 1DS5A 3EMGA 4ASDA 2OI4X 2IJMA 1CKIA 2GMXA 3DBQA 4DEGA 3P86A 2YZAA 3MFSA 4P4CA 2CKPA 4TWOA 3AQVA 4QP6A 3DAEA 3F6XA 4K11A 3IGOA 4AWIA 1UKHA 2VWUA 5IA3A 2QG5A 4CFXA 4JG7A 3ZBFA 3FZOA 2A0CX 3EN9A 5FQDC 2BRMA 2X2KA 3NYNA 4FVRA 5C01A 3QTSA 4DLJA 4C0TA 4Z7GA 2DS1A 4J52A 3BRBA 4FT0A 4E6AA 1LUFA 2GHLA 4JR7A 3UNZA 4BIEA 2JDSA 2VTMA 5CEQA 5CEIA 5A4QA 2PE2A 2VWWA 3EFLA 3NCGA 4BYIA 1KE5A 4RLLA 4L46A 4CKIA 3HDMA 2QD9A 3LJ0A 4C4HA 2X7GA 2W5BA 4JG8A 4D9UA 3WYXA 3ZLXA 4EI4A 5M44A 1NVQA 3MY0A 5FWKK 4APPA 4EH2A 5M51A 2UZVA 4O82A 1YVJA 1ZARA 1OB3A 3W32A 2FYSA 4FTOA 3ZOSA 1QL6A 2PU8A 3LIJA 2PSQA 4AU8A 3HRCA 3FAAA 3ZM9A 4FTAA 4ZTQA 5L6WL 2Q0NA 1OPKA 4TWPA 4MD9E 3FDNA 3TNQB 2OLCA 5LOHA 2C5VA 2OJIA 5DR9A 3C4FA 3QXPA 4DC2A 3GUBA 4UX9A 4XG2A 3LFFA 3Q2MA 3K5UA 1WBVA 2HIWA 4QP1A 5CQWA 4TYHA 4ASXA 2EWAA 3UIBA 4FKTA 4IZ7A 3BCEA 3TWJA 5KBQA 3L8SA 3ZFYA 5CU0A 2W96B 4XLVA 4EYJA 3TUBA 4AW1A 2Y9QA 4HJOA 4BDBA 3A99A 4XP3A 2ITZA 2XJ2A 2BCJA 4NCTA 5EYDA 2X8IA 4DG3E 4EWQA 5JKGA 3R63A 3NW6A 4U3ZA 2YISA 3RI1A 4A7CA 4AFJA 3NNUA 5L8KA 3U54A 2UW6A 3FPMA 4OBOA 3DPKA 2W4JA 2CKQA 1KOBA 4YBKA 3AMAA 1UWJA 4QOXA 4GT3A 3UNKA 5I9WA 3GQIA 1RDQE 3SA0A 1Z57A 4LMUA 1SNUA 1TVOA 5HLNA 4S32A 2ZV2A 2HCKA 4IHPA 1G8AA 3FSKA 5E1EA 4AZVA 5D7VA 4ACGA 5AMNA 5H9BA 3RKBA 2WMWA 3DCVA 1X8BA 4DLIA 5KZ0A 4C34A 3QQFA 4JIKA 2H96A 3MJ2A 3O8PA 4CXAA 3FZTA 4FODA 1YI6A 3Q96A 3SW7A 2XEZA 3MIYA 2VX0A 3WF8A 3H9OA 3A8XA 4QQTA 1Q61A 2W1EA 4EH6A 5JMSA 2EU9A 2QOQA 3I7CA 2ITPA 3VRZA 1YHVA 4DH3A 2C3LA 4ZTLA 3ULIA 3P7BA 3RGFA 2ZJWA 2B54A 5M57A 3PZHA 2AUHA 4JX7A 5B2MA 1VZOA 3U87A 3MVJA 5B0XA 1OKWA 4MF1A 3R28A 3ALNA 3U4UA 5KBRA 5A6OA 3HP2A 1T46A 2XMYA 3LFAA 2YFXA 4HGSA 3ZZEA 3TNHA 4D2TA 5EKNA 2FA2A 2Y6MA 3QQLA 4RVLA 3NUXA 4CG9A 4EK6A 4PP9A 3CTJA 5A46A 4KKGA 3U9CA 4K1BA 5HLWA 3N9XA 5LVPA 4V01A 4DHFA 2F9GA 2VNYA 3HMNA 4B4LA 1ERKA 2ZM3A 1UU8A 4MQ1A 3E8DA 1DM2A 3PSBA 5DR2A 3FLQA 2YWPA 5TF9A 3F2RA 2WTKB 1UWHA 2HXQA 2YDKA 3R8MA 4DGGA 3E8EA 5HTCA 5BYLA 2HAKA 4EJ7A 4ZTHA 4WKQA 1YI4A 1SVEA 2BHEA 1V1KA 1XQZA 2VO3A 2XS0A 4RMZA 1GZKA 4CZUA 3R22A 5I9YA 3CTQA 3F5GA 4I5HA 4EC9A 5HU9A 2HXLA 1URWA 4F65A 2ZVAA 4R1VA 2QOCA 2VTTA 2IZUA 3OUNB 3GCUA 4R6VA 1K2PA 3NS9A 3LW0A 1CKPA 1OKYA 1L3RE 4KB8A 4MXZA 4UYAA 2YN8A 4W8DA 5LXMA 3GB2A 4Y5HA 4DFYA 2A19B 4L53A 4NJDA 4PQNA 2J7TA 4H58A 4XBRA 4IW0A 4QYEA 4IVCA 3ZZWA 4BDJA 3W8LA 3HAVA 3DTCA 3L8PA 1M2PA 4QNYA 4KBCA 4HVIA 3C5IA 2XUUA 1JVPP 5I3OA 4JVGA 3ZXZA 3DKGA 3GU6A 2HZNA 4AXAA 2CNUA 2J0IA 2Y4PA 4FSRA 3CQWA 2XEYA 1FGIA 4TYGA 3LMHA 3QTUA 4X3FB 3FC1X 4D5KA 3QCQA 2QC6A 3LFQA 1F3MC 4Q9ZA 2VTSA 2VTOA 3OBJA 4BIDA 1V0BA 4FSYA 3RM7A 5GIOE 3IO7A 3ZUUA 4LL0A 4FSNA 4IFCA 2O63A 4YZBA 3CY3A 5DH3A 4NH1A 2X1NA 4QMOA 3WARA 4D28A 1W82A 4FKVA 5F9EA 1W83A 2JGZA 4YZ9A 1P4FA 5IMXA 5FBNC 4F7JA 4DT8A 2IW6A 1FPUA 4EOOA 4ORKA 2FVDA 3NUUA 3Q9ZA 4ITHA 4O6LA 3KRLA 4XUFA 2GQGA 3FMKA 4KINA 3FMMA 4AOJA 4FG9A 4OTPA 5LQFA 3KULB 4PNIA 4EZ5A 2YM3A 3COKA 3GGFA 4BHNA 4F1OA 1O6LA 3QYWA 2B53A 2OZAA 2YZLA 1MRVA 2XK3A 1IRKA 4JIAA 1WBPA 4PTEA 4EK4A 3PDTA 1CM8A 2W06A 5DWRA 1WBTA 3QRJA 5KMOA 3G33A 3L8XA 5GZ9A 5HE3A 2VTHA 4EL9A 1BL6A 2CGWA 4FSWA 3R02A 3TV4A 3V8SA 4OTDA 3I6WA 3QZHA 4CCBA 4KABA 4TPTA 4MF0A 4BCJA 2W1DA 1HCLA 3ZFMA 1W98A 1WBWA 1R0PA 4J71A 3DDQA 5CX9A 4G3DA 5FBOA 2QURA 4EKLA 3IOKA 3L9NA 1QMZA 5JT2A 4UN0C 4ZLOA 4YC8A 1WMKA 2Y7JA 4F4PA 3G5DA 4NM7A 4I0TA 5E9EA 2BTSA 2BRGA 5AR2A 2A2AA 2C6OA 3NR9A 2GFCA 2GHGA 3R73A 5DE2A 3SDJA 4F9YA 3FI4A 2ZM4A 3QQGA 3RK9A 2BRBA 3PRIA 2WU7A 3UGCA 4YURA 3BEGA 3HAMA 4CRSA 1JKSA 3A4PA 5AP6A 2YLFA 4YJPA 3KCKA 4JQ8A 4U81A 1V0PA 4BCOA 5BVNA 3TXOA 3QUDA 4FKRA 4LGDA 2QQ7A 2WFYA 3KA0A 3PLSA 4FC0A 4C4IA 3NSZA 3ZSHA 2RIOA 4AT3A 4CQGA 5CAVA 4LM5A 5K4IA 4OUCA 3OP5A 2PWLA 4IACA 3CPBA 3PE2A 4AS0A 3GNIB 4IDVA 4F1TA 1FMKA 5DRDA 4FNZA 3U55A 4MYGA 5AA9A 3D14A 2CN8A 2OIBA 3NUYA 3UBDA 4LMNA 4B8MA 3VUIA 3LMIA 3KK9A 2QI8A 2WPAA 1Q3WA 3E8NA 4MXOA 3UOHA 4PPBA 1QPJA 3AG9A 3IKAA 5HI2A 5HG8A 3H4JA 5CLPA 4AW2A 2YCRA 4P2KA 4EZ7A 2V55A 4IVDA 4OBQA 4RWIA 3U9NA 4IDTA 3FYKX 3GEQA 5HX6A 3SV0A 4D55A 4EH9A 4QRCA 3B2WA 4W8EA 1PY5A 2X4FA 4PRJA 4PWNA 3IGGA 2GNJA 2CLXA 2ZM1A 5ETAA 4FNYA 1H1RA 4YZDA 2F4JA 4FVPA 3KMWA 3UZTA 3R6XA 4XH6A 3FV8A 3NEWA 5CAUA 5HKMA 4R77A 4KBKA 3P9JA 5CVHA 4G6NA 4DBXA 3A4OX 1YKRA 3KL8A 3DAJA 4CMUA 1QPDA 5EW3A 4EJNA 1XH7A 5HOAA 1PRYA 5FGKA 2R3KA 4FKLA 3HX4A 4M66A 4G5JA 1JSVA 2UZDA 4F0IA 3F3ZA 1STCE 4O1PA 5CT0A 4O38A 4X2NA 3ZHPC 2XBAA 3RWQA 3MFUA 5DFPA 3EFJA 4XBUA 3CEKA 3NW5A 4QMTA 4XOYA 2PE1A 3FMHA 3KXZA 4E4MA 4X2JA 4MNEB 4N6YA 2FSMX 4O0SA 5E1SA 5AAGA 4AT4A 4FEUA 4DGMA 5ACBC 3ZYAA 1SVHA 3VUHA 2EVAA 3L9MA 2XKDA 5HCZA 2GU8A 3DFAA 2ACXA 2WQEA 3SX9A 4ZOGA 4FGRA 1H1WA 3R00A 3CE3A 3EWHA 4L9IA 3WZDA 3FLZA 3JPVA 4C3FA 5A9UA 4PMMA 1B38A 3NNWA 2PUPA 5M09A 1XKKA 2YCSA 4C7TA 2XBJA 3P1AA 2XNNA 2VWBA 1ZYDA 4MD8E 1XBBA 2YITA 1OUKA 3RPRA 4N0SA 5C9CA 4IX5A 1KE7A 1RJBA 4HGLA 2ZMCA 3QCSA 2X8EA 1XHAA 4KSQA 3UQCA 4EBVA 1U4DA 2HW6A 4PMPA 3OFMA 4HVDA 4GKHA 1ZY4A 2JDRA 3ORMA 4FF8A 3PPZA 4L52A 3CR0A 4QPAA 3RTPA 3W2QA 4EOSA 3MESA 2IN6A 2PY3A 5K3YA 3R7UA 3I81A 4P5ZA 4IMYA 3VS0A 2YDJA 3QQHA 4XG6A 4O7ZA 2GNFA 3PXKA 3CGFA 2QU6A 4Q5EA 1U54B 1FQ1B 4GVJA 3QTQA 4UMTA 3VS4A 1WBSA 3QU0A 3OCSA 3MH1A 3QTIA 3FHRA 3IDCA 4ZEGA 3TZ7A 4GG7A 4RWJA 5KCVA 2EUFB 3QFVA 4FV1A 2UUEA 3F3WA 3QTXA 5M55A 3SXFA 4XG7A 2R64A 4KBAA 3HA8A 3ACKA 5FUTA 2I0EA 4NW6A 1BI8A 2JDOA 4F0GA 5M07A 2G2FA 2YCQA 4LYNA 4BFMA 2VTNA 4I41A 5E7RA 1PKGA 3VS5A 3BHHA 3COMA 3BU5A 4PUZA 3FLNC 3WIKA 4GFMA 2FGIA 3EL7A 1R39A 2YJSA 4J1RA 5HQ0A 2CCIA 3Q9WA 4KRCA 5L2WA 3GFWA 4L7SA 2XYUA 3DU8A 5C1QB 3Q9XA 5ETIA 2ITUA 1RW8A 2XK9A 3HA6A 5HG7A 3W33A 4EZ3A 4RJ8A 3BYOA 4BCPA 3DJ7A 4MEDA 5HX8A 3PVBA 4M69B 4BL1A 4O0TA 3TDVA 4NIFA 3OUKA 4GK4A 2GNLA 4FV0A 4E5BA 5LWMA 1Q41A 5FP5A 3R2BA 3ODYX 1PHKA 2XA4A 2YAAA 5LVLA 1H1PA 4YPSA 1OZ1A 2ITQA 4FSTA 2ERKA 2PZIA 1QCFA 5EQYA 5J5SA 3V01A 3DLSA 4KNBA 2H6DA 1JSUA 2YIWA 4QMLA 5EKOA 5CS6A 1LPUA 3HMOA 5JK3A 3VIDA 4RFZA 4O7YA 1KE6A 4FIGA 3PG3A 4FK3A 1PMNA 1OL1A 2DQ7X 4GSBA 4G16A 4AGDA 4DINA 4J98A 3H9FA 4MXAA 4BKYA 2VU3A 3EH9A 2WQBA 1P5EA 5A4EA 3QA8A 2BZIB 3GCVA 4QMXA 5AP1A 4WRGA 2RFEA 4TYIA 5HBEA 5L4QA 3UOKA 4BHZA 3LQ3A 5HD4A 1W0XC 3E88A 3EZVA 5ANGA 2YWVA 4IAIA 4YJOA 3BHVA 1SMHA 4EC8A 3E3PA 4A4LA 2R3PA 1KV1A 1TQPA 3BBTB 4GG5A 5IG1A 1L8TA 4CFFA 3UZRA 5H8EA 1EH4A 2RKUA 1UA2A 4FTKA 1IA8A 3HMPA 4FG8A 2DWBA 4U80A 3UP7A 4HVGA 3RAIA 5A6NA 2BROA 1ZOHA 3DTWA 3R1NA 1JBPE 2W99B 5EI6A 1Y6BA 3W2PA 5J1WA 2V7AA 3FHIA 4FL3A 2BDWA 3QRKA 4L3LA 5AUVA 1OPJA 2CJMA 3BHYA 4QT1A 2VTAA 3GU7A 4IAYA 5DRBA 4JLCA 5E8TA 4LGGA 5ETFA 1ZMVA 5HE2A 5L2SA 4YJNA 1XH4A 4BN1A 2HK5A 4FEWA 3NPCA 4FTTA 4RC3A 4AAAA 4O7RA 3UJGA 2ZYBA 4E3CA 1LEZA 1WFCA 4A4OA 4G9RA 3OW4A 2R5TA 5LVNA 3R8PA 3H3CA 1XH8A 2R9SA 4QTCA 5BX0A 1IR3A 3OT3A 4USDA 5L8LA 2J90A 5AP2A 3NYVA 3UMWA 3D0EA 4ZTNA 4PDOA 1R0EA 5J95A 3CPCA 5AUYA 5IEVA 2BALA 5M4UA 5IQDA 1ZYLA 4I6BA 1E9HA 4C3RA 3GU4A 1FVVA 3F2AA 4YC6A 3SVVA 1UVRA 5T68A 3R04A 4HPTE 4I24A 1KOAA 2BDJA 5IA4A 5DYJA 2GNGA 5FEDA 2QOIA 3CC6A 5KZIA 3HEGA 3HGKA 4AA5A 4RIWA 4I6QA 4TYJA 4K18A 5B7VA 3HP5A 2YIYA 4MKCA 4LRKA 2GQRA 4RT7A 4TRLA 4AW0A 3QCYA 5CXHA 4B6LA 1PXIA 4LRMA 4S33A 5B2KA 2HWOA 3JR1A 1OKZA 4YHJA 2R4BA 4JAIA 4XCUA 4LG4A 3DNEA 4Z7HA 3HV4A 3PWDA 4KS7A 4IWQA 1ZOEA 3TACA 5J8IA 1M2QA 4FT5A 5FP6A 3NLBA 5KKRB 5IDPA 2O8YA 2UZTA 3E64A 2YM6A 1KUTA 5E8WA 5L2QA 4AT5A 3LFSA 1IEPA 5BMSA 3TT0A 3DNDA 3UMXA 4QP4A 3QD3A 3R21A 3V8WA 3RNIA 2OJ9A 1BMKA 3AD6A 4PPAA 3GI3A 4FV2A 2W9ZB 5HNBA 3ATTA 3Q4CA 1BUHA 4XLIA 4YHFA 3W2OA 4AX8A 3MFRA 4CFNA 4D2RA 1KSWA 4IJPA 3VF9A 3QA0A 3VW6A 5JRQA 2WTVA 2WNTA 4EOJA 2OJJA 4L6QA 2C1AA 3EZRA 4DG0E 2QHMA 2XNBA 5KNJA 3Q4TA 5BVFA 4LI5A 5AUZA 2BAJA 1Z9XA 2W1IA 2QLUA 2UVXA 3VS3A 4GEOA 3Q9YA 5IF1A 3UE4A 2VX1A 4E4XA 4FIHA 5BQ0A 1URCA 5IQAA 3QZFA 4JDHA 4J8NA 4OAVB 4XMOA 3WF9A 5EH0A 3VS7A 4WD5A 3KB7A 3T3VA 3C5UA 5AR3A 5BYYA 4DEDA 4DE4A 2WMQA 3RK5A 3DB8A 4QTDA 4ZY6A 5M53A 3EHAA 4OBPA 4R78A 4BDCA 3OOGA 3A61A 3V5TA 1AD5A 3MVHA 3MB6A 4YJTA 4RPVA 2YAKA 4ITJA 1Q8TA 2JEDA 3FLYA 3QWKA 4L45A 3N4TA 5D1JA 4EK3A 2WOTA 1H25A 2F7EE 4K77A 4BCFA 4IX4A 2B7AA 4FT9A 3V5PA 3O96A 4HYIA 1P14A 3CXWA 1YW2A 4OAUC 3FPQA 1MUOA 2Y4IC 5FXQA 3FE3A 1J1CA 2H8HA 3BLQA 3G51A 3OMVA 1GZOA 4RC2A 3NNVA 4UALA 4WBBB 2ETKA 4LUDA 4HOKA 2J0LA 5AUUA 2PE0A 1MQBA 4IZ5A 4RC4A 3ZC6A 4IVBA 3KRJA 3ZSGA 3GC9A 4B9DA 4QTEA 4O7VA 3M11A 2WTCA 5LMKC 4WBOA 3GOPA 3R30A 3LFCA 3VHEA 4BVUA 4AACA 5J9LA 2WAJA 4HZSA 2R0IA 4PMSA 5H8GA 4D0WA 3ZCLA 4U43A 3PJCA 2O0UA 4O0XA 5ACKA 2QODA 3LLTA 3PXFA 2OO8X 4WOVA 4C62A 1NT2A 4AW5A 3D2IA 3MY1A 3EYHA 4CRLA 3WF7A 5CSHA 3PVUA 3LPBA 5HIEA 3RAWA 5I4NA 3NYOA 4BDAA 4RJ7A 2E9NA 3QLGA 3SW4A 2PK9A 3NVMB 4BYJA 2IVVA 3BYUA 3QZGA 3RPOA 1AGWA 2O65A 3MB7A 1Y91A 2IZSA 4DFBA 3UODA 5IH6A 3C0HA 3KF4A 4KSPA 4NT4A 1WCCA 1YXTA 3GC0A 3FLWA 3EQCA 5CAOA 2ZOQA 2BZHB 4EOIA 3TJCA 3O0GA 1LEWA 3COIA 3HV6A 3OF0A 4I20A 5E8XA 4CV9A 4R3RA 4NKAA 4FKPA 5CXZA 3SG9A 3DK6A 3ET7A 2PZPA 1GOLA 3DY7A 4AE6A 3S0OA 4QTBA 3MIAA 3SRVA 1WAKA 3NDMA 3OTVA 4L3JA 5DR6A 3WIGA 4ZZMA 1Z5MA 5IA0A 4IAZA 5ITAA 3BEAA 4Q2AA 3TIYA 3H0ZA 3O23A 4GV1A 4ZS4A 4GIHA 4DN5A 3I7BA 2R3IA 2CKOA 2ZAZA 1KWPA 5LARA 4BDGA 4EH5A 3EIDA 1UV5A 3P23A 5KO1A 4B0GA 1HCKA 4YTIA 4MXXA 3WZEA 1E1XA 3L1SA 4RIYB 3ZRMA 4DH5A 3C51A 3FLSA 3CLYA 5AP3A 4O7TA 4JL9A 5CVFA 4EHGA 3DBCA 2GS6A 4NTSA 3BYVA 4IB0A 4FZ7A 4MVFA 3C0IA 5CAPA 4E1ZA 4QTAA 3QKKA 4WUAA 4ZY4A 2UW9A 5HGIA 1M7QA 1ZAOA 3LJ2A 4TNDA 1WVWA 3NZ0A 4NTTA 4AN9A 4FZAB 4USEA 2VWZA 1UKIA 2NRUA 4TL0A 2ESMA 4GS6A 2C47A 3OEFX 3V3VA 3EQRA 3LLAA 4TZRA 4I92A 4RGJA 5GJFA 2F7ZE 3FSFA 5IQEA 3C4WA 4FZ6A 3LXLA 3E3BX 4C4JA 4RFMA 3ZO4A 1VYWA 4ACCA 3HRBA 4BCKA 3UC4A 4D0XA 2W5HA 1OITA 3PTGA 4APCA 2PYWA 2XIZA 4Y72A 5HVYA 1DI9A 3UTOA 2OK1A 5FXSA 4E7WA 5KX8A 2R3RA 2JLDA 3NRMA 2FSOX 3D7TA 4M68A 4G3CA 1WVYA 3D94A 2HYYA 3UIUA 3Q32A 4PL3A 3NMUF 2Z8CA 4S30A 3FZ1A 2QOHA 4WNPA 3LMGA 3O7LD 2J5EA 5FDPA 4J53A 5TR6A 1PW2A 3PA5A 2B9FA 2C3JA 3QTZA 4BB4A 4DFXE 1T45A 3V5LA 4FV8A 5C26A 5C4KA 4RIOA 4ANBA 1FOTA 2C0OA 4UMUA 3U6IA 5JZJA 1MRUA 2B52A 3Q04A 2ITWA 2V22A 5TKDA 4YJVA 3U51A 4Z16A 4OTQA 2WHBA 2OW3A 5M56A 2HW7A 2IPXA 5IA1A 2QKWB 5I0BA 3FKOA 4CKJA 3EQGA 5AR7A 2Y6OA 2C5YA 3BV2A 3CTHA 3KC3A 3D9VA 4PF4A 5C8KA 3TDWA 2JKQA 4B8LA 2IWIA 2JKKA 2Y0AA 3K3IA 3M2WA 4L42A 1OIUA 4M15A 5D11A 5ETCA 3RMFA 4CFVA 4X6RA 4I5CA 2ZV8A 4V0GA 2PVNA 4CSVA 5IU2A 4FSUA 4UMQA 3H9RA 4IQ6A 4MWHA 1R78A 4JRNA 3ORIA 1G3NA 1GZNA 4DEEA 3AD4A 2OWBA 3UC3A 4F99A 4DCEA 5K4JA 4FX3A 1U5RA 3S2PA 3S95A 3TV6A 1F0QA 4AZEA 4IAKA 3MV5A 4BKJA 3FI3A 1YRPA 4XS2A 3LXNA 2ETMA 2W05A 3UQGA 1J91A 3ZC5A 4BF2A 3LCSA 1SZMA 5KE0A 3N4VA 3LFEA 4FSQA 4G17A 4LOOA 3CJFA 3BX5A 3POOA 4FG7A 3F69A 4EH8A 2YDIA 5EYKA 5CF8A 5BVEA 3LVPA 3OOMA 3A7GA 1OMWA 3P7CA 3POZA 4Q5HA 3I0OA 3DZOA 4QMYA 3P0MA 3DB6A 4U41A 3ENHA 2QO9A 4ZK5A 3BLRA 3G15A 4DFLA 3RCDA 3F5PA 2NPQA 4C61A 1WBOA 2G1TA 3QBNA 4NW5A 1O6KA 3LFBA 5J5TA 2J0JA 4DEIA 1OBGA 3DKCA 1YI3A 3Q53A 3MPTA 3THBA 5DHJA 3QRIA 4AZTA 3LCDA 4GMYA 3M1SA 4K8AA 3B2TA 4PDPA 3V04A 1NVRA 4DH8A 4RX9A 3OBGA 2O3PA 4EH3A 4YSJA 3IQ7A 5JFVA 3N4UA 4RSSA 2FUMA 3LCOA 2J2IB 5DPVA 4P90A 4G2FA 4C4GA 4CEGA 1RQQA 5CASA 4IWDA 5I9ZA 3NAXA 2NP8A 3KFAA 3PXZA 3VC4A 3BU3A 3FYJX 4O0WA 5DBXA 4D4SA 3FZPA 4TYHB 1K3AA 2VWXA 1JKKA 3BGQA 4R5YA 3QZIA 4M0ZA 3R1YA 4YU2A 4O0RA 2UVYA 3FC2A 4FKUA 4PDSA 5HEZA 5DMZA 4USFA 3LQ8A 3BPRA 5JSMA 3W8QA 2B9HA 3DGKA 2PVYA 4OLIA 4EUTA 2UW5A 2OF4A 4V04A 1XBAA 5FTQA 2BKKA 2OKRA 4M97A 1PMUA 4RJ6A 4FTIA 2C69A 3O50A 2Z02A 4WSQA 4DFNA 1CTPE 5CZIA 5HG9A 3FEGA 4IAAA 4I5MA 4ID7A 2RF9A 3GENA 4NM3A 3RJCA 4FKSA 3PY3A 2A4LA 2WMUA 3MDYA 2IW8A 4O7NA 4BY9E 2BUJA 3NAYA 4QP7A 2VD5A 4R7IA 4YO6A 5J7HA 3OTUA 3C9WA 3MWUA 2UW0A 3AC5A 3F7WA 2QU5A 2WTKC 4F1MA 1H0WA 4F6WA 1P2AA 4H39A 4M13A 4JXFA 3FZSA 1F5QA 3BYSA 4YUQA 1TKIA 2XNGA 2QOKA 3TNWA 4YJSA 5AJQA 4NM5A 2QOBA 4AFEA 3ACJA 3F66A 2YHVA 3C4EA 2EB3A 2F2UA 2BDFA 5IKWA 4OW8A 4A9YA 3CJGA 4NWMA 4RQVA 3GP0A 5LVMA 5E8UA 1W84A 4FYNA 5DGZA 4PPCA 3L9LA 5I3RA 4JR3A 4FGBA 3Q3BA 4C38A 4EONA 4EHEA 4ZJVA 5HVKA 1SNXA 4E5AX 2C3IB 2EXEA 3ZM4A 2BZKB 4AOIA 4F7SA 4QPMA 4MBIA 2G9XA 4CQEA 5K9IA 3IS5A 5CTPA 4E26A 3W16A 3GCPA 3KU2A 3FI8A 4J97A 4QNAA 3O71A 3S00A 3D7ZA 4FV5A 4X3FC 3P5KA 4CYIA 4ZSLA 2BRHA 4ZAUA 1H1QA 3BV3A 2P33A 2GCDA 4DGOA 4QMMA 4UXQA 4G1WA 5AEPA 3VNTA 1J7IA 5CNNA 2GTMA 3KREA 5JN2A 3LFDA 4UBAA 3KKVA 2LAVA 3BBWA 1W7HA 1YDTE 2V7OA 4B99A 1SM2A 2I1MA 1YDRE 3HLLA 3EQDA 3K54A 4ZIMA 4FTCA 1PXMA 3EQPA 2ERZE 4BCGA 3I0QA 3U6HA 3QGYA 4J7BA 4ERWA 2BILB 2XNMA 3P08A 5AM7A 3ZLYA 4EOLA 4UZHA 4FR4A 3EFWA 3FQHA 2OXXA 4FSMA 5EYCA 3EN7A 5IQCA 2UZWE 5T3QA 1OGUA 3UOLA 2C4GA 4XRLA 2J6MA 4HPUE 3AC3A 3LZBA 2WMXA 3WI6A 4F7LA 5DN3A 2WKMA 1KE9A 5EFQA 3CSVA 3KVWA 5DT3A 3NIZA 3JS2A 3OEZA 1PF8A 4RFYA 2XJ1A 3OCTA 4LOQA 4UB7A 4MXCA 4BR3A 5ICPA 2PVRA 4RWKA 2PMOX 4QP9A 4FKOA 1I09A 5CF4A 2E9UA 4QMPA 2VX3A 4A4XA 2W7XA 3ITZA 5CSVA 3E87A 4C36A 1G8SA 5AV0A 3GU8A 5D12A 4DGLC 3QRUA 2VZ6A 1ZYSA 2VTPA 4QMZA 3Q6UA 4HVHA 3SGCA 2UZBA 4UEUA 3TTIA 3LKMA 1IAJA 5C8MA 1OL6A 2XK7A 3OS3A 4O0VA 5FXRA 5I5ZA 2WEIA 4KIQA 4BCQA 4ZMFA 4ALWA 2VWYA 3QX4A 4HCUA 4QMWA 2Z7SA 2I6LA 3JY0A 4Y73A 2KULA 2UW3A 4FUXA 3H30A 4AZFA 1PMVA 2UW4A 1IASA 2Y8OA 4IB5A 4O22A 4EBWA 5JFSA 4GFOA 2C30A 3BGPA 4YSMA 2GSFA 2BVAA 3Q60A 5AR5A 3RCJA 2OZAB 4D5HA 3GU5A 3W55A 2PVFA 3SXRA 4FT7A 4EOQA 4YTCA 4O91A 3PZEA 4KIOA 4DTAA 3ZUTA 4EQUA 2X4ZA 1R1WA 2XK6A 4YTFA 4XP0A 1UU7A 3KMMA 1JLUE 4G3GA 2G2IA 3D5UA 4K9YA 4QYGA 3I60A 3OC1A 3TZ9A 2XNEA 3OZ6A 1MQ4A 3ZXTA 3MA3A 3WZUA 3R1QA 4MBLA 2H34A 4U0IA 4E6QA 3NGAA 3ZONA 4FV3A 3FI2A 2YIQA 3LCTA 2H9VA 3QD4A 4CFWA 5ANDA 3B8QA 5FEQA 2GS2A 2XRWA 1H28A 1TQMA 4J95A 2WTDA 3E7OA 1OM1A 2HY0A 5J9ZA 4Q9SA 3PPKA 1RE8A 1J7UA 3CCNA 3BE2A 1SVGA 3LM0A 3RZBA 1NVSA 5KMIA 5C03A 1E1VA 4FKGA 4AA0A 1MRYA 4U3YA 2RFDA 4FEXA 3PFQA 1BKXA 3RWPA 1H1SA 2XIRA 1M52A 2W1HA 2R3FA 2ZV7A 1Q99A 3LQ5A 3ZDUA 3RNYA 2CHLA 1GJOA 2OXDA 3MPAA 4Z9LA 4ZZNA 2CPKE 4IEBA 2JITA 4KD1A 4ZSEA 4F64A 1FMOE 5LMAA 4M67A 2J0MB 1R3CA 2QKRA 2R3HA 2I0VA 3TKUA 2W1CA 4GH2A 4TYEA 4IM2A 5L2TA 2RFNA 2PZYA 1M14A 5EHOA 4K6ZA 3F3UA 5CEKA 4D2SA 3R9NA 2HELA 4JQEA 3OG7A 3UVRA 3MA6A 5HG5A 3R9DA 2YCFA 3VJOA 3BU6A 5KUPA 4G6OA 5G1XA 4TXCA 5DT0A 3MSSA 4LUEA 4MH7A 3DBEA 3ENMA 4BWXA 3P7AA 3VBTA 3HMMA 2Z7RA 3QX2A 5AM6A 2X39A 2BMCA 4I1ZA 4FZDB 2J9MA 5D10A 5FEEA 1NW1A 3RAKA 4U9AA 4C37A 4WNOA 2R0UA 3CKXA 3EJ1A 4FKIA 3EQIA 5E8YA 4FSZA 4RG0A 4AUAA 3NUPA 2UZNA 3OY3A 4PY1A 4BTJA 3QUPA 4QYHA 4NZWB 3CKWA 3H0YA 3ORLA 5IH4A 4O6EA 3QQUA 2R3QA 1Q8WA 5KMJA 4A9SA 4FVQA 4M8TA 3ZLWA 4OTHA 5K0KA 3DV3A 4A9RA 2QVSE 3HMIA 2JBPA 5HICA 4D1XA 1GIJA 3S4QA 4E4NA 4FKJA 4FTNA 4AG8A 3ZRKA 1XH9A 4ZY5A 5EOLA 3DK7A 5CALA 2HZ4A 3PJ3A 1Q97A 4TT7A 3F61A 2RL5A 4W9WA 1JPAA 3ORZA 4DAWA 1OIRA 4QQ5A 3CBLA 4EOMA 1WZYA 4C02A 2JAMA 2W5AA 5DIAA 4O7SA 2OJGA 4ANQA 5C8NA 5M4CA 3V5WA 3DQXA 5HNIX 3AC1A 3PA4A 5E92A 3RHKA 3LAUA 2OU7A 5CSWA 4JQ7A 3BWFA 4PL4A 3Q52A 1W8CA 3KF7A 3PRFA 3IONA 3FWQA 3IOPA 2DYLA 4PV0A 2WTWA 4D9TA 3Q4UA 5IEXA 3OHTA 3FMEA 2C5XA 1VEBA 3CQUA 3QD0A 1PXKA 4U6RA 4JRVA 5CY3A 1JKLA 2X81A 2LGCA 3HYHA 4UY9A 2OJFE 4D4YA 3FL4A 5LMKA 1YWVA 3QQKA 2PZ5A 3FBVA 5HCYA 3R8LA 4DGNA 2E9VA 2WEVA 4F08A 3U4WA 1V0OA 4Y46A 5IQGA 1YXSA 3BIZA 4C33A 3A7HA 2IVSA 2AYPA 4ARKA 2XVDA 4BBFA 3BGZA 4O0UA 5KMNA 2XCKA 2VTRA 3TUDA 3AXWA 3TL8A 4EUUA 3NUAA 4ZXTA 3CGOA 5L6PA 1PYEA 3LFNA 3E7VA 4JBOA 4JDJA 5EW9A 3EQHA 3K3JA 5EDRA 4DFZE 4FKQA 4NEUA 4YZMA 5GIPE 2Z60A 4HNFA 5AIRA 4EH7A 1BYGA 5HNGA 2FSLX 3R9OA 4F0FA 3PG1A 2I40A 3HKOA 4ASEA 1DI8A 5J79A 4W9XA 2X8DA 3RPVA 2VO7A 2VWIA 5AP0A 4Y95A 3KN6A 4ZLYA 2NRYA 3HDNA 4E5WA 4NFMA 3SHEA 1H8FA 2BR1A 3C1XA 3TCPA 4WG5A 3BELA 4FI1A 1NA7A 2WTJA 3DA6A 2XIYA 4TWNA 4CTCA 3QTWA 3NVKI 3UPXA 4IJ9A 2ITVA 4LQMA 4XOZA 2W1ZA 2B9JA 4DITA 2I7QA 3ORPA 3EYGA 3KVXA 4EHZA 3G2FA 3KXMA 2ZB0A 3OY1A 4YLJA 3MBLA 4RIXA 4FTQA 3WOWA 3IW4A 5L6OA 2J50A 4IM0A 2R3OA 4W4VA 2OIQA 4Y8DA 2F7XE 4ONAA 3VS2A 3PWYA 2C6TA 3T8OA 2E9PA 5H8BA 4PTCA 4CTBA 5DI1A 1OIYA 4M14A 3ZFXA 3A7IA 4PMTA 4DF3A 2WGJA 5AV1A 4AZSA 4NIFB 1OBDA 4K0YA 3QRTA 5EI2A 4AOTA 4C58A 4E4LA 2I0YA 3DDPA 2XYNA 3VUTA 4JAJA 4L01A 4BDFA 2F49A 4I93A 4U5JA 5KHWA 4RJ4A 3RPSA 4N6ZA 3QWJA 4ZJIA 4HGEA 4U7ZA 5M4IA 2CNQA 4BICA 4DEHA 3OD6X 5HE0A 1ZXEA 2XB7A 4D1SA 5CEOA 5LVOA 3SXSA 1YWNA 3PJ1A 4L68A 3VBVA 3QC4A 2Z7QA 3TIZA 2BZJA 3WE4A 2C68A 4TY1A 5A54A 5AFVA 3DZQA 3GQLA 4ANNA 4AP7A 5CVGA 3MTLA 5IQHA 1JOWB 3BKBA 3FMDA 4KIKA 4U45A 4HYUA 5CSXA 3UQFA 1SYKA 2PVLA 1S9JA 3F88A 3ZU7A 5FG8A 2V0DA 4RX8A 2IVUA 2X7FA 3UG2A 4XEYA 2W9FB 2X6EA 2YM7A 3B8RA 3T9IA 4V05A 3FQEA 2YIXA 3FQSA 3PUPA 2O2UA 2XNOA 4H05A 2W0JA 4QPSA 4E93A 2PMNX 3NCZA 1GIHA 5AV4A 1H4LA 1XH5A 2NNWB 3EQFA 2E9OA 1Q24A 2X2MA 3FY2A 3OCGA 3VUDA 4TNBA 3FXZA 5TE0A 1H27A 2V62A 2OBJA 1H24A 3NUSA 3QALE 4BZNA 2XK8A 2B55A 4ZSAA 3LM5A 2HWPA 3W2RA 2VTJA 4C2VA 3AD5A 4O96A 1PXOA 3ZO3A 4NFNA 3SQQA 4G3FA 4XG8A 4O81A 3I79A 4AGWA 3IDPA 1YHSA 4LRJA 4ACMA 5EW8A 4RIYA 2WMAA 3MW1A 4X2FA 5EHYA 3MH2A 2WMSA 4ANOA 3V5QA 3ORNA 4WSYA 2W17A 4EOPA 4P5QA 5KKRC 5LMBA 3HL7A 1VYZA 3PXRA 3UPZA 5GJDA 4GJ2A 2PULA 3ZRLA 4AF3A 4CG8A 5CI6A 2PL0A 3Q2JA 2NO3A 2ZB1A 2ITOA 5M4FA 4ZTSA 4ALVA 4FEQA 1DAYA 2JAVA 2RG5A 2ZDUA 3NYXA 5HBHA 3G9LX 5HESA 3LCKA 4CLJA 4H3BA 3D83A 3OCBA 4HW7A 4WHZA 4IX3A 4HCVA 3FL5A 5HLPA 5J1VA 4L67A 3C0GA 3TI1A 3OWPA 4BZDA 2R2PA 4OR5A 5M06A 4O2ZA 4I5PA 4QMVA 5K5XA 5FD2A 3VHKA 2OFUA 3W18A 2B0QA 4L00A 4ZTRA 4RIWB 5AAEA 1PMEA 4Y85A 2GFSA 1YOJA 2WIHA 5HTIA 5IH5A 2BFYA 2C5OA 2UZLA 4X7QA 3F3TA 4ACHA 4BRXA 2R3JA 2VNWA 4AQCA 4IB1A 3MN3A 1YWRA 3W2SA 4IM3A 4F09A 4LOPA 2QOLA 3KCFA 4GW8A 2OH4A 4FIEA 4R5SA 1J3HA 5CQUA 4ZJJA 3RINA 4BDEA 3O8TA 2QG7A 3G9NA 3II5A 4BDKA 4II5A 5EQPA 4WG3A 5KMKA 5DEWA 4DTBA 3RHXA 3ANQA 3IW6A 5AV3A 2XM9A 4IAFA 5DEYA 2UZOA 4D4VA 3GFEA 4LV5A 4O7LA 4JJRA 4QP2A 4GRBA 2BTRA 3CD3A 3CS9A 5CAQA 2OH0E 2UZEA 4MQ2A 4WNKA 4E6DA 4UZDA 3VVHA 4EH4A 4FIFA 4QO9A 4OTFA 3R8UA 4BTKA 4OGRA 3EB0A 4YHTA 3AC8A 4XV3A 5JFWA 3C50A 3AMYA 4FOCA 1PYXA 4O0YA 3E5AA 4YNOA 4FIIA 4BTFA 1VJYA 2PMIA 3DQWA 3HUCA 5JGDA 5AR8A 3ZMMA 4D1ZA 4YLLA 4WT6A 4AZWA 4L43A 3MVLA 5B2LA 2C5NA 3DT1A 4QQJA 5G6VA 2Q0BA 3JXWA 4FK6A 3ZO2A 4G34A 4NUSA 4YJRA 3UVQA 3PP1A 4GIIA 4WRSA 3G90X 4G6LA 1Q4LA 5IZFA 3NNXA 4BWPA 2FSTX 2YLEA 3FMLA 1PXNA 4HNIA 3ERKA 3QD2B 3QQJA 4IWPA 3TEIA 2GS7A 2RFSA 2ONLC 2QHNA 4AGUA 2VGOA 3IW8A 4GYIA 4H3PA 2CDZA 2J5FA 5CNOA 4N4SA 1Q8UA 4FL2A 4FV9A 3VBYA 4CLIA 4Z55A 3E8CA 4PP7A 4G31A 2QO7A 4Y5QA 5A14A 3UOJA 4IIRA 3PY1A 4YJUA 3ZDIA 4EKKA 1OPLA 1ZWSA 4FTJA 3FXXA 4O21A 3LXKA 4FE2A 3BQCA 4TWCA 4EYMA 5A4LA 4BWKA 3DS6A 3KMUA 5JRSA 3NWWA 4WA9A 3VUMA 5I9UA 4ASZA 5IEYA 4XRJA 1BLXA 2BIKB 3GOKA 1VR2A 4L44A 2X7OA 4YC3A 2VAGA 5EI8A 5AX9A 4F63A 3F5XA 4UMRA 3AGMA 3ALOA 4JS8A 2R3LA 5FM2A 4GJ3A 5BPYA 3UIMA 2ZV9A 4S2ZA 5FTOA 3R8VA 3VO3A 3GT8A 4RZVA 3IG7A 4JBVA 5ANOA 4UYNA 5IMEA 3CQEA 4OT6A 1M2RA 2XZSA 2BKZA 3KXNA 5AA8A 1JAMA 1H07A 4X3FA 1FINA 2CSNA 4U40A 2VN9A 3TJDA 5HBJA 4OTWA 3C4CA 2XJ0A 2KTYA 3G0FA 1WBNA 4IC8A 2C6MA 5CF6A 4MWIA 1NY3A 3QUEA 2JBOA 2EB2A 4I6FA 4FKWA 2GDOA 3MS9A 4IADA 3A60A 3LHJA 3KXXA 2WZJA 2XK4A 3QL8A 3G6HA 4H1MA 1IAHA 2W4OA 3HV7A 4KS8A 4BCHA 4ZSJA 3R71A 4RX7A 4G9CA 3ZSIA 1A48A 3SKCA 4O1OA 4BGGA 2WD1A 3F2NA 3SRVB 5EG3A 3DJ5A 3PA3A 1APME 3KULA 4XJ0A 3SC1A 5DOSA 1OIQA 4L7FA 2WMRA 2R3NA 5I9VA 5JGAA 3ZH8A 2IW9A 4DFUA 2B1PA 2YA9A 5TO8A 2CGUA 4O7WA 4WIHA 3R8ZA 1JKTA 4D2PA 3D5VA 3TZ8A 3ATSA 4FZFB 3QGWA 4CT2A 3P79A 1FVRA 4NK9A 4RQKA 4JNWA 3C7QA 2HY81 2OGVA 5ANJA 4ACDA 4BI0A 2GQSA 3PVWA 3A2CA 2QR8A 4J99A 3TG1A 3R7YA 4ENYA 2P2HA 3P4KA 3UP2A 4CZYB 4QP3A 5IQFA 3UO4A 3AC2A 3R01A 5GHVA 3KRWA 1JQHA 3BI6A 1DAWA 5DVRA 2C0TA 1B6CB 3E62A 4IFGA 4ERKA 3LXPA 1WVXA 2OIDA 4CV8A 1IA9A 2WQMA 4GK2A 4D4RA 4CVAA 1ZY5A 3KRRA 3H10A 3FKNA 3PSDA 4CT1A 5E8ZA 3VWAA 1O6YA 2R3GA 3AC4A 2YACA 4YGAA 1CDKA 3JVRA 3D7TB 4FV7A 2C6IA 2QR7A 4GL9A 4O2PA 4AA4A 4BBEA 3NIEA 3VQHA 3TM0A 4MX9A 4A06A 2C0IA 4BCNA 3FJQE 5BMMA 3MPMA 4CMOA 2JD5A 3EOCA 4AE9A 5JQ8A 3F5UA 2CCHA 4FTUA 4UWYA 3RBWA 4BGHA 4QQCA 4TTHB 3KRXA 4KKHA 4ZSGA 5E4HA 5EM5A 3VBQA 3V6RA 2FB8A 1ZMUA 2CGVA 4OTGA 3O2MA 4R3CA 4JBPA 3UYSA 2FO0A 5KMLA 4ZZOA 3BE9A 4BCMA 2BAQA 4ALUA 3EQBA 5CYIA 4I0RA 4X2GA 1NXKA 3VW8A 1Y6AA 4F9WA 1OECA 4BDIA 1ND4A 3QF9A 1ZYCA 2ZMDA 3VS1A 3F82A 3O8UA 3IPHA 3O51A 5CI7A 4FMQA 4JOAA 3PE1A 5CU3A 3OW3A 4GFGA 4LGHA 4V0GB 5TOZA 3ELJA 4PNKA 5CT7A 5IDNA 1YHWA 2BRNA 3MH3A 4MTAA 4KUJA 5EDPA 4BIBA 3D15A 1S9IA 5A4CA 4U42A 4K2RA 3R7IA 5HO8A 5K5NA 4U79A 1JNKA 3WYYA 1CSNA 5HD7A 4I23A 3GCSA 3ANRA 3HNGA 4QD6A 1U46A 4XV2A 4Y83A 5BVKA 3DBDA 3UYTA 3FUPA 5DA3A 4JG6A 4MK0A 2SRCA 5DLSA 5JQ5A 4RBLA 2UVZA 4ANLA 3UO6A 3Q5ZA 2QOFA 2PTKA 4KKEA 4DCAA 3TNPC 4IBMA 3SAYA 4HCTA 4NCTC 3W10A 1Y57A 1B39A 1H08A 4GUBA 4LFIA 4MNEA 1U5QA 4U44A 3UVPA 3LE6A 4BC6A 4RVMA 4D2VA 1GAGA 2JDVA 3T3UA 4XG3A 5HO7A 4RRVA 3DXQA 5L2IA 3FMNA 5D7AA 3Q6WA 2W1GA 3I6UA 3RK7A 1CMKE 5EK7A 2WTIA 3D5WA 2A27A 3DOGA 3SD0A 1OI9A 4LL5A 4MD7E 4FICA 1O9UA 4YO4A 2JC6A 4GCJA 2CMWA 1BX6A 3FZRA 3I1AA 4EK8A 5M08A 1TQIA 2QCSA 3CIKA 1XR1A 3EFKA 3JVSA 5FDXA 4EK5A 4CKRA 5CF5A 5CU4A 4ANSA 5HTBA 3LJ1A 3QC9A 3R2YA 1LR4A 4NM0A 2E2BA 4YR8A 5FRIA 4W4WA 4AN3A 4DYMA 1UU9A 4ZLZA 2G01A 3EN6A 1PKDA 4FV4A 5BUIA 2RGPA 3R0TA 1GNGA 2BPMA 2WU6A 5GNKA 2J4ZA 5CEPA 3I5NA 4OT5A 3QKLA 4FEVA 3UNJA 4XG9A 3U8WA 5IUHA 1OVEA 3MFTA 4CFUA 3DJ6A 3QAME 1U54A 3W1FA 3WE8A 2FH9A 4C57A 4E6CA 3AT3A 2WQNA 3ORTA 1Q5KA 4MCVA 4BDHA 5GZ8A 3T9TA 2X2LA 4M7IA 4BTMA 1KV2A 2G2HA 4BCIA 4CD0A 3WILA 5HZNA 2PUNA 4XYFA 4FV6A 4FTRA 5K0XA 2UV2A 4C35A 2OICA 4RVTA 4JX3A 4QYYA 4AGCA 2JFLA 2XIKA 3DAKA 4YLKA 1ZYJA 2B9IA 3QHRA 4WNMA 4EHVA 3ORXA 5DT4A 4EEVA 4O86A 3PY0A 3HV3A 3I4BA 4OTIA 5TT7A 2X6DA 1UNLA 4C2WA 4IC7A 3EKKA 4E8AA 4CYJA 2PVMA 4HZRA 2IG7A 3OXIA 2WB8A 2YEXA 3N51A 4FT3A 3GXLA 3VBWA 5ANKA 4L8MA 3Q4ZA 2WMBA 3M42A 4F70A 3EL8A 5EOBA 2HOGA 3GCQA 4H3QA 1ZOGA 4M69A 1IG1A 4C8BA 5BVWA 5F95A 5GZAA 4EQCA 2OF2A 4F9AA 4DEBA 1PXJA 5LJJA 3MI9A 4DG2E 4F6UA 4A9UA 3ZS5A 4M12A 2YABA 2OG8A 1U59A 3R7GA 2P4IA 4OTRA 5GJGA 2GPHA 1QPEA 3PPJA 1XO2B 4JDIA 4J96A 2CN5A 4J8MA 3WF5A 3BHTA 4NKSA 4A9TA 3QLFA 3JUHA 3R7EA 1LP4A 2C1BA 4FNWA 1YXXA 4QMQA 1FBNA 2PVHA 4X6QC 3VRYA 1H26A 4L3PA 4UWBA 4KAOA 4WUNA 2WQOA 3R83A 2J0KA 5KHXA 5D41A 4YZNA 1OL7A 5CZHA 3E93A 4K33A 3VQUA 4YBJA 3SOAA 3ZO1A 2QLQA 2GTNA 4XP2A 3D5XA 3FY0A 2PMLX 4C59A 5HHWA 3BWJA 3K5VA 3JY9A 2G15A 4YPDA 3VULA 2Z2WA 3OWLA 3EN5A 1M17A 2WXVA 4XG4A 2QONA 5LCKA 1XBCA 3AGLA 2X9FA 5HIBA 1JSTA 5F20A 4BI1A 5CANA 5H3QA 3C13A 5L8JA 1PXPA 3UDBA 2P0CA 2W1FA 3QCXA 3F9NA 4NU1A 2JIUA 3ZUVA 2VV9A 5HVJA 3V51A 3TN8A 4S34A 3PYYA 4KRDA 3ZBXA 4Z3VA 2YM5A 2XH5A 4GYGA 4R7HA 5C4LA 4QYFA 3DLZA 4BKZA 1UNHA 4HYHA 3COHA 2ZDTA 1YXUA 4P7EA 2GNHA 3NX8A 4I4FA 4FA2A 2RSVA 3PXYA 5AUXA 2C6KA 4NYEA 4MHAA 3O7LB 3MVMA 1FVTA 3HV5A 2DUVA 3S1HA 2VTLA 4X3JA 4NSTA 4X2KA 4C4FA 3BZ3A 2RG6A 3REPA 1YQJA 4MXYA 1UNGA 5EDQA 4CCUA 4UXLA 3TKHA 2C6DA 3ETAA 4QMNA 5GINE 4BDDA 5HU3A 2PHKA 1OUYA 4DEAA 2REIA 2XRUA 4ZP5A 4E73A 1J1BA 5CU2A 3UO5A 3PSCA 3VS6A 2UW7A 4EQMA 4IB3A 2VGPA 4TKSA 4PTGA 4CNHA 3DKOA 4XV1A 3S3IA 3D2KA 4M84A 2OZOA 3L9PA 2YERA 4CGAA 4A07A 3LOKA 2VUWA 3OXTA 4FIJA 4XHKB 2BAKA 3U6JA 4G5PA 4GU9A 5J7BA 2ITNA 4LV8A 1BL7A 3WZKA 3PP0A 1GY3A 3DKFA 2PUUA 2IZRA 3IDBA 3DK3A 2VRXA 3CY2A 1KE8A 2WMTA 5IA5A 5JFXA 5F94A 3TTJA 2C6EA 4H1JA 3RVGA 1GIIA 5L3AA 2GNIA 1Q62A 2F2CB 2XKCA 3BQRA 4PX6A 1G5SA 5AP5A 5BNJA 5BVOA 5JH6A 4E20A 3VN9A 4UV0A 1GZ8A 3V6SA 4I6HA 3TUCA 2OXYA 1YXVA 3ODZX 3OXZA 2PVKA 3NUNA 4U8ZA 4YP8A 2XIXA 4I21A 3HZTA 5AX3A 5AADA 1XH6A 4GU6A 4IVAA 2PVJA 4U97A 2PUIA 4XV9A 4GUEA 2CLQA 4FBXA 4RA5A 5E8VA 5HORA 4C4EA 5A4TA 5CU6A 3JYAA 4RVKA 3ULZA 5EQEA 2JKMA 2VTIA 3F7ZA 5AP4A 5DG5A 3UZPA 1Q3DA 3OWJA 2QOOA 3WZJA 4M0YA 4W4XA 3QKMA 1PXLA 2HENA 2XF0A 3A7JA 1YDSE 4GK3A 5HCXA 2JIIA 5E8SA 3SLSA 2X9EA 2O64A 2XKEA 3MH0A 1A9UA 2EXMA 2XCHA 3KXGA 5HE1A 4CZTA 4GKIA 2O5KA 2JIVA 5FLFA 5IPJA 2ITXA 4RJ3A 4X21A 5EM6A 3RP9A 3FMJA 4FTLA 3PLAE 3AMBA 1XJDA 2BIYA 5AUTA 3IW7A 4XNEA 2CNVA 5LWNA 4O84A 3K2LA 5H2UA 3R9HA 3I5ZA 4DH7A 3CP9A 4TN6A 3RPYA 3BHUA 4PDYA 5DNRA 3Q5IA 5EHLA 3F3VA 1P4OA 2YM4A 4F9BA 3VUGA 4RJ5A 4IXPA 3KGAA 4IE9A 1I44A 4S31A 4ENXA 3VUKA 3QXOA 4B7TA 5CEMA 5EM7A 1OL2A 4FNXA 5IISA 4BBMA 4H36A 2JKOA 3KQ7A 4G3EA 4IZAA 5IQIA 2A1AB 2J51A 1J7LA 3HUBA 3IECA 3PIZA
chains in the Genus database with same CATH superfamily
2XNPA 2YJRA 3C4ZA 3RZFA 3PIXA 4GVAA 5KMMA 3UG1A 1M7NA 5E91A 3HECA 4FL1A 4JI9A 5IA2A 3CD8A 2P2IA 4TW9A 3TZMA 1CKJA 1HOWA 4M3QA 4UMPA 4DA5A 2CKEA 3MGYA 4RWLA 4R7BA 1BI7A 3HVCA 4JBQA 2HZIA 3PJ2A 2OFVA 5T6KA 3UIXA 4R3PA 5IUIA 3PXQA 2YIRA 4O27B 5D9HA 4ITIA 1ZLTA 1OKVA 2ONLA 2JFMA 4KIPA 3EN4A 4CMTA 4NL0A 2UZUE 3SG8A 3OT8A 3R7OA 3DXNA 1ZRZA 4WG4A 2R7IA 3IK3A 4DTKA 4EWHA 2F57A 1REJA 1Q8YA 1PJKA 4HGTA 4FOBA 3W2CA 3ZEPA 3FKLA 4EOKA 1REKA 4F7NA 1ZZLA 2Y4IB 3A8WA 3E63A 3VF8A 3KY2A 3QYZA 4I22A 5BVDA 2IF8A 3DXPA 3E92A 3KXHA 5IQBA 4R1YA 4QMUA 4JT3A 2PZRA 3ID6C 4ZMEA 5LCJA 4R8QA 3C4XA 4YNEA 3WF6A 4O83A 1ZMWA 2GHMA 1H0VA 3MTFA 4HYSA 4X0MA 3R9RA 4NJ3A 3OVVA 2PPQA 5HO6A 3ZTXA 1A06A 5BYZA 2HZ0A 5ANEA 2IZTA 3A62A 4I4EA 3GC7A 4N57A 4FUYA 5HIDA 3MJ1A 3PIYA 2VTQA 5C27A 3DBFA 4IZYA 5AAFA 2IO6A 4PL5A 1UU3A 5F4NA 4EORA 3QTRA 3D4QA 4CFMA 2R7BA 3AT4A 5AV2A 3MYGA 4QMSA 4DT9A 2XKFA 3PJ8A 5CWZA 3TNIA 2BFXA 4IX6A 2BHHA 1Y8GA 4YMJA 1OL5A 3R1SA 3DFCB 4ZS0A 2V5QA 2OSCA 4BGQA 3NW7A 3ORKA 5EM8A 4F9CA 2XM8A 4D2WA 4BZOA 2WOUA 1QPCA 1YOLA 3FXWA 3VAPA 4C3PA 3VJNA 2ETRA 4HVSA 3PFYA 4GT4A 2I0HA 3KK8A 2IVTA 3KEXA 4W4YA 4RZWA 4YJQA 2WO6A 4FTMA 5A3XA 3ZEWA 2AC3A 3WBLA 3HRFA 1MP8A 3P5JC 5EYMA 2CGXA 5CENA 4RLKA 2YM8A 5ANIA 4DH1A 2Z7LA 3KIOC 1H00A 3SOCA 3IW5A 4I3ZA 2P55A 2QNJA 4WO5A 3V5JA 4QP8A 3GBZA 2VO6A 4JDKA 4GT5A 5BUJA 4BI2A 4F6SA 5FTGA 3A7FA 4KA3A 5J87A 3O17A 1K9AA 3BLHA 5I9XA 4RIXB 5J9YA 1H01A 4YZCA 3V8TA 2R3MA 4IH8A 4RA4A 2WELA 4IWOA 1Y8YA 3AOXA 4N70A 4ZTMA 2C3KA 2Q83A 5JZNA 3AT2A 3P78A 3PVGA 4IANA 2ITTA 3OWKA 3GVUA 4I0SA 4UWCA 2B4SB 2W4KA 3MY5A 4ANMA 2XP2A 3OROA 3L8VA 1XMMA 2EXCX 2UW8A 1ATPE 2X0GA 2WMVA 4FYOA 5AIKA 3G6GA 3RM6A 2VWVA 5AUWA 4D58A 2WIPA 3G0EA 1JWHA 2AC5A 2JDTA 3EKNA 4I94A 4MBJA 5FM3A 5AWMA 5JEBA 4RX5A 3RAHA 5E90A 4MAOA 3VBXA 2VO0A 1YOMA 5JGBA 5AP7A 4KWPA 2P3GX 5AR4A 3GC8A 3RALA 3TV7A 4DBNA 4YTHA 4XX9A 5IUGA 1XWSA 3BYMA 4AN2A 4MNFA 3ZLSA 5BUEA 1Q8ZA 3R7VA 4KIKB 5F1ZA 1ZZ2A 5CSPA 3ROYA 3TKIA 3QHWA 1AQ1A 3KN5A 2QO2A 3ROCA 2C6LA 4AXEA 2ITYA 1FGKA 1DS5A 3EMGA 4ASDA 2OI4X 2IJMA 1CKIA 2GMXA 3DBQA 4DEGA 3P86A 2YZAA 3MFSA 4P4CA 2CKPA 4TWOA 3AQVA 4QP6A 4AXCA 3DAEA 3F6XA 4K11A 3IGOA 4AWIA 1UKHA 2VWUA 5IA3A 2QG5A 4CFXA 4JG7A 3ZBFA 3FZOA 2A0CX 3EN9A 5FQDC 2BRMA 2X2KA 3NYNA 4FVRA 5C01A 3QTSA 4DLJA 4C0TA 4Z7GA 2DS1A 4J52A 3BRBA 4FT0A 4E6AA 1LUFA 2GHLA 4JR7A 3UNZA 4BIEA 2JDSA 2VTMA 5CEQA 5CEIA 5A4QA 2PE2A 2VWWA 3EFLA 3NCGA 4BYIA 1KE5A 4RLLA 4L46A 4CKIA 3HDMA 2QD9A 3LJ0A 4C4HA 2X7GA 2W5BA 4DHIB 4JG8A 4D9UA 3WYXA 3ZLXA 4EI4A 5M44A 1NVQA 3MY0A 5FWKK 4APPA 4EH2A 5M51A 2UZVA 4O82A 1YVJA 1ZARA 1OB3A 3W32A 2FYSA 4FTOA 3ZOSA 1QL6A 2PU8A 3LIJA 2PSQA 4AU8A 3HRCA 3FAAA 3ZM9A 4FTAA 4ZTQA 5L6WL 2Q0NA 1OPKA 4TWPA 4MD9E 3FDNA 3TNQB 2OLCA 5LOHA 2C5VA 2OJIA 5DR9A 3C4FA 3QXPA 4DC2A 3GUBA 4UX9A 4XG2A 3LFFA 3Q2MA 3K5UA 1WBVA 2HIWA 4QP1A 5CQWA 4TYHA 4ASXA 2EWAA 3UIBA 4FKTA 4IZ7A 3BCEA 3TWJA 5KBQA 3L8SA 3ZFYA 5CU0A 2W96B 4XLVA 4EYJA 3TUBA 4AW1A 2Y9QA 4HJOA 4BDBA 3A99A 4XP3A 2ITZA 2XJ2A 2BCJA 4NCTA 5EYDA 2X8IA 4DG3E 4EWQA 5JKGA 3R63A 3NW6A 4U3ZA 2YISA 3RI1A 4A7CA 4AFJA 3NNUA 5L8KA 3U54A 2UW6A 3FPMA 3W0NA 4OBOA 3DPKA 2W4JA 2CKQA 1KOBA 4YBKA 3AMAA 1UWJA 4QOXA 4GT3A 3UNKA 5I9WA 3GQIA 1RDQE 3SA0A 1Z57A 4LMUA 1SNUA 1TVOA 5HLNA 4S32A 2ZV2A 2HCKA 4IHPA 1G8AA 3FSKA 5E1EA 4AZVA 5D7VA 4ACGA 5AMNA 3VONA 5H9BA 3RKBA 2WMWA 3DCVA 1X8BA 4DLIA 5KZ0A 4C34A 3QQFA 4JIKA 2H96A 3MJ2A 3O8PA 4CXAA 3FZTA 4FODA 1YI6A 3Q96A 3SW7A 2XEZA 3MIYA 2VX0A 3WF8A 3H9OA 3A8XA 4QQTA 1Q61A 2W1EA 4EH6A 5JMSA 2EU9A 2QOQA 3I7CA 2ITPA 3VRZA 1YHVA 4DH3A 2C3LA 4ZTLA 3ULIA 3P7BA 3RGFA 2ZJWA 2B54A 5M57A 3PZHA 2AUHA 4JX7A 5B2MA 1VZOA 3U87A 3MVJA 5B0XA 1OKWA 4MF1A 3R28A 3ALNA 3U4UA 5KBRA 5A6OA 3HP2A 1T46A 2XMYA 3LFAA 2YFXA 4HGSA 3ZZEA 3TNHA 4D2TA 5EKNA 2FA2A 2Y6MA 3QQLA 4RVLA 3NUXA 4CG9A 4EK6A 4PP9A 3CTJA 5A46A 4KKGA 3U9CA 4K1BA 5HLWA 3N9XA 5LVPA 4V01A 4DHFA 2F9GA 2VNYA 3HMNA 4B4LA 1ERKA 2ZM3A 1UU8A 4MQ1A 3E8DA 1DM2A 3PSBA 5DR2A 3FLQA 2YWPA 5TF9A 3F2RA 2WTKB 1UWHA 2HXQA 2YDKA 3R8MA 4DGGA 3E8EA 5HTCA 5BYLA 2HAKA 4EJ7A 4ZTHA 4WKQA 1YI4A 1SVEA 2BHEA 1V1KA 1XQZA 1W2DA 2VO3A 2XS0A 4RMZA 1GZKA 4CZUA 3R22A 5I9YA 3CTQA 3F5GA 4I5HA 4EC9A 5HU9A 2HXLA 1URWA 4F65A 4AXDA 2ZVAA 4R1VA 2QOCA 2VTTA 2IZUA 3OUNB 3GCUA 4R6VA 1K2PA 3NS9A 3LW0A 1CKPA 1OKYA 1L3RE 4KB8A 4MXZA 4UYAA 2YN8A 4W8DA 5LXMA 3GB2A 4Y5HA 4DFYA 2A19B 4L53A 4NJDA 4PQNA 2J7TA 4H58A 4XBRA 4IW0A 4QYEA 4IVCA 3ZZWA 4BDJA 3W8LA 3HAVA 3DTCA 3L8PA 1M2PA 4QNYA 4KBCA 4HVIA 3C5IA 2XUUA 1JVPP 5I3OA 4JVGA 3ZXZA 3DKGA 3GU6A 2HZNA 4AXAA 2CNUA 2J0IA 2Y4PA 4FSRA 3CQWA 2XEYA 1FGIA 4TYGA 1VLRA 3QTUA 4X3FB 3FC1X 4D5KA 3LMHA 3QCQA 2QC6A 3LFQA 1F3MC 4Q9ZA 2VTSA 2VTOA 3OBJA 4BIDA 1V0BA 4FSYA 3RM7A 5GIOE 3IO7A 3ZUUA 4LL0A 4FSNA 4IFCA 2O63A 4YZBA 3CY3A 5DH3A 4NH1A 2X1NA 4QMOA 3WARA 4D28A 1W82A 4FKVA 5F9EA 1TFFA 1W83A 2JGZA 4YZ9A 1P4FA 5IMXA 5FBNC 4F7JA 4DT8A 2IW6A 1FPUA 4EOOA 4ORKA 2FVDA 3NUUA 3Q9ZA 4QEBA 4ITHA 4O6LA 3KRLA 4XUFA 2GQGA 3FMKA 4KINA 3FMMA 4AOJA 4FG9A 2AQXA 4OTPA 3KULB 4PNIA 4EZ5A 5LQFA 2YM3A 3COKA 3GGFA 4BHNA 4F1OA 1O6LA 3QYWA 2B53A 2OZAA 2YZLA 1MRVA 2XK3A 1IRKA 4JIAA 1WBPA 4PTEA 4EK4A 3PDTA 1CM8A 2W06A 5DWRA 1WBTA 3QRJA 5KMOA 3G33A 3L8XA 5GZ9A 5HE3A 2VTHA 4EL9A 1BL6A 2CGWA 4FSWA 3R02A 3TV4A 3V8SA 4OTDA 3O5AA 3I6WA 3QZHA 4CCBA 4KABA 4TPTA 4MF0A 4BCJA 2W1DA 1HCLA 3ZFMA 1W98A 1WBWA 1R0PA 4J71A 3DDQA 5CX9A 4G3DA 5FBOA 2QURA 4EKLA 3IOKA 3L9NA 1QMZA 5JT2A 4UN0C 4ZLOA 4YC8A 1WMKA 2Y7JA 4F4PA 3G5DA 4NM7A 4I0TA 5E9EA 2BTSA 2BRGA 5AR2A 2A2AA 2C6OA 3NR9A 2GFCA 2GHGA 3R73A 5DE2A 3SDJA 4F9YA 3FI4A 2ZM4A 3QQGA 3RK9A 2BRBA 3PRIA 2WU7A 3UGCA 4YURA 3BEGA 3HAMA 4CRSA 1JKSA 3A4PA 5AP6A 2YLFA 4YJPA 3KCKA 4JQ8A 4U81A 1V0PA 3NFGB 4BCOA 5BVNA 3TXOA 4AAYA 3QUDA 4FKRA 4LGDA 2QQ7A 2WFYA 3KA0A 3PLSA 4FC0A 4C4IA 3NSZA 3ZSHA 2RIOA 4AT3A 4CQGA 5CAVA 4LM5A 5K4IA 4OUCA 3OP5A 2PWLA 4IACA 3CPBA 3PE2A 4AS0A 3GNIB 4IDVA 4F1TA 1FMKA 5DRDA 4FNZA 3U55A 4MYGA 5AA9A 3D14A 2CN8A 2OIBA 3NUYA 3UBDA 4LMNA 4B8MA 3VUIA 3LMIA 3KK9A 2QI8A 2WPAA 1Q3WA 3E8NA 4MXOA 3UOHA 4PPBA 1QPJA 3AG9A 3IKAA 5HI2A 5HG8A 3H4JA 5CLPA 4AW2A 2YCRA 4P2KA 4EZ7A 2V55A 4IVDA 4OBQA 4RWIA 3U9NA 2ZFYA 4IDTA 3FYKX 3GEQA 5HX6A 3SV0A 4D55A 4EH9A 4QRCA 3B2WA 4W8EA 1PY5A 2X4FA 4PRJA 4PWNA 3IGGA 2GNJA 2CLXA 2ZM1A 5ETAA 4FNYA 1H1RA 4YZDA 2F4JA 4FVPA 3KMWA 3UZTA 3R6XA 4XH6A 3FV8A 3NEWA 5CAUA 5HKMA 4R77A 4KBKA 3P9JA 5CVHA 4BJJB 4G6NA 4DBXA 3A4OX 1YKRA 3KL8A 3DAJA 4CMUA 1QPDA 5EW3A 2XAMA 4EJNA 1XH7A 5HOAA 1PRYA 5FGKA 2AEGA 2R3KA 4FKLA 3HX4A 4M66A 4G5JA 1JSVA 2UZDA 4F0IA 3F3ZA 1STCE 4O1PA 5CT0A 4O38A 4X2NA 3ZHPC 2XBAA 3RWQA 3MFUA 5DFPA 3EFJA 4XBUA 3CEKA 3NW5A 4QMTA 4XOYA 2PE1A 3FMHA 3KXZA 4E4MA 4X2JA 4MNEB 4N6YA 3BLAA 2FSMX 4O0SA 5E1SA 5AAGA 4AT4A 4FEUA 4DGMA 5ACBC 3ZYAA 1SVHA 3VUHA 2EVAA 3L9MA 2XKDA 5HCZA 2GU8A 3DFAA 2ACXA 2WQEA 3SX9A 4ZOGA 4FGRA 1H1WA 3R00A 3CE3A 3EWHA 4L9IA 3WZDA 3FLZA 3JPVA 4FRFA 4C3FA 5A9UA 4PMMA 1B38A 3NNWA 2PUPA 5M09A 1XKKA 2YCSA 4C7TA 2XBJA 3P1AA 2XNNA 2VWBA 1ZYDA 4MD8E 1XBBA 2YITA 1OUKA 3RPRA 4N0SA 5C9CA 4IX5A 1KE7A 1RJBA 4HGLA 2ZMCA 3QCSA 2X8EA 1XHAA 4KSQA 3UQCA 4EBVA 1U4DA 2HW6A 4PMPA 3OFMA 4HVDA 4GKHA 1ZY4A 2JDRA 4DHJA 3ORMA 4FF8A 3PPZA 4L52A 3CR0A 4QPAA 3RTPA 3W2QA 4EOSA 3MESA 2IN6A 2PY3A 5K3YA 3R7UA 3AKKA 3I81A 4P5ZA 4IMYA 3VS0A 2YDJA 3QQHA 4XG6A 4O7ZA 2GNFA 3PXKA 3CGFA 2QU6A 4Q5EA 1U54B 1FQ1B 4GVJA 3QTQA 4UMTA 3VS4A 1WBSA 3QU0A 3OCSA 3MH1A 3QTIA 3FHRA 3IDCA 4ZEGA 3TZ7A 4GG7A 4RWJA 5KCVA 2EUFB 3QFVA 4FV1A 2UUEA 3F3WA 3QTXA 5M55A 3SXFA 4XG7A 2R64A 4KBAA 3HA8A 3ACKA 5FUTA 2I0EA 4NW6A 1BI8A 2JDOA 4F0GA 5M07A 2G2FA 2YCQA 4LYNA 4BFMA 2VTNA 4I41A 5E7RA 1PKGA 3VS5A 3BHHA 3COMA 4LV7A 3BU5A 4PUZA 3FLNC 3WIKA 4GFMA 2FGIA 3EL7A 1R39A 2YJSA 4J1RA 5HQ0A 2CCIA 3Q9WA 4KRCA 5L2WA 3GFWA 4L7SA 2XYUA 3DU8A 5C1QB 3Q9XA 5ETIA 2ITUA 1RW8A 2XK9A 3HA6A 5HG7A 3W33A 4EZ3A 4RJ8A 3BYOA 4BCPA 3DJ7A 4MEDA 5HX8A 3PVBA 4M69B 4BL1A 4O0TA 3TDVA 4NIFA 3OUKA 4GK4A 2GNLA 4FV0A 4E5BA 5LWMA 1Q41A 5FP5A 3R2BA 3ODYX 1PHKA 2XA4A 2YAAA 5LVLA 1H1PA 4YPSA 1OZ1A 2ITQA 4FSTA 2ERKA 2PZIA 1QCFA 5EQYA 5J5SA 3V01A 3DLSA 4KNBA 2H6DA 1JSUA 2YIWA 4QMLA 5EKOA 5CS6A 1LPUA 3HMOA 5JK3A 3VIDA 4RFZA 4O7YA 1KE6A 4FIGA 3PG3A 4FK3A 1PMNA 1OL1A 2DQ7X 4GSBA 4G16A 4AGDA 4DINA 4J98A 3H9FA 4MXAA 4BKYA 2VU3A 3EH9A 2WQBA 1P5EA 5A4EA 3QA8A 2BZIB 3GCVA 4QMXA 5AP1A 4WRGA 2RFEA 4TYIA 1G8JA 5HBEA 5L4QA 3UOKA 4BHZA 3LQ3A 5HD4A 1W0XC 3E88A 3EZVA 5ANGA 2YWVA 4IAIA 4YJOA 3BHVA 1SMHA 4EC8A 3E3PA 4A4LA 2R3PA 1KV1A 1TQPA 3BBTB 4GG5A 5IG1A 1L8TA 4CFFA 3UZRA 5H8EA 1EH4A 2RKUA 1UA2A 4FTKA 1IA8A 3HMPA 4FG8A 2DWBA 4U80A 3UP7A 4HVGA 3RAIA 5A6NA 2BROA 1ZOHA 3DTWA 3R1NA 1JBPE 2W99B 5EI6A 1Y6BA 3W2PA 5J1WA 2V7AA 3FHIA 4FL3A 2BDWA 3QRKA 4L3LA 5AUVA 1OPJA 2CJMA 3BHYA 4QT1A 2VTAA 3GU7A 4IAYA 5DRBA 4JLCA 5E8TA 4LGGA 5ETFA 1ZMVA 5HE2A 5L2SA 4YJNA 1XH4A 4BN1A 2HK5A 4FEWA 3NPCA 4FTTA 4RC3A 4AAAA 4O7RA 3UJGA 2ZYBA 4E3CA 1LEZA 1WFCA 4A4OA 4G9RA 3OW4A 2R5TA 5LVNA 3R8PA 3H3CA 1XH8A 2R9SA 4QTCA 5BX0A 1IR3A 3OT3A 4USDA 5L8LA 2J90A 5AP2A 3NYVA 4MUQA 3UMWA 3D0EA 4ZTNA 4PDOA 1R0EA 5J95A 3CPCA 5AUYA 5IEVA 2BALA 5M4UA 5IQDA 1ZYLA 4I6BA 1E9HA 4C3RA 3GU4A 1FVVA 3F2AA 4YC6A 3SVVA 3ML1A 1UVRA 5T68A 3R04A 4HPTE 4I24A 1KOAA 2BDJA 5IA4A 5DYJA 2GNGA 5FEDA 2QOIA 3CC6A 5KZIA 3HEGA 3HGKA 1W2CA 4AA5A 4RIWA 4I6QA 4TYJA 4K18A 5B7VA 3HP5A 2YIYA 4MKCA 4LRKA 2GQRA 4RT7A 4TRLA 4AW0A 3QCYA 5CXHA 4B6LA 1PXIA 4LRMA 4S33A 5B2KA 2HWOA 3JR1A 1OKZA 4YHJA 2R4BA 4JAIA 4XCUA 4LG4A 3DNEA 4Z7HA 3HV4A 3PWDA 4KS7A 4IWQA 1ZOEA 3TACA 5J8IA 1M2QA 4FT5A 5FP6A 3NLBA 5KKRB 5IDPA 2O8YA 2UZTA 4I6LA 3E64A 2YM6A 1KUTA 5E8WA 5L2QA 4AT5A 3LFSA 1IEPA 5BMSA 3TT0A 3DNDA 3UMXA 4QP4A 3QD3A 3R21A 3V8WA 3RNIA 2OJ9A 1BMKA 3AD6A 4PPAA 3GI3A 4FV2A 2W9ZB 5HNBA 3ATTA 3Q4CA 1BUHA 4XLIA 4YHFA 3W2OA 4AX8A 3MFRA 4CFNA 4D2RA 1KSWA 3AKJA 4IJPA 3VF9A 3QA0A 3VW6A 5JRQA 2WTVA 2WNTA 4EOJA 2OJJA 4L6QA 2C1AA 3EZRA 4DG0E 2QHMA 2XNBA 5KNJA 3Q4TA 5BVFA 4LI5A 5AUZA 2BAJA 1Z9XA 2W1IA 2QLUA 2UVXA 3VS3A 4GEOA 4O4DA 3Q9YA 5IF1A 3UE4A 2VX1A 4E4XA 4FIHA 5BQ0A 1URCA 5IQAA 3QZFA 4JDHA 4J8NA 4OAVB 4XMOA 2IEWA 3WF9A 5EH0A 3VS7A 4WD5A 3KB7A 3T3VA 3C5UA 5AR3A 5BYYA 4DEDA 4QDEA 4DE4A 2WMQA 3RK5A 3DB8A 4QTDA 4ZY6A 5M53A 2XANA 3NFFB 3EHAA 4OBPA 4R78A 4BDCA 3OOGA 3A61A 3V5TA 1AD5A 3MVHA 3MB6A 4YJTA 4RPVA 2YAKA 4ITJA 1Q8TA 2JEDA 3FLYA 3QWKA 4L45A 3N4TA 5D1JA 4EK3A 2WOTA 1H25A 2F7EE 4K77A 4BCFA 4IX4A 2B7AA 4FT9A 3V5PA 3O96A 4HYIA 1P14A 3CXWA 1YW2A 4OAUC 3FPQA 1MUOA 2Y4IC 5FXQA 3FE3A 1J1CA 2H8HA 3BLQA 3G51A 3OMVA 1GZOA 4RC2A 3NNVA 4UALA 4WBBB 2ETKA 4LUDA 4HOKA 2J0LA 5AUUA 2PE0A 1MQBA 4IZ5A 4RC4A 3ZC6A 4IVBA 3KRJA 3ZSGA 3GC9A 4B9DA 4QTEA 4O7VA 3M11A 2WTCA 5LMKC 4WBOA 3GOPA 3R30A 3LFCA 3VHEA 4BVUA 4AACA 5J9LA 2WAJA 4HZSA 2R0IA 4PMSA 5H8GA 4D0WA 3ZCLA 4U43A 3PJCA 2O0UA 4O0XA 2A98A 5ACKA 2QODA 3LLTA 3PXFA 2OO8X 4WOVA 4C62A 1NT2A 4AW5A 3D2IA 3MY1A 3EYHA 4CRLA 3WF7A 5CSHA 3PVUA 3LPBA 5HIEA 3RAWA 5I4NA 3NYOA 4BDAA 4RJ7A 2E9NA 3QLGA 3SW4A 2PK9A 3NVMB 4BYJA 2IVVA 3BYUA 3QZGA 3RPOA 1AGWA 2O65A 3MB7A 1Y91A 4DHZA 2IZSA 4DFBA 3UODA 5IH6A 3C0HA 3KF4A 4KSPA 4NT4A 1WCCA 1YXTA 3GC0A 3FLWA 3EQCA 5CAOA 2ZOQA 2BZHB 4EOIA 3TJCA 3O0GA 1LEWA 3COIA 3HV6A 3OF0A 4I20A 5E8XA 4CV9A 4R3RA 4NKAA 4FKPA 5CXZA 3SG9A 3DK6A 3ET7A 2PZPA 1GOLA 3DY7A 4AE6A 3S0OA 4QTBA 3MIAA 3SRVA 1WAKA 3NDMA 3OTVA 4L3JA 5DR6A 3WIGA 4ZZMA 1Z5MA 5IA0A 4IAZA 5ITAA 3BEAA 4Q2AA 3TIYA 3H0ZA 3O23A 4GV1A 4ZS4A 4GIHA 4DN5A 3I7BA 2R3IA 2CKOA 2ZAZA 1KWPA 5LARA 4BDGA 4EH5A 3EIDA 1UV5A 3P23A 5KO1A 4B0GA 1HCKA 4YTIA 4MXXA 3WZEA 1E1XA 3L1SA 4RIYB 3ZRMA 4DH5A 3C51A 3FLSA 3CLYA 5AP3A 4O7TA 4JL9A 5CVFA 4EHGA 3DBCA 2GS6A 4NTSA 3BYVA 4IB0A 4FZ7A 4MVFA 3C0IA 5CAPA 4E1ZA 4QTAA 3QKKA 4WUAA 4ZY4A 2UW9A 5HGIA 1M7QA 1ZAOA 3LJ2A 4TNDA 1WVWA 3NZ0A 4NTTA 4AN9A 4FZAB 4USEA 2VWZA 1UKIA 2NRUA 4TL0A 2ESMA 4GS6A 2C47A 3OEFX 3V3VA 3EQRA 3LLAA 4TZRA 4I92A 4RGJA 5GJFA 2F7ZE 3FSFA 5IQEA 3C4WA 4FZ6A 3LXLA 3E3BX 4C4JA 4RFMA 3UDSA 3ZO4A 1VYWA 4ACCA 3HRBA 4BCKA 3UC4A 4D0XA 2W5HA 1OITA 3PTGA 4APCA 2PYWA 2XIZA 4Y72A 3W0OA 5HVYA 1DI9A 3UTOA 2OK1A 5FXSA 4E7WA 5KX8A 2R3RA 2JLDA 3NRMA 2FSOX 3D7TA 4M68A 4G3CA 1WVYA 3D94A 2HYYA 3UIUA 3Q32A 4PL3A 3NMUF 2Z8CA 4S30A 3FZ1A 2QOHA 4WNPA 3LMGA 3O7LD 2J5EA 5FDPA 4J53A 5TR6A 1PW2A 3PA5A 2B9FA 2C3JA 3QTZA 4BB4A 4DFXE 5BV3A 1T45A 4O4FA 3V5LA 4FV8A 5C26A 5C4KA 3UDZA 4RIOA 4ANBA 1FOTA 2C0OA 4UMUA 3U6IA 5JZJA 1MRUA 2B52A 3Q04A 2ITWA 2V22A 5TKDA 4YJVA 3U51A 4Z16A 4OTQA 2WHBA 2OW3A 5M56A 2HW7A 2IPXA 5IA1A 2QKWB 5I0BA 3FKOA 4CKJA 3EQGA 5AR7A 1TZDA 2Y6OA 2C5YA 3BV2A 3CTHA 3KC3A 3D9VA 4PF4A 5C8KA 3TDWA 2JKQA 4B8LA 2IWIA 2JKKA 2Y0AA 3K3IA 3M2WA 4L42A 1OIUA 4M15A 5D11A 5ETCA 3RMFA 4CFVA 4X6RA 4I5CA 2ZV8A 4V0GA 2PVNA 4CSVA 5IU2A 4FSUA 4UMQA 3H9RA 4IQ6A 4MWHA 1R78A 4JRNA 3ORIA 1G3NA 1GZNA 4DEEA 3AD4A 2OWBA 3UC3A 4F99A 4DCEA 5K4JA 4FX3A 1U5RA 3S2PA 3S95A 3W0RA 3TV6A 1F0QA 4AZEA 4IAKA 3MV5A 4BKJA 3FI3A 1YRPA 4XS2A 3LXNA 2ETMA 2W05A 4DDIA 3UQGA 1J91A 3ZC5A 4BF2A 3LCSA 1SZMA 5KE0A 3N4VA 3LFEA 4FSQA 4G17A 4LOOA 3CJFA 3BX5A 3POOA 4FG7A 3F69A 4EH8A 2YDIA 5EYKA 5CF8A 5BVEA 3LVPA 3OOMA 3A7GA 1OMWA 1G8KA 3P7CA 3POZA 4Q5HA 3I0OA 3DZOA 4QMYA 3P0MA 3DB6A 4U41A 3ENHA 2QO9A 4ZK5A 3BLRA 3G15A 4DFLA 3RCDA 3F5PA 2NPQA 4C61A 1WBOA 2G1TA 3QBNA 4NW5A 1O6KA 3LFBA 5J5TA 2J0JA 4DEIA 1OBGA 3DKCA 1YI3A 3Q53A 3MPTA 3THBA 5DHJA 3W0MA 3QRIA 4AZTA 3LCDA 4GMYA 3M1SA 4K8AA 3B2TA 4PDPA 3V04A 1NVRA 4DH8A 4RX9A 3OBGA 2O3PA 4EH3A 4YSJA 3IQ7A 5JFVA 3N4UA 4RSSA 2FUMA 3LCOA 2J2IB 5DPVA 4P90A 4G2FA 4C4GA 4CEGA 1RQQA 5CASA 4IWDA 5I9ZA 2XAOA 3NAXA 2NP8A 3KFAA 3PXZA 3VC4A 3BU3A 3FYJX 4O0WA 5DBXA 4D4SA 3FZPA 4TYHB 1K3AA 2VWXA 1JKKA