3QRPA

Structure of thermus thermophilus cse3 bound to an rna representing a product mimic complex
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
214
structure length
214
Chain Sequence
YFQMWLTKLVLNPASRAARRDLANPYEMHRTLSKAVSRALEEGRERLLWRLEPARGLEPPVVLVQTLTEPDWSVLDEGYAQVFPPKPFHPALKPGQRLRFRLRANPAKRLAATGKRVALKTPAEKVAWLERRLEEGGFRLLEGERGPWVQILQDTFLEVRRKKDGEEAGKLLQVQAVLFEGRLEVVDPERALATLRRGVGPGKALGLGLLSVAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein TTHB192
publication title Recognition and maturation of effector RNAs in a CRISPR interference pathway.
pubmed doi rcsb
source organism Thermus thermophilus hb8
molecule tags Rna binding protein/rna
total genus 53
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2011-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08798 CRISPR_assoc CRISPR associated protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1200 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Crispr-associated protein; domain 1 3qrpA01
3.30.70.1210 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Crispr-associated protein; domain 2 3qrpA02
2Y9HA 3QRRA 3QRQA 3QRPA 2Y8YA 5H9FK 4U7UD 5H9EK 1WJ9A 4QYZK 2Y8WA 5CD4A 4DZDA
chains in the Genus database with same CATH superfamily
2HQ3A 1QD1A 1J5EF 1F5AA 4DSIA 2D3ZA 3CCQS 3M8ZA 2YWWA 2KM8B 2DNMA 5DRKA 4C8ZA 1HQEA 3T41A 4L3KA 3DRXA 5J2PA 4NZ7A 2D3OR 2GIRA 3IO1A 1C4AA 4J9NA 4O44A 1TAQA 4IO1A 5DQHA 2DKOB 3QIPB 2JEJA 4ZJOA 4QR1A 2B56A 2R8KA 1IBLF 3M30B 3ZTRA 1VQKS 1SIWB 4FBTA 1UP1A 2Z2ZA 2CUYA 4RKUC 3M2UB 3M2RB 3CJSA 3WDOA 3FZBA 3MM6B 4OI4A 3KLHA 3PJWA 2CQBA 1X4AA 1Z4UA 5G0RA 2YPYA 3SQGB 1VHIA 2NXUA 1RAJA 3BGRB 2BOPA 2A10A 4F8RA 2HNZA 5D0EA 2Z8QA 4JI5J 1S1TA 4PWDB 4UW2A 1S1WA 4KKOB 3TA2A 3HVTB 3OW2R 2MQPA 3KG4A 1E6YA 3VGSA 1MROA 4WIQA 2IAJA 1CJUA 1D9FA 1YWXA 3CCMS 4I67A 3OUYB 3DDKA 2Q66A 5I42B 3KWMA 4ENOA 4YHHF 2WONB 2GMJA 3RBZA 4ES1A 4I6AA 1GX5A 4IFYA 1OY9A 1S10A 1LW0B 1WORA 1O6XA 2QZ8A 1UA0A 3KXDA 3FBCA 4F2SA 4EBCA 1QAYA 2PA8D 4EK2A 3KLEB 3CJ4A 1N5TA 4DV4F 2DK2A 1B3TA 1KC8T 4OZ5A 4DR6F 5KFQA 2ZBCA 3EDQB 2JC1A 4KIAA 3C6UA 2W4CA 2PA3A 3Q2TC 3KK1B 2V8HA 3TARA 4RPFA 1Q8BA 1TV6B 3CDUA 3ZZZA 2Z4PA 4B3TJ 1WTFA 3PX0A 1BY9A 5F8HA 4C8YA 1PCAA 4IRCA 1M5SA 2VUGA 2ZKTA 1AB8A 2FLPA 1J5OA 4OIXA 4GRSA 5KT2A 2FHMA 3BEGB 3FMBA 1UVKA 3QATA 4AE5A 3RTVA 3DKDA 4ZLPA 3P5TL 4LUBA 1H74A 1ZBTA 2VG6A 2VFVA 2CADA 2M4MA 4KO0A 3AD7C 2D9PA 3CWJA 4O3QA 2ZWPA 3C6TB 3MR3A 1JJHA 1ZTTA 4MK7A 4KPYA 4QIEA 2K7JA 4LRDA 2HHXA 1KP6A 2RVJA 1LFWA 4K7QA 3VTIA 1NUEA 1UWBB 5HATA 1NKCA 3TA1A 3N5FA 2RDDA 1TVRA 4YUDA 3H20A 1U6ZA 4ZN3A 5KT7A 3RYLA 3SCJE 1UPMB 2QMUB 3OL8A 4U7UK 2BR0A 1TL1B 3PIOQ 5T41A 1N0UA 4DCOB 3CC7S 4PQUB 3HPOA 4RUAA 1LWEA 4FF1A 1HBNA 2IM3A 4AD6A 3GFYA 4K4XA 4DPTA 4TKTA 1U8WA 1U2RA 3DXSX 2W24A 3EDRB 2ASDA 2ZNYA 4OZ2A 5J1NA 1YBAA 2BDPA 4EZ6A 2C2OB 5DJBA 2E5GA 1HW8A 3M6WA 2YH1A 5BXIA 3V81B 2QFIA 2XI3A 3D0IE 5DM7Q 5LXYA 5DLFA 2R2SA 1NRKA 3CJRA 4DU7A 2ZH4A 3OSNA 5HQ8A 1MW7A 1OO0B 3V6DB 1C1CB 5D4PA 1EKRA 3SDEB 2XMMA 4M5DB 2RHSB 1HBMA 2L9WA 4M63A 1RJJA 3A8JA 3D6HB 1KKHA 3UCUP 5DDQC 4YN3B 1KQFB 1BWVA 2KDOA 3A8KA 3J81j 3OVSA 4CLZA 4C8OA 1U2FA 3RR8A 2DY1A 1FRMA 4RO0A 1CVJA 4L76A 3VQSA 3PZPA 3QO9B 4QIWD 5J2NB 2XMUA 3B82A 4B02A 3R5DA 2QMXA 3EE3A 4MK8A 1ITPA 1QTMA 3MM9B 2DNQA 3B78A 1RKJA 4P2FA 4Y34A 3TJAA 2O3DA 5E7OB 2UXDF 4MYTA 4TY9A 1SC1B 1JWWA 1RLCL 4J5OA 5C24B 1MN7A 1NDLA 3MXHP 4BCAA 4LQ9A 3RB4A 2UUAF 4I7FB 2OI2A 5LMNF 1NB7A 1YRXA 3MWBA 3PM9A 2Z58B 1YLXA 3MM5B 2UVVA 1YRTA 4W92B 2DD8S 2WCXA 2YNGB 3Q8VA 1SIZA 3R5GA 5CXTA 4NA1A 5B0AA 3CT9A 2NPFA 1D8ZA 3AXKA 4FDFA 1M5HA 2NXNA 3M6VA 4GKJF 4P7TA 1KEKA 1B99A 1RHQB 4K4ZA 3LTOA 2RKIB 3PW4A 3A1YG 1VI7A 1S12A 2B9XA 2MQNA 4OI3A 3I9ZA 1HMVB 5G4DA 1U26A 4TY8A 3NWRA 2X1BA 1RBOB 3WC0A 3L7PA 5HBMA 2RMLA 3PRBA 2UXCF 4KV8A 2AYGA 1S97A 1L3SA 3Q24A 2WBRA 3H5XA 2MZRA 2IBOA 4ZVSB 3CD0A 2P8IA 2VQEJ 4GC7A 2C3MA 3DLGB 2W8LA 2H5JB 2RHQB 4OQJA 1VQOS 2MY8A 3FJ2A 2DHXA 4G3IA 1HWJA 3MI7X 2XG8A 4Q45A 5C42B 2DHAA 4ETXA 1TMMA 5ETKA 5FDLA 2J6SA 3RAXA 3BDEA 2E5LF 1KTVA 3MAAB 1KONA 4P71A 3NNAA 1U1RA 2R8IA 1WDDA 4DV7J 1P8GA 3DOMA 4PAAA 4KT0C 3JTPA 3O1LA 4JI4F 4WJBA 3MPDA 3W1YC 5DLGA 2YBVA 4NLDA 1N5QA 4H4KA 2MLZA 2CDRB 4OHYA 3PYDA 3ZO7A 2MSTA 4ZPWR 1TELA 2AGPA 1LWFA 3GYXB 2DO4A 1R0AB 2NUHA 1S9EA 4LSLA 3QJJA 3PNIA 1IR0A 4QWDA 1HHTP 1R43A 4PPZA 2UU9F 4ILRA 3PW2A 3KLIA 4DQQA 2WOMB 3POTB 1ZPVA 3QFHA 4DL6A 4KTQA 1YBTA 3MCMA 3LW5C 2C3YA 2E7WA 4QWEA 2RU3A 4ZVOB 2MXYA 2MY7A 2WBMA 2GV1A 3HKZD 4I64A 1X9WA 4MT1A 4PUOB 1YJRA 3D3CJ 2VOOA 4DZDA 3VAFA 3W61A 2IRUA 4B3RF 1FX2A 2Z57B 4P2MA 3M32A 4ICLB 2YKNA 2XYPB 3BH7B 2ZM6F 1Y4ZB 2RQCA 3VAIA 4AFFA 2ILYA 3M1VB 4J9LA 2OELA 1PILA 1BGXT 3DMJA 5LXRA 4WP9A 1F2HA 5HJXA 2LMIA 2YY3A 1RT2A 4IH6A 2DCUB 4ANCA 4P2XA 2WVFA 2D9OA 3K8WA 2XS5A 3I5BA 4MKVA 4OI1A 4DQPA 1GMWA 3ETOA 4ECXA 2RSQA 4DFJA 2R7WA 3W8GA 1AZSA 3I0SA 2AF6A 3CJTA 3GYGA 4DX8H 2ZITA 1EZZB 5HJYA 4RNMA 2UVRA 4D3GA 4MKBA 3CJKB 4IH7A 1Q79A 4X4NA 4KB7A 1M1GA 3SCIE 2AQ4A 4A8SA 4DU8A 4S0MA 3HT3A 4USWA 2VC1A 3D1HA 3DI6B 2X51A 4QU6A 2LQ9A 3RB3A 1PYOB 4ALZA 3CD6S 3DRSB 3C3LA 5KG0A 3OTDA 3C8YA 2E9ZA 1J2VA 2JNJA 2BM0A 3MCNA 4I68A 1K44A 4LIWA 2CQ1A 2BW7A 4MTPA 4DBQA 2H5EA 4NCGA 1N5YB 3QWPA 3RBEA 1S1UA 1WHYA 3AOAA 2LECA 1UKUA 3CCWA 3CMAS 1RT1A 3DFEA 3P49B 4JI2F 5H9FJ 1VBZA 2F65A 2ZHBA 1R8HA 4FXWA 3VGVA 4P72A 3EGVA 1MWZA 3CW2C 4K59A 1QE1A 1VQMS 3OR1A 3JXOA 4CH1A 3KHRA 4K0KF 2HVEA 1IM6A 2F8HA 1NJWA 1XERA 3K17A 2VOPA 1DARA 2W2MP 1WJ9A 1FTCA 2J6TA 2RDJA 2V0NA 2QX0A 3KK2B 2OD6A 4HEA9 2BANB 1SJ1A 1S9GA 1T3NA 1U1PA 2Y0SD 4PG8A 2IM0A 4LF5F 1F3VA 4ZVEA 3FBBA 3I87A 2HBZB 2V4JB 3RRGA 2MKYA 2ZVIA 1W2BR 3ETMA 5J1EA 4HHJA 5AXNA 1FTRA 4DS4A 3MDFA 2K2PA 2CPFA 1RP5A 4OYAA 2WVBA 1FRJA 3GWCA 3M8PB 4XTTA 4X64F 4AL6A 4JB8B 1S7IA 2EFGA 3LP1B 4TN2A 3EUNA 1HNZJ 3G8QA 4QW8A 1S48A 3AJ2A 4LVOP 5HVFA 2NZ4A 1SJQA 3DCAA 4YP3A 2P6TA 1RBAA 2YPZA 2K3IA 1JXVA 1UEKA 3ZTQA 1UAWA 2C3PA 1NDPA 1IKYA 2MEWA 1LWCA 5DM6Q 2MZQA 1SUQB 1CJTA 1VLYA 1FVQA 1KHVA 1N4LA 3HD1A 3PR4A 1QLNA 1OYDA 4WF9Q 1X5OA 3UPFA 2YX1A 5KFCA 2EFQA 3MFHA 1FWKA 1U48A 3VGTA 2W01A 2XC9A 3J7YI 4HH0A 2VG7A 1HHSA 4MIWA 4CRJA 2CXEA 1JLAA 1CJKB 4DV2J 3K5PA 4IG3A 2MYFA 4DOZA 2PI5A 1V3RA 2DHHA 3KK3A 4IRDA 4IDKB 1N88A 3IRXB 1NXIA 4RBVA 1HNWF 4LSZB 2J8AA 1REVB 3QLHB 4C4WA 1R3NA 2KL8A 4NE9C 1HR0F 4OX9F 1Z2ZA 4LRFA 4N7TA 1F5CA 3DLBA 5KFSA 4M5IA 3FEYB 1SC4B 4QIGA 1TL3B 1DJ0A 1EQ0A 3W9JA 1X8DA 1UW4A 1G6BA 4R5PA 4WKYA 5D3GB 4I4BA 1N36J 2GX8A 3G87A 1OS5A 1W2IA 1FO1A 1VQ8S 2XWXA 1ZAXA 2DNYA 4F04B 5L46A 2QYCA 2W4DA 4C8KA 3PJ9A 4KH0B 3TZYA 1RTHB 3HHLB 2M88A 5F9LA 2RT3A 3R1LA 3US5A 4CP5A 3S01A 1N48A 5KAKA 4R0EA 1X9SA 1T9VA 1B64A 4QZVB 1ZETA 4DFMA 2GC8A 1M5VC 5A8WB 4FKXA 2HHUA 2AGQA 4ILMA 1DHMA 4TQRA 4G1PA 2NZCA 3H59A 4J37A 2UP1A 2UVUA 3OBIA 1KWMA 1HYSB 4NMLA 3ITHA 1BLUA 3F41A 2IA6A 2Z2LA 3QRPA 3ZXWA 3T6BA 3O5TB 2KXFA 3QJLA 1FRXA 4LIRA 4YR3A 4J9KA 2LCWA 5KFWA 1IKXB 3JQJA 4U6PA 5HP1B 1W26A 1NO8A 4E0DA 1MG7A 4O3SA 1HPZA 1S57A 3T5KA 4RW7B 4K8RA 1Y00A 1KQKA 4USHA 4N56A 1VQ7S 1M0SA 4CM0A 1F0XA 2FGCA 3D9BA 4YB7A 3WIVA 1OY6A 3QT5A 2V2VA 4B9MA 1QVGR 4B3MF 1EARA 1P6TA 2WB4A 3OLBA 5KTQA 2W7PA 4WP3A 3GFZA 1JJ4A 4DUYJ 1NM2A 1FRHA 3QWUA 2MGZA 1KFSA 2JWNA 4C2MA 4OZ1A 5CQGA 3OLAA 4RX6A 5E41A 2GJFA 4X66F 5CD4H 2HNYA 4MFBA 3JS9A 1QUVA 2RNEA 1GMWD 2COLA 4CH0S 5EUHA 4HH1A 4PCQA 4NLOA 4C6AA 1RA6A 4URGA 5B0EA 4PWUA 4ED4A 2M52A 1NEEA 1EB0A 1XMOF 1FKPB 1VBXA 4FS1A 3UNGC 1S59A 3D4JA 3QGHA 1T11A 1HBUA 5CZVA 3DM2B 4DPYA 2IJRA 3AB2B 3KJFB 5DDRC 5KFNA 2EKNA 3CJ8A 5GMDA 3MD1A 3P8BB 2HRTA 2JFKA 4RW9B 1UCNA 2QO3A 1R6VA 2VFSA 2VASA 3U27A 3GIMA 3OXGA 4CT8A 4Q5VA 4WYLA 3DGPB 3I4HX 3CIZA 5D8HB 3MTJA 7FD1A 4G1QA 2MB0B 2Z0GA 4OYIA 2KVQE 1PKUA 3H7HB 2C22A 4F26A 1Q8LA 4BDPA 4LF9J 2ASLA 3NBPB 1RTDA 1FRKA 3MFIA 2XY5A 5T7LB 3QIDA 1MU2B 2C2NA 2UXBJ 1KDNA 2V2QA 1Z2LA 2DIVA 4ZLJA 5IM0B 2ZHOA 3K8VA 4ZHRA 4QOTA 2WTFA 1CC8A 3R6GB 1N6QA 4C97A 2ZUGA 2QIFA 2R8JA 4IKAA 4PQAA 2Q3PA 2AJFE 2M9KA 2J0QD 2G13A 1U0SA 1F9EB 2R2TA 1VC0A 1NZAA 5L1KA 5IV4A 3M8QB 2XS2A 4DR7J 1AUSL 2A3JA 2PMHA 3UR3C 3UI3A 2XGPA 1HNVA 2RRBA 2EPIA 1GH8A 4F4WA 3WC2A 2YX4A 3L7OA 1P1LA 3FVYA 4GMKA 3CCJS 1I3OB 3G2XA 2DBBA 2FPHX 4J91A 1WACA 5A0YA 2N4CA 1NB2A 4C3MA 1KRPA 3J7YU 3CMES 1SB6A 3U1LA 1WF2A 3LPYA 2V2KA 3MUTP 3NP5A 3FNNA 2G0JA 2JEGA 2CNOB 2HQCA 5ETOA 5A8RA 1MMDA 4C98A 3SI8A 1VRQC 1JLQA 1S1XA 5CYJA 3KLHB 4DXLA 1BXNA 3A3OB 5LT5A 4KPCA 2XSJA 2AD9A 2BKNA 2PSZA 2HNDA 2LDIA 2CVEA 3RW6A 1VQ9S 1GT8A 1VS3A 2CQCA 3QPIA 2HIQA 1V6HA 4U8YA 3NLCA 1VBYA 4OJ3A 4A8MP 2DT9A 1MROB 1WC1A 1YX2A 1K47A 4NXMJ 2EFOA 1PG5B 1S49A 1DQAA 1LKZA 3OL6A 1VQ6S 4ECQA 4CLTA 4BLGA 1UW9A 4NX9A 3BREA 3DLKB 3NAIA 4Q2LA 1C1BB 1IQZA 4IFYB 3PX6A 2CPYA 4DF4A 3BF4A 4WIIA 5ETNA 3HULA 3GILA 4Z37A 4X62F 4M5LA 3P3DA 2VFRA 1JXLA 4KGZB 2JFDA 2OPQB 1BQMA 3MMAA 4C8MA 4KJIA 2NSCA 2CJBA 3DHXA 3LALA 2K1RA 1DTTA 3OV7A 5GMKa 3C6UB 5DGAA 5HAOA 3IGNA 1XR5A 3OXLA 2O1PA 4QJVA 5IC6B 4DLGA 2VDHA 4FYVB 4X4VA 2ZDOA 5IFMA 1RT3A 2LLZA 4I6WA 4J9MA 4DR2F 4B3OB 2W8KA 2BM1A 3G8TA 4CO2A 5IS2A 2E5JA 2QE5A 4O4GA 5K8OA 5MLCV 2ZNZA 4AQYJ 5AJ3J 5L39A 4ED0A 2VPXB 4RBUA 4B3SF 4K4UA 2DHSA 3FCVA 2XTJP 2IVMA 1LW2B 2B8QA 4U7UD 1KSPA 2ZH2A 3S7RA 2OPRA 1GEHA 3ET6A 4OLPA 4L75A 3N6LA 3BPDA 2V9KA 3GP9A 1RXOB 2CPDA 3EYZA 2IY5B 2YQ0A 3NNHA 2KXNB 4KAIA 2C3UA 2BE9B 3W63A 1I51B 2HHVA 2ZKUA 2KG1A 4JI0J 1BUXA 3CC4S 2HZVA 3P4UB 4JV1A 3Q2SC 3ENQA 3Q0AA 1Q1KA 4LRBA 3FDSA 3G4SS 5EHHA 2GGPA 2HQIA 2V4RA 3DOLA 5KFVA 2WSFC 5L9NA 1DURA 2UUTA 2CNLB 1IKWA 3THPA 3FEXB 4WTYA 1UL3A 3I55S 4K4YA 4DSFA 5A8KB 2LKZA 2HMIB 3MD3A 1XN9A 1FF2A 2DPIA 2YNIA 3DRPB 4PYDA 5EWFA 5AT1B 4Z7CA 3D28A 5JUMA 2W2OP 4CO5A 4FVMA 5CYQA 3BJYA 1G7CB 3UDVA 1EKSA 1U2CA 4N76A 2J0SD 2DGVA 4F0HA 2ZH6A 1UJ4A 4KFBA 4LVNP 2DITA 1D9DA 2E1RA 2RU9A 4ELVA 3LAKA 3TUZC 4LF4J 1PAEX 4U9RA 1ULRA 3QT7A 1HA1A 3BSAA 2PMWA 4XO0A 4DV6F 1Q53A 3OTOJ 4RL1A 2QL9B 4HYKA 4WFYA 2D3O1 2XZWA 5AXLA 1BQNB 3R8YA 2WRMA 3MPUB 2RF2A 5EDWA 1HBMB 1H73A 1EETB 2DGUA 1SKUB 3LA0A 1QSLA 2Y9HA 1M5OC 2BW2A 1RU1A 2K7KA 4DG1A 4WBFA 3NAHA 4C3KA 2IDLA 3D0GE 1QTNB 3CJ5A 1X0FA 1HQUA 3LAMA 2GNKA 4NLRA 3RUBL 4ECTA 4IR1A 3PKYA 2DRAA 1E6VB 4TU8A 1S99A 3HVRA 2BJ3A 4PPDA 4BC7A 4A4JA 3IAM9 3P5BP 2FJVA 4ZOSA 2K06A 1J5EJ 1U6FA 4FYWB 2FVPA 3ISNC 2HHHF 3CGIA 3FSXA 2NXJA 4V19X 3T1YF 1FE4A 3FCHA 4CYUB 3CCUS 3AH6A 1QM9A 4C0BA 5KFLA 1DRZA 3PJXA 3C2PA 1RT4A 1IBLJ 2ZZNA 4G1IA 1VRUA 1JLCA 2V68A 2AJQA 2XB2D 2ZEJA 1XNRF 3HVAA 3UWTA 2I0XA 1HNIB 2A2CA 4DCPB 2CPXA 2UZAA 3AA8A 1SVDA 2HHWA 1WOOA 1L5UA 1VQ4S 4M95A 1WEZA 1R31A 3A3NB 2E7VA 2YH0A 3PRDA 5HBMB 2Z30B 1QSYA 2VBZA 4QIFA 5I3UB 4DS5A 4UQTA 1RTIA 3HI9A 2DGOA 2IM2A 4QWBA 3BGLA 3H40A 3HSZA 2BE2A 1TK5A 4O3RA 3HCXA 4ED5A 1F5BA 4FXVA 1Y10A 4YHHJ 3T1AA 4X4PA 5B0GA 4CLUA 1MWYA 4ZJQA 2RAQA 1V3ZA 4R0JA 5JVHQ 4FYYB 4D3HA 2QN6B 4PR6A 2OUGA 1NSPA 3VVTA 1U1LA 4DV4J 2JEIA 2DEJA 4JI7F 4ZS6A 2C42A 3O44A 1ZM2A 3QQCD 4ZPBA 3GJRB 3OVAA 5LMUF 3BQ2A 4DR6J 3KYLA 2QYGA 3BBBA 3W2WB 3DGVA 2W9BA 4DUYF 3JYTB 2DNLA 4LSLB 1IXKA 4HR2A 4K5RA 4L72B 2W9CB 5KFYA 3PACA 2VA3A 4ZVQB 3KLIB 5F8GA 1KVKA 3DYAA 4KH1B 4JI3J 1X9MA 1C4CA 1NK8A 4CCHA 4WFXA 1P9QC 1JLGA 4ED7A 4ZDNA 1YI2S 1CSJA 3Q8SB 1VQ5S 2BBEA 4IQXA 4CIOA 2ALYB 2D3UA 4ERDA 3MEDA 3J7ZT 1RT5A 1U1KA 4RW6B 2VBWA 2YKMB 1MWQA 4W98A 2CJYB 1HKAA 3H98A 3W9IA 2MQ8A 4G6VB 3M32B 4N5SA 4OYZA 3NXZA 2G2OA 2IVYA 1KD1T 2E1AA 1RACB 1G4CA 5KFRA 2YNHA 4WFNQ 3C14B 5BYQA 4AXJA 2YQ1A 1V9OA 5JXSA 2HRYA 1LQ9A 2AT1B 3VF0B 2ZUAA 1RUSA 4FNIA 2EK1A 4M5JA 1TKXB 3QBCA 3UQSA 4KGXB 3KJVB 4DR5F 1SQEA 1S0NA 2PN6A 3VZIA 4A46A 1RWNB 3EWGA 4M5HA 5E2QA 1NCLA 3J7A1 3H8YA 2XY6A 4NRTA 1JXEA 2C2MB 2F40A 4OV1A 2OAUA 4OZLA 2IBKA 2V4QA 2VPYB 3FRZA 4H4OA 3CF5Q 2YKQA 3GIRA 1VRTB 1XWLA 4EGLA 1RAHB 3NS7B 3O6QA 2Q6CA 2YNFA 4BBYA 4KR0B 2NS1B 1N33F 3KG0A 2C2EA 1OSCA 4I2PB 2H9ZA 1S0MA 1FFSB 2UUCF 4NLVA 5EGYA 1B7FA 3C16A 4EBEA 1SV5A 2ZBRA 2VPZB 3VGUA 4B9VA 3CDAA 2CZ9A 4TYBA 2XZDB 1X4HA 3L95X 5D78A 2WHOA 3MEGB 1S5ZA 4H4MA 4KYZA 4PZVA 2HAFA 6FDRA 5HROA 4DPOA 4J90A 4ZPCA 3AY0A 3GU0A 4HT5A 4RW8A 1PJ5A 4C48A 2F9DA 1URRA 2I6WA 1X31C 2J9CA 2ZD1A 1Q86T 1QE1B 2RRNA 3SFUA 3GIIA 3GG0A 2I1RA 2RH3A 3OR1B 2EVZA 5KFDA 2G0IA 4YOEA 2PT0A 2E1MC 3DOKA 5J2QA 1H3DA 3BYPA 3AOCA 1H0HB 3PDNA 1X5SA 3KOAA 4ZJLA 2N7YA 2UXDJ 1WG4A 2XHCA 3ZTOA 3KKFA 4ECYA 3W5ZA 4CLKA 2LXFA 3HVWA 2UUAJ 3SZ2A 3BKUA 5LMNJ 3V6KA 2B43A 1UFLA 3QIPA 1ZYQA 1NSAA 4UQGA 4HDGA 3UDLA 5K8PA 4QU7A 1U7LA 3M30A 1YZ7A 3V4IB 3MR2A 3EPIA 4ED3A 2B8PA 4LFCF 2OO4A 3M2UA 4UTGA 3M2RA 3CJ3A 5LJ3Y 1TKZA 4ECWA 4DSKA 1WG1A 3IA0A 1LK5A 3H90A 3I5CA 4GKJJ 1RABB 4ZVPB 2CQ0A 2R8GA 2YWEA 3SQGA 3AXMA 1RTJB 4Y65A 3BGRA 2FYXA 4A8XA 2WSEC 1KHWA 2ZOMA 4NMXA 2XI2A 2J7UA 2HRUA 1KNZA 4X4OA 1BQXA 1RZMA 2QC3A 1IKYB 2R2UA 1LWCB 4PWDA 1CLFA 2RDIA 1CJTB 1FJ7A 4KKOA 1T8EA 1NPPA 1TU0B 3H2LA 3HVTA 3IWXA 2UXCJ 4AT1B 4CLFA 1QDUB 4PWWA 3W5YA 2AWZA 4H4KC 2DGQA 3ENVA 2XZTB 3VAKA 1RHRB 3W66A 3QJPA 1R0CB 5AJ3F 1U02A 3K2YA 2KFZA 2VG7B 2XLKA 1WKKA 1A7GE 3GONA 4DQRA 4AUKA 4ECZA 4URSA 5KT4A 2GHVC 4RNOA 2HVDA 2FC9A 3H2UB 1LW0A 1K0TA 2W2PP 3W9HA 5D0HA 3RRHA 1K0VA 3M05A 3O2IA 1SL0A 2FY1A 4YEAA 1YQHA 2V63A 3OFGA 2E5LJ 1GAOA 2MZ1A 5H9EK 1GXUA 1RWUA 4LSNA 4L3NA 2BX6A 1N0VC 3T5JA 4JI4J 3PV8A 3KK1A 2NQPA 3VAMA 1VQYA 3FBEA 2YQ3A 1PAUB 4JYAF 1AA1B 1IBKF 3HM9A 3P45B 1FWLA 1X0PA 2CVIA 2AYMA 1WF1A 1BE4A 2UU9J 2RIJA 1YITS 2DNRA 4P9SA 1YJ9S 3H5UA 3DLHA 3DU5A 3IGVA 4R5PB 4RW4A 2FJAB 1T05B 2G2ZA 3NOCA 2BEFA 1FJGF 3IP0A 4CI0B 3D66A 3T5LA 2W25A 1VR6A 2M8HA 2WW8A 4DUZF 4X65F 1SBRA 1WD6A 2OTJS 3MR5A 1CJVB 4JI1J 1ZS6A 2EG2A 1UEVA 4B3RJ 5HLFB 1V5IB 4ZVHA 1NK5A 2ZM6J 3PW0A 3CB4A 2LVWA 3LP2B 4OZ3A 2BA9A 3JSMA 5E33A 2YX7A 4J9PA 3OT9A 3BKFA 1UWBA 8RUCA 3TZZA 5LM7E 1YK9A 1F9FA 2OKQA 4N8NA 3T9ZA 1TL1A 1U25A 1H38A 2GIQA 5K20B 4ED6A 3KHLA 1EAYC 4UOCA 5I3PA 4LQ3A 3QGPA 1IKVB 4B9SA 1HPZB 1RWKB 5JJBA 2GQCA 2HIYA 5DZ7A 1GK8A 1R8PA 1NKEA 3ZNUA 1VC5A 3QGIA 1X4BA 2F4VF 5ETSA 1IUJA 5FLXU 2DGWA 1KQGB 1C0TB 3JTOA 4FNHA 2I5JA 2HSEB 1UFWA 3FEZA 3KLGB 3V81A 2FLOA 2CQHA 1DQ9A 2BV3A 3EZ5A 2LQ5A 4USTA 1WTBA 3MECB 5IQQA 3IG1B 3G6ES 2BJ1A 2MLXA 2J0WA 2D41A 4A48A 2MKHA 3IR7B 2MGZB 2BKOA 1C1CA 3SDEA 2MKKA 1SKSA 2HNYB 4MFBB 4RWXA 2XM3A 4DV0F 3L3CA 3JQKA 4XK8C 4PEOA 3AFGA 4ZVTB 1VC6A 3Q23A 2GJ2A 2BOAA 5IT9Y 2CA9A 3L4BC 1B70B 2F1FA 3AJDA 4JI8F 1X4DA 4JI2J 3CO0P 4DF8A 4GKKF 2KU7A 4CNZA 3FQLA 3QO9A 2CQIA 2HBQB 5J2NA 1TKDA 3IWNC 5ETRA 2VH7A 1S6PB 4K0KJ 2W1BA 2FLNA 1VOMA 1AXQA 3DRRB 3LUYA 3V6HA 1NZ8A 4ZP7A 2FD2A 3F0NA 4ZCKA 1M5PC 2EFVA 4P10A 3RB0A 2KZZA 3KNGA 5HMZA 1UTAA 3GJSB 2GIFA 3MHYA 3G8SA 5B09A 5K8MA 4I7FA 1XK8A 2X3DA 3A13A 4UY85 1RDRA 2A6OA 2XEXA 3NGTA 3EM1A 2JL9A 4OHXA 2GHWA 1YG0A 4LF5J 4FPIA 1S6UA 1F60B 2CQPA 2Y1JA 3MM5A 1UVLA 1D8YA 2ZJRQ 1VYAA 5ADZA 2FVRA 3IAS9 1QY7A 1TQLA 1N5SA 1HI1A 3CCZA 4WTOB 4BWJA 1HWUA 5FLXY 2LEPA 1TUVA 4X64J 2RKIA 3W60A 3O8WA 4UOGA 1ZPWX 5K8NA 2C2RA 2EG1A 2WVEA 3M8SA 3GPAA 4MAKA 1RWXB 1ZAVA 2ERRA 3LP0B 1LV5A 4NL5A 4KGVB 3SIPB 1HMVA 1HNVB 4JUZA 2IPOB 4RUHA 4ECUA 2R4FA 3TUPA 1FNXH 4BC9A 2Y1LB 1XTZA 3U1MA 3ZZ0A 3M6XA 2FJBB 4JI3F 4TLRA 3HJVA 3DLGA 1BHNA 4K4SA 2MZTA 3NGRA 5D4NA 4LFAF 4DX6A 2XCAA 3E8OA 5C42A 2DH9A 2B4PA 1S6QB 4JBCA 5A8RB 2DR6A 1JLQB 1D1UA 3HHKA 4DN9A 3OSPA 2HZAA 7FDRA 2VZ9A 5HL7Q 1TL7B 2O66A 2XSJB 1D9AA 4MK9A 2DR8A 2HNDB 1VHFA 2ZZMA 3QNWB 1QJHA 4A8WA 1HNWJ 3U7JA 3CUNA 1IM4A 1SC6A 1SPBP 4ZP9A 1WKLA 2PDAA 4KQZA 1HR0J 4OX9J 4DV3J 1K8AT 3POTA 2FUG9 3T1HF 4ID5B 3MM8A 3VWSA 3KMSA 2DXFA 1FX4A 2NREA 4ID8A 3QSYB 1RWVB 2RQMA 2XMJA 3ICLA 4PUOA 3MUVP 5ETLA 4USKA 2FJEB 2PE8A 1X5PA 3ADAC 3R2DJ 3JAMU 2J7KA 3F56A 2OD4A 5HQMA 2KYXA 3BYRA 2MHNA 3DNCA 3MMAB 1KLNA 1GMUA 3M1VA 1DTTB 3MEEB 3G9CA 3BQ0A 3DDIA 5E3PA 2HFNA 5GMEA 1M90T 2C3OA 2A6MA 4YY3F 1DAXA 4B9TA 3EVMA 5D4LA 1HIYA 4OYBA 5MAOA 4EMDA 1FWPA 1TR0A 2OTLS 2VC0A 5F0UA 5HVHA 2B3TB 4PXBA 1NH8A 4J9SA 2CZ4A 2VIHA 3HHEA 2F8MA 1HFEL 2R8HA 4OJHA 5DS7A 3Q8QB 5KFUA 4CLSA 2OPRB 3ET6B 2QL5B 2DHGA 1N5VA 2J9EA 4IYQA 5L38A 4M5KA 1BMQB 4YB6A 4ZCIA 1I94F 2XYHB 4K2JA 3TA0A 2IVFB 3DI6A 2LDYA 3R27A 4QWAA 5JMNA 3HD2A 5CH7B 4B3MJ 4RZRA 2H4YB 2JC0A 2B9YA 2YVSA 4IFVA 5M2RA 5KFMA 3DRSA 2IYIA 2VF3A 3Q8UA 4FVCA 4Y6IA 1HLWA 4CLPA 2GGPB 1MMNA 2IJFA 1DLOB 4DI6A 1P9YA 3UNYA 3ZZUA 4F50A 1S0VA 2KRRA 3WZ0A 1XNQF 4E2FB 2KG0A 2KO1A 2XNQA 1N5YA 1R8BA 1UVIA 4F67A 5GADI 4X66J 2QLBB 3UW1A 4C0HA 1TUGB 1G3OA 3DDNA 5CYQB 4ZKAA 2ZFHA 2NLWA 2Y3YA 4JV5F 2HHQA 3BB5A 1XMOJ 1T9WA 2L3MA 4TXSA 4O3NA 5CYMB 2VB6A 3JAMY 2B4OA 3VHQA 3MMJA 4PRFA 3HFZB 3LGMA 2U1AA 1TP7A 4CM2A 2CPHA 4O3PA 1YJTA 3RAMA 4F3OA 5THWA 4WP8A 1XJWB 2AJ1A 4WWSA 4FYXB 1YJUA 1FK9B 2FY8A 2BANA 2B0GA 2XCPA 4ZPVR 4ZK7M 3NL0A 2JRSA 2RF2B 3M2VA 2YKAA 2ACYA 2E66A 4Q2MA 1IR1A 2C1EB 1JJCB 5D0RA 4NOHA 3PCOB 1WC6A 3IBWA 5KFPA 4EO6A 4DN0A 1U4BA 3D67A 1IBMF 1L3TA 2V4JA 4ZLNA 4NCBA 5LSLA 4OMFG 2FIUA 1AFJA 5E3RA 2W2QP 3PVXA 3SFGA 2VG5B 2Y1RI 1ROFA 1KVJA 1EP4B 3NRBA 3QGGA 2OMLA 3RW7A 1U1OA 2XGQA 5IZHA 3M8PA 4ZP8A 4USIA 4DPUA 4ELUA 1RKIA 3RB6A 3MF5A 1NPKA 3DLEB 3NGDA 3BSCA 4LBIA 2KFNA 4P73A 3LWMA 1Y3JA 4C8NA 3DLLQ 4KBIA 1FA0A 5C25B 2P9EA 3SYZA 3B8HA 4WKRA 2HAIA 1ZZNA 2DNKA 1YGYA 1SUQA 1Q82T 5KOXA 4EBDA 3TJ8A 4CDIA 4IUFA 1FXLA 3ISND 1JLFA 3UD5A 1Q16B 2JLEA 2BABA 2ROGA 3AQPA 2MQOA 1ZAWA 1U0HB 1FDAA 2DR9A 2FTRA 4YDDB 3NY0A 2BE7D 3C15B 2OGUA 1UMJA 2B51A 4LR9A 3H42A 4FPRA 3CTRA 4Q0BB 1MLAA 4HACA 5LJ5Y 1RT4B 4YR0A 3CNQP 4R8UB 4CTAA 1CJKA 3W2VB 2IDEA 1NU4A 3HKWA 2DCLA 4IRKA 3OR2B 4NI2B 4JI1F 2B9WA 3CEDA 4GVBB 1S7HA 1IWAA 1CQNA 3H25A 2ATCB 4IOBA 1UPPA 2QTWA 5KFAA 1HNXF 2RUGA 3IN5A 3QLHA 1I1GA 3UDCA 3DRYA 1WI6A 3ILLA 4I56A 2PGCA 3G71S 1RTIB 2MJNA 3CDEA 4PG6A 1LK7A 2P5VA 4CLYA 4NCAA 2BE2B 4LJMA 1TL3A 1FT8A 3I32A 2KRBA 3A8EA 5AE3A 2LA4A 5A2QY 3TW0A 2LQBA 4EI2A 4C9DA 5DDOC 7AT1B 2O01C 5D3GA 1O0PA 3BPSP 3OD2A 1NK7A 2DB1A 3RG6A 1WSVA 4I69A 1JLBB 1XIQA 3HHLA 1KFDA 4X62J 3VQTA 3W62A 4K5SA 5CAAA 3TVYA 4H54A 3QT6A 3RBXA 2DH7A 2ZJQQ 4WYWA 2KZMA 2DISA 1RWPB 4ZCLA 4ELTA 1AT1B 4WCEQ 3OVBA 2DY9A 4OL8A 2B6AB 1HYSA 1PBUA 3RAQA 2FLLA 2FZGB 3NEKA 2CQ2A 4DR2J 3DYAB 3OTBA 5GAGI 4K2XA 4F7VA 5HP1A 1PJ6A 1SH3A 1WELA 3EMTA 1RT6A 2Q79A 4LF2A 4B3SJ 1FD8A 3NKYA 4E98A 4LF8F 3MEDB 2AYBA 3A8IA 4XPEA 3TO8A 3LPEA 4RW7A 4DQIA 4ED1A 1M1KT 1RTZA 4KGMA 3ZNJ1 1YHQS 3TR5A 2N3LA 2M70A 4LF7F 4KHPF 5L1LA 2HEKA 2YNHB 2AZ1A 5BYSA 2P9CA 3FQKA 4OYMA 2DR7A 1XQIA 2MPUA 1C0UB 5KT6A 4DJBA 4M94A 3PEHA 1Q81T 1ZM3A 2LXUA 2MQQA 1UJ6A 4WFAQ 2PO4A 3N9UC 1OPZA 5GADU 1RWOB 1WEXA 2GVZA 1Y9OA 5ETVA 4BWMA 4QWCA 1CULB 1FKPA 1PC5A 2G1HA 4H4OB 5IC4B 1JIHA 1Y3KA 1OJ4A 1XR7A 4Y28C 1KLMA 1G1XA 3BBFA 3L9ZA 1HI0P 3KHGA 1T03A 3PKMA 2V8DA 4MKAA 4P7VA 4CO1A 4XPCA 3BSOA 5D77A 1HWKA 4RW9A 4ZPAA 3TEHB 5I3QA 3Q8PB 2OEMA 2M7SA 2RB7A 2XLJA 3GB0A 2X1AA 4DV6J 1SV5B 1RWMB 5KG2A 4MKYA 1U6BA 1NK4A 4YMEA 3MCOA 4F25A 4WE1A 1SH0A 4NLTA 3J7AN 4RUBA 3CD7A 2KB2A 4WPAA 3MCSA 3MMBA 4I6YA 3T6JA 2ILZA 4ZP6A 1IBCB 2VDIA 3EXYA 4CNYA 1B7YB 2PFDA 4H4MB 2VQFF 1GTHA 4QR0A 1MU2A 4DV5F 2CKWA 3AQOA 2IMOA 3AJ1A 2ZD1B 2R7XA 1MSWD 1YRUA 5IM0A 4FN5A 4F4ZA 2PEHA 2F5GA 2CNKB 3W7BA 5EN1A 5SZTA 2F8EX 1Y7PA 3I5AA 1APSA 2DEIA 2HLUA 4URQU 5J2QB 4I2QB 3SCLE 1NJXA 3M8QA 4DFKA 5LL6d 4NLXA 4CQ1A 4HT7A 2YTCA 5BR8F 1JKHA 4EYIB 4C0OC 4X84A 2AP6A 1JB0C 2LQJA 3THTA 4IO9Q 2L41A 3PO5A 3BGFA 2ZBQA 4RNHA 4ECVA 3GIJA 1TFYA 4DV3F 2KJVA 2KJWA 4B9UA 1RK8A 2V50A 2HHHJ 4Z2XA 4Y2CA 4DLEA 5D0GA 3D6TB 4PABA 1QAIA 1UVJA 3TVZA 2JLFA 2EC2A 3Q83A 1JLEB 3T1YJ 2FVSA 3FSYA 4CZCA 5KFKA 2QFJA 3CJQA 3WX8A 1HHQA 4ED8A 2VBYA 4LF6F 1IQTA 4JP8A 1TKZB 1Q4RA 3HO1A 3AB4B 4DSJA 4PXEA 1VDHA 4A47A 1XNRJ 2JH3A 2VJVA 4DHVA 1NPRA 1Q5YA 1OYEA 2OFHX 3GFXA 1XMBA 2F7VA 1UVMA 2VKRA 2B5JA 2FB0A 5EWEA 3LO3A 5AXKA 5C2CA 3KJNB 1FI4A 4GC6A 2E9RX 1LNQA 4L74A 1I6JA 5F9NA 2OPSB 1ZZFA 2LP4A 1HD1A 3GCXP 3SBMA 3PR5B 1WC4A 6AT1B 3EGWB 3W3SA 3DLKA 5DQIA 3TAQA 4JI6F 1XMQF 1C1BA 4WXOA 2CQDA 4LMZA 3PHTA 1Y0HA 3RRKA 1NMEB 3K5OA 3K59A 1TK0A 1RGVA 2OHDA 2GA7A 2DGXA 4F02A 2P9GA 2IRXA 5B0BA 1NJIT 5CHCB 2OPQA 3MMCB 2QLFB 1FJEB 2GZOA 3UVJA 3V2UC 1H98A 2GO9A 4LSNB 3ILJA 5IWAF 4JI7J 2LXIA 5LMUJ 1IVZA 3ZC4A 1DZ5A 1DY3A 2OSQA 3J81U 4B3OA 4DSEA 4J9VA 1RYSA 3V4MA 4TYAA 2F9JA 3G82B 2JEFA 5GAGU 3TANA 5L1JA 1NK9A 4B9NA 2V67A 4IH5A 4ZVFA 1CS4B 1XBWA 4RW4B 2DRDA 4DQSA 3FRYA 1X4CA 2OJ3A 1OIAA 3MR7A 1OPIA 3OPKA 2O67A 1HBOB 2FJXA 1LW2A 5H9FK 1AROP 1KBRA 3EJMA 3SSRA 4TQSA 4IG0B 2ATLA 3DLJA 2VL1A 3HHLD 1S77D 1RAGB 5HMXA 3LWLA 2BJEA 5D6GA 5F8IA 2QA4S 4QPXA 2CAJA 3JSMB 2JX2A 2NCKL 2DPJA 4UF4A 4F36A 1IJEB 4OHWA 4V1Ak 4KRWA 3C46A 1HI8A 5HI7A 2H5IB 1WEYA 3FFIB 1WNEA 5GVQA 1WSRA 5CCLA 2FDNA 3GFHA 2IYGA 3VCDA 3K7RA 4DR5J 3B54A 4X4QA 2WW4A 5A8KA 2HMIA 2A1BA 2DGTA 2KT3A 3R1HA 2A0FB 3TRGA 3DRPA 2BJ8A 4WK1A 3TAMB 1FCAA 2HS3A 1VFJA 3CCES 3NWGA 1YJWS 1RCOB 3PRVA 1Q5VA 1U24A 2V8VA 3CDBA 4Y2MA 1ZOTA 1U09A 4J9QA 1TZ0A 2XHWA 3GSIA 3J7Z5 3R2CJ 2N3OA 2I5JB 2IIHA 2I9SA 1TAUA 2OPPA 4N47A 2RS2A 1N33J 3MURP 5KT5A 2QEXS 2OLWA 2QSFA 1T94A 2GQQA 3T9NA 2E1CA 2IC3B 2UUCJ 4QPTA 3EPGA 3G86A 1BQNA 3LGNA 3J81Y 4JOUA 3BR8A 1O51A 2AW0A 2MQLA 3IFEA 3M9OB 4QYZJ 4LFBF 4DR1F 2KYZA 1EETA 1QUPA 1VQLS 3N6NA 1WOPA 2OSRA 5BYRA 2JHEA 3LGHA 4TVAB 1HQEB 5J2PB 2CNNB 2UUBF 4O44B 2ASYA 2KM8C 4QIVA 1A6LA 3VVUA 5F8JA 5HK4A 2ABYA 3N28A 2MTLA 5KG1A 4DR3F 3UFCX 4EYHB 3VZHA 1SCJB 4K4TA 1S1VA 5A76A 3PEJA 2Z2MA 3BH6B 2HK3A 4DSLA 4X4UA 3BS9A 1XC9A 2JJ4D 1LXJA 5G0RB 1FKOA 2QV6A 1GMVA 2MKIA 1E6VA 4PKDB 2Q1LA 4KY3A 3I6PA 4ZVGA 2HNZB 3Q89A 2XLIA 1S1TB 1S1WB 2HS0A 3FUYA 5KG6A 1NAQA 1E6YB 2HWTA 2IAJB 1CJUB 3GJQB 4LREA 4DX5A 2ADCA 4ZN1A 2ZH8A 4W4MA 4CYUA 1AYEA 4C11A 2ZWOA 4NASA 4DV1F 2BZ2A 1DBDA 1D0EA 3K0JA 4ZMMA 3TUJC 1CG2A 5IOLA 2I2YA 2FVQA 4LFCJ 1KS2A 3I0RA 1SJRA 1VJQA 4ZITA 3NGSA 4USVA 1GFWB 3EGZA 1HNIA 5KFTA 1OWXA 4YB1P 3QRQA 2RD5C 1RT7A 1IWGA 1NK0A 3TEGA 2XMVA 2BRLA 5I3UA 4ETZA 3N0VA 2X7IA 3TX0A 1H7WA 1H6KX 2UV8A 3MM7A 2FZKB 3QAUA 3CCLS 1OQ3A 2JOQA 1NJYA 1A9NB 4F0KA 4O0IA 5SUHA 1S72S 3NOGA 3ZZRA 2HFUA 2WK4A 1J5OB 5DG7A 5E3AA 4F2RA 3EX7B 3MR6A 2AJ4A 1V3SA 3J80U 1TKTA 4J9OA 2VG6B 2XMTA 1N32F 4Y2KA 4KO0B 3D2WA 1RWWB 4RWWA 5HN0A 5ETTA 2XULA 2CZVC 3GCWP 1WI8A 4E8UA 2VFTA 2VKZG 5C7PA 3W2WA 2FVCA 2RQ4A 3MAQA 2B4UA 3JYTA 5I4MA 1WHVA 1FJCA 8AT1B 1PSDA 4KC5A 6FD1A 1Y5IB 2K3KA 2W9CA 2AJ0A 2RQKA 3GV7B 4JYAJ 1TVRB 4DR4F 4WK3A 1IBKJ 2CPJA 2LFVA 3HMJG 1J27A 3I56S 2XS7A 2XSFA 3MM8B 1NDCA 2M0GB 5D15A 1B0PA 3M6UA 5HSPA 1SQGA 5M2UA 2Q43A 3DHWC 2JDJA 2BACA 1N34F 1DTQA 2H48B 1FJGJ 1LWEB 4RW6A 3IC1A 5J2MA 2YKMA 2CJAA 1HBNB 3UO0A 1C2PA 3E01A 5HMYA 4DUZJ 4X65J 3I31A 3OQ2A 1R27B 1OY8A 1VLOA 2G1DA 2GFFA 3RGIA 2C2DA 4C3LA 4X4RA 2C2ZB 4PXDA 5J1PA 4MH8A 3KG1A 2PMZD 2MJUA 3ULHA 2QLJB 3TJ9A 1NKBA 3CDWA 3C14A 1RE1B 5HMWA 3AA9A 4LRCA 2ACMA 5LSOA 3BSNA 4U8VA 3T3FA 5IQ6A 3CCSS 1VQNS 4NEYA 1TKXA 5K14A 1WOSA 2XMAA 3KJVA 1P1TA 4HKQA 3IBCB 2IA0A 4NWBA 1HL6A 5HQLA 3KDOA 2U2FA 1W25A 1TL4A 4WU2A 3R5CA 2MMYA 3TOQA 3IS9A 2GVDA 3K5LA 2QA4G 2D74B 2DNGA 1RBLA 1ELOA 3J80Y 4FXDA 3OJSA 2CWKA 1VRTA 4N8OA 2DVIA 2J5AA 3E3XA 2HQFA 4LBPA 1T0TV 3GQCA 4NXNF 3OTEA 5JVGQ 2F4VJ 2R7UA 1FDNA 3TNVA 3SMZA 4X4TA 3X3UA 3GJTB 4RR5A 2ASJA 3CCVS 3KLFA 4I2PA 2V9WA 3RJMB 1FEEA 4UY8T 4IFVB 2ZC4A 3ZTPA 3PX4A 3CE8A 1LXNA 1G2EA 2CIMA 1KOHA 1TL5A 4QYZK 4U96A 2UUWA 2BUNA 3PFOA 1T9XA 2KT5A 3S1TA 4DL5A 2ZH1A 1HD0A 3MEGA 4LRAA 4BHQA 3N79A 1RA7A 4DZ6A 4DV0J 3SV3A 2FHOB 3T5HA 2N7CA 4Q43A 3GE9A 2OIHA 2HQGA 3IRWP 5GAEI 1ZM4A 2AGOA 3E2EA 1HW9A 2F4FA 2X1FA 1EHWA 5CA5A 1FERA 3UCZP 4JI8J 4HL9A 3GMGA 2E29A 5IT0A 3RBDA 3QFWA 1YJVA 4GKKJ 1FEHA 5GAHI 4OYPA 1R7IA 3TQ1A 1NHVA 1NNDA 2N4DA 2E5HA 2RS8A 1OQ6A 4ZLLA 5AE2A 4PYAA 4OI0A 4RU9A 3TYTA 4UOFA 4JI5F 3R97A 2C2KB 1N56A 4AL7A 3QSIA 4TY8B 3M2VB 4PG4A 1GTEA 4KV8B 3H2VE 3UN3A 1QVFR 3VAHA 5F41A 1UVNA 2YKPA 3UR0A 2RE1A 2GW8A 2M2BA 2NXEA 4W90B 2KI2A 2RRAA 2DYAA 3JSBA 3V4IA 5DG9A 4FZVA 2HFOA 2EEYA 1EX8A 3ILIA 1YKWA 1HWIA 3HFKA 1SL2A 3H4BA 2H3EB 2R3VA 4OX8A 1NLKL 1WHWA 2CJXB 5FDLB 3AHPA 4XDCA 1VJWA 1RTJA 1SKRA 2CWXA 2DNOA 1UA1A 2DNNA 5U47A 4O0NA 2A2DA 1T9UA 1FESA 2P2CB 3DOMB 4ANEA 3M9NB 3TAPA 3QZ7A 3UE2A 1JK9B 3WBZA 4J7CA 1SQFA 4B3TF 1JLFB 3CXCR 3OHBA 1LWFB 2M8DB 2DR5A 1S9EB 1RAOA 4NRUA 2DXEA 1WUUA 1UEUA 5KFBA 5KG5A 4ZIWA 4Y2IA 2FZCB 3MTKA 4OFZA 2WVDA 3P96A 2MZSA 1WWHA 5DO2A 4EZ9A 1KR4A 4HACB 3UD4P 2KT2A 4WZMA 2VODA 4LFAJ 4ER8A 4CTAB 2FC8A 3NMAA 4O4RA 5B0FA 2ZC3A 3JTNA 3NGUA 3CIMA 5KFIA 2HWIA 1YIJS 4FF4A 1EIYB 3MEKA 3SQOP 2YKNB 4ZIVA 1RHJB 1HWLA 3PFEA 2HHTA 3MPVA 4IR9A 3BGUA 2JVRA 4AYBD 2PFFB 3PXGa 3RZAA 3DMJB 2BQUA 5T14A 3A12A 1RT2B 4QBUA 2HGNA 3ZZPA 5AE1A 2D69A 1FD2A 3MOZA 2J6UA 3I4PA 2G4BA 2CQGA 1R8AA 3T1HJ 1T05A 3BGOP 1NH7A 2E9TA 3HP6A 4YQWA 2ZVSA 3M4XA 1AZSB 4X4SA 3I0SB 4WFBQ 1KOOA 3GTYX 3AAWB 1WC0A 2AJ2A 3K57A 4ZVRB 1FFGB 4F4YA 1CJVA 4KGKA 2APOA 3FZ2A 1SXLA 3WIUA 4NPOA 3AD9C 5HLFA 2XO6A 5F8MA 3FC9A 5K5MA 3LP2A 4N77A 1BC6A 3M7VA 9RUBA 3PYGA 2K8GA 3GSDA 3EVWA 3QRRA 3R3TA 3PY8A 4RNFA 4YY3J 4A8YA 4ZCMA 2EI5A 2RJZA 2E44A 1CPZA 3IR6B 4UUWA 4P74A 4ECSA 4FF2A 1Q7YT 1YVFA 2AKWB 1IKVA 5CZXA 4NCGB 5F3TA 3ENWA 4R25A 1RT6B 1RAAB 4DX7A 1S1UB 3TWZA 4ZPDA 1RT1B 2EXUA 2ZJPQ 3BM7A 3K5NA 1YZ6A 2POKA 2HWHA 1ACMB 3SXLA 2ZE2A 4DMZA 3ILOA 2P6SA 1VIXA 4NLWA 2NPIA 2V69A 5FD1A 1C0TA 1I94J 4NYOA 5DDPC 1NK6A 1PIEA 3C66A 3KLGA 1SC3B 3HSGA 2DJWA 3LH2S 3UN5A 3HK2A 2L9NA 3TZXA 3MECA 3IG1A 2OFGX 2R9LA 2EKYA 5ETQA 4Y3CA 2DXDA 3UD3P 3KMQA 4WXWA 4I1TA 3ELHA 2VA2A 3GR0A 2KXHA 2EC0A 1S9GB 4L73A 1JNZB 1SJ3P 1RCXB 3R5JB 4HI2A 2XBPA 1XNQJ 3W8PA 2Z2YB 2GVZB 3VAGA 4UZBA 1FFWB 5GAEU 2NR0A 5J1EB 2WVCA 2AMCB 1Z1ZA 3AODA 3CCRS 2AEMA 2W4PA 5KOWA 3OXFA 1KLMB 4OHVA 5KG7A 2VFUA 4JV5J 3UCGA 3C19A 4ANDA 1T03B 3EICA 5GAHU 3M8YA 4AL5A 1S6PA 2H65B 2ZH5A 3MM6A 3TQEA 2QRRA 1N54B 1S4FA 2ALZA 2GAGC 3QMQA 3DRRA 3G96A 2CRLA 3HZEA 3PYFA 2ROPA 3OHAA 5KFFA 3HFVA 3CPWR 4CO4A 1IJFB 2HVIA 3NGKA 4RLEA 4HHHA 4WE1B 2GJIA 3Q8YA 4F4AA 1PYSB 1VQPS 3HDSA 1U1MA 3MMBB 4MYUA 2PEBA 4IQMA 3QAEA 1R8CA 3B6BA 1AUDA 1NDKA 2VQEF 4HTIA 5D4OA 4L6V3 1VBKA 2CG8A 2YKOA 3OUYA 3LANA 5KFGA 1IBMJ 4RJVA 5ITHA 4P75A 1DQ8A 3D5MA 5I42A 1F9HA 2WONA 1ICEB 1LOUA 2GQ2A 4ES3A 5K9FA 1LFPA 4TU9A 3A3PB 3VAJA 4NLYA 1CC7A 3PIPQ 3MPWA 2EBGA 1JLAB 3Q8RB 1KTQA 3ZZYA 1M5KC 4BS2A 1Y5NB 1FDDA 4IG3B 3KLEA 2B7CB 4DV7F 3JB9k 4M1KA 3B4MA 2B7BB 1P27B 3LP0A 3HLUA 3R5AA 3KK3B 5E0OA 2ZHAA 1U47A 3JQMA 1JKHB 2J76E 2DH8A 4CWBA 2RILA 4JV2A 1JMTA 2XMKA 3I96A 4A8QA 1TV6A 3N6MA 3OFEA 1LWXA 1H72C 3PW5A 2DGSA 3H5SA 4B08A 1UZDA 5IT4A 4A8KA 5FJ4A 1S6QA 3AD8C 5IT9U 4TU7A 2X3GA 4QR2A 3GLJA 1IR2A 2HVZA 1N52B 2NYHA 2X1GA 3OTCA 1TL7A 3C6TA 1NSKL 2VU5A 3T19A 5E3CA 1A0OB 1Q7LB 3K89A 2B5JB 2HHPA 1B4SA 3HHLC 5B0CA 1NJZA 2BYCA 1RAIB 1HNXJ 2HGLA 4O3OA 2I38A 3DXBA 4LBHA 2V8GA 2HGMA 5CABA 4NLQA 4OX7A 5LSRA 1FNMA 2DNPA 3ENAA 3NMRA 3NS6A 1JJ2R 3ITHB 2EFNA 3N4WA 3EXCX 4ID5A 5B7WA 2HQDA 3WX4A 1WDTA 1I5OB 4OJ1A 4F4XA 4PQUA 4A8OA 1ZTWA 2LYVA 3IWLA 1O5JA 2EBEA 5F0WA 3AOBA 3CO9A 4LF1A 2R42A 3BN7A 3TP2A 2SXLA 4OHZA 3M8WA 3TX8A 5F3ZA 2L9DA 1PC4A 3BZQA 4ITSA 3UVJB 3R5BA 4F4KA 4PG5A 1SH2A 4NLPA 2M3DA 3MEEA 4KE5A 2VICA 1O8BA 2D1CA 2KTQA 1T9TA 4ED2A 2GHPA 3D54A 2AX0A 4LR7A 2RUSA 2IRYA 1JQGA 5KFXA 5IV3A 2JVOA 2NSBA 1FNOA 1VMBA 3FKBA 2CYYA 2FJWA 4DDFA 4A8FA 1PO6A 1S76D 3V6DA 2XNRA 2XY7A 1RYRA 3QYYA 4M5DA 5ETMA 3S6EA 3BO4A 1Q95G 2PD1A 2ZH9A 2AIRB 4QW9A 2QA2A 1TTHB 2VBXA 4LF8J 1X4FA 2R7VA 1L3KA 2PIIA 4OLOA 3FBFA 2KVIA 2NXCA 3EZOA 3BQ1A 3EZUA 1HBUB 5L8RC 5C2GA 1VQSA 1L3UA 4DFPA 5L9XA 1FHTA 4LF7J 2UVWA 4KHPJ 3NCQA 4DL4A 3MM9A 4OYXA 3Q22A 3IXQA 2WB1D 4FF3A 1RAEB 2GMHA 3W64A 1Q8KA 2LQ8A 1T7PA 4K4VA 4P2SA 2ZBPA 5A6WA 2J7WA 4HVZA 1DLOA 3THVA 3K58A 5C24A 3LQVA 5B08A 1U1QA 4G1QB 2VV5A 4LR8A 1RB0A 4OX6A 1YTYA 3KTQA 1YBUA 4DL2A 1WKJA 4ECRA 1TK8A 1H7XA 3MZIA 1M1HA 5HANA 2XO7A 1RTDB 1D09B 4HHUA 3O3LA 4ES2A 1K1SA 2YNGA 2ZZTA 3I9V9 5CYMA 2ZDPA 4ZHRB 5CD4A 1Y5LB 2BQRA 2BVZA 2CJQA 3RR7A 1HNZF 1N6QB 2QLWA 3DN9A 4ILLA 4EUVA 1TFWA 4OZ0A 3BBCA 1H2UX 3CSKA 2OPPB 3IBFB 3MPYA 2KH9A 2HFZA 1GXLA 3L09A 3HZGA 1F6TA 4USJC 3ZFVA 3SEOA 1FK9A 1REGX 1S4EA 4MMOA 3HHNB 2CFXA 1S9FA 3ZTSA 4TNOA 4YFUA 2AU0A 1RLDA 1SJFA 2OH2A 4X2BA 1FRLA 4M5GA 3R7BB 1QAXA 5A0YB 3WQPA 4CO0A 3BO2A 2AZ3A 4G65A 2XMWA 2VG5A 2VQFJ 4CH7A 5KG4A 1EP4A 2DO0A 2DRBA 3D68A 4DV5J 4KHRA 3LOUA 4J9UE 4CLLA 2H4WB 3UN2A 3D0HE 4DV2F 2E7XA 1S1VB 3DLEA 2J9DA 5KFEA 2O5DA 1S1XB 5LOQA 3OL9A 2V94A 4HI1A 4DWIA 2XWYA 3MAAA 2IFXA 2HURA 2VD3A 3E51A 2QMWA 1PGZA 1FKOB 2ZH3A 2FQQB 5C25A 4O23A 1SL1A 3KJQB 4F0MA 4HTJA 4NLGA 1MMLA 4EEYA 2Y8YA 5EX3A 3MAHA 5BR8J 3K5MA 4WU3A 5BJRA 3FCWA 3X1LB 4Q8FA 5KFOA 2VPWB 2J9DE 1R0AA 1FRIA 4EO8A 3G6VA 2UV8G 1B0VA 2MSSA 3CMQA 2J8SA 1U0HA 3OFFA 5FIIA 2W7AA 4ZA1A 1Q8IA 8ATCB 4QCLA 2W2NP 3C15A 2JSXA 4YS2A 2WOMA 4C11B 3GV8B 3OJUA 4Y0FA 2OMOA 3EGNA 2MLYA 2AYEA 4OV6A 4Q0BA 1N36F 3CJ0A 5KG3A 2ADBA 4Q8EA 1RADB 1L3VA 4R8UA 3MUMP 3HX9A 2KHDA 1WC3A 1FDBA 3W2VA 4UZCA 4P52A 3TUIC 2F63A 4LF6J 3H0PA 3I0RB 3OR2A 4NI2A 2LU1A 3OL7A 4GVBA 4NZ6A 2MZJA 1XEZA 3CJ2A 3NCRA 4ICLA 3TVKA 2HKEA 1BQMB 1RT7B 1FXDA 3GV5B 2K1RB 3BV8A 3KUGA 2QGFB 4XAKA 2FHJA 2HBRB 2ZH7A 2XQCA 3MM7B 1RHKB 3HF5A 4NZ0A 2V34A 1SJ4P 2GS8A 1RT3B 2QSWA 3KFWX 4KSEB 4ZPTR 2BKPA 1D3WA 1S0OA 2GAHC 3FMWA 2Y1IA 2GCFA 2OEJA 1R0BG 4O4GB 4YB5A 3R9LA 3D1OA 1KN6A 1VGYA 4JI6J 4J9RA 1XMQJ 3NG8A 3NNCA 1TKTB 4JV0A 2KN4A 1Y11A 2HG4A 2EW9A 3EVOA 1JLBA 4DL3A 1Q78A 4NEZA 2PI4A 4FYDA 1AFIA 3CJKA 2YWKA 1KVIA 2BXJA 4B9LA 1UETA 1JX4A 1K73T 4Z7YA 3BKTA 3CD5A 3BN4A 5H9EJ 2CPEA 4DCJB 5IWAJ 3D1QA 3M9MB 2BJ7A 3M8RA 2ZOFA 4CT9A 2JLGA 1EJ7L 3BO3A 4CLWA 2B6AA 4UT4A 5A6PA 3HXMA 2R7RA 3IM8A 1RISA 1S79A 1PBAA 4EU0A 3DOLB 2AX1A 3G6YA 2MKSA 1IKWB 2LEAA 3IM9A 2DNZA 3KDNA 1X4EA 4MIAA 2AHOB 3PTWA 4WZQA 3G6XA 1DTQB 2YWFA 5CCMA 2YNIB 5J2MB 1EQMA 2MHEA 1T02A 2CJKA 4GVLA 2MKJA 3E01B 1W7WA 4IOAQ 2R7SA 3PG9A 2BJ9A 1SKWA 2W9AA 3F73A 3GZ7A 2CPIA 1QAJA 1RSCA 3QZ8A 4KFBB 4C8LA 3W5XA 3VR1A 3ZZTA 3GYNA 3KUHA 3I82A 4DEZA 4OZNA 2OP5A 3CVKA 3R6LB 5M2PA 3KK2A 2HK2A 1MN9A 1C0UA 5K14B 2ZOGA 5F8NA 1RI7A 1R6YA 3WHIA 4HLBA 1RQ0A 1NSQA 4LF9F 4Y00A 1X60A 1F1BB 3RU0A 4OJGA 4OI6A 2CDQA 4MIBA 3IS9B 2GVDB 2J0XA 3A4TA 1CULA 2N82B 5A2QU 2UXBF 3SCKE 1N8RT 1ZM9A 1UJ5A 3CULA 1VIOA 2PC6A 4RNNA 2WSCC 3TZWA 1U49A 3D3BJ 2HHSA 3U1NA 2HFVA 2Z56B 3GR1A 4DG1B 1YJ7A 2FHKA 3IR5B 2MQMA 2YWHA 3LP1A 1S6OA 3PYEA 5IXUA 1TUWA 1HQUB 3KLFB 2R7OA 3NCPA 4DR7F 2HZCA 4OI2A 4Q44A 4NA3A 4P6QA 1GQEA 2C28A 2MKCA 5DG8A 1FVSA 1FE0A 4RBTA 2YXLA 4OYWA 4OZJA 3JSRA 4LFBJ 2V2ZA 4I0WA 4DR1J 2VONA 1NHKL 3KUEA 2M5YA 3UDEA 2AEFA 2KHCA 3ISZA 3F44A 2GO8A 2UUBJ 2QJ3A 2KKHA 3PW7A 2H51B 1FKAF 3GIKA 1VRUB 1JLCB 3V6JA 1ZA1B 4DR3J 4XDDA 3H5YA 2XYGB 4PXCA 1PJ7A 2G0CA 4FKYA 4I2QA 4FP9A 2R2RA 3CCTA 2B9EA 3HSJA 4TLQA 1GNKA 5F8LA 1YSJA 4ZVUB 3V5RA 5EWGA 3OFHA 2VJUA 5E5NA 4IDKA 2HBYB 3IRXA 2VHGA 1U1NA 5RUBA 5B0DA 1REVA 5E3QA 1R89A 2EFPA 1T9YA 3PO4A 2E5IA 4NXMF 4EFAC 1T95A 1TMJA 4F3MA 5DGBA 1UZHA 2W7OA 3KLVA 3SV4A 2B4VA 1B0TA 3IMQJ 2CQ4A 4DUTA 4U7CA 3LF0A 2ROEA 3AT1B 1JLEA 5C5JA 4M5NA 2HFSA 5ETPA 4DV1J 2BQ3A 2QG9B 4RU2A 3MOJB 3ZZOA 2L08A 1OMSA 9ATCB 3NS5A 2FGOA 2D7SA 2GMLA 3FSIA 1KQSR 2MDAA 1WF0A 3PHEA 1MNEA 4USMA 1JNRB 4HDHA 2Q6BA 1RTHA 2H54B 1V5VA 3HSDA 3JSYA 3B4DA 3VV2B 2LEBA 3FK4A 5KFZA 1WG5A 5A8WA 2R7TA 2W9BB 1QSSA 4FBUA 4M8LA 2OPSA 2QT7A 1FXRA 1BD6A 2QLXA 4AQYF 1OSDA 2HLTA 3ONQA 5DZ6A 1JLGB 4B17A 2IMWP 2CG4A 1BWEA 4IOCQ 1IKXA 1X5TA 4MJKA 3H4DA 3VALA 4PG7A 1CBKA 1GXTA 1RT5B 4U67Q 2LU2A 2NUUG 3TI0A 4LT6A 3MMCA 1N32J 1NBEB 2OEKA 1RHUB 1URNA 2IM1A 1GX6A 2EWHA 4QYRA 2CJ9A 3HJFA 2CQ3A 4N41A 3KNAA 4AXIA 5EX0A 2Y0BB 1YDLA 4USUA 5DQGA 4JI0F 2YWGA 5HO4A 2G9OA 1VCTA 3MGJA 5L1IA 2FHJD 1IN0A 1AW0A 4C7QA 4KHMA 3SSSA 1H2VZ 4EWTA 1XR6A 3HHDA 1F2GA 2ZBIA 3BR9A 4GO5X 1K9MT 3G82A 3BDPA 4DR4J 3N01A 4UOHA 4GO7X 1VK8A 2BRKA 2LA6A 3D6MB 1CS4A 2WAQD 5KFHA 4K4WA 3R7NB 2V6AA 3SSQA 4OYOA 4CO3A 1RU2A 1HBOA 1DFDA 1U8SA 1N34J 2BMBA 5H1SV 2L48A 3DC2A 2Y8WA 2BJDA 2QL7B 2R7QA 3Q86A 1HARA 1ZA2B 4IG0A 3R7SB 4F3QA 4YR2A 2HS4A 1PYTA 3DM2A 4NYZA 4WFZA 4LF4F 2YNFB 2E1PA 3DU6A 4NLUA 2WZ1A 5DETA 3GG1A 1LEOA 2IHR1 4Q7AA 3FGVA 3U02A 1F3FA 3L7UA 3OTOF 2DNHA 1X4GA 2I8EA 2HVHA 4U95A 2FJDB 2DTJA 2G2YA 1WHXA 3HT0A 3FFIA 2DIUA 3C16B 3DGPA 4K50A 1RAFB 2IJNA 1UWAA 2HPUA 1H2TZ 1VK3A 2KFYA 3S8SA 5AXMA 4NLSA 4ATNA 1CEZA 4QQBA 2HYIB 3N5BA 4XIUA 4FS2A 1K1QA 3NBPA 3TAMA 2AV5A 2V8PA 3W65A 1YJNS 5HROB 4DPWA 4DPXA 1VISA 1RHMB 1WC5A 5T7LA 4RW8B 5HVGA 2H1YA 2QA1A 1CQMA 2ZE2B 3CC2S 4V19J 1NHUA 5KT3A 3QT8A 4DL7A 3P6YC 1SI9A 3D6FB 4YDXA 1U45A 2V5HG 4M5MA 1HQ2A 4Y2AA 3KHHA 4UUXA 4NXNJ 1ZH5A 2AEJA 1T3OA 2CPZA 3DOKB 1X7VA 5KFJA 2HW3A 2IC3A 4NYPA 2F3JA 2A18A 2JZ5A 2EK6A 4NA2A 4DL0C 3D7SB 1UFKA 1Q0NA 4RUCA 2NYIA
chains in the Genus database with same CATH topology
2Y9HA 3QRRA 3QRQA 3QRPA 2Y8YA 5H9FK 4U7UD 5H9EK 1WJ9A 4QYZK 2Y8WA 5CD4A 4DZDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y9H A;  3QRR A;  3QRQ A;  3QRP A;  2Y8Y A;  5H9F K;  4U7U D;  5H9E K;  1WJ9 A;  4QYZ K;  2Y8W A;  5CD4 A;  4DZD A; 
#chains in the Genus database with same CATH topology
 2HQ3 A;  1QD1 A;  1J5E F;  1F5A A;  4DSI A;  2D3Z A;  3CCQ S;  3M8Z A;  2YWW A;  2KM8 B;  2DNM A;  5DRK A;  4C8Z A;  1HQE A;  3T41 A;  4L3K A;  3DRX A;  5J2P A;  4NZ7 A;  2D3O R;  2GIR A;  3IO1 A;  1C4A A;  4J9N A;  4O44 A;  1TAQ A;  4IO1 A;  5DQH A;  2DKO B;  3QIP B;  2JEJ A;  4ZJO A;  4QR1 A;  2B56 A;  2R8K A;  1IBL F;  3M30 B;  3ZTR A;  1VQK S;  1SIW B;  4FBT A;  1UP1 A;  2Z2Z A;  2CUY A;  4RKU C;  3M2U B;  3M2R B;  3CJS A;  3WDO A;  3FZB A;  3MM6 B;  4OI4 A;  3KLH A;  3PJW A;  2CQB A;  1X4A A;  1Z4U A;  5G0R A;  2YPY A;  3SQG B;  1VHI A;  2NXU A;  1RAJ A;  3BGR B;  2BOP A;  2A10 A;  4F8R A;  2HNZ A;  5D0E A;  2Z8Q A;  4JI5 J;  1S1T A;  4PWD B;  4UW2 A;  1S1W A;  4KKO B;  3TA2 A;  3HVT B;  3OW2 R;  2MQP A;  3KG4 A;  1E6Y A;  3VGS A;  1MRO A;  4WIQ A;  2IAJ A;  1CJU A;  1D9F A;  1YWX A;  3CCM S;  4I67 A;  3OUY B;  3DDK A;  2Q66 A;  5I42 B;  3KWM A;  4ENO A;  4YHH F;  2WON B;  2GMJ A;  3RBZ A;  4ES1 A;  4I6A A;  1GX5 A;  4IFY A;  1OY9 A;  1S10 A;  1LW0 B;  1WOR A;  1O6X A;  2QZ8 A;  1UA0 A;  3KXD A;  3FBC A;  4F2S A;  4EBC A;  1QAY A;  2PA8 D;  4EK2 A;  3KLE B;  3CJ4 A;  1N5T A;  4DV4 F;  2DK2 A;  1B3T A;  1KC8 T;  4OZ5 A;  4DR6 F;  5KFQ A;  2ZBC A;  3EDQ B;  2JC1 A;  4KIA A;  3C6U A;  2W4C A;  2PA3 A;  3Q2T C;  3KK1 B;  2V8H A;  3TAR A;  4RPF A;  1Q8B A;  1TV6 B;  3CDU A;  3ZZZ A;  2Z4P A;  4B3T J;  1WTF A;  3PX0 A;  1BY9 A;  5F8H A;  4C8Y A;  1PCA A;  4IRC A;  1M5S A;  2VUG A;  2ZKT A;  1AB8 A;  2FLP A;  1J5O A;  4OIX A;  4GRS A;  5KT2 A;  2FHM A;  3BEG B;  3FMB A;  1UVK A;  3QAT A;  4AE5 A;  3RTV A;  3DKD A;  4ZLP A;  3P5T L;  4LUB A;  1H74 A;  1ZBT A;  2VG6 A;  2VFV A;  2CAD A;  2M4M A;  4KO0 A;  3AD7 C;  2D9P A;  3CWJ A;  4O3Q A;  2ZWP A;  3C6T B;  3MR3 A;  1JJH A;  1ZTT A;  4MK7 A;  4KPY A;  4QIE A;  2K7J A;  4LRD A;  2HHX A;  1KP6 A;  2RVJ A;  1LFW A;  4K7Q A;  3VTI A;  1NUE A;  1UWB B;  5HAT A;  1NKC A;  3TA1 A;  3N5F A;  2RDD A;  1TVR A;  4YUD A;  3H20 A;  1U6Z A;  4ZN3 A;  5KT7 A;  3RYL A;  3SCJ E;  1UPM B;  2QMU B;  3OL8 A;  4U7U K;  2BR0 A;  1TL1 B;  3PIO Q;  5T41 A;  1N0U A;  4DCO B;  3CC7 S;  4PQU B;  3HPO A;  4RUA A;  1LWE A;  4FF1 A;  1HBN A;  2IM3 A;  4AD6 A;  3GFY A;  4K4X A;  4DPT A;  4TKT A;  1U8W A;  1U2R A;  3DXS X;  2W24 A;  3EDR B;  2ASD A;  2ZNY A;  4OZ2 A;  5J1N A;  1YBA A;  2BDP A;  4EZ6 A;  2C2O B;  5DJB A;  2E5G A;  1HW8 A;  3M6W A;  2YH1 A;  5BXI A;  3V81 B;  2QFI A;  2XI3 A;  3D0I E;  5DM7 Q;  5LXY A;  5DLF A;  2R2S A;  1NRK A;  3CJR A;  4DU7 A;  2ZH4 A;  3OSN A;  5HQ8 A;  1MW7 A;  1OO0 B;  3V6D B;  1C1C B;  5D4P A;  1EKR A;  3SDE B;  2XMM A;  4M5D B;  2RHS B;  1HBM A;  2L9W A;  4M63 A;  1RJJ A;  3A8J A;  3D6H B;  1KKH A;  3UCU P;  5DDQ C;  4YN3 B;  1KQF B;  1BWV A;  2KDO A;  3A8K A;  3J81 j;  3OVS A;  4CLZ A;  4C8O A;  1U2F A;  3RR8 A;  2DY1 A;  1FRM A;  4RO0 A;  1CVJ A;  4L76 A;  3VQS A;  3PZP A;  3QO9 B;  4QIW D;  5J2N B;  2XMU A;  3B82 A;  4B02 A;  3R5D A;  2QMX A;  3EE3 A;  4MK8 A;  1ITP A;  1QTM A;  3MM9 B;  2DNQ A;  3B78 A;  1RKJ A;  4P2F A;  4Y34 A;  3TJA A;  2O3D A;  5E7O B;  2UXD F;  4MYT A;  4TY9 A;  1SC1 B;  1JWW A;  1RLC L;  4J5O A;  5C24 B;  1MN7 A;  1NDL A;  3MXH P;  4BCA A;  4LQ9 A;  3RB4 A;  2UUA F;  4I7F B;  2OI2 A;  5LMN F;  1NB7 A;  1YRX A;  3MWB A;  3PM9 A;  2Z58 B;  1YLX A;  3MM5 B;  2UVV A;  1YRT A;  4W92 B;  2DD8 S;  2WCX A;  2YNG B;  3Q8V A;  1SIZ A;  3R5G A;  5CXT A;  4NA1 A;  5B0A A;  3CT9 A;  2NPF A;  1D8Z A;  3AXK A;  4FDF A;  1M5H A;  2NXN A;  3M6V A;  4GKJ F;  4P7T A;  1KEK A;  1B99 A;  1RHQ B;  4K4Z A;  3LTO A;  2RKI B;  3PW4 A;  3A1Y G;  1VI7 A;  1S12 A;  2B9X A;  2MQN A;  4OI3 A;  3I9Z A;  1HMV B;  5G4D A;  1U26 A;  4TY8 A;  3NWR A;  2X1B A;  1RBO B;  3WC0 A;  3L7P A;  5HBM A;  2RML A;  3PRB A;  2UXC F;  4KV8 A;  2AYG A;  1S97 A;  1L3S A;  3Q24 A;  2WBR A;  3H5X A;  2MZR A;  2IBO A;  4ZVS B;  3CD0 A;  2P8I A;  2VQE J;  4GC7 A;  2C3M A;  3DLG B;  2W8L A;  2H5J B;  2RHQ B;  4OQJ A;  1VQO S;  2MY8 A;  3FJ2 A;  2DHX A;  4G3I A;  1HWJ A;  3MI7 X;  2XG8 A;  4Q45 A;  5C42 B;  2DHA A;  4ETX A;  1TMM A;  5ETK A;  5FDL A;  2J6S A;  3RAX A;  3BDE A;  2E5L F;  1KTV A;  3MAA B;  1KON A;  4P71 A;  3NNA A;  1U1R A;  2R8I A;  1WDD A;  4DV7 J;  1P8G A;  3DOM A;  4PAA A;  4KT0 C;  3JTP A;  3O1L A;  4JI4 F;  4WJB A;  3MPD A;  3W1Y C;  5DLG A;  2YBV A;  4NLD A;  1N5Q A;  4H4K A;  2MLZ A;  2CDR B;  4OHY A;  3PYD A;  3ZO7 A;  2MST A;  4ZPW R;  1TEL A;  2AGP A;  1LWF A;  3GYX B;  2DO4 A;  1R0A B;  2NUH A;  1S9E A;  4LSL A;  3QJJ A;  3PNI A;  1IR0 A;  4QWD A;  1HHT P;  1R43 A;  4PPZ A;  2UU9 F;  4ILR A;  3PW2 A;  3KLI A;  4DQQ A;  2WOM B;  3POT B;  1ZPV A;  3QFH A;  4DL6 A;  4KTQ A;  1YBT A;  3MCM A;  3LW5 C;  2C3Y A;  2E7W A;  4QWE A;  2RU3 A;  4ZVO B;  2MXY A;  2MY7 A;  2WBM A;  2GV1 A;  3HKZ D;  4I64 A;  1X9W A;  4MT1 A;  4PUO B;  1YJR A;  3D3C J;  2VOO A;  4DZD A;  3VAF A;  3W61 A;  2IRU A;  4B3R F;  1FX2 A;  2Z57 B;  4P2M A;  3M32 A;  4ICL B;  2YKN A;  2XYP B;  3BH7 B;  2ZM6 F;  1Y4Z B;  2RQC A;  3VAI A;  4AFF A;  2ILY A;  3M1V B;  4J9L A;  2OEL A;  1PIL A;  1BGX T;  3DMJ A;  5LXR A;  4WP9 A;  1F2H A;  5HJX A;  2LMI A;  2YY3 A;  1RT2 A;  4IH6 A;  2DCU B;  4ANC A;  4P2X A;  2WVF A;  2D9O A;  3K8W A;  2XS5 A;  3I5B A;  4MKV A;  4OI1 A;  4DQP A;  1GMW A;  3ETO A;  4ECX A;  2RSQ A;  4DFJ A;  2R7W A;  3W8G A;  1AZS A;  3I0S A;  2AF6 A;  3CJT A;  3GYG A;  4DX8 H;  2ZIT A;  1EZZ B;  5HJY A;  4RNM A;  2UVR A;  4D3G A;  4MKB A;  3CJK B;  4IH7 A;  1Q79 A;  4X4N A;  4KB7 A;  1M1G A;  3SCI E;  2AQ4 A;  4A8S A;  4DU8 A;  4S0M A;  3HT3 A;  4USW A;  2VC1 A;  3D1H A;  3DI6 B;  2X51 A;  4QU6 A;  2LQ9 A;  3RB3 A;  1PYO B;  4ALZ A;  3CD6 S;  3DRS B;  3C3L A;  5KG0 A;  3OTD A;  3C8Y A;  2E9Z A;  1J2V A;  2JNJ A;  2BM0 A;  3MCN A;  4I68 A;  1K44 A;  4LIW A;  2CQ1 A;  2BW7 A;  4MTP A;  4DBQ A;  2H5E A;  4NCG A;  1N5Y B;  3QWP A;  3RBE A;  1S1U A;  1WHY A;  3AOA A;  2LEC A;  1UKU A;  3CCW A;  3CMA S;  1RT1 A;  3DFE A;  3P49 B;  4JI2 F;  5H9F J;  1VBZ A;  2F65 A;  2ZHB A;  1R8H A;  4FXW A;  3VGV A;  4P72 A;  3EGV A;  1MWZ A;  3CW2 C;  4K59 A;  1QE1 A;  1VQM S;  3OR1 A;  3JXO A;  4CH1 A;  3KHR A;  4K0K F;  2HVE A;  1IM6 A;  2F8H A;  1NJW A;  1XER A;  3K17 A;  2VOP A;  1DAR A;  2W2M P;  1WJ9 A;  1FTC A;  2J6T A;  2RDJ A;  2V0N A;  2QX0 A;  3KK2 B;  2OD6 A;  4HEA 9;  2BAN B;  1SJ1 A;  1S9G A;  1T3N A;  1U1P A;  2Y0S D;  4PG8 A;  2IM0 A;  4LF5 F;  1F3V A;  4ZVE A;  3FBB A;  3I87 A;  2HBZ B;  2V4J B;  3RRG A;  2MKY A;  2ZVI A;  1W2B R;  3ETM A;  5J1E A;  4HHJ A;  5AXN A;  1FTR A;  4DS4 A;  3MDF A;  2K2P A;  2CPF A;  1RP5 A;  4OYA A;  2WVB A;  1FRJ A;  3GWC A;  3M8P B;  4XTT A;  4X64 F;  4AL6 A;  4JB8 B;  1S7I A;  2EFG A;  3LP1 B;  4TN2 A;  3EUN A;  1HNZ J;  3G8Q A;  4QW8 A;  1S48 A;  3AJ2 A;  4LVO P;  5HVF A;  2NZ4 A;  1SJQ A;  3DCA A;  4YP3 A;  2P6T A;  1RBA A;  2YPZ A;  2K3I A;  1JXV A;  1UEK A;  3ZTQ A;  1UAW A;  2C3P A;  1NDP A;  1IKY A;  2MEW A;  1LWC A;  5DM6 Q;  2MZQ A;  1SUQ B;  1CJT A;  1VLY A;  1FVQ A;  1KHV A;  1N4L A;  3HD1 A;  3PR4 A;  1QLN A;  1OYD A;  4WF9 Q;  1X5O A;  3UPF A;  2YX1 A;  5KFC A;  2EFQ A;  3MFH A;  1FWK A;  1U48 A;  3VGT A;  2W01 A;  2XC9 A;  3J7Y I;  4HH0 A;  2VG7 A;  1HHS A;  4MIW A;  4CRJ A;  2CXE A;  1JLA A;  1CJK B;  4DV2 J;  3K5P A;  4IG3 A;  2MYF A;  4DOZ A;  2PI5 A;  1V3R A;  2DHH A;  3KK3 A;  4IRD A;  4IDK B;  1N88 A;  3IRX B;  1NXI A;  4RBV A;  1HNW F;  4LSZ B;  2J8A A;  1REV B;  3QLH B;  4C4W A;  1R3N A;  2KL8 A;  4NE9 C;  1HR0 F;  4OX9 F;  1Z2Z A;  4LRF A;  4N7T A;  1F5C A;  3DLB A;  5KFS A;  4M5I A;  3FEY B;  1SC4 B;  4QIG A;  1TL3 B;  1DJ0 A;  1EQ0 A;  3W9J A;  1X8D A;  1UW4 A;  1G6B A;  4R5P A;  4WKY A;  5D3G B;  4I4B A;  1N36 J;  2GX8 A;  3G87 A;  1OS5 A;  1W2I A;  1FO1 A;  1VQ8 S;  2XWX A;  1ZAX A;  2DNY A;  4F04 B;  5L46 A;  2QYC A;  2W4D A;  4C8K A;  3PJ9 A;  4KH0 B;  3TZY A;  1RTH B;  3HHL B;  2M88 A;  5F9L A;  2RT3 A;  3R1L A;  3US5 A;  4CP5 A;  3S01 A;  1N48 A;  5KAK A;  4R0E A;  1X9S A;  1T9V A;  1B64 A;  4QZV B;  1ZET A;  4DFM A;  2GC8 A;  1M5V C;  5A8W B;  4FKX A;  2HHU A;  2AGQ A;  4ILM A;  1DHM A;  4TQR A;  4G1P A;  2NZC A;  3H59 A;  4J37 A;  2UP1 A;  2UVU A;  3OBI A;  1KWM A;  1HYS B;  4NML A;  3ITH A;  1BLU A;  3F41 A;  2IA6 A;  2Z2L A;  3QRP A;  3ZXW A;  3T6B A;  3O5T B;  2KXF A;  3QJL A;  1FRX A;  4LIR A;  4YR3 A;  4J9K A;  2LCW A;  5KFW A;  1IKX B;  3JQJ A;  4U6P A;  5HP1 B;  1W26 A;  1NO8 A;  4E0D A;  1MG7 A;  4O3S A;  1HPZ A;  1S57 A;  3T5K A;  4RW7 B;  4K8R A;  1Y00 A;  1KQK A;  4USH A;  4N56 A;  1VQ7 S;  1M0S A;  4CM0 A;  1F0X A;  2FGC A;  3D9B A;  4YB7 A;  3WIV A;  1OY6 A;  3QT5 A;  2V2V A;  4B9M A;  1QVG R;  4B3M F;  1EAR A;  1P6T A;  2WB4 A;  3OLB A;  5KTQ A;  2W7P A;  4WP3 A;  3GFZ A;  1JJ4 A;  4DUY J;  1NM2 A;  1FRH A;  3QWU A;  2MGZ A;  1KFS A;  2JWN A;  4C2M A;  4OZ1 A;  5CQG A;  3OLA A;  4RX6 A;  5E41 A;  2GJF A;  4X66 F;  5CD4 H;  2HNY A;  4MFB A;  3JS9 A;  1QUV A;  2RNE A;  1GMW D;  2COL A;  4CH0 S;  5EUH A;  4HH1 A;  4PCQ A;  4NLO A;  4C6A A;  1RA6 A;  4URG A;  5B0E A;  4PWU A;  4ED4 A;  2M52 A;  1NEE A;  1EB0 A;  1XMO F;  1FKP B;  1VBX A;  4FS1 A;  3UNG C;  1S59 A;  3D4J A;  3QGH A;  1T11 A;  1HBU A;  5CZV A;  3DM2 B;  4DPY A;  2IJR A;  3AB2 B;  3KJF B;  5DDR C;  5KFN A;  2EKN A;  3CJ8 A;  5GMD A;  3MD1 A;  3P8B B;  2HRT A;  2JFK A;  4RW9 B;  1UCN A;  2QO3 A;  1R6V A;  2VFS A;  2VAS A;  3U27 A;  3GIM A;  3OXG A;  4CT8 A;  4Q5V A;  4WYL A;  3DGP B;  3I4H X;  3CIZ A;  5D8H B;  3MTJ A;  7FD1 A;  4G1Q A;  2MB0 B;  2Z0G A;  4OYI A;  2KVQ E;  1PKU A;  3H7H B;  2C22 A;  4F26 A;  1Q8L A;  4BDP A;  4LF9 J;  2ASL A;  3NBP B;  1RTD A;  1FRK A;  3MFI A;  2XY5 A;  5T7L B;  3QID A;  1MU2 B;  2C2N A;  2UXB J;  1KDN A;  2V2Q A;  1Z2L A;  2DIV A;  4ZLJ A;  5IM0 B;  2ZHO A;  3K8V A;  4ZHR A;  4QOT A;  2WTF A;  1CC8 A;  3R6G B;  1N6Q A;  4C97 A;  2ZUG A;  2QIF A;  2R8J A;  4IKA A;  4PQA A;  2Q3P A;  2AJF E;  2M9K A;  2J0Q D;  2G13 A;  1U0S A;  1F9E B;  2R2T A;  1VC0 A;  1NZA A;  5L1K A;  5IV4 A;  3M8Q B;  2XS2 A;  4DR7 J;  1AUS L;  2A3J A;  2PMH A;  3UR3 C;  3UI3 A;  2XGP A;  1HNV A;  2RRB A;  2EPI A;  1GH8 A;  4F4W A;  3WC2 A;  2YX4 A;  3L7O A;  1P1L A;  3FVY A;  4GMK A;  3CCJ S;  1I3O B;  3G2X A;  2DBB A;  2FPH X;  4J91 A;  1WAC A;  5A0Y A;  2N4C A;  1NB2 A;  4C3M A;  1KRP A;  3J7Y U;  3CME S;  1SB6 A;  3U1L A;  1WF2 A;  3LPY A;  2V2K A;  3MUT P;  3NP5 A;  3FNN A;  2G0J A;  2JEG A;  2CNO B;  2HQC A;  5ETO A;  5A8R A;  1MMD A;  4C98 A;  3SI8 A;  1VRQ C;  1JLQ A;  1S1X A;  5CYJ A;  3KLH B;  4DXL A;  1BXN A;  3A3O B;  5LT5 A;  4KPC A;  2XSJ A;  2AD9 A;  2BKN A;  2PSZ A;  2HND A;  2LDI A;  2CVE A;  3RW6 A;  1VQ9 S;  1GT8 A;  1VS3 A;  2CQC A;  3QPI A;  2HIQ A;  1V6H A;  4U8Y A;  3NLC A;  1VBY A;  4OJ3 A;  4A8M P;  2DT9 A;  1MRO B;  1WC1 A;  1YX2 A;  1K47 A;  4NXM J;  2EFO A;  1PG5 B;  1S49 A;  1DQA A;  1LKZ A;  3OL6 A;  1VQ6 S;  4ECQ A;  4CLT A;  4BLG A;  1UW9 A;  4NX9 A;  3BRE A;  3DLK B;  3NAI A;  4Q2L A;  1C1B B;  1IQZ A;  4IFY B;  3PX6 A;  2CPY A;  4DF4 A;  3BF4 A;  4WII A;  5ETN A;  3HUL A;  3GIL A;  4Z37 A;  4X62 F;  4M5L A;  3P3D A;  2VFR A;  1JXL A;  4KGZ B;  2JFD A;  2OPQ B;  1BQM A;  3MMA A;  4C8M A;  4KJI A;  2NSC A;  2CJB A;  3DHX A;  3LAL A;  2K1R A;  1DTT A;  3OV7 A;  5GMK a;  3C6U B;  5DGA A;  5HAO A;  3IGN A;  1XR5 A;  3OXL A;  2O1P A;  4QJV A;  5IC6 B;  4DLG A;  2VDH A;  4FYV B;  4X4V A;  2ZDO A;  5IFM A;  1RT3 A;  2LLZ A;  4I6W A;  4J9M A;  4DR2 F;  4B3O B;  2W8K A;  2BM1 A;  3G8T A;  4CO2 A;  5IS2 A;  2E5J A;  2QE5 A;  4O4G A;  5K8O A;  5MLC V;  2ZNZ A;  4AQY J;  5AJ3 J;  5L39 A;  4ED0 A;  2VPX B;  4RBU A;  4B3S F;  4K4U A;  2DHS A;  3FCV A;  2XTJ P;  2IVM A;  1LW2 B;  2B8Q A;  4U7U D;  1KSP A;  2ZH2 A;  3S7R A;  2OPR A;  1GEH A;  3ET6 A;  4OLP A;  4L75 A;  3N6L A;  3BPD A;  2V9K A;  3GP9 A;  1RXO B;  2CPD A;  3EYZ A;  2IY5 B;  2YQ0 A;  3NNH A;  2KXN B;  4KAI A;  2C3U A;  2BE9 B;  3W63 A;  1I51 B;  2HHV A;  2ZKU A;  2KG1 A;  4JI0 J;  1BUX A;  3CC4 S;  2HZV A;  3P4U B;  4JV1 A;  3Q2S C;  3ENQ A;  3Q0A A;  1Q1K A;  4LRB A;  3FDS A;  3G4S S;  5EHH A;  2GGP A;  2HQI A;  2V4R A;  3DOL A;  5KFV A;  2WSF C;  5L9N A;  1DUR A;  2UUT A;  2CNL B;  1IKW A;  3THP A;  3FEX B;  4WTY A;  1UL3 A;  3I55 S;  4K4Y A;  4DSF A;  5A8K B;  2LKZ A;  2HMI B;  3MD3 A;  1XN9 A;  1FF2 A;  2DPI A;  2YNI A;  3DRP B;  4PYD A;  5EWF A;  5AT1 B;  4Z7C A;  3D28 A;  5JUM A;  2W2O P;  4CO5 A;  4FVM A;  5CYQ A;  3BJY A;  1G7C B;  3UDV A;  1EKS A;  1U2C A;  4N76 A;  2J0S D;  2DGV A;  4F0H A;  2ZH6 A;  1UJ4 A;  4KFB A;  4LVN P;  2DIT A;  1D9D A;  2E1R A;  2RU9 A;  4ELV A;  3LAK A;  3TUZ C;  4LF4 J;  1PAE X;  4U9R A;  1ULR A;  3QT7 A;  1HA1 A;  3BSA A;  2PMW A;  4XO0 A;  4DV6 F;  1Q53 A;  3OTO J;  4RL1 A;  2QL9 B;  4HYK A;  4WFY A;  2D3O 1;  2XZW A;  5AXL A;  1BQN B;  3R8Y A;  2WRM A;  3MPU B;  2RF2 A;  5EDW A;  1HBM B;  1H73 A;  1EET B;  2DGU A;  1SKU B;  3LA0 A;  1QSL A;  2Y9H A;  1M5O C;  2BW2 A;  1RU1 A;  2K7K A;  4DG1 A;  4WBF A;  3NAH A;  4C3K A;  2IDL A;  3D0G E;  1QTN B;  3CJ5 A;  1X0F A;  1HQU A;  3LAM A;  2GNK A;  4NLR A;  3RUB L;  4ECT A;  4IR1 A;  3PKY A;  2DRA A;  1E6V B;  4TU8 A;  1S99 A;  3HVR A;  2BJ3 A;  4PPD A;  4BC7 A;  4A4J A;  3IAM 9;  3P5B P;  2FJV A;  4ZOS A;  2K06 A;  1J5E J;  1U6F A;  4FYW B;  2FVP A;  3ISN C;  2HHH F;  3CGI A;  3FSX A;  2NXJ A;  4V19 X;  3T1Y F;  1FE4 A;  3FCH A;  4CYU B;  3CCU S;  3AH6 A;  1QM9 A;  4C0B A;  5KFL A;  1DRZ A;  3PJX A;  3C2P A;  1RT4 A;  1IBL J;  2ZZN A;  4G1I A;  1VRU A;  1JLC A;  2V68 A;  2AJQ A;  2XB2 D;  2ZEJ A;  1XNR F;  3HVA A;  3UWT A;  2I0X A;  1HNI B;  2A2C A;  4DCP B;  2CPX A;  2UZA A;  3AA8 A;  1SVD A;  2HHW A;  1WOO A;  1L5U A;  1VQ4 S;  4M95 A;  1WEZ A;  1R31 A;  3A3N B;  2E7V A;  2YH0 A;  3PRD A;  5HBM B;  2Z30 B;  1QSY A;  2VBZ A;  4QIF A;  5I3U B;  4DS5 A;  4UQT A;  1RTI A;  3HI9 A;  2DGO A;  2IM2 A;  4QWB A;  3BGL A;  3H40 A;  3HSZ A;  2BE2 A;  1TK5 A;  4O3R A;  3HCX A;  4ED5 A;  1F5B A;  4FXV A;  1Y10 A;  4YHH J;  3T1A A;  4X4P A;  5B0G A;  4CLU A;  1MWY A;  4ZJQ A;  2RAQ A;  1V3Z A;  4R0J A;  5JVH Q;  4FYY B;  4D3H A;  2QN6 B;  4PR6 A;  2OUG A;  1NSP A;  3VVT A;  1U1L A;  4DV4 J;  2JEI A;  2DEJ A;  4JI7 F;  4ZS6 A;  2C42 A;  3O44 A;  1ZM2 A;  3QQC D;  4ZPB A;  3GJR B;  3OVA A;  5LMU F;  3BQ2 A;  4DR6 J;  3KYL A;  2QYG A;  3BBB A;  3W2W B;  3DGV A;  2W9B A;  4DUY F;  3JYT B;  2DNL A;  4LSL B;  1IXK A;  4HR2 A;  4K5R A;  4L72 B;  2W9C B;  5KFY A;  3PAC A;  2VA3 A;  4ZVQ B;  3KLI B;  5F8G A;  1KVK A;  3DYA A;  4KH1 B;  4JI3 J;  1X9M A;  1C4C A;  1NK8 A;  4CCH A;  4WFX A;  1P9Q C;  1JLG A;  4ED7 A;  4ZDN A;  1YI2 S;  1CSJ A;  3Q8S B;  1VQ5 S;  2BBE A;  4IQX A;  4CIO A;  2ALY B;  2D3U A;  4ERD A;  3MED A;  3J7Z T;  1RT5 A;  1U1K A;  4RW6 B;  2VBW A;  2YKM B;  1MWQ A;  4W98 A;  2CJY B;  1HKA A;  3H98 A;  3W9I A;  2MQ8 A;  4G6V B;  3M32 B;  4N5S A;  4OYZ A;  3NXZ A;  2G2O A;  2IVY A;  1KD1 T;  2E1A A;  1RAC B;  1G4C A;  5KFR A;  2YNH A;  4WFN Q;  3C14 B;  5BYQ A;  4AXJ A;  2YQ1 A;  1V9O A;  5JXS A;  2HRY A;  1LQ9 A;  2AT1 B;  3VF0 B;  2ZUA A;  1RUS A;  4FNI A;  2EK1 A;  4M5J A;  1TKX B;  3QBC A;  3UQS A;  4KGX B;  3KJV B;  4DR5 F;  1SQE A;  1S0N A;  2PN6 A;  3VZI A;  4A46 A;  1RWN B;  3EWG A;  4M5H A;  5E2Q A;  1NCL A;  3J7A 1;  3H8Y A;  2XY6 A;  4NRT A;  1JXE A;  2C2M B;  2F40 A;  4OV1 A;  2OAU A;  4OZL A;  2IBK A;  2V4Q A;  2VPY B;  3FRZ A;  4H4O A;  3CF5 Q;  2YKQ A;  3GIR A;  1VRT B;  1XWL A;  4EGL A;  1RAH B;  3NS7 B;  3O6Q A;  2Q6C A;  2YNF A;  4BBY A;  4KR0 B;  2NS1 B;  1N33 F;  3KG0 A;  2C2E A;  1OSC A;  4I2P B;  2H9Z A;  1S0M A;  1FFS B;  2UUC F;  4NLV A;  5EGY A;  1B7F A;  3C16 A;  4EBE A;  1SV5 A;  2ZBR A;  2VPZ B;  3VGU A;  4B9V A;  3CDA A;  2CZ9 A;  4TYB A;  2XZD B;  1X4H A;  3L95 X;  5D78 A;  2WHO A;  3MEG B;  1S5Z A;  4H4M A;  4KYZ A;  4PZV A;  2HAF A;  6FDR A;  5HRO A;  4DPO A;  4J90 A;  4ZPC A;  3AY0 A;  3GU0 A;  4HT5 A;  4RW8 A;  1PJ5 A;  4C48 A;  2F9D A;  1URR A;  2I6W A;  1X31 C;  2J9C A;  2ZD1 A;  1Q86 T;  1QE1 B;  2RRN A;  3SFU A;  3GII A;  3GG0 A;  2I1R A;  2RH3 A;  3OR1 B;  2EVZ A;  5KFD A;  2G0I A;  4YOE A;  2PT0 A;  2E1M C;  3DOK A;  5J2Q A;  1H3D A;  3BYP A;  3AOC A;  1H0H B;  3PDN A;  1X5S A;  3KOA A;  4ZJL A;  2N7Y A;  2UXD J;  1WG4 A;  2XHC A;  3ZTO A;  3KKF A;  4ECY A;  3W5Z A;  4CLK A;  2LXF A;  3HVW A;  2UUA J;  3SZ2 A;  3BKU A;  5LMN J;  3V6K A;  2B43 A;  1UFL A;  3QIP A;  1ZYQ A;  1NSA A;  4UQG A;  4HDG A;  3UDL A;  5K8P A;  4QU7 A;  1U7L A;  3M30 A;  1YZ7 A;  3V4I B;  3MR2 A;  3EPI A;  4ED3 A;  2B8P A;  4LFC F;  2OO4 A;  3M2U A;  4UTG A;  3M2R A;  3CJ3 A;  5LJ3 Y;  1TKZ A;  4ECW A;  4DSK A;  1WG1 A;  3IA0 A;  1LK5 A;  3H90 A;  3I5C A;  4GKJ J;  1RAB B;  4ZVP B;  2CQ0 A;  2R8G A;  2YWE A;  3SQG A;  3AXM A;  1RTJ B;  4Y65 A;  3BGR A;  2FYX A;  4A8X A;  2WSE C;  1KHW A;  2ZOM A;  4NMX A;  2XI2 A;  2J7U A;  2HRU A;  1KNZ A;  4X4O A;  1BQX A;  1RZM A;  2QC3 A;  1IKY B;  2R2U A;  1LWC B;  4PWD A;  1CLF A;  2RDI A;  1CJT B;  1FJ7 A;  4KKO A;  1T8E A;  1NPP A;  1TU0 B;  3H2L A;  3HVT A;  3IWX A;  2UXC J;  4AT1 B;  4CLF A;  1QDU B;  4PWW A;  3W5Y A;  2AWZ A;  4H4K C;  2DGQ A;  3ENV A;  2XZT B;  3VAK A;  1RHR B;  3W66 A;  3QJP A;  1R0C B;  5AJ3 F;  1U02 A;  3K2Y A;  2KFZ A;  2VG7 B;  2XLK A;  1WKK A;  1A7G E;  3GON A;  4DQR A;  4AUK A;  4ECZ A;  4URS A;  5KT4 A;  2GHV C;  4RNO A;  2HVD A;  2FC9 A;  3H2U B;  1LW0 A;  1K0T A;  2W2P P;  3W9H A;  5D0H A;  3RRH A;  1K0V A;  3M05 A;  3O2I A;  1SL0 A;  2FY1 A;  4YEA A;  1YQH A;  2V63 A;  3OFG A;  2E5L J;  1GAO A;  2MZ1 A;  5H9E K;  1GXU A;  1RWU A;  4LSN A;  4L3N A;  2BX6 A;  1N0V C;  3T5J A;  4JI4 J;  3PV8 A;  3KK1 A;  2NQP A;  3VAM A;  1VQY A;  3FBE A;  2YQ3 A;  1PAU B;  4JYA F;  1AA1 B;  1IBK F;  3HM9 A;  3P45 B;  1FWL A;  1X0P A;  2CVI A;  2AYM A;  1WF1 A;  1BE4 A;  2UU9 J;  2RIJ A;  1YIT S;  2DNR A;  4P9S A;  1YJ9 S;  3H5U A;  3DLH A;  3DU5 A;  3IGV A;  4R5P B;  4RW4 A;  2FJA B;  1T05 B;  2G2Z A;  3NOC A;  2BEF A;  1FJG F;  3IP0 A;  4CI0 B;  3D66 A;  3T5L A;  2W25 A;  1VR6 A;  2M8H A;  2WW8 A;  4DUZ F;  4X65 F;  1SBR A;  1WD6 A;  2OTJ S;  3MR5 A;  1CJV B;  4JI1 J;  1ZS6 A;  2EG2 A;  1UEV A;  4B3R J;  5HLF B;  1V5I B;  4ZVH A;  1NK5 A;  2ZM6 J;  3PW0 A;  3CB4 A;  2LVW A;  3LP2 B;  4OZ3 A;  2BA9 A;  3JSM A;  5E33 A;  2YX7 A;  4J9P A;  3OT9 A;  3BKF A;  1UWB A;  8RUC A;  3TZZ A;  5LM7 E;  1YK9 A;  1F9F A;  2OKQ A;  4N8N A;  3T9Z A;  1TL1 A;  1U25 A;  1H38 A;  2GIQ A;  5K20 B;  4ED6 A;  3KHL A;  1EAY C;  4UOC A;  5I3P A;  4LQ3 A;  3QGP A;  1IKV B;  4B9S A;  1HPZ B;  1RWK B;  5JJB A;  2GQC A;  2HIY A;  5DZ7 A;  1GK8 A;  1R8P A;  1NKE A;  3ZNU A;  1VC5 A;  3QGI A;  1X4B A;  2F4V F;  5ETS A;  1IUJ A;  5FLX U;  2DGW A;  1KQG B;  1C0T B;  3JTO A;  4FNH A;  2I5J A;  2HSE B;  1UFW A;  3FEZ A;  3KLG B;  3V81 A;  2FLO A;  2CQH A;  1DQ9 A;  2BV3 A;  3EZ5 A;  2LQ5 A;  4UST A;  1WTB A;  3MEC B;  5IQQ A;  3IG1 B;  3G6E S;  2BJ1 A;  2MLX A;  2J0W A;  2D41 A;  4A48 A;  2MKH A;  3IR7 B;  2MGZ B;  2BKO A;  1C1C A;  3SDE A;  2MKK A;  1SKS A;  2HNY B;  4MFB B;  4RWX A;  2XM3 A;  4DV0 F;  3L3C A;  3JQK A;  4XK8 C;  4PEO A;  3AFG A;  4ZVT B;  1VC6 A;  3Q23 A;  2GJ2 A;  2BOA A;  5IT9 Y;  2CA9 A;  3L4B C;  1B70 B;  2F1F A;  3AJD A;  4JI8 F;  1X4D A;  4JI2 J;  3CO0 P;  4DF8 A;  4GKK F;  2KU7 A;  4CNZ A;  3FQL A;  3QO9 A;  2CQI A;  2HBQ B;  5J2N A;  1TKD A;  3IWN C;  5ETR A;  2VH7 A;  1S6P B;  4K0K J;  2W1B A;  2FLN A;  1VOM A;  1AXQ A;  3DRR B;  3LUY A;  3V6H A;  1NZ8 A;  4ZP7 A;  2FD2 A;  3F0N A;  4ZCK A;  1M5P C;  2EFV A;  4P10 A;  3RB0 A;  2KZZ A;  3KNG A;  5HMZ A;  1UTA A;  3GJS B;  2GIF A;  3MHY A;  3G8S A;  5B09 A;  5K8M A;  4I7F A;  1XK8 A;  2X3D A;  3A13 A;  4UY8 5;  1RDR A;  2A6O A;  2XEX A;  3NGT A;  3EM1 A;  2JL9 A;  4OHX A;  2GHW A;  1YG0 A;  4LF5 J;  4FPI A;  1S6U A;  1F60 B;  2CQP A;  2Y1J A;  3MM5 A;  1UVL A;  1D8Y A;  2ZJR Q;  1VYA A;  5ADZ A;  2FVR A;  3IAS 9;  1QY7 A;  1TQL A;  1N5S A;  1HI1 A;  3CCZ A;  4WTO B;  4BWJ A;  1HWU A;  5FLX Y;  2LEP A;  1TUV A;  4X64 J;  2RKI A;  3W60 A;  3O8W A;  4UOG A;  1ZPW X;  5K8N A;  2C2R A;  2EG1 A;  2WVE A;  3M8S A;  3GPA A;  4MAK A;  1RWX B;  1ZAV A;  2ERR A;  3LP0 B;  1LV5 A;  4NL5 A;  4KGV B;  3SIP B;  1HMV A;  1HNV B;  4JUZ A;  2IPO B;  4RUH A;  4ECU A;  2R4F A;  3TUP A;  1FNX H;  4BC9 A;  2Y1L B;  1XTZ A;  3U1M A;  3ZZ0 A;  3M6X A;  2FJB B;  4JI3 F;  4TLR A;  3HJV A;  3DLG A;  1BHN A;  4K4S A;  2MZT A;  3NGR A;  5D4N A;  4LFA F;  4DX6 A;  2XCA A;  3E8O A;  5C42 A;  2DH9 A;  2B4P A;  1S6Q B;  4JBC A;  5A8R B;  2DR6 A;  1JLQ B;  1D1U A;  3HHK A;  4DN9 A;  3OSP A;  2HZA A;  7FDR A;  2VZ9 A;  5HL7 Q;  1TL7 B;  2O66 A;  2XSJ B;  1D9A A;  4MK9 A;  2DR8 A;  2HND B;  1VHF A;  2ZZM A;  3QNW B;  1QJH A;  4A8W A;  1HNW J;  3U7J A;  3CUN A;  1IM4 A;  1SC6 A;  1SPB P;  4ZP9 A;  1WKL A;  2PDA A;  4KQZ A;  1HR0 J;  4OX9 J;  4DV3 J;  1K8A T;  3POT A;  2FUG 9;  3T1H F;  4ID5 B;  3MM8 A;  3VWS A;  3KMS A;  2DXF A;  1FX4 A;  2NRE A;  4ID8 A;  3QSY B;  1RWV B;  2RQM A;  2XMJ A;  3ICL A;  4PUO A;  3MUV P;  5ETL A;  4USK A;  2FJE B;  2PE8 A;  1X5P A;  3ADA C;  3R2D J;  3JAM U;  2J7K A;  3F56 A;  2OD4 A;  5HQM A;  2KYX A;  3BYR A;  2MHN A;  3DNC A;  3MMA B;  1KLN A;  1GMU A;  3M1V A;  1DTT B;  3MEE B;  3G9C A;  3BQ0 A;  3DDI A;  5E3P A;  2HFN A;  5GME A;  1M90 T;  2C3O A;  2A6M A;  4YY3 F;  1DAX A;  4B9T A;  3EVM A;  5D4L A;  1HIY A;  4OYB A;  5MAO A;  4EMD A;  1FWP A;  1TR0 A;  2OTL S;  2VC0 A;  5F0U A;  5HVH A;  2B3T B;  4PXB A;  1NH8 A;  4J9S A;  2CZ4 A;  2VIH A;  3HHE A;  2F8M A;  1HFE L;  2R8H A;  4OJH A;  5DS7 A;  3Q8Q B;  5KFU A;  4CLS A;  2OPR B;  3ET6 B;  2QL5 B;  2DHG A;  1N5V A;  2J9E A;  4IYQ A;  5L38 A;  4M5K A;  1BMQ B;  4YB6 A;  4ZCI A;  1I94 F;  2XYH B;  4K2J A;  3TA0 A;  2IVF B;  3DI6 A;  2LDY A;  3R27 A;  4QWA A;  5JMN A;  3HD2 A;  5CH7 B;  4B3M J;  4RZR A;  2H4Y B;  2JC0 A;  2B9Y A;  2YVS A;  4IFV A;  5M2R A;  5KFM A;  3DRS A;  2IYI A;  2VF3 A;  3Q8U A;  4FVC A;  4Y6I A;  1HLW A;  4CLP A;  2GGP B;  1MMN A;  2IJF A;  1DLO B;  4DI6 A;  1P9Y A;  3UNY A;  3ZZU A;  4F50 A;  1S0V A;  2KRR A;  3WZ0 A;  1XNQ F;  4E2F B;  2KG0 A;  2KO1 A;  2XNQ A;  1N5Y A;  1R8B A;  1UVI A;  4F67 A;  5GAD I;  4X66 J;  2QLB B;  3UW1 A;  4C0H A;  1TUG B;  1G3O A;  3DDN A;  5CYQ B;  4ZKA A;  2ZFH A;  2NLW A;  2Y3Y A;  4JV5 F;  2HHQ A;  3BB5 A;  1XMO J;  1T9W A;  2L3M A;  4TXS A;  4O3N A;  5CYM B;  2VB6 A;  3JAM Y;  2B4O A;  3VHQ A;  3MMJ A;  4PRF A;  3HFZ B;  3LGM A;  2U1A A;  1TP7 A;  4CM2 A;  2CPH A;  4O3P A;  1YJT A;  3RAM A;  4F3O A;  5THW A;  4WP8 A;  1XJW B;  2AJ1 A;  4WWS A;  4FYX B;  1YJU A;  1FK9 B;  2FY8 A;  2BAN A;  2B0G A;  2XCP A;  4ZPV R;  4ZK7 M;  3NL0 A;  2JRS A;  2RF2 B;  3M2V A;  2YKA A;  2ACY A;  2E66 A;  4Q2M A;  1IR1 A;  2C1E B;  1JJC B;  5D0R A;  4NOH A;  3PCO B;  1WC6 A;  3IBW A;  5KFP A;  4EO6 A;  4DN0 A;  1U4B A;  3D67 A;  1IBM F;  1L3T A;  2V4J A;  4ZLN A;  4NCB A;  5LSL A;  4OMF G;  2FIU A;  1AFJ A;  5E3R A;  2W2Q P;  3PVX A;  3SFG A;  2VG5 B;  2Y1R I;  1ROF A;  1KVJ A;  1EP4 B;  3NRB A;  3QGG A;  2OML A;  3RW7 A;  1U1O A;  2XGQ A;  5IZH A;  3M8P A;  4ZP8 A;  4USI A;  4DPU A;  4ELU A;  1RKI A;  3RB6 A;  3MF5 A;  1NPK A;  3DLE B;  3NGD A;  3BSC A;  4LBI A;  2KFN A;  4P73 A;  3LWM A;  1Y3J A;  4C8N A;  3DLL Q;  4KBI A;  1FA0 A;  5C25 B;  2P9E A;  3SYZ A;  3B8H A;  4WKR A;  2HAI A;  1ZZN A;  2DNK A;  1YGY A;  1SUQ A;  1Q82 T;  5KOX A;  4EBD A;  3TJ8 A;  4CDI A;  4IUF A;  1FXL A;  3ISN D;  1JLF A;  3UD5 A;  1Q16 B;  2JLE A;  2BAB A;  2ROG A;  3AQP A;  2MQO A;  1ZAW A;  1U0H B;  1FDA A;  2DR9 A;  2FTR A;  4YDD B;  3NY0 A;  2BE7 D;  3C15 B;  2OGU A;  1UMJ A;  2B51 A;  4LR9 A;  3H42 A;  4FPR A;  3CTR A;  4Q0B B;  1MLA A;  4HAC A;  5LJ5 Y;  1RT4 B;  4YR0 A;  3CNQ P;  4R8U B;  4CTA A;  1CJK A;  3W2V B;  2IDE A;  1NU4 A;  3HKW A;  2DCL A;  4IRK A;  3OR2 B;  4NI2 B;  4JI1 F;  2B9W A;  3CED A;  4GVB B;  1S7H A;  1IWA A;  1CQN A;  3H25 A;  2ATC B;  4IOB A;  1UPP A;  2QTW A;  5KFA A;  1HNX F;  2RUG A;  3IN5 A;  3QLH A;  1I1G A;  3UDC A;  3DRY A;  1WI6 A;  3ILL A;  4I56 A;  2PGC A;  3G71 S;  1RTI B;  2MJN A;  3CDE A;  4PG6 A;  1LK7 A;  2P5V A;  4CLY A;  4NCA A;  2BE2 B;  4LJM A;  1TL3 A;  1FT8 A;  3I32 A;  2KRB A;  3A8E A;  5AE3 A;  2LA4 A;  5A2Q Y;  3TW0 A;  2LQB A;  4EI2 A;  4C9D A;  5DDO C;  7AT1 B;  2O01 C;  5D3G A;  1O0P A;  3BPS P;  3OD2 A;  1NK7 A;  2DB1 A;  3RG6 A;  1WSV A;  4I69 A;  1JLB B;  1XIQ A;  3HHL A;  1KFD A;  4X62 J;  3VQT A;  3W62 A;  4K5S A;  5CAA A;  3TVY A;  4H54 A;  3QT6 A;  3RBX A;  2DH7 A;  2ZJQ Q;  4WYW A;  2KZM A;  2DIS A;  1RWP B;  4ZCL A;  4ELT A;  1AT1 B;  4WCE Q;  3OVB A;  2DY9 A;  4OL8 A;  2B6A B;  1HYS A;  1PBU A;  3RAQ A;  2FLL A;  2FZG B;  3NEK A;  2CQ2 A;  4DR2 J;  3DYA B;  3OTB A;  5GAG I;  4K2X A;  4F7V A;  5HP1 A;  1PJ6 A;  1SH3 A;  1WEL A;  3EMT A;  1RT6 A;  2Q79 A;  4LF2 A;  4B3S J;  1FD8 A;  3NKY A;  4E98 A;  4LF8 F;  3MED B;  2AYB A;  3A8I A;  4XPE A;  3TO8 A;  3LPE A;  4RW7 A;  4DQI A;  4ED1 A;  1M1K T;  1RTZ A;  4KGM A;  3ZNJ 1;  1YHQ S;  3TR5 A;  2N3L A;  2M70 A;  4LF7 F;  4KHP F;  5L1L A;  2HEK A;  2YNH B;  2AZ1 A;  5BYS A;  2P9C A;  3FQK A;  4OYM A;  2DR7 A;  1XQI A;  2MPU A;  1C0U B;  5KT6 A;  4DJB A;  4M94 A;  3PEH A;  1Q81 T;  1ZM3 A;  2LXU A;  2MQQ A;  1UJ6 A;  4WFA Q;  2PO4 A;  3N9U C;  1OPZ A;  5GAD U;  1RWO B;  1WEX A;  2GVZ A;  1Y9O A;  5ETV A;  4BWM A;  4QWC A;  1CUL B;  1FKP A;  1PC5 A;  2G1H A;  4H4O B;  5IC4 B;  1JIH A;  1Y3K A;  1OJ4 A;  1XR7 A;  4Y28 C;  1KLM A;  1G1X A;  3BBF A;  3L9Z A;  1HI0 P;  3KHG A;  1T03 A;  3PKM A;  2V8D A;  4MKA A;  4P7V A;  4CO1 A;  4XPC A;  3BSO A;  5D77 A;  1HWK A;  4RW9 A;  4ZPA A;  3TEH B;  5I3Q A;  3Q8P B;  2OEM A;  2M7S A;  2RB7 A;  2XLJ A;  3GB0 A;  2X1A A;  4DV6 J;  1SV5 B;  1RWM B;  5KG2 A;  4MKY A;  1U6B A;  1NK4 A;  4YME A;  3MCO A;  4F25 A;  4WE1 A;  1SH0 A;  4NLT A;  3J7A N;  4RUB A;  3CD7 A;  2KB2 A;  4WPA A;  3MCS A;  3MMB A;  4I6Y A;  3T6J A;  2ILZ A;  4ZP6 A;  1IBC B;  2VDI A;  3EXY A;  4CNY A;  1B7Y B;  2PFD A;  4H4M B;  2VQF F;  1GTH A;  4QR0 A;  1MU2 A;  4DV5 F;  2CKW A;  3AQO A;  2IMO A;  3AJ1 A;  2ZD1 B;  2R7X A;  1MSW D;  1YRU A;  5IM0 A;  4FN5 A;  4F4Z A;  2PEH A;  2F5G A;  2CNK B;  3W7B A;  5EN1 A;  5SZT A;  2F8E X;  1Y7P A;  3I5A A;  1APS A;  2DEI A;  2HLU A;  4URQ U;  5J2Q B;  4I2Q B;  3SCL E;  1NJX A;  3M8Q A;  4DFK A;  5LL6 d;  4NLX A;  4CQ1 A;  4HT7 A;  2YTC A;  5BR8 F;  1JKH A;  4EYI B;  4C0O C;  4X84 A;  2AP6 A;  1JB0 C;  2LQJ A;  3THT A;  4IO9 Q;  2L41 A;  3PO5 A;  3BGF A;  2ZBQ A;  4RNH A;  4ECV A;  3GIJ A;  1TFY A;  4DV3 F;  2KJV A;  2KJW A;  4B9U A;  1RK8 A;  2V50 A;  2HHH J;  4Z2X A;  4Y2C A;  4DLE A;  5D0G A;  3D6T B;  4PAB A;  1QAI A;  1UVJ A;  3TVZ A;  2JLF A;  2EC2 A;  3Q83 A;  1JLE B;  3T1Y J;  2FVS A;  3FSY A;  4CZC A;  5KFK A;  2QFJ A;  3CJQ A;  3WX8 A;  1HHQ A;  4ED8 A;  2VBY A;  4LF6 F;  1IQT A;  4JP8 A;  1TKZ B;  1Q4R A;  3HO1 A;  3AB4 B;  4DSJ A;  4PXE A;  1VDH A;  4A47 A;  1XNR J;  2JH3 A;  2VJV A;  4DHV A;  1NPR A;  1Q5Y A;  1OYE A;  2OFH X;  3GFX A;  1XMB A;  2F7V A;  1UVM A;  2VKR A;  2B5J A;  2FB0 A;  5EWE A;  3LO3 A;  5AXK A;  5C2C A;  3KJN B;  1FI4 A;  4GC6 A;  2E9R X;  1LNQ A;  4L74 A;  1I6J A;  5F9N A;  2OPS B;  1ZZF A;  2LP4 A;  1HD1 A;  3GCX P;  3SBM A;  3PR5 B;  1WC4 A;  6AT1 B;  3EGW B;  3W3S A;  3DLK A;  5DQI A;  3TAQ A;  4JI6 F;  1XMQ F;  1C1B A;  4WXO A;  2CQD A;  4LMZ A;  3PHT A;  1Y0H A;  3RRK A;  1NME B;  3K5O A;  3K59 A;  1TK0 A;  1RGV A;  2OHD A;  2GA7 A;  2DGX A;  4F02 A;  2P9G A;  2IRX A;  5B0B A;  1NJI T;  5CHC B;  2OPQ A;  3MMC B;  2QLF B;  1FJE B;  2GZO A;  3UVJ A;  3V2U C;  1H98 A;  2GO9 A;  4LSN B;  3ILJ A;  5IWA F;  4JI7 J;  2LXI A;  5LMU J;  1IVZ A;  3ZC4 A;  1DZ5 A;  1DY3 A;  2OSQ A;  3J81 U;  4B3O A;  4DSE A;  4J9V A;  1RYS A;  3V4M A;  4TYA A;  2F9J A;  3G82 B;  2JEF A;  5GAG U;  3TAN A;  5L1J A;  1NK9 A;  4B9N A;  2V67 A;  4IH5 A;  4ZVF A;  1CS4 B;  1XBW A;  4RW4 B;  2DRD A;  4DQS A;  3FRY A;  1X4C A;  2OJ3 A;  1OIA A;  3MR7 A;  1OPI A;  3OPK A;  2O67 A;  1HBO B;  2FJX A;  1LW2 A;  5H9F K;  1ARO P;  1KBR A;  3EJM A;  3SSR A;  4TQS A;  4IG0 B;  2ATL A;  3DLJ A;  2VL1 A;  3HHL D;  1S77 D;  1RAG B;  5HMX A;  3LWL A;  2BJE A;  5D6G A;  5F8I A;  2QA4 S;  4QPX A;  2CAJ A;  3JSM B;  2JX2 A;  2NCK L;  2DPJ A;  4UF4 A;  4F36 A;  1IJE B;  4OHW A;  4V1A k;  4KRW A;  3C46 A;  1HI8 A;  5HI7 A;  2H5I B;  1WEY A;  3FFI B;  1WNE A;  5GVQ A;  1WSR A;  5CCL A;  2FDN A;  3GFH A;  2IYG A;  3VCD A;  3K7R A;  4DR5 J;  3B54 A;  4X4Q A;  2WW4 A;  5A8K A;  2HMI A;  2A1B A;  2DGT A;  2KT3 A;  3R1H A;  2A0F B;  3TRG A;  3DRP A;  2BJ8 A;  4WK1 A;  3TAM B;  1FCA A;  2HS3 A;  1VFJ A;  3CCE S;  3NWG A;  1YJW S;  1RCO B;  3PRV A;  1Q5V A;  1U24 A;  2V8V A;  3CDB A;  4Y2M A;  1ZOT A;  1U09 A;  4J9Q A;  1TZ0 A;  2XHW A;  3GSI A;  3J7Z 5;  3R2C J;  2N3O A;  2I5J B;  2IIH A;  2I9S A;  1TAU A;  2OPP A;  4N47 A;  2RS2 A;  1N33 J;  3MUR P;  5KT5 A;  2QEX S;  2OLW A;  2QSF A;  1T94 A;  2GQQ A;  3T9N A;  2E1C A;  2IC3 B;  2UUC J;  4QPT A;  3EPG A;  3G86 A;  1BQN A;  3LGN A;  3J81 Y;  4JOU A;  3BR8 A;  1O51 A;  2AW0 A;  2MQL A;  3IFE A;  3M9O B;  4QYZ J;  4LFB F;  4DR1 F;  2KYZ A;  1EET A;  1QUP A;  1VQL S;  3N6N A;  1WOP A;  2OSR A;  5BYR A;  2JHE A;  3LGH A;  4TVA B;  1HQE B;  5J2P B;  2CNN B;  2UUB F;  4O44 B;  2ASY A;  2KM8 C;  4QIV A;  1A6L A;  3VVU A;  5F8J A;  5HK4 A;  2ABY A;  3N28 A;  2MTL A;  5KG1 A;  4DR3 F;  3UFC X;  4EYH B;  3VZH A;  1SCJ B;  4K4T A;  1S1V A;  5A76 A;  3PEJ A;  2Z2M A;  3BH6 B;  2HK3 A;  4DSL A;  4X4U A;  3BS9 A;  1XC9 A;  2JJ4 D;  1LXJ A;  5G0R B;  1FKO A;  2QV6 A;  1GMV A;  2MKI A;  1E6V A;  4PKD B;  2Q1L A;  4KY3 A;  3I6P A;  4ZVG A;  2HNZ B;  3Q89 A;  2XLI A;  1S1T B;  1S1W B;  2HS0 A;  3FUY A;  5KG6 A;  1NAQ A;  1E6Y B;  2HWT A;  2IAJ B;  1CJU B;  3GJQ B;  4LRE A;  4DX5 A;  2ADC A;  4ZN1 A;  2ZH8 A;  4W4M A;  4CYU A;  1AYE A;  4C11 A;  2ZWO A;  4NAS A;  4DV1 F;  2BZ2 A;  1DBD A;  1D0E A;  3K0J A;  4ZMM A;  3TUJ C;  1CG2 A;  5IOL A;  2I2Y A;  2FVQ A;  4LFC J;  1KS2 A;  3I0R A;  1SJR A;  1VJQ A;  4ZIT A;  3NGS A;  4USV A;  1GFW B;  3EGZ A;  1HNI A;  5KFT A;  1OWX A;  4YB1 P;  3QRQ A;  2RD5 C;  1RT7 A;  1IWG A;  1NK0 A;  3TEG A;  2XMV A;  2BRL A;  5I3U A;  4ETZ A;  3N0V A;  2X7I A;  3TX0 A;  1H7W A;  1H6K X;  2UV8 A;  3MM7 A;  2FZK B;  3QAU A;  3CCL S;  1OQ3 A;  2JOQ A;  1NJY A;  1A9N B;  4F0K A;  4O0I A;  5SUH A;  1S72 S;  3NOG A;  3ZZR A;  2HFU A;  2WK4 A;  1J5O B;  5DG7 A;  5E3A A;  4F2R A;  3EX7 B;  3MR6 A;  2AJ4 A;  1V3S A;  3J80 U;  1TKT A;  4J9O A;  2VG6 B;  2XMT A;  1N32 F;  4Y2K A;  4KO0 B;  3D2W A;  1RWW B;  4RWW A;  5HN0 A;  5ETT A;  2XUL A;  2CZV C;  3GCW P;  1WI8 A;  4E8U A;  2VFT A;  2VKZ G;  5C7P A;  3W2W A;  2FVC A;  2RQ4 A;  3MAQ A;  2B4U A;  3JYT A;  5I4M A;  1WHV A;  1FJC A;  8AT1 B;  1PSD A;  4KC5 A;  6FD1 A;  1Y5I B;  2K3K A;  2W9C A;  2AJ0 A;  2RQK A;  3GV7 B;  4JYA J;  1TVR B;  4DR4 F;  4WK3 A;  1IBK J;  2CPJ A;  2LFV A;  3HMJ G;  1J27 A;  3I56 S;  2XS7 A;  2XSF A;  3MM8 B;  1NDC A;  2M0G B;  5D15 A;  1B0P A;  3M6U A;  5HSP A;  1SQG A;  5M2U A;  2Q43 A;  3DHW C;  2JDJ A;  2BAC A;  1N34 F;  1DTQ A;  2H48 B;  1FJG J;  1LWE B;  4RW6 A;  3IC1 A;  5J2M A;  2YKM A;  2CJA A;  1HBN B;  3UO0 A;  1C2P A;  3E01 A;  5HMY A;  4DUZ J;  4X65 J;  3I31 A;  3OQ2 A;  1R27 B;  1OY8 A;  1VLO A;  2G1D A;  2GFF A;  3RGI A;  2C2D A;  4C3L A;  4X4R A;  2C2Z B;  4PXD A;  5J1P A;  4MH8 A;  3KG1 A;  2PMZ D;  2MJU A;  3ULH A;  2QLJ B;  3TJ9 A;  1NKB A;  3CDW A;  3C14 A;  1RE1 B;  5HMW A;  3AA9 A;  4LRC A;  2ACM A;  5LSO A;  3BSN A;  4U8V A;  3T3F A;  5IQ6 A;  3CCS S;  1VQN S;  4NEY A;  1TKX A;  5K14 A;  1WOS A;  2XMA A;  3KJV A;  1P1T A;  4HKQ A;  3IBC B;  2IA0 A;  4NWB A;  1HL6 A;  5HQL A;  3KDO A;  2U2F A;  1W25 A;  1TL4 A;  4WU2 A;  3R5C A;  2MMY A;  3TOQ A;  3IS9 A;  2GVD A;  3K5L A;  2QA4 G;  2D74 B;  2DNG A;  1RBL A;  1ELO A;  3J80 Y;  4FXD A;  3OJS A;  2CWK A;  1VRT A;  4N8O A;  2DVI A;  2J5A A;  3E3X A;  2HQF A;  4LBP A;  1T0T V;  3GQC A;  4NXN F;  3OTE A;  5JVG Q;  2F4V J;  2R7U A;  1FDN A;  3TNV A;  3SMZ A;  4X4T A;  3X3U A;  3GJT B;  4RR5 A;  2ASJ A;  3CCV S;  3KLF A;  4I2P A;  2V9W A;  3RJM B;  1FEE A;  4UY8 T;  4IFV B;  2ZC4 A;  3ZTP A;  3PX4 A;  3CE8 A;  1LXN A;  1G2E A;  2CIM A;  1KOH A;  1TL5 A;  4QYZ K;  4U96 A;  2UUW A;  2BUN A;  3PFO A;  1T9X A;  2KT5 A;  3S1T A;  4DL5 A;  2ZH1 A;  1HD0 A;  3MEG A;  4LRA A;  4BHQ A;  3N79 A;  1RA7 A;  4DZ6 A;  4DV0 J;  3SV3 A;  2FHO B;  3T5H A;  2N7C A;  4Q43 A;  3GE9 A;  2OIH A;  2HQG A;  3IRW P;  5GAE I;  1ZM4 A;  2AGO A;  3E2E A;  1HW9 A;  2F4F A;  2X1F A;  1EHW A;  5CA5 A;  1FER A;  3UCZ P;  4JI8 J;  4HL9 A;  3GMG A;  2E29 A;  5IT0 A;  3RBD A;  3QFW A;  1YJV A;  4GKK J;  1FEH A;  5GAH I;  4OYP A;  1R7I A;  3TQ1 A;  1NHV A;  1NND A;  2N4D A;  2E5H A;  2RS8 A;  1OQ6 A;  4ZLL A;  5AE2 A;  4PYA A;  4OI0 A;  4RU9 A;  3TYT A;  4UOF A;  4JI5 F;  3R97 A;  2C2K B;  1N56 A;  4AL7 A;  3QSI A;  4TY8 B;  3M2V B;  4PG4 A;  1GTE A;  4KV8 B;  3H2V E;  3UN3 A;  1QVF R;  3VAH A;  5F41 A;  1UVN A;  2YKP A;  3UR0 A;  2RE1 A;  2GW8 A;  2M2B A;  2NXE A;  4W90 B;  2KI2 A;  2RRA A;  2DYA A;  3JSB A;  3V4I A;  5DG9 A;  4FZV A;  2HFO A;  2EEY A;  1EX8 A;  3ILI A;  1YKW A;  1HWI A;  3HFK A;  1SL2 A;  3H4B A;  2H3E B;  2R3V A;  4OX8 A;  1NLK L;  1WHW A;  2CJX B;  5FDL B;  3AHP A;  4XDC A;  1VJW A;  1RTJ A;  1SKR A;  2CWX A;  2DNO A;  1UA1 A;  2DNN A;  5U47 A;  4O0N A;  2A2D A;  1T9U A;  1FES A;  2P2C B;  3DOM B;  4ANE A;  3M9N B;  3TAP A;  3QZ7 A;  3UE2 A;  1JK9 B;  3WBZ A;  4J7C A;  1SQF A;  4B3T F;  1JLF B;  3CXC R;  3OHB A;  1LWF B;  2M8D B;  2DR5 A;  1S9E B;  1RAO A;  4NRU A;  2DXE A;  1WUU A;  1UEU A;  5KFB A;  5KG5 A;  4ZIW A;  4Y2I A;  2FZC B;  3MTK A;  4OFZ A;  2WVD A;  3P96 A;  2MZS A;  1WWH A;  5DO2 A;  4EZ9 A;  1KR4 A;  4HAC B;  3UD4 P;  2KT2 A;  4WZM A;  2VOD A;  4LFA J;  4ER8 A;  4CTA B;  2FC8 A;  3NMA A;  4O4R A;  5B0F A;  2ZC3 A;  3JTN A;  3NGU A;  3CIM A;  5KFI A;  2HWI A;  1YIJ S;  4FF4 A;  1EIY B;  3MEK A;  3SQO P;  2YKN B;  4ZIV A;  1RHJ B;  1HWL A;  3PFE A;  2HHT A;  3MPV A;  4IR9 A;  3BGU A;  2JVR A;  4AYB D;  2PFF B;  3PXG a;  3RZA A;  3DMJ B;  2BQU A;  5T14 A;  3A12 A;  1RT2 B;  4QBU A;  2HGN A;  3ZZP A;  5AE1 A;  2D69 A;  1FD2 A;  3MOZ A;  2J6U A;  3I4P A;  2G4B A;  2CQG A;  1R8A A;  3T1H J;  1T05 A;  3BGO P;  1NH7 A;  2E9T A;  3HP6 A;  4YQW A;  2ZVS A;  3M4X A;  1AZS B;  4X4S A;  3I0S B;  4WFB Q;  1KOO A;  3GTY X;  3AAW B;  1WC0 A;  2AJ2 A;  3K57 A;  4ZVR B;  1FFG B;  4F4Y A;  1CJV A;  4KGK A;  2APO A;  3FZ2 A;  1SXL A;  3WIU A;  4NPO A;  3AD9 C;  5HLF A;  2XO6 A;  5F8M A;  3FC9 A;  5K5M A;  3LP2 A;  4N77 A;  1BC6 A;  3M7V A;  9RUB A;  3PYG A;  2K8G A;  3GSD A;  3EVW A;  3QRR A;  3R3T A;  3PY8 A;  4RNF A;  4YY3 J;  4A8Y A;  4ZCM A;  2EI5 A;  2RJZ A;  2E44 A;  1CPZ A;  3IR6 B;  4UUW A;  4P74 A;  4ECS A;  4FF2 A;  1Q7Y T;  1YVF A;  2AKW B;  1IKV A;  5CZX A;  4NCG B;  5F3T A;  3ENW A;  4R25 A;  1RT6 B;  1RAA B;  4DX7 A;  1S1U B;  3TWZ A;  4ZPD A;  1RT1 B;  2EXU A;  2ZJP Q;  3BM7 A;  3K5N A;  1YZ6 A;  2POK A;  2HWH A;  1ACM B;  3SXL A;  2ZE2 A;  4DMZ A;  3ILO A;  2P6S A;  1VIX A;  4NLW A;  2NPI A;  2V69 A;  5FD1 A;  1C0T A;  1I94 J;  4NYO A;  5DDP C;  1NK6 A;  1PIE A;  3C66 A;  3KLG A;  1SC3 B;  3HSG A;  2DJW A;  3LH2 S;  3UN5 A;  3HK2 A;  2L9N A;  3TZX A;  3MEC A;  3IG1 A;  2OFG X;  2R9L A;  2EKY A;  5ETQ A;  4Y3C A;  2DXD A;  3UD3 P;  3KMQ A;  4WXW A;  4I1T A;  3ELH A;  2VA2 A;  3GR0 A;  2KXH A;  2EC0 A;  1S9G B;  4L73 A;  1JNZ B;  1SJ3 P;  1RCX B;  3R5J B;  4HI2 A;  2XBP A;  1XNQ J;  3W8P A;  2Z2Y B;  2GVZ B;  3VAG A;  4UZB A;  1FFW B;  5GAE U;  2NR0 A;  5J1E B;  2WVC A;  2AMC B;  1Z1Z A;  3AOD A;  3CCR S;  2AEM A;  2W4P A;  5KOW A;  3OXF A;  1KLM B;  4OHV A;  5KG7 A;  2VFU A;  4JV5 J;  3UCG A;  3C19 A;  4AND A;  1T03 B;  3EIC A;  5GAH U;  3M8Y A;  4AL5 A;  1S6P A;  2H65 B;  2ZH5 A;  3MM6 A;  3TQE A;  2QRR A;  1N54 B;  1S4F A;  2ALZ A;  2GAG C;  3QMQ A;  3DRR A;  3G96 A;  2CRL A;  3HZE A;  3PYF A;  2ROP A;  3OHA A;  5KFF A;  3HFV A;  3CPW R;  4CO4 A;  1IJF B;  2HVI A;  3NGK A;  4RLE A;  4HHH A;  4WE1 B;  2GJI A;  3Q8Y A;  4F4A A;  1PYS B;  1VQP S;  3HDS A;  1U1M A;  3MMB B;  4MYU A;  2PEB A;  4IQM A;  3QAE A;  1R8C A;  3B6B A;  1AUD A;  1NDK A;  2VQE F;  4HTI A;  5D4O A;  4L6V 3;  1VBK A;  2CG8 A;  2YKO A;  3OUY A;  3LAN A;  5KFG A;  1IBM J;  4RJV A;  5ITH A;  4P75 A;  1DQ8 A;  3D5M A;  5I42 A;  1F9H A;  2WON A;  1ICE B;  1LOU A;  2GQ2 A;  4ES3 A;  5K9F A;  1LFP A;  4TU9 A;  3A3P B;  3VAJ A;  4NLY A;  1CC7 A;  3PIP Q;  3MPW A;  2EBG A;  1JLA B;  3Q8R B;  1KTQ A;  3ZZY A;  1M5K C;  4BS2 A;  1Y5N B;  1FDD A;  4IG3 B;  3KLE A;  2B7C B;  4DV7 F;  3JB9 k;  4M1K A;  3B4M A;  2B7B B;  1P27 B;  3LP0 A;  3HLU A;  3R5A A;  3KK3 B;  5E0O A;  2ZHA A;  1U47 A;  3JQM A;  1JKH B;  2J76 E;  2DH8 A;  4CWB A;  2RIL A;  4JV2 A;  1JMT A;  2XMK A;  3I96 A;  4A8Q A;  1TV6 A;  3N6M A;  3OFE A;  1LWX A;  1H72 C;  3PW5 A;  2DGS A;  3H5S A;  4B08 A;  1UZD A;  5IT4 A;  4A8K A;  5FJ4 A;  1S6Q A;  3AD8 C;  5IT9 U;  4TU7 A;  2X3G A;  4QR2 A;  3GLJ A;  1IR2 A;  2HVZ A;  1N52 B;  2NYH A;  2X1G A;  3OTC A;  1TL7 A;  3C6T A;  1NSK L;  2VU5 A;  3T19 A;  5E3C A;  1A0O B;  1Q7L B;  3K89 A;  2B5J B;  2HHP A;  1B4S A;  3HHL C;  5B0C A;  1NJZ A;  2BYC A;  1RAI B;  1HNX J;  2HGL A;  4O3O A;  2I38 A;  3DXB A;  4LBH A;  2V8G A;  2HGM A;  5CAB A;  4NLQ A;  4OX7 A;  5LSR A;  1FNM A;  2DNP A;  3ENA A;  3NMR A;  3NS6 A;  1JJ2 R;  3ITH B;  2EFN A;  3N4W A;  3EXC X;  4ID5 A;  5B7W A;  2HQD A;  3WX4 A;  1WDT A;  1I5O B;  4OJ1 A;  4F4X A;  4PQU A;  4A8O A;  1ZTW A;  2LYV A;  3IWL A;  1O5J A;  2EBE A;  5F0W A;  3AOB A;  3CO9 A;  4LF1 A;  2R42 A;  3BN7 A;  3TP2 A;  2SXL A;  4OHZ A;  3M8W A;  3TX8 A;  5F3Z A;  2L9D A;  1PC4 A;  3BZQ A;  4ITS A;  3UVJ B;  3R5B A;  4F4K A;  4PG5 A;  1SH2 A;  4NLP A;  2M3D A;  3MEE A;  4KE5 A;  2VIC A;  1O8B A;  2D1C A;  2KTQ A;  1T9T A;  4ED2 A;  2GHP A;  3D54 A;  2AX0 A;  4LR7 A;  2RUS A;  2IRY A;  1JQG A;  5KFX A;  5IV3 A;  2JVO A;  2NSB A;  1FNO A;  1VMB A;  3FKB A;  2CYY A;  2FJW A;  4DDF A;  4A8F A;  1PO6 A;  1S76 D;  3V6D A;  2XNR A;  2XY7 A;  1RYR A;  3QYY A;  4M5D A;  5ETM A;  3S6E A;  3BO4 A;  1Q95 G;  2PD1 A;  2ZH9 A;  2AIR B;  4QW9 A;  2QA2 A;  1TTH B;  2VBX A;  4LF8 J;  1X4F A;  2R7V A;  1L3K A;  2PII A;  4OLO A;  3FBF A;  2KVI A;  2NXC A;  3EZO A;  3BQ1 A;  3EZU A;  1HBU B;  5L8R C;  5C2G A;  1VQS A;  1L3U A;  4DFP A;  5L9X A;  1FHT A;  4LF7 J;  2UVW A;  4KHP J;  3NCQ A;  4DL4 A;  3MM9 A;  4OYX A;  3Q22 A;  3IXQ A;  2WB1 D;  4FF3 A;  1RAE B;  2GMH A;  3W64 A;  1Q8K A;  2LQ8 A;  1T7P A;  4K4V A;  4P2S A;  2ZBP A;  5A6W A;  2J7W A;  4HVZ A;  1DLO A;  3THV A;  3K58 A;  5C24 A;  3LQV A;  5B08 A;  1U1Q A;  4G1Q B;  2VV5 A;  4LR8 A;  1RB0 A;  4OX6 A;  1YTY A;  3KTQ A;  1YBU A;  4DL2 A;  1WKJ A;  4ECR A;  1TK8 A;  1H7X A;  3MZI A;  1M1H A;  5HAN A;  2XO7 A;  1RTD B;  1D09 B;  4HHU A;  3O3L A;  4ES2 A;  1K1S A;  2YNG A;  2ZZT A;  3I9V 9;  5CYM A;  2ZDP A;  4ZHR B;  5CD4 A;  1Y5L B;  2BQR A;  2BVZ A;  2CJQ A;  3RR7 A;  1HNZ F;  1N6Q B;  2QLW A;  3DN9 A;  4ILL A;  4EUV A;  1TFW A;  4OZ0 A;  3BBC A;  1H2U X;  3CSK A;  2OPP B;  3IBF B;  3MPY A;  2KH9 A;  2HFZ A;  1GXL A;  3L09 A;  3HZG A;  1F6T A;  4USJ C;  3ZFV A;  3SEO A;  1FK9 A;  1REG X;  1S4E A;  4MMO A;  3HHN B;  2CFX A;  1S9F A;  3ZTS A;  4TNO A;  4YFU A;  2AU0 A;  1RLD A;  1SJF A;  2OH2 A;  4X2B A;  1FRL A;  4M5G A;  3R7B B;  1QAX A;  5A0Y B;  3WQP A;  4CO0 A;  3BO2 A;  2AZ3 A;  4G65 A;  2XMW A;  2VG5 A;  2VQF J;  4CH7 A;  5KG4 A;  1EP4 A;  2DO0 A;  2DRB A;  3D68 A;  4DV5 J;  4KHR A;  3LOU A;  4J9U E;  4CLL A;  2H4W B;  3UN2 A;  3D0H E;  4DV2 F;  2E7X A;  1S1V B;  3DLE A;  2J9D A;  5KFE A;  2O5D A;  1S1X B;  5LOQ A;  3OL9 A;  2V94 A;  4HI1 A;  4DWI A;  2XWY A;  3MAA A;  2IFX A;  2HUR A;  2VD3 A;  3E51 A;  2QMW A;  1PGZ A;  1FKO B;  2ZH3 A;  2FQQ B;  5C25 A;  4O23 A;  1SL1 A;  3KJQ B;  4F0M A;  4HTJ A;  4NLG A;  1MML A;  4EEY A;  2Y8Y A;  5EX3 A;  3MAH A;  5BR8 J;  3K5M A;  4WU3 A;  5BJR A;  3FCW A;  3X1L B;  4Q8F A;  5KFO A;  2VPW B;  2J9D E;  1R0A A;  1FRI A;  4EO8 A;  3G6V A;  2UV8 G;  1B0V A;  2MSS A;  3CMQ A;  2J8S A;  1U0H A;  3OFF A;  5FII A;  2W7A A;  4ZA1 A;  1Q8I A;  8ATC B;  4QCL A;  2W2N P;  3C15 A;  2JSX A;  4YS2 A;  2WOM A;  4C11 B;  3GV8 B;  3OJU A;  4Y0F A;  2OMO A;  3EGN A;  2MLY A;  2AYE A;  4OV6 A;  4Q0B A;  1N36 F;  3CJ0 A;  5KG3 A;  2ADB A;  4Q8E A;  1RAD B;  1L3V A;  4R8U A;  3MUM P;  3HX9 A;  2KHD A;  1WC3 A;  1FDB A;  3W2V A;  4UZC A;  4P52 A;  3TUI C;  2F63 A;  4LF6 J;  3H0P A;  3I0R B;  3OR2 A;  4NI2 A;  2LU1 A;  3OL7 A;  4GVB A;  4NZ6 A;  2MZJ A;  1XEZ A;  3CJ2 A;  3NCR A;  4ICL A;  3TVK A;  2HKE A;  1BQM B;  1RT7 B;  1FXD A;  3GV5 B;  2K1R B;  3BV8 A;  3KUG A;  2QGF B;  4XAK A;  2FHJ A;  2HBR B;  2ZH7 A;  2XQC A;  3MM7 B;  1RHK B;  3HF5 A;  4NZ0 A;  2V34 A;  1SJ4 P;  2GS8 A;  1RT3 B;  2QSW A;  3KFW X;  4KSE B;  4ZPT R;  2BKP A;  1D3W A;  1S0O A;  2GAH C;  3FMW A;  2Y1I A;  2GCF A;  2OEJ A;  1R0B G;  4O4G B;  4YB5 A;  3R9L A;  3D1O A;  1KN6 A;  1VGY A;  4JI6 J;  4J9R A;  1XMQ J;  3NG8 A;  3NNC A;  1TKT B;  4JV0 A;  2KN4 A;  1Y11 A;  2HG4 A;  2EW9 A;  3EVO A;  1JLB A;  4DL3 A;  1Q78 A;  4NEZ A;  2PI4 A;  4FYD A;  1AFI A;  3CJK A;  2YWK A;  1KVI A;  2BXJ A;  4B9L A;  1UET A;  1JX4 A;  1K73 T;  4Z7Y A;  3BKT A;  3CD5 A;  3BN4 A;  5H9E J;  2CPE A;  4DCJ B;  5IWA J;  3D1Q A;  3M9M B;  2BJ7 A;  3M8R A;  2ZOF A;  4CT9 A;  2JLG A;  1EJ7 L;  3BO3 A;  4CLW A;  2B6A A;  4UT4 A;  5A6P A;  3HXM A;  2R7R A;  3IM8 A;  1RIS A;  1S79 A;  1PBA A;  4EU0 A;  3DOL B;  2AX1 A;  3G6Y A;  2MKS A;  1IKW B;  2LEA A;  3IM9 A;  2DNZ A;  3KDN A;  1X4E A;  4MIA A;  2AHO B;  3PTW A;  4WZQ A;  3G6X A;  1DTQ B;  2YWF A;  5CCM A;  2YNI B;  5J2M B;  1EQM A;  2MHE A;  1T02 A;  2CJK A;  4GVL A;  2MKJ A;  3E01 B;  1W7W A;  4IOA Q;  2R7S A;  3PG9 A;  2BJ9 A;  1SKW A;  2W9A A;  3F73 A;  3GZ7 A;  2CPI A;  1QAJ A;  1RSC A;  3QZ8 A;  4KFB B;  4C8L A;  3W5X A;  3VR1 A;  3ZZT A;  3GYN A;  3KUH A;  3I82 A;  4DEZ A;  4OZN A;  2OP5 A;  3CVK A;  3R6L B;  5M2P A;  3KK2 A;  2HK2 A;  1MN9 A;  1C0U A;  5K14 B;  2ZOG A;  5F8N A;  1RI7 A;  1R6Y A;  3WHI A;  4HLB A;  1RQ0 A;  1NSQ A;  4LF9 F;  4Y00 A;  1X60 A;  1F1B B;  3RU0 A;  4OJG A;  4OI6 A;  2CDQ A;  4MIB A;  3IS9 B;  2GVD B;  2J0X A;  3A4T A;  1CUL A;  2N82 B;  5A2Q U;  2UXB F;  3SCK E;  1N8R T;  1ZM9 A;  1UJ5 A;  3CUL A;  1VIO A;  2PC6 A;  4RNN A;  2WSC C;  3TZW A;  1U49 A;  3D3B J;  2HHS A;  3U1N A;  2HFV A;  2Z56 B;  3GR1 A;  4DG1 B;  1YJ7 A;  2FHK A;  3IR5 B;  2MQM A;  2YWH A;  3LP1 A;  1S6O A;  3PYE A;  5IXU A;  1TUW A;  1HQU B;  3KLF B;  2R7O A;  3NCP A;  4DR7 F;  2HZC A;  4OI2 A;  4Q44 A;  4NA3 A;  4P6Q A;  1GQE A;  2C28 A;  2MKC A;  5DG8 A;  1FVS A;  1FE0 A;  4RBT A;  2YXL A;  4OYW A;  4OZJ A;  3JSR A;  4LFB J;  2V2Z A;  4I0W A;  4DR1 J;  2VON A;  1NHK L;  3KUE A;  2M5Y A;  3UDE A;  2AEF A;  2KHC A;  3ISZ A;  3F44 A;  2GO8 A;  2UUB J;  2QJ3 A;  2KKH A;  3PW7 A;  2H51 B;  1FKA F;  3GIK A;  1VRU B;  1JLC B;  3V6J A;  1ZA1 B;  4DR3 J;  4XDD A;  3H5Y A;  2XYG B;  4PXC A;  1PJ7 A;  2G0C A;  4FKY A;  4I2Q A;  4FP9 A;  2R2R A;  3CCT A;  2B9E A;  3HSJ A;  4TLQ A;  1GNK A;  5F8L A;  1YSJ A;  4ZVU B;  3V5R A;  5EWG A;  3OFH A;  2VJU A;  5E5N A;  4IDK A;  2HBY B;  3IRX A;  2VHG A;  1U1N A;  5RUB A;  5B0D A;  1REV A;  5E3Q A;  1R89 A;  2EFP A;  1T9Y A;  3PO4 A;  2E5I A;  4NXM F;  4EFA C;  1T95 A;  1TMJ A;  4F3M A;  5DGB A;  1UZH A;  2W7O A;  3KLV A;  3SV4 A;  2B4V A;  1B0T A;  3IMQ J;  2CQ4 A;  4DUT A;  4U7C A;  3LF0 A;  2ROE A;  3AT1 B;  1JLE A;  5C5J A;  4M5N A;  2HFS A;  5ETP A;  4DV1 J;  2BQ3 A;  2QG9 B;  4RU2 A;  3MOJ B;  3ZZO A;  2L08 A;  1OMS A;  9ATC B;  3NS5 A;  2FGO A;  2D7S A;  2GML A;  3FSI A;  1KQS R;  2MDA A;  1WF0 A;  3PHE A;  1MNE A;  4USM A;  1JNR B;  4HDH A;  2Q6B A;  1RTH A;  2H54 B;  1V5V A;  3HSD A;  3JSY A;  3B4D A;  3VV2 B;  2LEB A;  3FK4 A;  5KFZ A;  1WG5 A;  5A8W A;  2R7T A;  2W9B B;  1QSS A;  4FBU A;  4M8L A;  2OPS A;  2QT7 A;  1FXR A;  1BD6 A;  2QLX A;  4AQY F;  1OSD A;  2HLT A;  3ONQ A;  5DZ6 A;  1JLG B;  4B17 A;  2IMW P;  2CG4 A;  1BWE A;  4IOC Q;  1IKX A;  1X5T A;  4MJK A;  3H4D A;  3VAL A;  4PG7 A;  1CBK A;  1GXT A;  1RT5 B;  4U67 Q;  2LU2 A;  2NUU G;  3TI0 A;  4LT6 A;  3MMC A;  1N32 J;  1NBE B;  2OEK A;  1RHU B;  1URN A;  2IM1 A;  1GX6 A;  2EWH A;  4QYR A;  2CJ9 A;  3HJF A;  2CQ3 A;  4N41 A;  3KNA A;  4AXI A;  5EX0 A;  2Y0B B;  1YDL A;  4USU A;  5DQG A;  4JI0 F;  2YWG A;  5HO4 A;  2G9O A;  1VCT A;  3MGJ A;  5L1I A;  2FHJ D;  1IN0 A;  1AW0 A;  4C7Q A;  4KHM A;  3SSS A;  1H2V Z;  4EWT A;  1XR6 A;  3HHD A;  1F2G A;  2ZBI A;  3BR9 A;  4GO5 X;  1K9M T;  3G82 A;  3BDP A;  4DR4 J;  3N01 A;  4UOH A;  4GO7 X;  1VK8 A;  2BRK A;  2LA6 A;  3D6M B;  1CS4 A;  2WAQ D;  5KFH A;  4K4W A;  3R7N B;  2V6A A;  3SSQ A;  4OYO A;  4CO3 A;  1RU2 A;  1HBO A;  1DFD A;  1U8S A;  1N34 J;  2BMB A;  5H1S V;  2L48 A;  3DC2 A;  2Y8W A;  2BJD A;  2QL7 B;  2R7Q A;  3Q86 A;  1HAR A;  1ZA2 B;  4IG0 A;  3R7S B;  4F3Q A;  4YR2 A;  2HS4 A;  1PYT A;  3DM2 A;  4NYZ A;  4WFZ A;  4LF4 F;  2YNF B;  2E1P A;  3DU6 A;  4NLU A;  2WZ1 A;  5DET A;  3GG1 A;  1LEO A;  2IHR 1;  4Q7A A;  3FGV A;  3U02 A;  1F3F A;  3L7U A;  3OTO F;  2DNH A;  1X4G A;  2I8E A;  2HVH A;  4U95 A;  2FJD B;  2DTJ A;  2G2Y A;  1WHX A;  3HT0 A;  3FFI A;  2DIU A;  3C16 B;  3DGP A;  4K50 A;  1RAF B;  2IJN A;  1UWA A;  2HPU A;  1H2T Z;  1VK3 A;  2KFY A;  3S8S A;  5AXM A;  4NLS A;  4ATN A;  1CEZ A;  4QQB A;  2HYI B;  3N5B A;  4XIU A;  4FS2 A;  1K1Q A;  3NBP A;  3TAM A;  2AV5 A;  2V8P A;  3W65 A;  1YJN S;  5HRO B;  4DPW A;  4DPX A;  1VIS A;  1RHM B;  1WC5 A;  5T7L A;  4RW8 B;  5HVG A;  2H1Y A;  2QA1 A;  1CQM A;  2ZE2 B;  3CC2 S;  4V19 J;  1NHU A;  5KT3 A;  3QT8 A;  4DL7 A;  3P6Y C;  1SI9 A;  3D6F B;  4YDX A;  1U45 A;  2V5H G;  4M5M A;  1HQ2 A;  4Y2A A;  3KHH A;  4UUX A;  4NXN J;  1ZH5 A;  2AEJ A;  1T3O A;  2CPZ A;  3DOK B;  1X7V A;  5KFJ A;  2HW3 A;  2IC3 A;  4NYP A;  2F3J A;  2A18 A;  2JZ5 A;  2EK6 A;  4NA2 A;  4DL0 C;  3D7S B;  1UFK A;  1Q0N A;  4RUC A;  2NYI A; 
#chains in the Genus database with same CATH homology
 2Y9H A;  3QRR A;  3QRQ A;  3QRP A;  2Y8Y A;  5H9F K;  4U7U D;  5H9E K;  1WJ9 A;  4QYZ K;  2Y8W A;  5CD4 A;  4DZD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...