3QRPA

Structure of thermus thermophilus cse3 bound to an rna representing a product mimic complex
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
214
structure length
214
Chain Sequence
YFQMWLTKLVLNPASRAARRDLANPYEMHRTLSKAVSRALEEGRERLLWRLEPARGLEPPVVLVQTLTEPDWSVLDEGYAQVFPPKPFHPALKPGQRLRFRLRANPAKRLAATGKRVALKTPAEKVAWLERRLEEGGFRLLEGERGPWVQILQDTFLEVRRKKDGEEAGKLLQVQAVLFEGRLEVVDPERALATLRRGVGPGKALGLGLLSVAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Recognition and maturation of effector RNAs in a CRISPR interference pathway.
pubmed doi rcsb
source organism Thermus thermophilus hb8
molecule tags Rna binding protein/rna
molecule keywords Putative uncharacterized protein TTHB192
total genus 53
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2011-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08798 CRISPR_assoc CRISPR associated protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1200 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Crispr-associated protein; domain 1 3qrpA01
3.30.70.1210 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Crispr-associated protein; domain 2 3qrpA02
2Y8YA 2Y8WA 5CD4A 3QRPA 4QYZK 2Y9HA 4DZDA 5H9EK 1WJ9A 3QRRA 4U7UD 3QRQA 5H9FK
chains in the Genus database with same CATH superfamily
3SCLE 3KFWX 2W4DA 4PXBA 1KC8T 4RLEA 2L9DA 4DLEA 2IJRA 2F3JA 4TQSA 4AT1B 3KNGA 4J37A 3U27A 2GVZA 1T03B 3D0GE 3UN2A 5BYQA 5KT3A 3R7BB 3W7BA 4DWIA 1GAOA 1F2HA 5ITHA 1JNRB 4PAAA 4QW8A 3TO8A 4CNYA 3QJLA 3FRYA 1ROFA 2W4PA 4MAKA 3IMQJ 4RKUC 3VGSA 3NBPA 2B4OA 1RWOB 4KHRA 1TKZB 2BE2A 4A8XA 4RZRA 3D3CJ 2IBOA 1FNMA 4JI4J 3AQPA 5KFJA 3DYAB 1SJ3P 1FCAA 4AYBD 5JUMA 2CQBA 1HKAA 2AJFE 2ZOFA 1FHTA 3W8GA 1U6FA 4EO8A 4ES3A 3TUJC 2IHR1 1Z2LA 1NSPA 2XWXA 4P52A 3Q89A 2XC9A 2OPSA 1LWFA 2KHDA 5GMDA 3D6FB 4OX7A 4F4YA 3MOJB 4W92B 4ECXA 2VBWA 3AOBA 3C46A 1OY9A 4CLLA 5KG4A 3PYDA 3OHAA 2QA4S 4DL3A 2U1AA 1BQNB 3W66A 2IM2A 1MSWD 3HCXA 4WTYA 4ANDA 5HL7Q 3VWSA 2HVIA 1YQHA 2Z0GA 5DG8A 3ILOA 2W25A 2XGQA 1YIJS 1W2BR 3ENAA 4F2RA 5DS7A 2D3ZA 5D4LA 3HHEA 4LSLA 3U1NA 4XO0A 1S1VA 4OIXA 4X4SA 2JC1A 2DXEA 2XI3A 1MMLA 2M52A 2DPJA 3SDEB 1X7VA 4K5SA 2RRBA 1HQUB 3LO3A 1A7GE 5KG1A 5EX0A 4NRTA 4YR3A 1SL2A 2WRMA 1JJHA 2G2YA 1FJCA 1GMVA 2YY3A 3VGVA 2OD6A 4DQIA 1G7CB 3F0NA 4B9MA 2C3YA 3P3DA 5GVQA 1XMQF 4UW2A 4ZCKA 4DV7J 2UUBF 2DNOA 1HFEL 2BE9B 1RK8A 2M9KA 3CULA 4RW4A 2MQMA 3DLEA 3SQGA 3M8QB 3KLGB 3MR3A 1NK8A 4IRKA 3TUPA 3PX0A 3Q22A 1HD1A 2GQCA 4Y6IA 3NS5A 1NH7A 3PFOA 6FDRA 4RW7A 4FBTA 4J9MA 5J2NA 1KHVA 3TQ1A 3I0RA 2LDYA 1DQAA 4NPOA 1K8AT 3NGSA 4FPIA 3NGUA 2HZCA 1HHSA 4FKYA 3MAAA 3RW7A 1RU2A 3KXDA 1IQZA 2VHGA 3MECA 4ZHRB 1S79A 5H9EJ 1GQEA 4DV5J 4A8QA 2BR0A 1VRUA 2ABYA 3KLIB 5HP1A 2HGMA 5KFLA 3BQ0A 1QE1A 3RU0A 1YHQS 4FN5A 1U1NA 2LQ5A 5J1EA 4X65J 3PR4A 4ECUA 3Q83A 5SUHA 2KT5A 3D9BA 2Q79A 5ADZA 4O0IA 4QR1A 3M8RA 4DOZA 5E7OB 1VGYA 2R7QA 4N56A 3V4IB 2CNOB 4PG5A 1DARA 5GMEA 1NK9A 2EKNA 1Q82T 3UI3A 1YLXA 4DLGA 4JUZA 1IM4A 3LWLA 1UPPA 2YPZA 5KFHA 3RR7A 3N6MA 3IR5B 4RPFA 3SBMA 1Y00A 4C8ZA 4DR5F 1U45A 5J2PA 1JLAA 1RCXB 1XN9A 5CAAA 3HT0A 1S72S 3DRSB 1E6VB 2DGVA 3A3OB 3KDOA 3U1MA 3U02A 2WHOA 2CPHA 2J0XA 1LNQA 2VKRA 5IT9U 4ECYA 4OL8A 2PA3A 2CA9A 3W62A 1GMUA 2A6MA 1CG2A 5HJXA 4WE1A 1XK8A 2BE7D 4ZLPA 4B9TA 1DTQA 2M70A 3X1LB 1LWEA 5IV4A 2E5IA 1S76D 3H5XA 1KEKA 4M94A 3UVJB 3H4DA 1Q7YT 3JAMU 4IOAQ 3NGKA 4UY8T 2V6AA 2DHSA 5EWFA 1S49A 4ECQA 4PWUA 2IA0A 4TY8A 3VAHA 3SZ2A 2J7WA 3D54A 1UA1A 5GAHI 2DNHA 2X1AA 1OMSA 1R3NA 1VQKS 2PI5A 5KFMA 1RDRA 4P71A 1KRPA 5A8RB 5FLXY 2YKMA 4EU0A 1V5VA 1WC6A 2RJZA 3C8YA 5I4MA 1SCJB 3FVYA 4HR2A 3AT1B 4P7VA 3T6BA 1HNVA 3J7YU 3FDSA 3PVXA 2ASYA 1HWJA 3NOGA 4NRUA 3IAM9 3ETMA 2AW0A 3MMCA 4C48A 1TFWA 1T9TA 1FXLA 3ONQA 3BN7A 1B0VA 4L72B 1JLBB 2DNKA 2Q6BA 5H9FK 4KH1B 3M6VA 5IT4A 5HAOA 4F4AA 3ZZUA 3GV7B 3BO4A 4NZ0A 1ZAWA 2CPDA 2RKIA 2ZJPQ 2BQRA 2CQ1A 1QUVA 3GJSB 2DD8S 4MK8A 3K5LA 1GXTA 4L75A 5C7PA 3T9NA 4GKJJ 3CVKA 2VKZG 3E8OA 3K2YA 1UFLA 4FXVA 2Z8QA 5T7LA 3BGRB 2YH0A 3LAMA 4M63A 2HFNA 3HFZB 5D0HA 3ZTOA 3FGVA 3DOKB 1Z2ZA 1QAJA 4C8OA 2XY5A 2OP5A 3THTA 1N56A 1SUQA 4CQ1A 3QJPA 5KG5A 3GJQB 2HLUA 3R3TA 1S10A 3M8PB 2KG0A 1IWAA 2J9CA 3F56A 3JSMB 2QYGA 2J9DA 2JFDA 2R8HA 3JYTA 3NNAA 3TZYA 3TX8A 2EBEA 3UWTA 2IC3B 2D1CA 3OL9A 1N33J 2J8SA 5D0RA 3HSDA 3CD6S 4PZVA 1TL1A 4U7CA 4AXJA 2LU2A 3LGHA 4K50A 4KIAA 3QNWB 3V6DB 3PRDA 4FYYB 2R2TA 3K58A 2OKQA 3FEZA 1UWAA 4GO5X 5HJYA 1U25A 2MQQA 2ZH9A 1DTTA 4FF2A 4P74A 5BYRA 3LQVA 3FMWA 3MMBB 3HSZA 4OYIA 3TA2A 1NDPA 2QMXA 4ZPDA 2RHQB 2FC9A 1I6JA 1EQ0A 2RS8A 2I8EA 3BN4A 5AXNA 3KHGA 4CYUB 4OFZA 4JYAJ 3CJ5A 4ZPCA 4OYBA 2LXUA 2XS2A 4HT7A 5ETPA 3GYXB 3EVOA 4LFAF 1K1SA 1QTNB 5F8IA 4YY3F 3HSGA 4LF2A 2POKA 3U1LA 5H9EK 1H98A 2MZSA 4YB1P 1MMNA 4C4WA 3IAS9 4AQYF 1R31A 2IM0A 3PG9A 4ID5B 3W9IA 3PYEA 5ETQA 2E7VA 1VQYA 1FWKA 4KRWA 4CO2A 2AYEA 3GG0A 3WC2A 3BH7B 2PMHA 3GZ7A 4ITSA 2OELA 2HNZA 1PJ5A 2ROPA 4DU8A 2V8GA 2VICA 2IIHA 1EETA 3W65A 4DBQA 5A8KA 4DEZA 2ILZA 1J5EF 2WVDA 4MKVA 3HVAA 1HBOB 2E5JA 2HBZB 5IQ6A 1TK0A 2FLLA 2OJ3A 2HQGA 3AODA 1NK4A 2ZZNA 3DI6B 1Y5LB 2XO6A 4LRBA 3ZZOA 2QL5B 4Q5VA 4DF8A 1S0NA 4RW8A 3EVWA 3D7SB 2M0GB 3RB0A 3FSXA 1UETA 3MM7A 5C25A 1RWUA 2ZHAA 3D0IE 3OW2R 1CULB 4NEZA 2JJ4D 3RG6A 1RYRA 1XR6A 1Q7LB 3TUZC 5AXLA 3VAKA 4UY85 3IM8A 2BANB 3O3LA 4CT9A 4CT8A 5KOXA 1JLCB 5CYQB 3F41A 1AFJA 2F8EX 1OWXA 4O4RA 4NZ7A 4B9LA 2LEPA 4U9RA 2IMWP 1QVFR 2V9WA 2KG1A 2HFZA 2UU9J 2Y8WA 4IQMA 2YWWA 1U8WA 3DDIA 2CAJA 3VR1A 1P8GA 1CJUB 3CJRA 2XHWA 3OR2B 4CLFA 4DMZA 3AD8C 1XEZA 2WBMA 2XHCA 1NKBA 4NLTA 4NLOA 2RF2A 4DV3F 2HHUA 1GTHA 3GFXA 4N77A 3D5MA 1HA1A 2P9GA 4AL7A 2RB7A 1IBLJ 1I1GA 4QPTA 3DNCA 4LR8A 1T94A 3NS6A 1JK9B 2AGPA 2EG1A 4IG0A 4UOCA 3V81A 2DRBA 3PFEA 4PUOB 3TAPA 1O5JA 2V2QA 4QWBA 1VRQC 2F9DA 1YRUA 1S1WB 1XR7A 1HNXF 3QRQA 2E1AA 2Z2LA 4FF4A 1T9WA 4AXIA 4ZPVR 4KGZB 3ZNUA 2MKYA 1X4CA 3PXGa 3EZOA 3IFEA 1T05A 3DLKA 3DRYA 1FKOA 3MR6A 3ENWA 2OAUA 4NXMJ 3W64A 1H38A 2VA3A 3GFZA 1P9YA 3MMAB 4P2SA 1Y7PA 3R2DJ 2B43A 2CNNB 3FZBA 2VG7A 1UWBA 2AHOB 1S9FA 3I55S 1T03A 4JI4F 4RW6A 3MM9A 2QA1A 3DN9A 2FHMA 5AXKA 1FK9A 4LF8J 1F5CA 4EZ9A 3W9JA 1RWPB 2E1PA 3C15B 4PYAA 2R2RA 3T1HJ 1IBMJ 2B5JB 3BS9A 1LEOA 1N0UA 1GK8A 1A6LA 3HX9A 3CTRA 5IZHA 2FVRA 2E9ZA 1RBOB 2PEBA 4PRFA 1I51B 2FJEB 3B54A 1FVQA 2GIFA 5KFXA 3CC2S 5CH7B 4KV8A 1WEZA 3EX7B 5HMXA 1QSLA 4RR5A 3DOLA 5G0RA 4ED4A 3CMES 4RW9A 1VQ8S 3JQKA 4CI0B 2AV5A 4ZVHA 3W2VA 3IC1A 1RAEB 2W01A 2ZJQQ 1NK6A 2G0IA 1C4AA 1BUXA 1SC1B 2G1DA 2RUSA 3NCPA 3TVYA 2XULA 2DR7A 2KDOA 2DHHA 4QBUA 4FP9A 2WW4A 5I3QA 2KH9A 2XNRA 3NY0A 1JXEA 1VBYA 4X4RA 2DEJA 2DHXA 1PYOB 1DY3A 1TP7A 2DNPA 2CDRB 5IV3A 1FXRA 3K89A 3Q23A 2KJWA 2R7SA 3MCOA 3K57A 3W5ZA 1HNZJ 3AD7C 1YVFA 1YJ7A 3TNVA 1RTZA 2OEMA 5I42A 4EO6A 4TVAB 4BWJA 1OJ4A 5AT1B 4KFBB 1E6YB 2CWXA 2WONA 3R7SB 1NZAA 1M5HA 4G1QA 4NYPA 2KN4A 1UVKA 3GV5B 4UT4A 1S1UA 1VK8A 3KWMA 3FMBA 4H4KA 4FYXB 1LW2A 2L48A 3I82A 1R6YA 1RABB 3AY0A 5K5MA 3V5RA 1BXNA 1N54B 2QFJA 3M4XA 1WSRA 1T9XA 1RP5A 3D3BJ 1VBZA 4DSIA 3W63A 2NREA 1H3DA 5C2CA 3OVAA 3HVRA 3IS9B 1LK7A 3WX4A 1RHMB 5CHCB 2KVQE 3BYRA 4NA3A 4OJ3A 3G87A 4X66F 5CCLA 5EWGA 2YWFA 3N28A 4PABA 4ZJQA 2A1BA 4XDCA 2QZ8A 1ZZNA 2ZEJA 3RB4A 2A2DA 3DFEA 3GR1A 4DX5A 4MKAA 5KFNA 4J9NA 1EARA 2RD5C 1WF2A 2DHAA 2L9WA 3FZ2A 4P72A 1FJ7A 5E33A 1SH0A 3NBPB 5LXRA 3TQEA 3HMJG 5F8GA 3G6VA 2VOPA 2BE2B 4ZP6A 3BDPA 4MYTA 2AEJA 3I4PA 4PXDA 3DYAA 4PEOA 4ZA1A 2DXDA 2VPZB 3TOQA 2CJ9A 3DGPA 1VRTB 2KB2A 5KFBA 2AJ1A 1HR0J 1VQ9S 2GGPA 1FI4A 2NSCA 3IBCB 3MI7X 4Y2MA 3I32A 3ZZPA 3A8IA 1LWFB 3CO9A 2VL1A 1NM2A 4O3RA 1M1KT 4LFBF 4J9QA 3V6JA 1WOSA 2GA7A 4CLTA 1BQNA 3L7PA 4DX6A 1OSCA 4NLVA 5KFCA 3T1HF 4X65F 3J7AN 2KZMA 4DFMA 3OQ2A 4JI1J 4Q8EA 1TAUA 2H3EB 1TZ0A 3FBEA 4ANEA 2C2DA 2UXCJ 2DGUA 1APSA 2QO3A 4CO4A 2F40A 1RWXB 1Q8LA 4DPTA 1S1VB 2HS0A 4QIWD 5KG2A 4TNOA 4QU7A 1PC5A 3SDEA 2NS1B 2R7OA 2KU7A 3A1YG 3FCVA 1QSSA 1F3VA 1FX2A 2NPFA 4V19J 1N0VC 2MTLA 1RHJB 3PACA 2CJQA 3GYNA 3A8KA 1RHKB 3NKYA 3SFUA 4YS2A 4ZIWA 2W7OA 4EGLA 3RTVA 5F8JA 3Q8VA 4CO3A 1HI0P 2M88A 2CQHA 5LT5A 4HI2A 2BACA 1FXDA 3N9UC 4F4ZA 1VC6A 1CJTA 1WG5A 2D3O1 4USHA 1TKTB 5B0GA 4RW4B 5KOWA 1KNZA 1XBWA 3DLEB 3K0JA 3SQGB 1ZPVA 3M8QA 5LMUJ 3CJ2A 2JRSA 2B9WA 5IWAF 3HHLB 1K9MT 1T02A 4URSA 2N4CA 1JLQA 4QYZK 4DV1J 3BO2A 4URQU 4C2MA 1UMJA 1ZOTA 1Y0HA 3CCQS 2GJIA 1X4HA 1PJ7A 2CVEA 2GO9A 3DKDA 5A76A 4ED5A 3A12A 4OI0A 1O51A 3KK2B 3MAAB 4ZPTR 3JS9A 5IS2A 1ZM2A 2HHSA 2VPYB 3D1HA 1FWLA 1TL4A 2NYHA 1F9EB 4K0KF 1VRUB 3KLIA 4DUYJ 4K4XA 5ETLA 5HP1B 4M5DB 1QE1B 2CJXB 4JI8J 5J1EB 3TZWA 4DV6F 1TMJA 1PG5B 2HNYB 4HL9A 4KGVB 5MAOA 1Q8BA 4PG4A 1UW4A 2UXDJ 1MG7A 1OQ6A 5EHHA 3OUYA 2C3MA 3K8WA 1FX4A 2CJYB 1R8AA 2VF3A 3M8WA 3TVKA 2HIQA 1SJQA 4LF1A 1GMWA 1IR2A 3QFHA 3RBXA 1KHWA 2E9TA 1N6QA 4OYOA 4EZ6A 3MOZA 1SIZA 2RQMA 1TVRA 1FNOA 1MNEA 2BJ7A 1C2PA 2YXLA 3CD5A 4IG3A 5J2PB 5JMNA 1J2VA 1RJJA 2I1RA 5LM7E 1E6VA 1P9QC 1N5TA 1F9HA 3OFEA 4OZ2A 3MEKA 2EK1A 4B17A 2ATCB 3D1QA 2MZRA 3MFIA 2VOOA 3FKBA 2UZAA 4NA2A 4ZVFA 4KHPJ 4R8UA 2BBEA 2XY7A 3VF0B 4BBYA 3AH6A 4WE1B 2ZH2A 3RRGA 2JVOA 4OLOA 1PCAA 2FHJD 2BUNA 2V69A 1YWXA 2RU9A 4HVZA 4MT1A 3CJKA 2N3OA 1LWEB 3H40A 4DFJA 1SC3B 2KL8A 3IRWP 5CYMA 2MQ8A 3ET6A 1NDCA 4LSNB 1FDNA 1EHWA 3OBIA 5HANA 5JXSA 3UVJA 4EFAC 4OZ5A 4QW9A 4R5PA 1KBRA 5HQMA 2K1RA 2XM3A 1N34J 2AP6A 4I6AA 1OIAA 4TY8B 4PXCA 1Q78A 2CPJA 2AU0A 2UVWA 4WFBQ 1WUUA 2E7WA 4WP8A 2WCXA 3CPWR 4R25A 1F2GA 2CIMA 1EP4A 1M5KC 3UDLA 1A0OB 3G2XA 2YKMB 3HM9A 5CD4H 2VA2A 1RT6A 5KTQA 3L3CA 2KXNB 4A4JA 1S6QB 2HLTA 1VQMS 1JWWA 1HNVB 1RHUB 1GX5A 1WC1A 3RAQA 2VV5A 3FBFA 4IO1A 4LVOP 4F3MA 1VC0A 1EKRA 3TEHB 1BHNA 1U2RA 3CMQA 2N7YA 3D1OA 2WB1D 2BKOA 1X5SA 4O44A 4ENOA 3GONA 2W8KA 4KPYA 3DM2B 4QWEA 1LOUA 2WVBA 4OMFG 2RKIB 5F9NA 2A10A 3TRGA 4FKXA 2OHDA 5A2QU 4I2QA 2RE1A 2RDDA 3R5GA 4H4KC 3KLVA 3VVTA 1U1LA 1OPIA 3QRRA 3Q8UA 2QMWA 3JTPA 4CDIA 1YX2A 4DR6J 4UQGA 3BGRA 1WC4A 4YFUA 1J27A 2HHQA 4DV7F 3Q24A 4B9VA 3DOKA 3Q8YA 5D3GB 4DX8H 4B08A 5HVFA 1T9UA 2P5VA 1D8YA 1L3UA 3EGNA 1SXLA 1U6ZA 3D2WA 2SXLA 2DHGA 3JSMA 3GTYX 4MYUA 2E5HA 2JNJA 4FNHA 2M7SA 3QIPA 4UOFA 3UE2A 1VBXA 2AYMA 2ZUGA 3B78A 4CTAA 1RAAB 3LW5C 2K8GA 4A47A 2R8GA 2KI2A 2YNGB 5F8MA 1KTVA 2CQIA 1K0VA 2HMIA 1S59A 1U0HB 4NL5A 2H65B 4MMOA 1MROA 3MZIA 3D68A 1FNXH 4DU7A 3V6DA 2ZFHA 1SV5B 4USKA 3QAEA 2E1CA 4LFCF 3BH6B 4NLGA 1FA0A 1HQEA 1XERA 4PQAA 1BLUA 3R5CA 5ETVA 2I6WA 1JIHA 5KT5A 3P4UB 4X4QA 3K17A 1XWLA 4NXNF 1BD6A 2Y1RI 1S9EA 1KN6A 4CH1A 1SC4B 4DR3J 1BY9A 4JP8A 4MIBA 1C4CA 4I2PB 2HVHA 3MUVP 1FTCA 4F04B 4I68A 3CCUS 4NCBA 3HSJA 5E3AA 4CYUA 5IOLA 1YDLA 2BQUA 1KOOA 3OTCA 2QTWA 5IC4B 1OY6A 5KG0A 3CNQP 3AB4B 3KG1A 1ZA1B 1KKHA 2RQKA 4CRJA 2NUHA 2BJ9A 1RISA 4Y34A 1HHTP 1S6PB 4WU3A 3QBCA 3WBZA 2OI2A 2KT3A 1M1HA 2HZAA 3IXQA 1RTDA 3ITHB 2DGSA 3NMAA 6AT1B 4ID5A 3CF5Q 4CLZA 2ZBQA 4WFAQ 2CPFA 3M9MB 3RZAA 5KT2A 3M9OB 3D28A 4ICLB 2AEFA 2DB1A 3KJQB 1N34F 4DG1A 2HNZB 3IGNA 1KFSA 3G8TA 2X7IA 3R5BA 9RUBA 1WI8A 2ZBCA 1EETB 2HAIA 2W2OP 5B0CA 4ECZA 2DNLA 3DXBA 1XNRJ 2XZDB 1RYSA 4NASA 2IVYA 4QWDA 3ENVA 4JI2F 5IT0A 1PKUA 1WHWA 3HXMA 2QSFA 1VQLS 1LW0A 1WJ9A 4RW8B 4DFPA 3C6TB 4USIA 5G4DA 1D9FA 2COLA 2ZBPA 3CCMS 2KO1A 1CJKA 4DR2J 1MLAA 4LBPA 1CULA 1KTQA 4DXLA 1X0PA 3SQOP 4ER8A 2BANA 4LT6A 3OLBA 3L09A 4M5JA 2HWHA 2O3DA 1JLCA 5ETMA 4F3QA 4UOGA 1FERA 1M0SA 1ACMB 3E01B 3CJ3A 2V34A 3C6UB 3GIRA 2PA8D 2IRYA 4F50A 3CC7S 1NSAA 2ZC4A 3EICA 3CC4S 2B51A 1JKHA 3KLFB 4YOEA 3WQPA 4DUZF 2FD2A 3OR1B 2C2EA 3K7RA 4U7UD 2AJ0A 2C2KB 1CJUA 2I38A 3A4TA 3LUYA 4CLYA 4JI7J 2DPIA 2ZVIA 4DSFA 2JVRA 3K5MA 3PYFA 2RF2B 4ANCA 5DM7Q 1VLOA 3AXMA 3OTBA 1EQMA 4KHMA 2YX4A 4ZVGA 4MIAA 3KUHA 2IY5B 1KS2A 1TMMA 3IGVA 3J80U 2BEFA 4CH7A 3BO3A 2WW8A 3UD3P 3TWZA 4IG0B 2G1HA 2V0NA 2LXFA 3V81B 3DRXA 1KWMA 3CDAA 3PJXA 2AQ4A 4WP9A 1S1WA 4HH1A 2R7XA 1TUVA 2BDPA 3HI9A 3GR0A 1Z4UA 1RTIA 4U95A 2AMCB 5DGAA 2MYFA 1NLKL 4URGA 1T05B 1L5UA 3QIDA 2RILA 5CABA 4KC5A 4HACA 4ZPBA 2MB0B 4HHUA 3ZXWA 5K8OA 1VHIA 1WWHA 1X9MA 3MMAA 3UCUP 4HT5A 4RNNA 4DR3F 1UZHA 2CQPA 1UWBB 1TKXA 2Y1LB 2CWKA 1WEYA 4NA1A 3TAMA 3FJ2A 2DGOA 2X1GA 4QR2A 2DJWA 3VTIA 2LDIA 7FDRA 2JH3A 2FZKB 4RW6B 2CQ4A 3PJ9A 3BGFA 2ZE2A 1SQGA 4ERDA 2X3DA 3C15A 1F60B 4C7QA 2B5JA 1UVNA 1SH2A 1BC6A 3J81j 1IKYB 2KM8C 2C42A 4ES2A 5LOQA 4USMA 1YJ9S 4P75A 1HNWJ 3CD0A 1TQLA 4KV8B 3X3UA 4Z37A 4DSLA 2F8MA 2MSTA 1UEUA 3SSQA 1RT3B 3VAJA 1HBNA 1NPKA 1Q16B 4J9VA 3BB5A 1T9VA 3DOLB 4MTPA 4DZDA 2MJUA 1S4EA 2V4JA 2XMVA 2YQ3A 2ZUAA 3W2VB 2VQFF 1KLMA 1X31C 2CQ3A 3JQJA 5HO4A 3H42A 3SV4A 4NYOA 2ZITA 1AFIA 1TKDA 3N6LA 4ID8A 3T1AA 1RUSA 1LV5A 1Q81T 1G1XA 2YKQA 2HFOA 7FD1A 4IRCA 1YI2S 1H7WA 5D77A 5D0GA 4JOUA 2UUAF 1DRZA 2HQ3A 2BX6A 1JJ4A 2L3MA 2OMLA 3CIZA 2MQNA 3TUIC 2W9BB 4JYAF 4E98A 2YH1A 1H72C 5D15A 1U0SA 1NDLA 5I42B 2RQCA 1F1BB 1YZ6A 2HFSA 3G86A 1FKAF 5DQIA 1CVJA 2Y0SD 5IWAJ 5AJ3F 1N88A 1E6YA 4QIGA 2WONB 3DDNA 2BVZA 5DDRC 4G1QB 4WIIA 2CADA 3CDWA 2F8HA 2V50A 3PKMA 2LA4A 4C98A 3WIUA 1S1UB 2ALYB 2HPUA 3GCXP 1RWNB 5KFKA 2R8JA 4MJKA 1LW2B 3PIPQ 1S6UA 1RHQB 3DLBA 3PYGA 2UP1A 3Q0AA 2VU5A 1KQKA 1KQFB 5HN0A 2XB2D 3O5TB 2VUGA 2VQEF 3TI0A 3IS9A 4TY9A 2ZZMA 4DR4J 4DV0F 3LP1B 4LF9J 1W26A 4DN9A 3DC2A 5GADU 4MKBA 3EGZA 2MZJA 1B7FA 4ZK7M 4E2FB 3PRVA 3BGUA 3B82A 4QJVA 2QN6B 4TLRA 1BQXA 1N36F 2V2KA 1FRKA 2HVEA 1QAXA 1QDUB 2B6AA 2YKNB 1KFDA 4L73A 4LRFA 2LECA 3FNNA 2E44A 1G4CA 2O67A 2FVQA 3AJ2A 4CZCA 1GFWB 3ZZ0A 4OYXA 3O8WA 4B02A 5KT4A 1XMQJ 2ALZA 4LF5J 3CDEA 2GCFA 1HBMB 3DGPB 2WBRA 1VRTA 3FBCA 3KKFA 5HI7A 3QGPA 1OPZA 3S8SA 1B0TA 4QWAA 2V67A 3LWMA 2XMMA 2GGPB 2DT9A 5L1JA 2MQOA 2ASDA 2P8IA 2VDHA 3DHWC 2DISA 4KR0B 4C0OC 4J9LA 2Y9HA 2Z56B 3G8QA 2BJDA 2XQCA 3RAXA 2IPOB 3GILA 2RS2A 2XLJA 1TR0A 2JLFA 1PAUB 3BQ1A 2DIUA 4JI8F 2PMWA 1HPZA 2GQQA 1XMOJ 1X9SA 2BRKA 3RBDA 2DKOB 3Q86A 1RT1A 2AGOA 1O0PA 4ZVEA 2MKJA 1RQ0A 5B0DA 2V2ZA 4DV5F 1QAYA 5DETA 1KD1T 3UNYA 4JI1F 5KFAA 4GC7A 4H4MA 3BGLA 5IC6B 1IBKF 3T5HA 3T1YF 1TTHB 2CG8A 4DQQA 1CEZA 4OX9J 4OX6A 3MTJA 2J0WA 5K20B 1H0HB 3OJUA 3G96A 3NGRA 4K4VA 2CNLB 4AL5A 2EI5A 3Q2SC 1FFWB 4J9RA 1CJTB 1R6VA 2WVEA 1P6TA 1NB7A 1K47A 2IYIA 4WFNQ 1TKTA 1WACA 3D6HB 4CLUA 3D6TB 1F9FA 4PR6A 1K44A 3SI8A 1EX8A 1U1QA 1ITPA 2CPZA 3HHLA 2ACYA 3HULA 4EK2A 1JLQB 4NCAA 4EMDA 1JLEA 1Q5VA 1XQIA 1X60A 2FB0A 2HVDA 2MMYA 3AD9C 4WU2A 2MZ1A 2ZH7A 1G6BA 2DR5A 2X3GA 3M32A 4R0JA 4QYZJ 3TP2A 3W5XA 2B56A 4M5KA 3H25A 3D67A 4CLPA 1TV6A 1VOMA 1X4AA 4F26A 4Q44A 3KK2A 4N41A 1F3FA 1VQ7S 4NLQA 3TJ8A 1CQNA 1FRJA 3OL7A 4C3MA 2HHXA 2MQLA 2BOAA 3VVUA 4CIOA 4M5DA 4DUTA 2KZZA 2RDJA 1R0CB 2ZDOA 5KFGA 2HNYA 3OT9A 2I0XA 2J0SD 1D9AA 4KGXB 3OUYB 1CC7A 1KQGB 2DY1A 1RHRB 1VK3A 4PWDB 5HQ8A 1EB0A 2YWKA 1G2EA 1TELA 2MKSA 3FC9A 2QEXS 4OJGA 2ZM6J 1HBUA 1N6QB 2MHEA 3VZHA 4D3GA 5GAGU 2G0JA 3KG4A 4A8KA 4LQ3A 4ZPWR 1TVRB 3H5SA 4IG3B 4IQXA 2M8DB 3UFCX 1SL1A 1B4SA 2P6SA 1V5IB 2BMBA 1WOOA 1D0EA 1HNZF 4CLWA 5GAHU 2GAHC 1N36J 4ELVA 2CJKA 2EG2A 5E3CA 5J2MA 3QGIA 1WELA 1LXJA 2E7XA 4R0EA 4R8UB 1YJUA 5KAKA 1TFYA 3HF5A 4X4NA 3CJKB 4LF5F 3CIMA 4RUCA 2DNQA 1CPZA 3EWGA 5BR8J 4DL5A 4JI5J 1S1XB 5CYMB 2C3OA 2V5HG 3ET6B 4LSNA 2JZ5A 4QIEA 4DV4J 4DL6A 4LIWA 2LQJA 4A8YA 2ADCA 3DLHA 1XMBA 4C11B 4R5PB 2K1RB 3H98A 5L1KA 1BWEA 4ATNA 1KR4A 3UO0A 3BR8A 1UJ6A 3MHYA 4YN3B 4ZP9A 1AZSB 5DRKA 4DQSA 3GIKA 3V6HA 4K4SA 4ECVA 1BWVA 1EP4B 4N8OA 2J0QD 4KBIA 1BE4A 2RQ4A 5E3RA 1JB0C 1N5SA 3AXKA 3OSNA 1IJFB 1NK7A 4LF7F 1RT6B 5K8MA 5IM0A 5DQHA 1GMWD 4I64A 1VFJA 5K14B 1S6QA 3HT3A 1VHFA 1L3VA 4WZMA 1GTEA 5L8RC 1S0VA 3PCOB 1YJWS 4K5RA 5BXIA 3MURP 5KFWA 2Q3PA 3NP5A 2B4VA 5HVHA 3SCIE 1FESA 2WOMB 1RBLA 2F9JA 3UPFA 4LR7A 4OZ0A 4O44B 1C0UB 1CSJA 4ZVPB 2XYGB 3DM2A 4J91A 3TVZA 4DQRA 1VJQA 2YWEA 1R8BA 2ZKUA 4X4TA 3T5LA 1UA0A 1YJTA 3PO5A 4RBVA 2PN6A 1IVZA 4I2QB 1VI7A 2UUWA 2GHWA 5LL6d 2MDAA 1Q53A 2M8HA 2B8PA 2MXYA 3WX8A 4XIUA 3WC0A 1ZETA 4HLBA 1RGVA 1VIOA 2AGQA 2W1BA 3VHQA 3GG1A 8ATCB 4ZPAA 5D3GA 5DLGA 2XMKA 1DJ0A 3RBZA 4NZ6A 1N8RT 4YUDA 4UUWA 1LK5A 2HS4A 2VC1A 3GSIA 3I9ZA 4O0NA 2IYGA 2AJ4A 2NXNA 3H20A 4NCGB 3Q8PB 3GIJA 1T3OA 3QIPB 2UXCF 3GWCA 2NXEA 3A8EA 4CTAB 2CJAA 4A8SA 1M5OC 2YNGA 1FJEB 2UU9F 5F9LA 2HK2A 5I3PA 3RRKA 2HMIB 1U0HA 5D8HB 1JJCB 3CJQA 3UDEA 5IFMA 2AYGA 1XR5A 1MROB 4NOHA 5CZXA 3P49B 4CM0A 2QJ3A 1SV5A 1JXVA 4LUBA 4HEA9 4NLWA 2HZVA 1HQEB 2EFNA 2Y1JA 4XAKA 1SKWA 4DQPA 4PQUA 2D41A 2RVJA 3L9ZA 1HWLA 3ZC4A 2ZM6F 5DLFA 4WBFA 1N48A 2N7CA 3PX6A 2OTJS 1S9EB 2EFOA 5LMUF 3CW2C 1RCOB 2OPPA 1S0OA 4DL2A 4I2PA 1U26A 3ISNC 4MH8A 3QFWA 4E8UA 4JV5F 3UD5A 1RBAA 2H4YB 5M2PA 2PFDA 3SEOA 2FLOA 2ZOGA 4NMLA 4ECWA 3EXYA 4P7TA 4IYQA 4Y2IA 1VIXA 3KTQA 2R3VA 3TARA 2JEFA 4O3NA 4CH0S 1S6PA 5ETSA 4CLSA 8RUCA 1S0MA 2XS5A 4LBIA 3W3SA 1RTDB 3SSRA 3AB2B 3ITHA 4DPYA 5A6WA 3Q2TC 4DUYF 2V9KA 4JB8B 5GAEU 2H48B 2LEAA 2GFFA 2ACMA 2AIRB 3QO9B 4FZVA 4ICLA 3G8SA 3PV8A 3MCSA 4TYBA 3BKTA 4U8VA 4K4TA 4DG1B 3HPOA 1RAFB 2G13A 3A3NB 2ATLA 1L3TA 1J5OB 4B3TF 2R7VA 4C3LA 4ED1A 1X9WA 3JXOA 2KRBA 1RAHB 2LFVA 3QT6A 2DNNA 1Y11A 2NCKL 3D0HE 4HI1A 5KG7A 5FDLA 1IQTA 2XI2A 2HW3A 4Z2XA 1LW0B 1UFKA 3UD4P 1ZM9A 1V9OA 3C6TA 4OHYA 2CKWA 3BGOP 2R8IA 4L6V3 4USTA 1HLWA 1UW9A 4UTGA 1TU0B 3LP0B 1CJKB 1URRA 2OIHA 5A0YB 2V8HA 2DH9A 1UEKA 3GSDA 2DRDA 4EUVA 4IUFA 2I5JA 3E01A 4LF6F 3C14A 2OTLS 3H5YA 2XMJA 1AROP 1X5OA 3C6UA 3R5DA 1RWVB 4K2JA 5L1LA 2FJWA 4NXMF 4QIVA 1FO1A 2ZD1B 4DPXA 2HHWA 4DPUA 1JKHB 4UUXA 2K3IA 3RYLA 3KLFA 4C8YA 3OR1A 3W5YA 2C2OB 2P9CA 5AJ3J 1TUGB 2F63A 1JQGA 4M8LA 3O2IA 1QM9A 2IFXA 3CWJA 3GMGA 4OHWA 4J9PA 1BQMB 1HNWF 1VBKA 3MEEB 4QYRA 4B3SF 5E3QA 2ZH8A 2KHCA 2RH3A 3CD7A 3MPUB 4DDFA 2D3OR 1WTBA 3VAIA 2VQEJ 1U49A 5DGBA 3CCLS 2RHSB 3N0VA 2FZCB 3FEXB 4J7CA 3RB6A 4JV1A 4PWWA 1LWCB 4DN0A 1UKUA 3VAGA 4KPCA 2GAGC 2YTCA 4D3HA 3FSIA 1R43A 1RTIB 3BYPA 3IWLA 3OTOJ 3EE3A 1RB0A 3MAHA 4I6WA 4DCOB 5HQLA 1DZ5A 2O5DA 3QPIA 4HACB 1KOHA 4PCQA 3W1YC 4RUHA 4TU8A 3GIIA 3CGIA 3ZZYA 1LFWA 4C8KA 4OLPA 1YBTA 4N76A 1H74A 3JSYA 4RWWA 4YHHJ 4OV1A 2VD3A 2JC0A 4DR6F 4PPDA 3MF5A 1TKXB 4LRCA 3TAMB 3OXGA 2H5EA 2HFVA 3M1VA 4IH6A 5GADI 5B0FA 3UCZP 2XWYA 2CPXA 4RO0A 2DEIA 1WKLA 3R7NB 4ZLJA 4ZN1A 2ZE2B 4A8WA 3M6UA 1YJVA 4RWXA 2J76E 2ZHOA 1O8BA 2FUG9 3GQCA 3PDNA 5LSRA 4MFBB 1IKYA 4KE5A 1ICEB 2IM1A 5M2RA 1X4GA 4N7TA 4OI6A 3EPGA 4RU2A 4FXDA 4XK8C 3KYLA 5KG6A 5AXMA 1SBRA 2DNMA 1ZAVA 2JFKA 4KGKA 3PZPA 3AJDA 1RT3A 4ZLNA 2LYVA 1HBNB 4DV0J 1HNIA 1SQEA 3DOMB 3R5JB 1K73T 1L3SA 2DO0A 2DVIA 2V4JB 4PG6A 3QQCD 4Y28C 2C2RA 4NE9C 2YWHA 5B7WA 1KLMB 3MM5A 2JDJA 3TX0A 4DR1J 1PGZA 1X4FA 5C5JA 4EEYA 4X84A 4LFCJ 4C0HA 3AHPA 1HW9A 3J81U 2GW8A 2OD4A 2YNIB 2UVVA 4OX9F 2DCLA 2DH7A 1RTHA 3ICLA 1U8SA 4NMXA 2IRXA 3IRXA 3UCGA 3WIVA 3ZFVA 3Q8RB 3I4HX 2JL9A 3BDEA 1WSVA 2DGQA 2W9BA 5J2QB 4O3SA 3CEDA 3MPDA 5K9FA 2K7KA 2NQPA 1ZYQA 1IJEB 3W2WB 3MXHP 1NH8A 4C0BA 4WKRA 3AA9A 1LQ9A 4P10A 1XNQF 1DQ9A 1C1BB 3BZQA 4GVLA 3VAFA 2QA2A 2ROGA 2FGOA 3KDNA 1U24A 2M5YA 4Q43A 4LFAJ 5HLFA 1T11A 4AL6A 1T7PA 1XMOF 3HZGA 2PD1A 1FKPB 1S48A 9ATCB 4DR7F 3HHLC 3SMZA 4JI6F 1OO0B 1ZA2B 5ETTA 4F0MA 2ZZTA 4ED3A 2W7PA 1NXIA 4WTOB 1NKEA 1X4EA 3E2EA 4HHHA 4WF9Q 2H9ZA 4LIRA 1FFGB 3POTA 3LP1A 4IH5A 2FTRA 2ADBA 2BXJA 4P9SA 3TZZA 3M6XA 5L39A 2IBKA 3PHEA 5JVHQ 4C6AA 2FY8A 2KKHA 2O01C 1B64A 2F4FA 3RGIA 2B4PA 3TA1A 3IP0A 1Q0NA 3CMAS 1PIEA 1J5EJ 2KFYA 5KFIA 2RRNA 4OYWA 1IKXB 3G82B 5DQGA 2B6AB 1K1QA 2YKNA 2NZ4A 2I2YA 2DY9A 2WTFA 2KJVA 1S12A 1T8EA 2VFUA 5HROB 1RWWB 2BKNA 2H1YA 4HYKA 4KGMA 1HBMA 3EDRB 3H0PA 1U1RA 4LF4F 3NEKA 1ZM4A 2VFVA 3QSIA 2GZOA 2KVIA 2W2MP 4BWMA 3MEGB 4XPCA 3S7RA 1HYSA 1K0TA 3Q8QB 2YPYA 4WK3A 1SKUB 3I5BA 2LLZA 2LQ8A 3T9ZA 2HBRB 5H1SV 4X4UA 1WOPA 3LALA 5LSOA 1U2CA 4LSZB 2V8DA 1WNEA 2GMLA 2FLPA 4BC9A 1YK9A 5IT9Y 2YNHA 1S7IA 1IXKA 1FVSA 1I3OB 1UFWA 1HPZB 3R5AA 1RT7A 5F3ZA 4C8MA 2DR9A 4F8RA 2LCWA 5J1PA 1Q95G 3CCZA 3J80Y 4LMZA 1RT1B 5LJ5Y 2YKPA 2FY1A 5DJBA 4FDFA 3PM9A 3K5OA 2FVPA 5LXYA 1DLOB 4GC6A 2DR8A 4H4MB 2FIUA 4FS2A 4DV3J 2HURA 5L9NA 1ZBTA 3CDBA 1GEHA 3D4JA 1MU2B 1NRKA 2IAJB 2V8VA 4N8NA 4NLDA 4OYMA 2ERRA 2BJ1A 2OMOA 4DFKA 2QIFA 3NAIA 4X64J 3LAKA 1W25A 1M5SA 3OSPA 3P5TL 3GE9A 3GJRB 4QCLA 2J6SA 2OLWA 3S6EA 3THPA 1QVGR 5KG3A 4LJMA 4GO7X 2QFIA 4EWTA 1VJWA 4WXOA 3C2PA 1S9GA 1PILA 2P2CB 2HQFA 1JLEB 1LFPA 2ZDPA 2QLWA 3GFHA 3RUBL 4DL4A 1QY7A 2XNQA 3M32B 1B7YB 5EX3A 4NX9A 3NWRA 3GCWP 4C97A 1RT2A 3P45B 2W8LA 1TV6B 2VPXB 1VLYA 2BOPA 1TK8A 5GMKa 4NEYA 1RADB 2YX7A 2EFGA 2J8AA 3BM7A 3OVBA 2BV3A 2Z2ZA 1M90T 3ZZRA 4J9KA 5LSLA 5B0AA 1N5YB 3AAWB 4OZ1A 1OYEA 3N4WA 3HK2A 5B08A 2HRYA 4DS5A 4OI2A 1DFDA 2OPRB 2C1EB 2QA4G 4IFVA 2HHHJ 2MLZA 4W4MA 4JI6J 2VODA 1IR1A 2VQFJ 4PWDA 4I0WA 3UN3A 3GB0A 4TXSA 1DAXA 5B0BA 2KRRA 1C1CB 4S0MA 1HBUB 1YKWA 4DI6A 2GO8A 2E5LJ 4GKKF 5KFRA 1FDAA 1ZS6A 2LQBA 1YBUA 2Z30B 4TU9A 1NPPA 2J7KA 2V2VA 3BR9A 3H4BA 2HNDB 3VV2B 5HBMB 1H6KX 1YITS 2DRAA 4JI0F 4IFYB 3OLAA 3DU5A 3QATA 5M2UA 1U7LA 3PO4A 1AW0A 2OPQA 4ZVOB 3NS7B 2HRTA 2LA6A 3S1TA 2YBVA 1NJXA 4CCHA 2Y8YA 1WG4A 3CJ4A 5J2MB 2HHTA 1Y10A 1REGX 2V94A 1CS4A 2QLBB 1AA1B 2RSQA 2FHJA 2KM8B 1I94F 4M5HA 4ZOSA 4ZKAA 1N4LA 5B09A 1WHXA 4ZIVA 1S1XA 4NXNJ 2OFGX 3PW0A 1AXQA 1NAQA 3J7ZT 2L41A 1FD2A 1T9YA 3MR2A 2IJFA 4C11A 3BREA 2V4RA 1CJVA 3AA8A 4GRSA 3CCVS 2VFRA 1TK5A 3FRZA 1Y3JA 1AZSA 3DHXA 1KVKA 5I3UA 2CRLA 3F73A 1V3SA 1SJRA 5IM0B 1WF1A 2ZBRA 4M5IA 5K14A 1D8ZA 3I5CA 4OZNA 3BKFA 4BLGA 5EWEA 5EGYA 1U1PA 1RA7A 3M2UB 4YDXA 2ZWPA 2DYAA 4ZVSB 2HVZA 2W9CA 2C3UA 4USVA 2H4WB 3NGDA 4B3MF 5A2QY 2KFNA 2XMAA 1S1TB 1R0AA 2WOMA 4X66J 1NSKL 3OXFA 5F41A 1UTAA 1X5PA 1C0UA 5LMNJ 4OZLA 1T3NA 3FCHA 4GVBA 2IA6A 1AT1B 3DDKA 3EDQB 3HHKA 2PGCA 2EFVA 3SFGA 3VQSA 2D9PA 3EYZA 1IBKJ 3DMJA 2OGUA 2DGXA 2Z57B 3NCQA 1EAYC 2D7SA 4I1TA 3KJVA 3L4BC 3GLJA 4I6YA 2VASA 3BBBA 4I7FB 2L9NA 3DRPB 4WKYA 1NHVA 3LTOA 4OQJA 5F0WA 5C24A 4ES1A 4DSKA 2XG8A 1GH8A 3ZTQA 3GPAA 4WYWA 2W2NP 2AX1A 2HKEA 4DCPB 3HFKA 2ZH4A 2QE5A 3O44A 3BSCA 4G6VB 2E5GA 4NCGA 4UF4A 4QU6A 1NZ8A 3C16A 4TQRA 4ZCLA 1JLGA 3I31A 3G6XA 2DNYA 2FVSA 1FJGF 3KUEA 1Q5YA 3I9V9 3WHIA 3H2VE 3JSBA 2ASJA 4DUZJ 3D6MB 2C2MB 4Y00A 4DPOA 2H5IB 1NJZA 4ECRA 2CXEA 3B6BA 3KLEA 4CP5A 1D9DA 1R8CA 3NNCA 1KVIA 4J5OA 4P6QA 1GX6A 2RT3A 3A13A 2OSRA 4TLQA 4C3KA 3F44A 4NI2B 3G4SS 4X4OA 1URNA 3LPEA 4YDDB 4PQUB 4F0HA 1EKSA 2QYCA 2VG6B 2L08A 4OZJA 2KT2A 4P73A 6FD1A 4KH0B 1PAEX 1NHUA 1FEHA 2J9EA 2VC0A 3PEJA 3L7OA 4LREA 5KFEA 1U1MA 2AZ3A 1WDTA 1N5VA 2D9OA 2OPPB 1X5TA 5HMZA 3OTOF 2ZH3A 1NDKA 2BM0A 1N52B 3MEDA 3OL6A 2QRRA 3BSOA 3DRRB 4WIQA 2YX1A 3MUTP 4EBCA 2AKWB 2JWNA 3KUGA 2VBZA 3LANA 3VQTA 2GVDA 3VZIA 5E0OA 3KNAA 1JNZB 8AT1B 2NUUG 4FPRA 2VJUA 2M2BA 2ZKTA 3UN5A 1FRXA 3D66A 5KT6A 2QMUB 1Q1KA 2N82B 5MLCV 1HR0F 1VQ5S 1AUSL 1UVMA 1R8HA 1VQ4S 5AE2A 3IG1A 1RLDA 3PW5A 2HQDA 3RBEA 2W7AA 4YQWA 1OSDA 3QO9A 5KT7A 2GIRA 3HJFA 2G0CA 1BMQB 2IDEA 2N3LA 3KHHA 2EFPA 3G71S 2XLIA 4F4WA 3OJSA 3A8JA 2A2CA 3PW2A 3E3XA 1SQFA 5IQQA 1Y5IB 2EW9A 3QT5A 3KK1A 1J5OA 4IH7A 1N32F 1HWKA 2FZGB 1VDHA 2GV1A 4UQTA 2W2QP 4DV6J 4IR9A 5FDLB 3J7YI 2GJ2A 2QSWA 2V63A 2XZWA 3MR5A 2ILYA 2CYYA 4DR1F 4ECSA 3QT8A 5DZ6A 2JSXA 3PX4A 3N5BA 1GXLA 1WKJA 3LP0A 4DV2J 4IDKB 2WB4A 5A0YA 5F8LA 3FFIA 2FC8A 1Q8IA 2MLYA 2YNFB 5E5NA 1QJHA 1SC6A 3MCNA 3QLHB 4RUBA 4YHHF 2GC8A 2ZH6A 2R42A 3ETOA 4ZITA 4I69A 2PI4A 3HD2A 4X4PA 2I5JB 2UUBJ 3C14B 5D6GA 4ILMA 2CQ0A 3PTWA 1C0TB 2GIQA 3K5PA 3H8YA 4P2XA 4OHXA 2VG5B 3V4MA 2ZD1A 1IUJA 1TAQA 2WSEC 5HATA 2Y3YA 1RLCL 1Y5NB 2R9LA 1EIYB 3C19A 2CQ2A 4CNZA 4O4GB 4F7VA 4BDPA 3AOAA 2DNRA 3A3PB 1CC8A 2M4MA 1AUDA 4Z7YA 3WZ0A 1VC5A 4DCJB 2RUGA 1BQMA 3BPSP 4NYZA 1WC5A 2LU1A 3UQSA 2XY6A 1U6BA 3MEEA 4MIWA 2OFHX 2IRUA 3M8YA 5L38A 4C8LA 3NNHA 3MD3A 3PW7A 4RNOA 1X4DA 2VB6A 2J6UA 3UW1A 4Y3CA 3VGTA 1NEEA 1P27B 1TL3A 4LF8F 5C42B 4PYDA 3CCRS 1NJIT 3GU0A 1LWCA 4Q0BA 1HMVA 1UAWA 2O66A 3P5BP 3BF4A 3L95X 1RAJA 4I56A 3NRBA 4FBUA 3I5AA 4LBHA 4U67Q 2RU3A 4O3PA 4J90A 4ZP8A 1AYEA 3UDVA 5CA5A 3W60A 5DZ7A 3B4MA 4Q45A 4DR4F 4LF9F 3OTEA 4RNHA 2GHPA 3PR5B 4DSJA 3QWPA 3M2RB 3M30A 4ZVQB 1NJYA 1P1TA 1MN9A 3SYZA 5KFPA 2UUTA 5DG7A 3M1VB 2PMZD 1RAOA 3K8VA 1HQ2A 2VJVA 3I96A 2VPWB 5FIIA 3TA0A 3BSAA 2GS8A 1RWMB 2MY8A 5E3PA 3NAHA 4MFBA 2B4UA 1DURA 4M1KA 4JV5J 1QAIA 1OS5A 3OVSA 3THVA 1UJ4A 4P2MA 1HI1A 1UVIA 3GFYA 3PNIA 4FYWB 1D1UA 2MKKA 2NPIA 1OYDA 5A8WB 2B7CB 3HD1A 4IOCQ 2HFUA 3R1HA 1NHKL 1HNIB 2NXCA 3DOMA 2E66A 2ZVSA 3IA0A 5EUHA 2BRLA 3K5NA 2LQ9A 1IKWA 1MWYA 4ZCIA 1Y3KA 3MM5B 5K8PA 1QD1A 2JEIA 4U7UK 2KTQA 3KMSA 2UXBF 2BJ8A 2XYPB 3C66A 3W61A 1RT4B 4C9DA 2XSFA 4DS4A 2YNIA 2R7WA 1FDDA 1TL7A 2QLXA 4UOHA 3MAQA 2QC3A 1RTHB 2MJNA 3S01A 1HWUA 2OO4A 2ZNZA 3IRXB 4U8YA 3UR3C 2CZ4A 2ZJRQ 4X64F 1U1OA 2FHKA 3QMQA 5J2QA 4ELTA 1XTZA 3CDUA 2B9YA 3LPYA 4P2FA 2G4BA 3JTOA 4QWCA 3EUNA 3MM8B 3HP6A 3W2WA 5A6PA 3KJFB 4NWBA 1OY8A 4A46A 1LKZA 1XJWB 3HDSA 3CCJS 1FT8A 1HHQA 4J9UE 1C1BA 1PBUA 2UV8A 3O1LA 1JLFB 4OYAA 4KO0B 2N4DA 4BC7A 5HVGA 3FK4A 4Y2KA 3J7A1 5HLFB 4GKJF 5KFDA 2EC0A 3QRPA 2OEKA 1F6TA 2XBPA 3KK3B 2FLNA 1S4FA 1FKPA 1NB2A 4WXWA 4BS2A 1X0FA 1QUPA 2IVMA 4NLPA 4RL1A 3BBFA 1TUWA 3O6QA 2XCAA 1HD0A 1F5BA 4B3TJ 3M2VB 4CM2A 2ZOMA 1HARA 2B0GA 5F3TA 4ED0A 3POTB 1NO8A 2J5AA 2XSJA 3LA0A 2DTJA 4F4KA 2Q66A 5CXTA 1B99A 1GNKA 4PPZA 2HHHF 3FUYA 1S97A 3QGHA 2HEKA 3LP2A 3L7UA 5KFQA 2EFQA 5EDWA 2HGNA 2B8QA 2EK6A 2XCPA 3CXCR 4QOTA 3NCRA 1YTYA 1SB6A 4KKOB 4X2BA 2F1FA 1SJ1A 1B70B 2H5JB 3BEGB 1P1LA 3MTKA 2MGZB 1IKXA 1MWZA 1Q4RA 2AF6A 2BZ2A 2EEYA 1RTJA 3G82A 1UVLA 3AOCA 5HSPA 4NLYA 4B9NA 1FRMA 3ILJA 4H54A 1UP1A 5HROA 3IM9A 2VZ9A 4HHJA 2R7RA 2FJDB 2C28A 2NYIA 3MCMA 2PO4A 5DM6Q 1WKKA 1HI8A 2P6TA 2WVCA 2ZWOA 4ZJLA 2GNKA 4TN2A 4WFZA 3MEGA 4K4YA 2BABA 1VR6A 2NSBA 1HYSB 1S5ZA 2PSZA 2Z2YB 1RAIB 1I94J 1FF2A 1WEXA 1ELOA 3I0SB 4WP3A 1DHMA 4YB6A 2XS7A 4FYDA 1HW8A 4TYAA 4DX7A 1B0PA 2YNHB 3ILLA 1RT7B 1RT5A 5T14A 1NBEB 2XMUA 3NWGA 4ZMMA 2CQGA 4JI7F 4V19X 4FYVB 1DLOA 4RNMA 4JV2A 2DITA 3R27A 1RI7A 4ZLLA 1FFSB 2ZH1A 3V2UC 1WHVA 2AWZA 1ULRA 4L76A 1Q86T 2R8KA 2NXUA 1MU2A 1H7XA 2IAJA 2J7UA 3IR7B 5ETOA 1UPMB 2IMOA 3QZ8A 3DLGB 2MZTA 5JVGQ 3MM6B 4ED6A 1D3WA 2LP4A 2CZVC 2MKHA 2UXBJ 4XTTA 5ETRA 4PG7A 2E1MC 4WPAA 4B3MJ 3AQOA 5D78A 2E9RX 1RE1B 1MW7A 1VYAA 5KFZA 2UXDF 1REVB 3UDCA 2H54B 2CQDA 4G1IA 1S9GB 3OV7A 3P6YC 4HDHA 1KP6A 4USUA 4N47A 3CUNA 4XDDA 3CT9A 2FHOB 2LVWA 1R8PA 4GMKA 4JBCA 4LRAA 2LEBA 1RT2B 3GYGA 3MR7A 3LGMA 1NU4A 2FQQB 3KLHA 4OJHA 2R7UA 1Z1ZA 4Q7AA 2CQCA 5DDPC 4MK9A 4ZJOA 2OEJA 4BHQA 1RACB 2PIIA 2QL7B 4RUAA 3HVWA 2W24A 5T41A 3T6JA 1N5YA 1M5PC 1YJNS 3CB4A 2UVUA 5DDQC 4JI5F 4ZVRB 4NLSA 4WK1A 3T41A 5KFTA 2OPRA 3KJNB 3SCKE 2XMTA 4IFVB 4RJVA 2YQ1A 3HKWA 1RKJA 4B3OB 3MUMP 1XNQJ 3MPVA 1ZH5A 4K4UA 1D09B 2DIVA 1PBAA 3HHDA 3M8ZA 3CCTA 4M5LA 4Q2LA 4ZDNA 1KQSR 1C1CA 2B9EA 4FVCA 2AT1B 2NZCA 5THWA 5LJ3Y 3VGUA 2AJ2A 1KSPA 1FE4A 1T95A 2Q43A 2X1BA 1VISA 1MN7A 2HNDA 5HBMA 3QGGA 1CQMA 3CE8A 2Z2MA 4IFYA 2PC6A 1GT8A 2FDNA 2IM3A 4H4OA 1IKVA 3CJ0A 2DR6A 3ZTPA 2QLJB 2MEWA 2OPQB 3HVTB 5KFSA 4E0DA 3CCSS 4EYHB 2A6OA 2AD9A 4ALZA 3NMRA 4DR5J 2ZH5A 4Y0FA 2M3DA 2YKOA 3FCWA 4USWA 3K59A 2DXFA 4OHZA 1CS4B 2CZ9A 4RU9A 3M9NB 2UUAJ 2VFSA 2VFTA 2AEMA 1H73A 1X8DA 1LWXA 2PDAA 3OHBA 2K3KA 5CCMA 4RBTA 1WC3A 3R9LA 3H90A 4L3NA 4OYPA 1CJVB 2GVZB 1S6OA 3TJ9A 4DR7J 2C2NA 3G6YA 2EPIA 4Q2MA 4YR0A 2I9SA 5E41A 3RJMB 5L1IA 4KY3A 1HL6A 4FS1A 2B7BB 2VBXA 4YEAA 4DJBA 5I3UB 3R2CJ 4DZ6A 4OV6A 4F67A 2R2UA 1CBKA 2MPUA 1TKZA 2R2SA 1IWGA 3IR6B 3QJJA 2DGWA 2KXFA 2ROEA 3H2LA 2AJQA 5CQGA 3M2UA 4KYZA 4NLXA 2W9CB 1PYTA 3ILIA 4HDGA 4QIFA 1KDNA 4KJIA 3RAMA 2MHNA 3FEYB 1WORA 4HTIA 2J9DE 2WVFA 4OZ3A 1S1TA 5BR8F 4LVNP 1R0AB 2OPSB 2QT7A 2RIJA 2NR0A 3PJWA 4CO0A 4Q8FA 4L3KA 4OI4A 2LMIA 4UZCA 2K06A 2BJ3A 1VCTA 4GVBB 4A48A 5L46A 4YR2A 1M1GA 2AYBA 4ED8A 2HBYB 3GJTB 3DMJB 3KJVB 3OFHA 5KFYA 3W9HA 3RRHA 4I7FA 2DNGA 4ECTA 3DRPA 2YWGA 2G2OA 5C24B 3QAUA 4OI3A 4LSLB 2FJAB 4K7QA 5HK4A 1O6XA 1RKIA 5IXUA 4XPEA 3G9CA 1IR0A 2HQIA 2U2FA 2XLKA 1HQUA 4DL7A 4J9OA 3NXZA 1VQSA 3CJTA 1PYSB 4CLKA 3I6PA 5D4PA 4EYIB 4WZQA 2CPYA 2BYCA 3MD1A 3CSKA 3C16B 3TJAA 2WAQD 4KTQA 2B9XA 4LF6J 1FEEA 3JTNA 4DPWA 2GJFA 3T5JA 1JLGB 2RRAA 3PY8A 2CUYA 2BJEA 3N5FA 1H2VZ 5SZTA 2DO4A 1L3KA 2G2ZA 2PE8A 3HHNB 1U02A 2KYXA 3ZZTA 3KLGA 3KLEB 4Y2CA 1H2TZ 2GMHA 2UUCJ 2ZHBA 2JX2A 3JAMY 1ZM3A 2FJBB 4RW7B 4EI2A 5J2NB 4ETZA 5GAGI 3QSYB 4NI2A 1S57A 2W2PP 4C8NA 1LXNA 4FXWA 4CO5A 2VG6A 3EGWB 3I0RB 3US5A 4DV2F 5HMWA 1RZMA 2EXUA 4FF1A 4EBDA 2D69A 3KG0A 4AFFA 1U47A 3PIOQ 3MGJA 4IR1A 3PHTA 3E51A 3ISND 2C2ZB 3MECB 4ZHRA 4B3RF 4U6PA 3MEDB 5CD4A 2MLXA 2E5LF 3DRRA 1HIYA 2PEHA 2EWHA 5F0UA 2GVDB 2H51B 3C3LA 4JI2J 2MKCA 1V3RA 3ZNJ1 1NMEB 2XGPA 2OSQA 3V4IA 1VQOS 4OHVA 2LXIA 4JI0J 1WG1A 3P8BB 3ENQA 1U2FA 1U09A 1RU1A 3IG1B 5D4OA 3N79A 4DR2F 2MZQA 4WFYA 1NCLA 5GAEI 2O1PA 4JI3F 1DQ8A 2PFFB 3B8HA 2DGTA 5BYSA 2EC2A 5FD1A 4A8FA 4K4ZA 1YGYA 1JLAB 4KQZA 1IN0A 3VALA 3DRSA 3KK1B 1M5VC 1R0BG 5FJ4A 4A8MP 3H5UA 2W4CA 3OPKA 2FJXA 1KONA 1DBDA 3HJVA 1YRXA 1QTMA 1R27B 3BSNA 2V68A 2B3TB 4WYLA 3ZTRA 4IKAA 4K0KJ 2D74B 4LRDA 3SV3A 3WDOA 2HK3A 1DTQB 4HKQA 3ZZZA 4DSEA 1WC0A 1ZZFA 4QR0A 4IDKA 3G6ES 3QWUA 1KVJA 1VQ6S 3FFIB 4RX6A 4K8RA 4M95A 3HLUA 2YNFA 2FPHX 1FRIA 2A3JA 3QLHA 3ADAC 4F4XA 1W2IA 2DK2A 2HRUA 5K8NA 4F0KA 3BQ2A 2KXHA 3OXLA 4QPXA 2HWIA 3Q8SB 1FD8A 1C0TA 3BBCA 3LF0A 3NLCA 2VG5A 5CZVA 3R97A 1WDDA 2C3PA 1EJ7L 5A8RA 4IO9Q 2CPIA 2RDIA 2BQ3A 3ISZA 1SIWB 5CYJA 4UZBA 3V6KA 4F36A 5LMNF 4O4GA 2JEJA 3JQMA 3SCJE 1SH3A 4F02A 1PSDA 1UL3A 2LKZA 2X51A 3HHLD 3W8PA 3CCES 3MFHA 1JJ2R 2UVRA 2CG4A 3MMCB 4W98A 3ELHA 5FLXU 1ZTWA 4DV4F 1JLBA 4OX8A 5ETKA 4AD6A 2MQPA 4KHPF 2Q1LA 5C2GA 3TANA 1SJ4P 1VS3A 1TL3B 1YSJA 4ED2A 3EXCX 5C42A 4KB7A 3EPIA 1V6HA 1I5OB 4V1Ak 1HMVB 2VH7A 4ZVUB 5J1NA 4ILLA 4Q0BB 4B9UA 2YVSA 1WHYA 3EGVA 1QSYA 2UUCF 4LF7J 4NLRA 5KFVA 2MSSA 2HQCA 5T7LB 5BJRA 4K59A 2FYXA 4JV0A 3SIPB 4DL0C 2KYZA 4PKDB 1FJGJ 3AJ1A 3QT7A 4F25A 1SUQB 1HNXJ 2QGFB 1JX4A 4QZVB 2WK4A 3M8PA 3R1LA 4W90B 3M30B 2HG4A 3M2RA 4WWSA 4Y2AA 3T19A 1RXOB 1PO6A 3I56S 3DXSX 2K7JA 2DNZA 2UV8G 3JYTB 2V4QA 4IRDA 3OD2A 2IC3A 2QLFB 2VBYA 2YKAA 3FSYA 7AT1B 1YG0A 3FBBA 3UNGC 1RSCA 4OJ1A 1TL1B 4LR9A 2JLEA 3OL8A 1S99A 1SPBP 1SJFA 3CCWA 5B0EA 4ZN3A 1UZDA 1R7IA 2EKYA 2NXJA 4WFXA 3H2UB 1XC9A 3KMQA 3ZO7A 1X4BA 2GX8A 4HTJA 3N6NA 4I4BA 5E2QA 2E29A 5RUBA 4N5SA 1B3TA 2CNKB 1DTTB 2RAQA 3B4DA 1WF0A 5U47A 5A8WA 3ULHA 3MMBA 2HS3A 4JI3J 5F8NA 3J81Y 4GKKJ 2OUGA 1UVJA 1IKWB 4KAIA 4CWBA 1SKSA 3GP9A 1PJ6A 3I87A 3CJSA 1IM6A 3RW6A 1TL5A 2JEGA 1RT4A 4CO1A 4J9SA 3BV8A 3DCAA 2W9AA 1TL7B 4MK7A 1FRHA 3JSRA 2IDLA 1MMDA 2ASLA 1FWPA 2WZ1A 2XMWA 1N32J 2HGLA 3DU6A 2Z58B 4F2SA 1UJ5A 2BA9A 3LH2S 4M5GA 5KFFA 2F5GA 4DF4A 4YB5A 3BKUA 2JOQA 1U4BA 1RWKB 3TYTA 4I67A 2EVZA 3MDFA 3R6GB 1SVDA 3MM8A 3EJMA 4O3OA 2XYHB 3PEHA 3HO1A 1KLNA 2QL9B 3M05A 2AX0A 3EZUA 3TW0A 1NSQA 1VQNS 2KFZA 2Q6CA 2Z4PA 5A8KB 1N33F 1JLFA 1RA6A 4KO0A 2V8PA 5DG9A 1HBOA 2HIYA 2RNEA 3T5KA 4LF4J 5DDOC 4WCEQ 3KK3A 1HWIA 3DI6A 2J6TA 2VIHA 3HZEA 1U1KA 2VONA 1NPRA 3KHLA 4WJBA 2C22A 4O23A 5C25B 3MM7B 4LQ9A 1S7HA 3M2VA 2HSEB 2F4VJ 4MKYA 4USJC 2X1FA 2XSJB 2IVFB 1H2UX 3LGNA 2APOA 2CPEA 4G65A 4ZS6A 2NLWA 3QZ7A 2XEXA 2BM1A 4K2XA 3T3FA 1CLFA 3EM1A 5CYQA 4PG8A 2A18A 3LP2B 3EMTA 3R8YA 1QLNA 3BPDA 3SXLA 4FF3A 4ZVTB 3FQLA 4KKOA 4ZP7A 2MGZA 3IBWA 2GHVC 4O3QA 4YY3J 3IO1A 5H9FJ 4TU7A 1RTJB 3KHRA 3MPYA 3BJYA 2MKIA 2HHPA 4G1PA 4TKTA 4X62J 3DLJA 4DHVA 4LFBJ 2F65A 1YBAA 5DO2A 3MPWA 1FE0A 3OR2A 4Z7CA 4KSEB 3M7VA 4OYZA 1N5QA 1VQPS 1G3OA 3MMJA 3TR5A 4K4WA 3R6LB 1NJWA 2DBBA 4YP3A 2QG9B 3DGVA 2FVCA 4QQBA 1WTFA 5JJBA 4ED7A 3T1YJ 1IBCB 3M8SA 4NLUA 1UEVA 1SI9A 1SKRA 2CFXA 3I0SA 3OFGA 2A0FB 1EZZB 4L74A 3TAQA 3EZ5A 3CJ8A 4PUOA 2EBGA 3NGTA 2R7TA 2XO7A 5EN1A 3UR0A 2BKPA 2QX0A 1GXUA 2PT0A 2HWTA 4PXEA 3QYYA 2FJVA 3DLLQ 2IJNA 3IWNC 3HKZD 3PW4A 2P9EA 4Y65A 2Y0BB 1RT5B 3H7HB 4OI1A 1R89A 5KFUA 5KFOA 3IN5A 4FNIA 3PKYA 3DLKB 2WSFC 1AB8A 1FKOB 1VMBA 3IWXA 5L9XA 3GV8B 3TZXA 5D0EA 2Y1IA 1T0TV 2BW2A 5F8HA 2JHEA 2CVIA 1BGXT 2OH2A 1YJRA 4B3SJ 1F5AA 4F3OA 1UCNA 4U96A 1V3ZA 1ZPWX 3J7Z5 2DCUB 4EBEA 2VG7B 3H59A 4DV1F 3DLGA 3VAMA 1PC4A 1Q79A 5AE1A 3RB3A 4AQYJ 1NNDA 3MM6A 4RBUA 3MM9B 1FK9B 3OTDA 1XNRF 4YMEA 1S77D 4ZCMA 3P96A 1REVA 3MWBA 2D3UA 1FDBA 4ILRA 1NUEA 4ELUA 1ZAXA 2VDIA 3NOCA 3GIMA 2ZNYA 3OFFA 4X4VA 4ETXA 5ETNA 2XTJP 3HFVA 4YB7A 2HHVA 1IBLF 1Q8KA 1XIQA 1YRTA 3AFGA 3KLHB 1NK5A 3M6WA 5G0RB 4RW9B 2E1RA 1MWQA 2GMJA 3U7JA 1FRLA 4FVMA 2FGCA 4M5NA 1ZTTA 1NKCA 1NK0A 1A9NB 4M5MA 5AE3A 2ZBIA 4B9SA 3NG8A 1Y9OA 2F7VA 4KT0C 3TEGA 3KOAA 2DH8A 2GQ2A 1W7WA 2ZC3A 4AUKA 1SL0A 4AE5A 4B3OA 2HAFA 2F4VF 1RAGB 1YZ7A 2MY7A 3SSSA 1F0XA 1JMTA 1OQ3A 2K2PA 1Y4ZB 2R4FA 4G3IA 4HH0A 2CDQA 1FTRA 2WSCC 1U48A 4A8OA 4KFBA 3CO0P 3JB9k 1JXLA 4RNFA 3PRBA 3EVMA 4H4OB 2HBQB 1IKVB 2G9OA 4B3RJ 2AZ1A 3LOUA 3VCDA 3HVTA 1WI6A 1IBMF 3IBFB 1WD6A 2QV6A 2BW7A 2CJBA 2RMLA 2YQ0A 3ZTSA 5HMYA 3RR8A 3FQKA 5D4NA 4BCAA 4X62F 2JLGA 2HYIB 4IOBA 3N01A 2XZTB 3NL0A
chains in the Genus database with same CATH topology
2Y8YA 2Y8WA 5CD4A 3QRPA 4QYZK 2Y9HA 4DZDA 5H9EK 1WJ9A 3QRRA 4U7UD 3QRQA 5H9FK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y8Y A;  2Y8W A;  5CD4 A;  3QRP A;  4QYZ K;  2Y9H A;  4DZD A;  5H9E K;  1WJ9 A;  3QRR A;  4U7U D;  3QRQ A;  5H9F K; 
#chains in the Genus database with same CATH topology
 3SCL E;  3KFW X;  2W4D A;  4PXB A;  1KC8 T;  4RLE A;  2L9D A;  4DLE A;  2IJR A;  2F3J A;  4TQS A;  4AT1 B;  3KNG A;  4J37 A;  3U27 A;  2GVZ A;  1T03 B;  3D0G E;  3UN2 A;  5BYQ A;  5KT3 A;  3R7B B;  3W7B A;  4DWI A;  1GAO A;  1F2H A;  5ITH A;  1JNR B;  4PAA A;  4QW8 A;  3TO8 A;  4CNY A;  3QJL A;  3FRY A;  1ROF A;  2W4P A;  4MAK A;  3IMQ J;  4RKU C;  3VGS A;  3NBP A;  2B4O A;  1RWO B;  4KHR A;  1TKZ B;  2BE2 A;  4A8X A;  4RZR A;  3D3C J;  2IBO A;  1FNM A;  4JI4 J;  3AQP A;  5KFJ A;  3DYA B;  1SJ3 P;  1FCA A;  4AYB D;  5JUM A;  2CQB A;  1HKA A;  2AJF E;  2ZOF A;  1FHT A;  3W8G A;  1U6F A;  4EO8 A;  4ES3 A;  3TUJ C;  2IHR 1;  1Z2L A;  1NSP A;  2XWX A;  4P52 A;  3Q89 A;  2XC9 A;  2OPS A;  1LWF A;  2KHD A;  5GMD A;  3D6F B;  4OX7 A;  4F4Y A;  3MOJ B;  4W92 B;  4ECX A;  2VBW A;  3AOB A;  3C46 A;  1OY9 A;  4CLL A;  5KG4 A;  3PYD A;  3OHA A;  2QA4 S;  4DL3 A;  2U1A A;  1BQN B;  3W66 A;  2IM2 A;  1MSW D;  3HCX A;  4WTY A;  4AND A;  5HL7 Q;  3VWS A;  2HVI A;  1YQH A;  2Z0G A;  5DG8 A;  3ILO A;  2W25 A;  2XGQ A;  1YIJ S;  1W2B R;  3ENA A;  4F2R A;  5DS7 A;  2D3Z A;  5D4L A;  3HHE A;  4LSL A;  3U1N A;  4XO0 A;  1S1V A;  4OIX A;  4X4S A;  2JC1 A;  2DXE A;  2XI3 A;  1MML A;  2M52 A;  2DPJ A;  3SDE B;  1X7V A;  4K5S A;  2RRB A;  1HQU B;  3LO3 A;  1A7G E;  5KG1 A;  5EX0 A;  4NRT A;  4YR3 A;  1SL2 A;  2WRM A;  1JJH A;  2G2Y A;  1FJC A;  1GMV A;  2YY3 A;  3VGV A;  2OD6 A;  4DQI A;  1G7C B;  3F0N A;  4B9M A;  2C3Y A;  3P3D A;  5GVQ A;  1XMQ F;  4UW2 A;  4ZCK A;  4DV7 J;  2UUB F;  2DNO A;  1HFE L;  2BE9 B;  1RK8 A;  2M9K A;  3CUL A;  4RW4 A;  2MQM A;  3DLE A;  3SQG A;  3M8Q B;  3KLG B;  3MR3 A;  1NK8 A;  4IRK A;  3TUP A;  3PX0 A;  3Q22 A;  1HD1 A;  2GQC A;  4Y6I A;  3NS5 A;  1NH7 A;  3PFO A;  6FDR A;  4RW7 A;  4FBT A;  4J9M A;  5J2N A;  1KHV A;  3TQ1 A;  3I0R A;  2LDY A;  1DQA A;  4NPO A;  1K8A T;  3NGS A;  4FPI A;  3NGU A;  2HZC A;  1HHS A;  4FKY A;  3MAA A;  3RW7 A;  1RU2 A;  3KXD A;  1IQZ A;  2VHG A;  3MEC A;  4ZHR B;  1S79 A;  5H9E J;  1GQE A;  4DV5 J;  4A8Q A;  2BR0 A;  1VRU A;  2ABY A;  3KLI B;  5HP1 A;  2HGM A;  5KFL A;  3BQ0 A;  1QE1 A;  3RU0 A;  1YHQ S;  4FN5 A;  1U1N A;  2LQ5 A;  5J1E A;  4X65 J;  3PR4 A;  4ECU A;  3Q83 A;  5SUH A;  2KT5 A;  3D9B A;  2Q79 A;  5ADZ A;  4O0I A;  4QR1 A;  3M8R A;  4DOZ A;  5E7O B;  1VGY A;  2R7Q A;  4N56 A;  3V4I B;  2CNO B;  4PG5 A;  1DAR A;  5GME A;  1NK9 A;  2EKN A;  1Q82 T;  3UI3 A;  1YLX A;  4DLG A;  4JUZ A;  1IM4 A;  3LWL A;  1UPP A;  2YPZ A;  5KFH A;  3RR7 A;  3N6M A;  3IR5 B;  4RPF A;  3SBM A;  1Y00 A;  4C8Z A;  4DR5 F;  1U45 A;  5J2P A;  1JLA A;  1RCX B;  1XN9 A;  5CAA A;  3HT0 A;  1S72 S;  3DRS B;  1E6V B;  2DGV A;  3A3O B;  3KDO A;  3U1M A;  3U02 A;  2WHO A;  2CPH A;  2J0X A;  1LNQ A;  2VKR A;  5IT9 U;  4ECY A;  4OL8 A;  2PA3 A;  2CA9 A;  3W62 A;  1GMU A;  2A6M A;  1CG2 A;  5HJX A;  4WE1 A;  1XK8 A;  2BE7 D;  4ZLP A;  4B9T A;  1DTQ A;  2M70 A;  3X1L B;  1LWE A;  5IV4 A;  2E5I A;  1S76 D;  3H5X A;  1KEK A;  4M94 A;  3UVJ B;  3H4D A;  1Q7Y T;  3JAM U;  4IOA Q;  3NGK A;  4UY8 T;  2V6A A;  2DHS A;  5EWF A;  1S49 A;  4ECQ A;  4PWU A;  2IA0 A;  4TY8 A;  3VAH A;  3SZ2 A;  2J7W A;  3D54 A;  1UA1 A;  5GAH I;  2DNH A;  2X1A A;  1OMS A;  1R3N A;  1VQK S;  2PI5 A;  5KFM A;  1RDR A;  4P71 A;  1KRP A;  5A8R B;  5FLX Y;  2YKM A;  4EU0 A;  1V5V A;  1WC6 A;  2RJZ A;  3C8Y A;  5I4M A;  1SCJ B;  3FVY A;  4HR2 A;  3AT1 B;  4P7V A;  3T6B A;  1HNV A;  3J7Y U;  3FDS A;  3PVX A;  2ASY A;  1HWJ A;  3NOG A;  4NRU A;  3IAM 9;  3ETM A;  2AW0 A;  3MMC A;  4C48 A;  1TFW A;  1T9T A;  1FXL A;  3ONQ A;  3BN7 A;  1B0V A;  4L72 B;  1JLB B;  2DNK A;  2Q6B A;  5H9F K;  4KH1 B;  3M6V A;  5IT4 A;  5HAO A;  4F4A A;  3ZZU A;  3GV7 B;  3BO4 A;  4NZ0 A;  1ZAW A;  2CPD A;  2RKI A;  2ZJP Q;  2BQR A;  2CQ1 A;  1QUV A;  3GJS B;  2DD8 S;  4MK8 A;  3K5L A;  1GXT A;  4L75 A;  5C7P A;  3T9N A;  4GKJ J;  3CVK A;  2VKZ G;  3E8O A;  3K2Y A;  1UFL A;  4FXV A;  2Z8Q A;  5T7L A;  3BGR B;  2YH0 A;  3LAM A;  4M63 A;  2HFN A;  3HFZ B;  5D0H A;  3ZTO A;  3FGV A;  3DOK B;  1Z2Z A;  1QAJ A;  4C8O A;  2XY5 A;  2OP5 A;  3THT A;  1N56 A;  1SUQ A;  4CQ1 A;  3QJP A;  5KG5 A;  3GJQ B;  2HLU A;  3R3T A;  1S10 A;  3M8P B;  2KG0 A;  1IWA A;  2J9C A;  3F56 A;  3JSM B;  2QYG A;  2J9D A;  2JFD A;  2R8H A;  3JYT A;  3NNA A;  3TZY A;  3TX8 A;  2EBE A;  3UWT A;  2IC3 B;  2D1C A;  3OL9 A;  1N33 J;  2J8S A;  5D0R A;  3HSD A;  3CD6 S;  4PZV A;  1TL1 A;  4U7C A;  4AXJ A;  2LU2 A;  3LGH A;  4K50 A;  4KIA A;  3QNW B;  3V6D B;  3PRD A;  4FYY B;  2R2T A;  3K58 A;  2OKQ A;  3FEZ A;  1UWA A;  4GO5 X;  5HJY A;  1U25 A;  2MQQ A;  2ZH9 A;  1DTT A;  4FF2 A;  4P74 A;  5BYR A;  3LQV A;  3FMW A;  3MMB B;  3HSZ A;  4OYI A;  3TA2 A;  1NDP A;  2QMX A;  4ZPD A;  2RHQ B;  2FC9 A;  1I6J A;  1EQ0 A;  2RS8 A;  2I8E A;  3BN4 A;  5AXN A;  3KHG A;  4CYU B;  4OFZ A;  4JYA J;  3CJ5 A;  4ZPC A;  4OYB A;  2LXU A;  2XS2 A;  4HT7 A;  5ETP A;  3GYX B;  3EVO A;  4LFA F;  1K1S A;  1QTN B;  5F8I A;  4YY3 F;  3HSG A;  4LF2 A;  2POK A;  3U1L A;  5H9E K;  1H98 A;  2MZS A;  4YB1 P;  1MMN A;  4C4W A;  3IAS 9;  4AQY F;  1R31 A;  2IM0 A;  3PG9 A;  4ID5 B;  3W9I A;  3PYE A;  5ETQ A;  2E7V A;  1VQY A;  1FWK A;  4KRW A;  4CO2 A;  2AYE A;  3GG0 A;  3WC2 A;  3BH7 B;  2PMH A;  3GZ7 A;  4ITS A;  2OEL A;  2HNZ A;  1PJ5 A;  2ROP A;  4DU8 A;  2V8G A;  2VIC A;  2IIH A;  1EET A;  3W65 A;  4DBQ A;  5A8K A;  4DEZ A;  2ILZ A;  1J5E F;  2WVD A;  4MKV A;  3HVA A;  1HBO B;  2E5J A;  2HBZ B;  5IQ6 A;  1TK0 A;  2FLL A;  2OJ3 A;  2HQG A;  3AOD A;  1NK4 A;  2ZZN A;  3DI6 B;  1Y5L B;  2XO6 A;  4LRB A;  3ZZO A;  2QL5 B;  4Q5V A;  4DF8 A;  1S0N A;  4RW8 A;  3EVW A;  3D7S B;  2M0G B;  3RB0 A;  3FSX A;  1UET A;  3MM7 A;  5C25 A;  1RWU A;  2ZHA A;  3D0I E;  3OW2 R;  1CUL B;  4NEZ A;  2JJ4 D;  3RG6 A;  1RYR A;  1XR6 A;  1Q7L B;  3TUZ C;  5AXL A;  3VAK A;  4UY8 5;  3IM8 A;  2BAN B;  3O3L A;  4CT9 A;  4CT8 A;  5KOX A;  1JLC B;  5CYQ B;  3F41 A;  1AFJ A;  2F8E X;  1OWX A;  4O4R A;  4NZ7 A;  4B9L A;  2LEP A;  4U9R A;  2IMW P;  1QVF R;  2V9W A;  2KG1 A;  2HFZ A;  2UU9 J;  2Y8W A;  4IQM A;  2YWW A;  1U8W A;  3DDI A;  2CAJ A;  3VR1 A;  1P8G A;  1CJU B;  3CJR A;  2XHW A;  3OR2 B;  4CLF A;  4DMZ A;  3AD8 C;  1XEZ A;  2WBM A;  2XHC A;  1NKB A;  4NLT A;  4NLO A;  2RF2 A;  4DV3 F;  2HHU A;  1GTH A;  3GFX A;  4N77 A;  3D5M A;  1HA1 A;  2P9G A;  4AL7 A;  2RB7 A;  1IBL J;  1I1G A;  4QPT A;  3DNC A;  4LR8 A;  1T94 A;  3NS6 A;  1JK9 B;  2AGP A;  2EG1 A;  4IG0 A;  4UOC A;  3V81 A;  2DRB A;  3PFE A;  4PUO B;  3TAP A;  1O5J A;  2V2Q A;  4QWB A;  1VRQ C;  2F9D A;  1YRU A;  1S1W B;  1XR7 A;  1HNX F;  3QRQ A;  2E1A A;  2Z2L A;  4FF4 A;  1T9W A;  4AXI A;  4ZPV R;  4KGZ B;  3ZNU A;  2MKY A;  1X4C A;  3PXG a;  3EZO A;  3IFE A;  1T05 A;  3DLK A;  3DRY A;  1FKO A;  3MR6 A;  3ENW A;  2OAU A;  4NXM J;  3W64 A;  1H38 A;  2VA3 A;  3GFZ A;  1P9Y A;  3MMA B;  4P2S A;  1Y7P A;  3R2D J;  2B43 A;  2CNN B;  3FZB A;  2VG7 A;  1UWB A;  2AHO B;  1S9F A;  3I55 S;  1T03 A;  4JI4 F;  4RW6 A;  3MM9 A;  2QA1 A;  3DN9 A;  2FHM A;  5AXK A;  1FK9 A;  4LF8 J;  1F5C A;  4EZ9 A;  3W9J A;  1RWP B;  2E1P A;  3C15 B;  4PYA A;  2R2R A;  3T1H J;  1IBM J;  2B5J B;  3BS9 A;  1LEO A;  1N0U A;  1GK8 A;  1A6L A;  3HX9 A;  3CTR A;  5IZH A;  2FVR A;  2E9Z A;  1RBO B;  2PEB A;  4PRF A;  1I51 B;  2FJE B;  3B54 A;  1FVQ A;  2GIF A;  5KFX A;  3CC2 S;  5CH7 B;  4KV8 A;  1WEZ A;  3EX7 B;  5HMX A;  1QSL A;  4RR5 A;  3DOL A;  5G0R A;  4ED4 A;  3CME S;  4RW9 A;  1VQ8 S;  3JQK A;  4CI0 B;  2AV5 A;  4ZVH A;  3W2V A;  3IC1 A;  1RAE B;  2W01 A;  2ZJQ Q;  1NK6 A;  2G0I A;  1C4A A;  1BUX A;  1SC1 B;  2G1D A;  2RUS A;  3NCP A;  3TVY A;  2XUL A;  2DR7 A;  2KDO A;  2DHH A;  4QBU A;  4FP9 A;  2WW4 A;  5I3Q A;  2KH9 A;  2XNR A;  3NY0 A;  1JXE A;  1VBY A;  4X4R A;  2DEJ A;  2DHX A;  1PYO B;  1DY3 A;  1TP7 A;  2DNP A;  2CDR B;  5IV3 A;  1FXR A;  3K89 A;  3Q23 A;  2KJW A;  2R7S A;  3MCO A;  3K57 A;  3W5Z A;  1HNZ J;  3AD7 C;  1YVF A;  1YJ7 A;  3TNV A;  1RTZ A;  2OEM A;  5I42 A;  4EO6 A;  4TVA B;  4BWJ A;  1OJ4 A;  5AT1 B;  4KFB B;  1E6Y B;  2CWX A;  2WON A;  3R7S B;  1NZA A;  1M5H A;  4G1Q A;  4NYP A;  2KN4 A;  1UVK A;  3GV5 B;  4UT4 A;  1S1U A;  1VK8 A;  3KWM A;  3FMB A;  4H4K A;  4FYX B;  1LW2 A;  2L48 A;  3I82 A;  1R6Y A;  1RAB B;  3AY0 A;  5K5M A;  3V5R A;  1BXN A;  1N54 B;  2QFJ A;  3M4X A;  1WSR A;  1T9X A;  1RP5 A;  3D3B J;  1VBZ A;  4DSI A;  3W63 A;  2NRE A;  1H3D A;  5C2C A;  3OVA A;  3HVR A;  3IS9 B;  1LK7 A;  3WX4 A;  1RHM B;  5CHC B;  2KVQ E;  3BYR A;  4NA3 A;  4OJ3 A;  3G87 A;  4X66 F;  5CCL A;  5EWG A;  2YWF A;  3N28 A;  4PAB A;  4ZJQ A;  2A1B A;  4XDC A;  2QZ8 A;  1ZZN A;  2ZEJ A;  3RB4 A;  2A2D A;  3DFE A;  3GR1 A;  4DX5 A;  4MKA A;  5KFN A;  4J9N A;  1EAR A;  2RD5 C;  1WF2 A;  2DHA A;  2L9W A;  3FZ2 A;  4P72 A;  1FJ7 A;  5E33 A;  1SH0 A;  3NBP B;  5LXR A;  3TQE A;  3HMJ G;  5F8G A;  3G6V A;  2VOP A;  2BE2 B;  4ZP6 A;  3BDP A;  4MYT A;  2AEJ A;  3I4P A;  4PXD A;  3DYA A;  4PEO A;  4ZA1 A;  2DXD A;  2VPZ B;  3TOQ A;  2CJ9 A;  3DGP A;  1VRT B;  2KB2 A;  5KFB A;  2AJ1 A;  1HR0 J;  1VQ9 S;  2GGP A;  1FI4 A;  2NSC A;  3IBC B;  3MI7 X;  4Y2M A;  3I32 A;  3ZZP A;  3A8I A;  1LWF B;  3CO9 A;  2VL1 A;  1NM2 A;  4O3R A;  1M1K T;  4LFB F;  4J9Q A;  3V6J A;  1WOS A;  2GA7 A;  4CLT A;  1BQN A;  3L7P A;  4DX6 A;  1OSC A;  4NLV A;  5KFC A;  3T1H F;  4X65 F;  3J7A N;  2KZM A;  4DFM A;  3OQ2 A;  4JI1 J;  4Q8E A;  1TAU A;  2H3E B;  1TZ0 A;  3FBE A;  4ANE A;  2C2D A;  2UXC J;  2DGU A;  1APS A;  2QO3 A;  4CO4 A;  2F40 A;  1RWX B;  1Q8L A;  4DPT A;  1S1V B;  2HS0 A;  4QIW D;  5KG2 A;  4TNO A;  4QU7 A;  1PC5 A;  3SDE A;  2NS1 B;  2R7O A;  2KU7 A;  3A1Y G;  3FCV A;  1QSS A;  1F3V A;  1FX2 A;  2NPF A;  4V19 J;  1N0V C;  2MTL A;  1RHJ B;  3PAC A;  2CJQ A;  3GYN A;  3A8K A;  1RHK B;  3NKY A;  3SFU A;  4YS2 A;  4ZIW A;  2W7O A;  4EGL A;  3RTV A;  5F8J A;  3Q8V A;  4CO3 A;  1HI0 P;  2M88 A;  2CQH A;  5LT5 A;  4HI2 A;  2BAC A;  1FXD A;  3N9U C;  4F4Z A;  1VC6 A;  1CJT A;  1WG5 A;  2D3O 1;  4USH A;  1TKT B;  5B0G A;  4RW4 B;  5KOW A;  1KNZ A;  1XBW A;  3DLE B;  3K0J A;  3SQG B;  1ZPV A;  3M8Q A;  5LMU J;  3CJ2 A;  2JRS A;  2B9W A;  5IWA F;  3HHL B;  1K9M T;  1T02 A;  4URS A;  2N4C A;  1JLQ A;  4QYZ K;  4DV1 J;  3BO2 A;  4URQ U;  4C2M A;  1UMJ A;  1ZOT A;  1Y0H A;  3CCQ S;  2GJI A;  1X4H A;  1PJ7 A;  2CVE A;  2GO9 A;  3DKD A;  5A76 A;  4ED5 A;  3A12 A;  4OI0 A;  1O51 A;  3KK2 B;  3MAA B;  4ZPT R;  3JS9 A;  5IS2 A;  1ZM2 A;  2HHS A;  2VPY B;  3D1H A;  1FWL A;  1TL4 A;  2NYH A;  1F9E B;  4K0K F;  1VRU B;  3KLI A;  4DUY J;  4K4X A;  5ETL A;  5HP1 B;  4M5D B;  1QE1 B;  2CJX B;  4JI8 J;  5J1E B;  3TZW A;  4DV6 F;  1TMJ A;  1PG5 B;  2HNY B;  4HL9 A;  4KGV B;  5MAO A;  1Q8B A;  4PG4 A;  1UW4 A;  2UXD J;  1MG7 A;  1OQ6 A;  5EHH A;  3OUY A;  2C3M A;  3K8W A;  1FX4 A;  2CJY B;  1R8A A;  2VF3 A;  3M8W A;  3TVK A;  2HIQ A;  1SJQ A;  4LF1 A;  1GMW A;  1IR2 A;  3QFH A;  3RBX A;  1KHW A;  2E9T A;  1N6Q A;  4OYO A;  4EZ6 A;  3MOZ A;  1SIZ A;  2RQM A;  1TVR A;  1FNO A;  1MNE A;  2BJ7 A;  1C2P A;  2YXL A;  3CD5 A;  4IG3 A;  5J2P B;  5JMN A;  1J2V A;  1RJJ A;  2I1R A;  5LM7 E;  1E6V A;  1P9Q C;  1N5T A;  1F9H A;  3OFE A;  4OZ2 A;  3MEK A;  2EK1 A;  4B17 A;  2ATC B;  3D1Q A;  2MZR A;  3MFI A;  2VOO A;  3FKB A;  2UZA A;  4NA2 A;  4ZVF A;  4KHP J;  4R8U A;  2BBE A;  2XY7 A;  3VF0 B;  4BBY A;  3AH6 A;  4WE1 B;  2ZH2 A;  3RRG A;  2JVO A;  4OLO A;  1PCA A;  2FHJ D;  2BUN A;  2V69 A;  1YWX A;  2RU9 A;  4HVZ A;  4MT1 A;  3CJK A;  2N3O A;  1LWE B;  3H40 A;  4DFJ A;  1SC3 B;  2KL8 A;  3IRW P;  5CYM A;  2MQ8 A;  3ET6 A;  1NDC A;  4LSN B;  1FDN A;  1EHW A;  3OBI A;  5HAN A;  5JXS A;  3UVJ A;  4EFA C;  4OZ5 A;  4QW9 A;  4R5P A;  1KBR A;  5HQM A;  2K1R A;  2XM3 A;  1N34 J;  2AP6 A;  4I6A A;  1OIA A;  4TY8 B;  4PXC A;  1Q78 A;  2CPJ A;  2AU0 A;  2UVW A;  4WFB Q;  1WUU A;  2E7W A;  4WP8 A;  2WCX A;  3CPW R;  4R25 A;  1F2G A;  2CIM A;  1EP4 A;  1M5K C;  3UDL A;  1A0O B;  3G2X A;  2YKM B;  3HM9 A;  5CD4 H;  2VA2 A;  1RT6 A;  5KTQ A;  3L3C A;  2KXN B;  4A4J A;  1S6Q B;  2HLT A;  1VQM S;  1JWW A;  1HNV B;  1RHU B;  1GX5 A;  1WC1 A;  3RAQ A;  2VV5 A;  3FBF A;  4IO1 A;  4LVO P;  4F3M A;  1VC0 A;  1EKR A;  3TEH B;  1BHN A;  1U2R A;  3CMQ A;  2N7Y A;  3D1O A;  2WB1 D;  2BKO A;  1X5S A;  4O44 A;  4ENO A;  3GON A;  2W8K A;  4KPY A;  3DM2 B;  4QWE A;  1LOU A;  2WVB A;  4OMF G;  2RKI B;  5F9N A;  2A10 A;  3TRG A;  4FKX A;  2OHD A;  5A2Q U;  4I2Q A;  2RE1 A;  2RDD A;  3R5G A;  4H4K C;  3KLV A;  3VVT A;  1U1L A;  1OPI A;  3QRR A;  3Q8U A;  2QMW A;  3JTP A;  4CDI A;  1YX2 A;  4DR6 J;  4UQG A;  3BGR A;  1WC4 A;  4YFU A;  1J27 A;  2HHQ A;  4DV7 F;  3Q24 A;  4B9V A;  3DOK A;  3Q8Y A;  5D3G B;  4DX8 H;  4B08 A;  5HVF A;  1T9U A;  2P5V A;  1D8Y A;  1L3U A;  3EGN A;  1SXL A;  1U6Z A;  3D2W A;  2SXL A;  2DHG A;  3JSM A;  3GTY X;  4MYU A;  2E5H A;  2JNJ A;  4FNH A;  2M7S A;  3QIP A;  4UOF A;  3UE2 A;  1VBX A;  2AYM A;  2ZUG A;  3B78 A;  4CTA A;  1RAA B;  3LW5 C;  2K8G A;  4A47 A;  2R8G A;  2KI2 A;  2YNG B;  5F8M A;  1KTV A;  2CQI A;  1K0V A;  2HMI A;  1S59 A;  1U0H B;  4NL5 A;  2H65 B;  4MMO A;  1MRO A;  3MZI A;  3D68 A;  1FNX H;  4DU7 A;  3V6D A;  2ZFH A;  1SV5 B;  4USK A;  3QAE A;  2E1C A;  4LFC F;  3BH6 B;  4NLG A;  1FA0 A;  1HQE A;  1XER A;  4PQA A;  1BLU A;  3R5C A;  5ETV A;  2I6W A;  1JIH A;  5KT5 A;  3P4U B;  4X4Q A;  3K17 A;  1XWL A;  4NXN F;  1BD6 A;  2Y1R I;  1S9E A;  1KN6 A;  4CH1 A;  1SC4 B;  4DR3 J;  1BY9 A;  4JP8 A;  4MIB A;  1C4C A;  4I2P B;  2HVH A;  3MUV P;  1FTC A;  4F04 B;  4I68 A;  3CCU S;  4NCB A;  3HSJ A;  5E3A A;  4CYU A;  5IOL A;  1YDL A;  2BQU A;  1KOO A;  3OTC A;  2QTW A;  5IC4 B;  1OY6 A;  5KG0 A;  3CNQ P;  3AB4 B;  3KG1 A;  1ZA1 B;  1KKH A;  2RQK A;  4CRJ A;  2NUH A;  2BJ9 A;  1RIS A;  4Y34 A;  1HHT P;  1S6P B;  4WU3 A;  3QBC A;  3WBZ A;  2OI2 A;  2KT3 A;  1M1H A;  2HZA A;  3IXQ A;  1RTD A;  3ITH B;  2DGS A;  3NMA A;  6AT1 B;  4ID5 A;  3CF5 Q;  4CLZ A;  2ZBQ A;  4WFA Q;  2CPF A;  3M9M B;  3RZA A;  5KT2 A;  3M9O B;  3D28 A;  4ICL B;  2AEF A;  2DB1 A;  3KJQ B;  1N34 F;  4DG1 A;  2HNZ B;  3IGN A;  1KFS A;  3G8T A;  2X7I A;  3R5B A;  9RUB A;  1WI8 A;  2ZBC A;  1EET B;  2HAI A;  2W2O P;  5B0C A;  4ECZ A;  2DNL A;  3DXB A;  1XNR J;  2XZD B;  1RYS A;  4NAS A;  2IVY A;  4QWD A;  3ENV A;  4JI2 F;  5IT0 A;  1PKU A;  1WHW A;  3HXM A;  2QSF A;  1VQL S;  1LW0 A;  1WJ9 A;  4RW8 B;  4DFP A;  3C6T B;  4USI A;  5G4D A;  1D9F A;  2COL A;  2ZBP A;  3CCM S;  2KO1 A;  1CJK A;  4DR2 J;  1MLA A;  4LBP A;  1CUL A;  1KTQ A;  4DXL A;  1X0P A;  3SQO P;  4ER8 A;  2BAN A;  4LT6 A;  3OLB A;  3L09 A;  4M5J A;  2HWH A;  2O3D A;  1JLC A;  5ETM A;  4F3Q A;  4UOG A;  1FER A;  1M0S A;  1ACM B;  3E01 B;  3CJ3 A;  2V34 A;  3C6U B;  3GIR A;  2PA8 D;  2IRY A;  4F50 A;  3CC7 S;  1NSA A;  2ZC4 A;  3EIC A;  3CC4 S;  2B51 A;  1JKH A;  3KLF B;  4YOE A;  3WQP A;  4DUZ F;  2FD2 A;  3OR1 B;  2C2E A;  3K7R A;  4U7U D;  2AJ0 A;  2C2K B;  1CJU A;  2I38 A;  3A4T A;  3LUY A;  4CLY A;  4JI7 J;  2DPI A;  2ZVI A;  4DSF A;  2JVR A;  3K5M A;  3PYF A;  2RF2 B;  4ANC A;  5DM7 Q;  1VLO A;  3AXM A;  3OTB A;  1EQM A;  4KHM A;  2YX4 A;  4ZVG A;  4MIA A;  3KUH A;  2IY5 B;  1KS2 A;  1TMM A;  3IGV A;  3J80 U;  2BEF A;  4CH7 A;  3BO3 A;  2WW8 A;  3UD3 P;  3TWZ A;  4IG0 B;  2G1H A;  2V0N A;  2LXF A;  3V81 B;  3DRX A;  1KWM A;  3CDA A;  3PJX A;  2AQ4 A;  4WP9 A;  1S1W A;  4HH1 A;  2R7X A;  1TUV A;  2BDP A;  3HI9 A;  3GR0 A;  1Z4U A;  1RTI A;  4U95 A;  2AMC B;  5DGA A;  2MYF A;  1NLK L;  4URG A;  1T05 B;  1L5U A;  3QID A;  2RIL A;  5CAB A;  4KC5 A;  4HAC A;  4ZPB A;  2MB0 B;  4HHU A;  3ZXW A;  5K8O A;  1VHI A;  1WWH A;  1X9M A;  3MMA A;  3UCU P;  4HT5 A;  4RNN A;  4DR3 F;  1UZH A;  2CQP A;  1UWB B;  1TKX A;  2Y1L B;  2CWK A;  1WEY A;  4NA1 A;  3TAM A;  3FJ2 A;  2DGO A;  2X1G A;  4QR2 A;  2DJW A;  3VTI A;  2LDI A;  7FDR A;  2JH3 A;  2FZK B;  4RW6 B;  2CQ4 A;  3PJ9 A;  3BGF A;  2ZE2 A;  1SQG A;  4ERD A;  2X3D A;  3C15 A;  1F60 B;  4C7Q A;  2B5J A;  1UVN A;  1SH2 A;  1BC6 A;  3J81 j;  1IKY B;  2KM8 C;  2C42 A;  4ES2 A;  5LOQ A;  4USM A;  1YJ9 S;  4P75 A;  1HNW J;  3CD0 A;  1TQL A;  4KV8 B;  3X3U A;  4Z37 A;  4DSL A;  2F8M A;  2MST A;  1UEU A;  3SSQ A;  1RT3 B;  3VAJ A;  1HBN A;  1NPK A;  1Q16 B;  4J9V A;  3BB5 A;  1T9V A;  3DOL B;  4MTP A;  4DZD A;  2MJU A;  1S4E A;  2V4J A;  2XMV A;  2YQ3 A;  2ZUA A;  3W2V B;  2VQF F;  1KLM A;  1X31 C;  2CQ3 A;  3JQJ A;  5HO4 A;  3H42 A;  3SV4 A;  4NYO A;  2ZIT A;  1AFI A;  1TKD A;  3N6L A;  4ID8 A;  3T1A A;  1RUS A;  1LV5 A;  1Q81 T;  1G1X A;  2YKQ A;  2HFO A;  7FD1 A;  4IRC A;  1YI2 S;  1H7W A;  5D77 A;  5D0G A;  4JOU A;  2UUA F;  1DRZ A;  2HQ3 A;  2BX6 A;  1JJ4 A;  2L3M A;  2OML A;  3CIZ A;  2MQN A;  3TUI C;  2W9B B;  4JYA F;  4E98 A;  2YH1 A;  1H72 C;  5D15 A;  1U0S A;  1NDL A;  5I42 B;  2RQC A;  1F1B B;  1YZ6 A;  2HFS A;  3G86 A;  1FKA F;  5DQI A;  1CVJ A;  2Y0S D;  5IWA J;  5AJ3 F;  1N88 A;  1E6Y A;  4QIG A;  2WON B;  3DDN A;  2BVZ A;  5DDR C;  4G1Q B;  4WII A;  2CAD A;  3CDW A;  2F8H A;  2V50 A;  3PKM A;  2LA4 A;  4C98 A;  3WIU A;  1S1U B;  2ALY B;  2HPU A;  3GCX P;  1RWN B;  5KFK A;  2R8J A;  4MJK A;  1LW2 B;  3PIP Q;  1S6U A;  1RHQ B;  3DLB A;  3PYG A;  2UP1 A;  3Q0A A;  2VU5 A;  1KQK A;  1KQF B;  5HN0 A;  2XB2 D;  3O5T B;  2VUG A;  2VQE F;  3TI0 A;  3IS9 A;  4TY9 A;  2ZZM A;  4DR4 J;  4DV0 F;  3LP1 B;  4LF9 J;  1W26 A;  4DN9 A;  3DC2 A;  5GAD U;  4MKB A;  3EGZ A;  2MZJ A;  1B7F A;  4ZK7 M;  4E2F B;  3PRV A;  3BGU A;  3B82 A;  4QJV A;  2QN6 B;  4TLR A;  1BQX A;  1N36 F;  2V2K A;  1FRK A;  2HVE A;  1QAX A;  1QDU B;  2B6A A;  2YKN B;  1KFD A;  4L73 A;  4LRF A;  2LEC A;  3FNN A;  2E44 A;  1G4C A;  2O67 A;  2FVQ A;  3AJ2 A;  4CZC A;  1GFW B;  3ZZ0 A;  4OYX A;  3O8W A;  4B02 A;  5KT4 A;  1XMQ J;  2ALZ A;  4LF5 J;  3CDE A;  2GCF A;  1HBM B;  3DGP B;  2WBR A;  1VRT A;  3FBC A;  3KKF A;  5HI7 A;  3QGP A;  1OPZ A;  3S8S A;  1B0T A;  4QWA A;  2V67 A;  3LWM A;  2XMM A;  2GGP B;  2DT9 A;  5L1J A;  2MQO A;  2ASD A;  2P8I A;  2VDH A;  3DHW C;  2DIS A;  4KR0 B;  4C0O C;  4J9L A;  2Y9H A;  2Z56 B;  3G8Q A;  2BJD A;  2XQC A;  3RAX A;  2IPO B;  3GIL A;  2RS2 A;  2XLJ A;  1TR0 A;  2JLF A;  1PAU B;  3BQ1 A;  2DIU A;  4JI8 F;  2PMW A;  1HPZ A;  2GQQ A;  1XMO J;  1X9S A;  2BRK A;  3RBD A;  2DKO B;  3Q86 A;  1RT1 A;  2AGO A;  1O0P A;  4ZVE A;  2MKJ A;  1RQ0 A;  5B0D A;  2V2Z A;  4DV5 F;  1QAY A;  5DET A;  1KD1 T;  3UNY A;  4JI1 F;  5KFA A;  4GC7 A;  4H4M A;  3BGL A;  5IC6 B;  1IBK F;  3T5H A;  3T1Y F;  1TTH B;  2CG8 A;  4DQQ A;  1CEZ A;  4OX9 J;  4OX6 A;  3MTJ A;  2J0W A;  5K20 B;  1H0H B;  3OJU A;  3G96 A;  3NGR A;  4K4V A;  2CNL B;  4AL5 A;  2EI5 A;  3Q2S C;  1FFW B;  4J9R A;  1CJT B;  1R6V A;  2WVE A;  1P6T A;  1NB7 A;  1K47 A;  2IYI A;  4WFN Q;  1TKT A;  1WAC A;  3D6H B;  4CLU A;  3D6T B;  1F9F A;  4PR6 A;  1K44 A;  3SI8 A;  1EX8 A;  1U1Q A;  1ITP A;  2CPZ A;  3HHL A;  2ACY A;  3HUL A;  4EK2 A;  1JLQ B;  4NCA A;  4EMD A;  1JLE A;  1Q5V A;  1XQI A;  1X60 A;  2FB0 A;  2HVD A;  2MMY A;  3AD9 C;  4WU2 A;  2MZ1 A;  2ZH7 A;  1G6B A;  2DR5 A;  2X3G A;  3M32 A;  4R0J A;  4QYZ J;  3TP2 A;  3W5X A;  2B56 A;  4M5K A;  3H25 A;  3D67 A;  4CLP A;  1TV6 A;  1VOM A;  1X4A A;  4F26 A;  4Q44 A;  3KK2 A;  4N41 A;  1F3F A;  1VQ7 S;  4NLQ A;  3TJ8 A;  1CQN A;  1FRJ A;  3OL7 A;  4C3M A;  2HHX A;  2MQL A;  2BOA A;  3VVU A;  4CIO A;  4M5D A;  4DUT A;  2KZZ A;  2RDJ A;  1R0C B;  2ZDO A;  5KFG A;  2HNY A;  3OT9 A;  2I0X A;  2J0S D;  1D9A A;  4KGX B;  3OUY B;  1CC7 A;  1KQG B;  2DY1 A;  1RHR B;  1VK3 A;  4PWD B;  5HQ8 A;  1EB0 A;  2YWK A;  1G2E A;  1TEL A;  2MKS A;  3FC9 A;  2QEX S;  4OJG A;  2ZM6 J;  1HBU A;  1N6Q B;  2MHE A;  3VZH A;  4D3G A;  5GAG U;  2G0J A;  3KG4 A;  4A8K A;  4LQ3 A;  4ZPW R;  1TVR B;  3H5S A;  4IG3 B;  4IQX A;  2M8D B;  3UFC X;  1SL1 A;  1B4S A;  2P6S A;  1V5I B;  2BMB A;  1WOO A;  1D0E A;  1HNZ F;  4CLW A;  5GAH U;  2GAH C;  1N36 J;  4ELV A;  2CJK A;  2EG2 A;  5E3C A;  5J2M A;  3QGI A;  1WEL A;  1LXJ A;  2E7X A;  4R0E A;  4R8U B;  1YJU A;  5KAK A;  1TFY A;  3HF5 A;  4X4N A;  3CJK B;  4LF5 F;  3CIM A;  4RUC A;  2DNQ A;  1CPZ A;  3EWG A;  5BR8 J;  4DL5 A;  4JI5 J;  1S1X B;  5CYM B;  2C3O A;  2V5H G;  3ET6 B;  4LSN A;  2JZ5 A;  4QIE A;  4DV4 J;  4DL6 A;  4LIW A;  2LQJ A;  4A8Y A;  2ADC A;  3DLH A;  1XMB A;  4C11 B;  4R5P B;  2K1R B;  3H98 A;  5L1K A;  1BWE A;  4ATN A;  1KR4 A;  3UO0 A;  3BR8 A;  1UJ6 A;  3MHY A;  4YN3 B;  4ZP9 A;  1AZS B;  5DRK A;  4DQS A;  3GIK A;  3V6H A;  4K4S A;  4ECV A;  1BWV A;  1EP4 B;  4N8O A;  2J0Q D;  4KBI A;  1BE4 A;  2RQ4 A;  5E3R A;  1JB0 C;  1N5S A;  3AXK A;  3OSN A;  1IJF B;  1NK7 A;  4LF7 F;  1RT6 B;  5K8M A;  5IM0 A;  5DQH A;  1GMW D;  4I64 A;  1VFJ A;  5K14 B;  1S6Q A;  3HT3 A;  1VHF A;  1L3V A;  4WZM A;  1GTE A;  5L8R C;  1S0V A;  3PCO B;  1YJW S;  4K5R A;  5BXI A;  3MUR P;  5KFW A;  2Q3P A;  3NP5 A;  2B4V A;  5HVH A;  3SCI E;  1FES A;  2WOM B;  1RBL A;  2F9J A;  3UPF A;  4LR7 A;  4OZ0 A;  4O44 B;  1C0U B;  1CSJ A;  4ZVP B;  2XYG B;  3DM2 A;  4J91 A;  3TVZ A;  4DQR A;  1VJQ A;  2YWE A;  1R8B A;  2ZKU A;  4X4T A;  3T5L A;  1UA0 A;  1YJT A;  3PO5 A;  4RBV A;  2PN6 A;  1IVZ A;  4I2Q B;  1VI7 A;  2UUW A;  2GHW A;  5LL6 d;  2MDA A;  1Q53 A;  2M8H A;  2B8P A;  2MXY A;  3WX8 A;  4XIU A;  3WC0 A;  1ZET A;  4HLB A;  1RGV A;  1VIO A;  2AGQ A;  2W1B A;  3VHQ A;  3GG1 A;  8ATC B;  4ZPA A;  5D3G A;  5DLG A;  2XMK A;  1DJ0 A;  3RBZ A;  4NZ6 A;  1N8R T;  4YUD A;  4UUW A;  1LK5 A;  2HS4 A;  2VC1 A;  3GSI A;  3I9Z A;  4O0N A;  2IYG A;  2AJ4 A;  2NXN A;  3H20 A;  4NCG B;  3Q8P B;  3GIJ A;  1T3O A;  3QIP B;  2UXC F;  3GWC A;  2NXE A;  3A8E A;  4CTA B;  2CJA A;  4A8S A;  1M5O C;  2YNG A;  1FJE B;  2UU9 F;  5F9L A;  2HK2 A;  5I3P A;  3RRK A;  2HMI B;  1U0H A;  5D8H B;  1JJC B;  3CJQ A;  3UDE A;  5IFM A;  2AYG A;  1XR5 A;  1MRO B;  4NOH A;  5CZX A;  3P49 B;  4CM0 A;  2QJ3 A;  1SV5 A;  1JXV A;  4LUB A;  4HEA 9;  4NLW A;  2HZV A;  1HQE B;  2EFN A;  2Y1J A;  4XAK A;  1SKW A;  4DQP A;  4PQU A;  2D41 A;  2RVJ A;  3L9Z A;  1HWL A;  3ZC4 A;  2ZM6 F;  5DLF A;  4WBF A;  1N48 A;  2N7C A;  3PX6 A;  2OTJ S;  1S9E B;  2EFO A;  5LMU F;  3CW2 C;  1RCO B;  2OPP A;  1S0O A;  4DL2 A;  4I2P A;  1U26 A;  3ISN C;  4MH8 A;  3QFW A;  4E8U A;  4JV5 F;  3UD5 A;  1RBA A;  2H4Y B;  5M2P A;  2PFD A;  3SEO A;  2FLO A;  2ZOG A;  4NML A;  4ECW A;  3EXY A;  4P7T A;  4IYQ A;  4Y2I A;  1VIX A;  3KTQ A;  2R3V A;  3TAR A;  2JEF A;  4O3N A;  4CH0 S;  1S6P A;  5ETS A;  4CLS A;  8RUC A;  1S0M A;  2XS5 A;  4LBI A;  3W3S A;  1RTD B;  3SSR A;  3AB2 B;  3ITH A;  4DPY A;  5A6W A;  3Q2T C;  4DUY F;  2V9K A;  4JB8 B;  5GAE U;  2H48 B;  2LEA A;  2GFF A;  2ACM A;  2AIR B;  3QO9 B;  4FZV A;  4ICL A;  3G8S A;  3PV8 A;  3MCS A;  4TYB A;  3BKT A;  4U8V A;  4K4T A;  4DG1 B;  3HPO A;  1RAF B;  2G13 A;  3A3N B;  2ATL A;  1L3T A;  1J5O B;  4B3T F;  2R7V A;  4C3L A;  4ED1 A;  1X9W A;  3JXO A;  2KRB A;  1RAH B;  2LFV A;  3QT6 A;  2DNN A;  1Y11 A;  2NCK L;  3D0H E;  4HI1 A;  5KG7 A;  5FDL A;  1IQT A;  2XI2 A;  2HW3 A;  4Z2X A;  1LW0 B;  1UFK A;  3UD4 P;  1ZM9 A;  1V9O A;  3C6T A;  4OHY A;  2CKW A;  3BGO P;  2R8I A;  4L6V 3;  4UST A;  1HLW A;  1UW9 A;  4UTG A;  1TU0 B;  3LP0 B;  1CJK B;  1URR A;  2OIH A;  5A0Y B;  2V8H A;  2DH9 A;  1UEK A;  3GSD A;  2DRD A;  4EUV A;  4IUF A;  2I5J A;  3E01 A;  4LF6 F;  3C14 A;  2OTL S;  3H5Y A;  2XMJ A;  1ARO P;  1X5O A;  3C6U A;  3R5D A;  1RWV B;  4K2J A;  5L1L A;  2FJW A;  4NXM F;  4QIV A;  1FO1 A;  2ZD1 B;  4DPX A;  2HHW A;  4DPU A;  1JKH B;  4UUX A;  2K3I A;  3RYL A;  3KLF A;  4C8Y A;  3OR1 A;  3W5Y A;  2C2O B;  2P9C A;  5AJ3 J;  1TUG B;  2F63 A;  1JQG A;  4M8L A;  3O2I A;  1QM9 A;  2IFX A;  3CWJ A;  3GMG A;  4OHW A;  4J9P A;  1BQM B;  1HNW F;  1VBK A;  3MEE B;  4QYR A;  4B3S F;  5E3Q A;  2ZH8 A;  2KHC A;  2RH3 A;  3CD7 A;  3MPU B;  4DDF A;  2D3O R;  1WTB A;  3VAI A;  2VQE J;  1U49 A;  5DGB A;  3CCL S;  2RHS B;  3N0V A;  2FZC B;  3FEX B;  4J7C A;  3RB6 A;  4JV1 A;  4PWW A;  1LWC B;  4DN0 A;  1UKU A;  3VAG A;  4KPC A;  2GAG C;  2YTC A;  4D3H A;  3FSI A;  1R43 A;  1RTI B;  3BYP A;  3IWL A;  3OTO J;  3EE3 A;  1RB0 A;  3MAH A;  4I6W A;  4DCO B;  5HQL A;  1DZ5 A;  2O5D A;  3QPI A;  4HAC B;  1KOH A;  4PCQ A;  3W1Y C;  4RUH A;  4TU8 A;  3GII A;  3CGI A;  3ZZY A;  1LFW A;  4C8K A;  4OLP A;  1YBT A;  4N76 A;  1H74 A;  3JSY A;  4RWW A;  4YHH J;  4OV1 A;  2VD3 A;  2JC0 A;  4DR6 F;  4PPD A;  3MF5 A;  1TKX B;  4LRC A;  3TAM B;  3OXG A;  2H5E A;  2HFV A;  3M1V A;  4IH6 A;  5GAD I;  5B0F A;  3UCZ P;  2XWY A;  2CPX A;  4RO0 A;  2DEI A;  1WKL A;  3R7N B;  4ZLJ A;  4ZN1 A;  2ZE2 B;  4A8W A;  3M6U A;  1YJV A;  4RWX A;  2J76 E;  2ZHO A;  1O8B A;  2FUG 9;  3GQC A;  3PDN A;  5LSR A;  4MFB B;  1IKY A;  4KE5 A;  1ICE B;  2IM1 A;  5M2R A;  1X4G A;  4N7T A;  4OI6 A;  3EPG A;  4RU2 A;  4FXD A;  4XK8 C;  3KYL A;  5KG6 A;  5AXM A;  1SBR A;  2DNM A;  1ZAV A;  2JFK A;  4KGK A;  3PZP A;  3AJD A;  1RT3 A;  4ZLN A;  2LYV A;  1HBN B;  4DV0 J;  1HNI A;  1SQE A;  3DOM B;  3R5J B;  1K73 T;  1L3S A;  2DO0 A;  2DVI A;  2V4J B;  4PG6 A;  3QQC D;  4Y28 C;  2C2R A;  4NE9 C;  2YWH A;  5B7W A;  1KLM B;  3MM5 A;  2JDJ A;  3TX0 A;  4DR1 J;  1PGZ A;  1X4F A;  5C5J A;  4EEY A;  4X84 A;  4LFC J;  4C0H A;  3AHP A;  1HW9 A;  3J81 U;  2GW8 A;  2OD4 A;  2YNI B;  2UVV A;  4OX9 F;  2DCL A;  2DH7 A;  1RTH A;  3ICL A;  1U8S A;  4NMX A;  2IRX A;  3IRX A;  3UCG A;  3WIV A;  3ZFV A;  3Q8R B;  3I4H X;  2JL9 A;  3BDE A;  1WSV A;  2DGQ A;  2W9B A;  5J2Q B;  4O3S A;  3CED A;  3MPD A;  5K9F A;  2K7K A;  2NQP A;  1ZYQ A;  1IJE B;  3W2W B;  3MXH P;  1NH8 A;  4C0B A;  4WKR A;  3AA9 A;  1LQ9 A;  4P10 A;  1XNQ F;  1DQ9 A;  1C1B B;  3BZQ A;  4GVL A;  3VAF A;  2QA2 A;  2ROG A;  2FGO A;  3KDN A;  1U24 A;  2M5Y A;  4Q43 A;  4LFA J;  5HLF A;  1T11 A;  4AL6 A;  1T7P A;  1XMO F;  3HZG A;  2PD1 A;  1FKP B;  1S48 A;  9ATC B;  4DR7 F;  3HHL C;  3SMZ A;  4JI6 F;  1OO0 B;  1ZA2 B;  5ETT A;  4F0M A;  2ZZT A;  4ED3 A;  2W7P A;  1NXI A;  4WTO B;  1NKE A;  1X4E A;  3E2E A;  4HHH A;  4WF9 Q;  2H9Z A;  4LIR A;  1FFG B;  3POT A;  3LP1 A;  4IH5 A;  2FTR A;  2ADB A;  2BXJ A;  4P9S A;  3TZZ A;  3M6X A;  5L39 A;  2IBK A;  3PHE A;  5JVH Q;  4C6A A;  2FY8 A;  2KKH A;  2O01 C;  1B64 A;  2F4F A;  3RGI A;  2B4P A;  3TA1 A;  3IP0 A;  1Q0N A;  3CMA S;  1PIE A;  1J5E J;  2KFY A;  5KFI A;  2RRN A;  4OYW A;  1IKX B;  3G82 B;  5DQG A;  2B6A B;  1K1Q A;  2YKN A;  2NZ4 A;  2I2Y A;  2DY9 A;  2WTF A;  2KJV A;  1S12 A;  1T8E A;  2VFU A;  5HRO B;  1RWW B;  2BKN A;  2H1Y A;  4HYK A;  4KGM A;  1HBM A;  3EDR B;  3H0P A;  1U1R A;  4LF4 F;  3NEK A;  1ZM4 A;  2VFV A;  3QSI A;  2GZO A;  2KVI A;  2W2M P;  4BWM A;  3MEG B;  4XPC A;  3S7R A;  1HYS A;  1K0T A;  3Q8Q B;  2YPY A;  4WK3 A;  1SKU B;  3I5B A;  2LLZ A;  2LQ8 A;  3T9Z A;  2HBR B;  5H1S V;  4X4U A;  1WOP A;  3LAL A;  5LSO A;  1U2C A;  4LSZ B;  2V8D A;  1WNE A;  2GML A;  2FLP A;  4BC9 A;  1YK9 A;  5IT9 Y;  2YNH A;  1S7I A;  1IXK A;  1FVS A;  1I3O B;  1UFW A;  1HPZ B;  3R5A A;  1RT7 A;  5F3Z A;  4C8M A;  2DR9 A;  4F8R A;  2LCW A;  5J1P A;  1Q95 G;  3CCZ A;  3J80 Y;  4LMZ A;  1RT1 B;  5LJ5 Y;  2YKP A;  2FY1 A;  5DJB A;  4FDF A;  3PM9 A;  3K5O A;  2FVP A;  5LXY A;  1DLO B;  4GC6 A;  2DR8 A;  4H4M B;  2FIU A;  4FS2 A;  4DV3 J;  2HUR A;  5L9N A;  1ZBT A;  3CDB A;  1GEH A;  3D4J A;  1MU2 B;  1NRK A;  2IAJ B;  2V8V A;  4N8N A;  4NLD A;  4OYM A;  2ERR A;  2BJ1 A;  2OMO A;  4DFK A;  2QIF A;  3NAI A;  4X64 J;  3LAK A;  1W25 A;  1M5S A;  3OSP A;  3P5T L;  3GE9 A;  3GJR B;  4QCL A;  2J6S A;  2OLW A;  3S6E A;  3THP A;  1QVG R;  5KG3 A;  4LJM A;  4GO7 X;  2QFI A;  4EWT A;  1VJW A;  4WXO A;  3C2P A;  1S9G A;  1PIL A;  2P2C B;  2HQF A;  1JLE B;  1LFP A;  2ZDP A;  2QLW A;  3GFH A;  3RUB L;  4DL4 A;  1QY7 A;  2XNQ A;  3M32 B;  1B7Y B;  5EX3 A;  4NX9 A;  3NWR A;  3GCW P;  4C97 A;  1RT2 A;  3P45 B;  2W8L A;  1TV6 B;  2VPX B;  1VLY A;  2BOP A;  1TK8 A;  5GMK a;  4NEY A;  1RAD B;  2YX7 A;  2EFG A;  2J8A A;  3BM7 A;  3OVB A;  2BV3 A;  2Z2Z A;  1M90 T;  3ZZR A;  4J9K A;  5LSL A;  5B0A A;  1N5Y B;  3AAW B;  4OZ1 A;  1OYE A;  3N4W A;  3HK2 A;  5B08 A;  2HRY A;  4DS5 A;  4OI2 A;  1DFD A;  2OPR B;  2C1E B;  2QA4 G;  4IFV A;  2HHH J;  2MLZ A;  4W4M A;  4JI6 J;  2VOD A;  1IR1 A;  2VQF J;  4PWD A;  4I0W A;  3UN3 A;  3GB0 A;  4TXS A;  1DAX A;  5B0B A;  2KRR A;  1C1C B;  4S0M A;  1HBU B;  1YKW A;  4DI6 A;  2GO8 A;  2E5L J;  4GKK F;  5KFR A;  1FDA A;  1ZS6 A;  2LQB A;  1YBU A;  2Z30 B;  4TU9 A;  1NPP A;  2J7K A;  2V2V A;  3BR9 A;  3H4B A;  2HND B;  3VV2 B;  5HBM B;  1H6K X;  1YIT S;  2DRA A;  4JI0 F;  4IFY B;  3OLA A;  3DU5 A;  3QAT A;  5M2U A;  1U7L A;  3PO4 A;  1AW0 A;  2OPQ A;  4ZVO B;  3NS7 B;  2HRT A;  2LA6 A;  3S1T A;  2YBV A;  1NJX A;  4CCH A;  2Y8Y A;  1WG4 A;  3CJ4 A;  5J2M B;  2HHT A;  1Y10 A;  1REG X;  2V94 A;  1CS4 A;  2QLB B;  1AA1 B;  2RSQ A;  2FHJ A;  2KM8 B;  1I94 F;  4M5H A;  4ZOS A;  4ZKA A;  1N4L A;  5B09 A;  1WHX A;  4ZIV A;  1S1X A;  4NXN J;  2OFG X;  3PW0 A;  1AXQ A;  1NAQ A;  3J7Z T;  2L41 A;  1FD2 A;  1T9Y A;  3MR2 A;  2IJF A;  4C11 A;  3BRE A;  2V4R A;  1CJV A;  3AA8 A;  4GRS A;  3CCV S;  2VFR A;  1TK5 A;  3FRZ A;  1Y3J A;  1AZS A;  3DHX A;  1KVK A;  5I3U A;  2CRL A;  3F73 A;  1V3S A;  1SJR A;  5IM0 B;  1WF1 A;  2ZBR A;  4M5I A;  5K14 A;  1D8Z A;  3I5C A;  4OZN A;  3BKF A;  4BLG A;  5EWE A;  5EGY A;  1U1P A;  1RA7 A;  3M2U B;  4YDX A;  2ZWP A;  2DYA A;  4ZVS B;  2HVZ A;  2W9C A;  2C3U A;  4USV A;  2H4W B;  3NGD A;  4B3M F;  5A2Q Y;  2KFN A;  2XMA A;  1S1T B;  1R0A A;  2WOM A;  4X66 J;  1NSK L;  3OXF A;  5F41 A;  1UTA A;  1X5P A;  1C0U A;  5LMN J;  4OZL A;  1T3N A;  3FCH A;  4GVB A;  2IA6 A;  1AT1 B;  3DDK A;  3EDQ B;  3HHK A;  2PGC A;  2EFV A;  3SFG A;  3VQS A;  2D9P A;  3EYZ A;  1IBK J;  3DMJ A;  2OGU A;  2DGX A;  2Z57 B;  3NCQ A;  1EAY C;  2D7S A;  4I1T A;  3KJV A;  3L4B C;  3GLJ A;  4I6Y A;  2VAS A;  3BBB A;  4I7F B;  2L9N A;  3DRP B;  4WKY A;  1NHV A;  3LTO A;  4OQJ A;  5F0W A;  5C24 A;  4ES1 A;  4DSK A;  2XG8 A;  1GH8 A;  3ZTQ A;  3GPA A;  4WYW A;  2W2N P;  2AX1 A;  2HKE A;  4DCP B;  3HFK A;  2ZH4 A;  2QE5 A;  3O44 A;  3BSC A;  4G6V B;  2E5G A;  4NCG A;  4UF4 A;  4QU6 A;  1NZ8 A;  3C16 A;  4TQR A;  4ZCL A;  1JLG A;  3I31 A;  3G6X A;  2DNY A;  2FVS A;  1FJG F;  3KUE A;  1Q5Y A;  3I9V 9;  3WHI A;  3H2V E;  3JSB A;  2ASJ A;  4DUZ J;  3D6M B;  2C2M B;  4Y00 A;  4DPO A;  2H5I B;  1NJZ A;  4ECR A;  2CXE A;  3B6B A;  3KLE A;  4CP5 A;  1D9D A;  1R8C A;  3NNC A;  1KVI A;  4J5O A;  4P6Q A;  1GX6 A;  2RT3 A;  3A13 A;  2OSR A;  4TLQ A;  4C3K A;  3F44 A;  4NI2 B;  3G4S S;  4X4O A;  1URN A;  3LPE A;  4YDD B;  4PQU B;  4F0H A;  1EKS A;  2QYC A;  2VG6 B;  2L08 A;  4OZJ A;  2KT2 A;  4P73 A;  6FD1 A;  4KH0 B;  1PAE X;  1NHU A;  1FEH A;  2J9E A;  2VC0 A;  3PEJ A;  3L7O A;  4LRE A;  5KFE A;  1U1M A;  2AZ3 A;  1WDT A;  1N5V A;  2D9O A;  2OPP B;  1X5T A;  5HMZ A;  3OTO F;  2ZH3 A;  1NDK A;  2BM0 A;  1N52 B;  3MED A;  3OL6 A;  2QRR A;  3BSO A;  3DRR B;  4WIQ A;  2YX1 A;  3MUT P;  4EBC A;  2AKW B;  2JWN A;  3KUG A;  2VBZ A;  3LAN A;  3VQT A;  2GVD A;  3VZI A;  5E0O A;  3KNA A;  1JNZ B;  8AT1 B;  2NUU G;  4FPR A;  2VJU A;  2M2B A;  2ZKT A;  3UN5 A;  1FRX A;  3D66 A;  5KT6 A;  2QMU B;  1Q1K A;  2N82 B;  5MLC V;  1HR0 F;  1VQ5 S;  1AUS L;  1UVM A;  1R8H A;  1VQ4 S;  5AE2 A;  3IG1 A;  1RLD A;  3PW5 A;  2HQD A;  3RBE A;  2W7A A;  4YQW A;  1OSD A;  3QO9 A;  5KT7 A;  2GIR A;  3HJF A;  2G0C A;  1BMQ B;  2IDE A;  2N3L A;  3KHH A;  2EFP A;  3G71 S;  2XLI A;  4F4W A;  3OJS A;  3A8J A;  2A2C A;  3PW2 A;  3E3X A;  1SQF A;  5IQQ A;  1Y5I B;  2EW9 A;  3QT5 A;  3KK1 A;  1J5O A;  4IH7 A;  1N32 F;  1HWK A;  2FZG B;  1VDH A;  2GV1 A;  4UQT A;  2W2Q P;  4DV6 J;  4IR9 A;  5FDL B;  3J7Y I;  2GJ2 A;  2QSW A;  2V63 A;  2XZW A;  3MR5 A;  2ILY A;  2CYY A;  4DR1 F;  4ECS A;  3QT8 A;  5DZ6 A;  2JSX A;  3PX4 A;  3N5B A;  1GXL A;  1WKJ A;  3LP0 A;  4DV2 J;  4IDK B;  2WB4 A;  5A0Y A;  5F8L A;  3FFI A;  2FC8 A;  1Q8I A;  2MLY A;  2YNF B;  5E5N A;  1QJH A;  1SC6 A;  3MCN A;  3QLH B;  4RUB A;  4YHH F;  2GC8 A;  2ZH6 A;  2R42 A;  3ETO A;  4ZIT A;  4I69 A;  2PI4 A;  3HD2 A;  4X4P A;  2I5J B;  2UUB J;  3C14 B;  5D6G A;  4ILM A;  2CQ0 A;  3PTW A;  1C0T B;  2GIQ A;  3K5P A;  3H8Y A;  4P2X A;  4OHX A;  2VG5 B;  3V4M A;  2ZD1 A;  1IUJ A;  1TAQ A;  2WSE C;  5HAT A;  2Y3Y A;  1RLC L;  1Y5N B;  2R9L A;  1EIY B;  3C19 A;  2CQ2 A;  4CNZ A;  4O4G B;  4F7V A;  4BDP A;  3AOA A;  2DNR A;  3A3P B;  1CC8 A;  2M4M A;  1AUD A;  4Z7Y A;  3WZ0 A;  1VC5 A;  4DCJ B;  2RUG A;  1BQM A;  3BPS P;  4NYZ A;  1WC5 A;  2LU1 A;  3UQS A;  2XY6 A;  1U6B A;  3MEE A;  4MIW A;  2OFH X;  2IRU A;  3M8Y A;  5L38 A;  4C8L A;  3NNH A;  3MD3 A;  3PW7 A;  4RNO A;  1X4D A;  2VB6 A;  2J6U A;  3UW1 A;  4Y3C A;  3VGT A;  1NEE A;  1P27 B;  1TL3 A;  4LF8 F;  5C42 B;  4PYD A;  3CCR S;  1NJI T;  3GU0 A;  1LWC A;  4Q0B A;  1HMV A;  1UAW A;  2O66 A;  3P5B P;  3BF4 A;  3L95 X;  1RAJ A;  4I56 A;  3NRB A;  4FBU A;  3I5A A;  4LBH A;  4U67 Q;  2RU3 A;  4O3P A;  4J90 A;  4ZP8 A;  1AYE A;  3UDV A;  5CA5 A;  3W60 A;  5DZ7 A;  3B4M A;  4Q45 A;  4DR4 F;  4LF9 F;  3OTE A;  4RNH A;  2GHP A;  3PR5 B;  4DSJ A;  3QWP A;  3M2R B;  3M30 A;  4ZVQ B;  1NJY A;  1P1T A;  1MN9 A;  3SYZ A;  5KFP A;  2UUT A;  5DG7 A;  3M1V B;  2PMZ D;  1RAO A;  3K8V A;  1HQ2 A;  2VJV A;  3I96 A;  2VPW B;  5FII A;  3TA0 A;  3BSA A;  2GS8 A;  1RWM B;  2MY8 A;  5E3P A;  3NAH A;  4MFB A;  2B4U A;  1DUR A;  4M1K A;  4JV5 J;  1QAI A;  1OS5 A;  3OVS A;  3THV A;  1UJ4 A;  4P2M A;  1HI1 A;  1UVI A;  3GFY A;  3PNI A;  4FYW B;  1D1U A;  2MKK A;  2NPI A;  1OYD A;  5A8W B;  2B7C B;  3HD1 A;  4IOC Q;  2HFU A;  3R1H A;  1NHK L;  1HNI B;  2NXC A;  3DOM A;  2E66 A;  2ZVS A;  3IA0 A;  5EUH A;  2BRL A;  3K5N A;  2LQ9 A;  1IKW A;  1MWY A;  4ZCI A;  1Y3K A;  3MM5 B;  5K8P A;  1QD1 A;  2JEI A;  4U7U K;  2KTQ A;  3KMS A;  2UXB F;  2BJ8 A;  2XYP B;  3C66 A;  3W61 A;  1RT4 B;  4C9D A;  2XSF A;  4DS4 A;  2YNI A;  2R7W A;  1FDD A;  1TL7 A;  2QLX A;  4UOH A;  3MAQ A;  2QC3 A;  1RTH B;  2MJN A;  3S01 A;  1HWU A;  2OO4 A;  2ZNZ A;  3IRX B;  4U8Y A;  3UR3 C;  2CZ4 A;  2ZJR Q;  4X64 F;  1U1O A;  2FHK A;  3QMQ A;  5J2Q A;  4ELT A;  1XTZ A;  3CDU A;  2B9Y A;  3LPY A;  4P2F A;  2G4B A;  3JTO A;  4QWC A;  3EUN A;  3MM8 B;  3HP6 A;  3W2W A;  5A6P A;  3KJF B;  4NWB A;  1OY8 A;  4A46 A;  1LKZ A;  1XJW B;  3HDS A;  3CCJ S;  1FT8 A;  1HHQ A;  4J9U E;  1C1B A;  1PBU A;  2UV8 A;  3O1L A;  1JLF B;  4OYA A;  4KO0 B;  2N4D A;  4BC7 A;  5HVG A;  3FK4 A;  4Y2K A;  3J7A 1;  5HLF B;  4GKJ F;  5KFD A;  2EC0 A;  3QRP A;  2OEK A;  1F6T A;  2XBP A;  3KK3 B;  2FLN A;  1S4F A;  1FKP A;  1NB2 A;  4WXW A;  4BS2 A;  1X0F A;  1QUP A;  2IVM A;  4NLP A;  4RL1 A;  3BBF A;  1TUW A;  3O6Q A;  2XCA A;  1HD0 A;  1F5B A;  4B3T J;  3M2V B;  4CM2 A;  2ZOM A;  1HAR A;  2B0G A;  5F3T A;  4ED0 A;  3POT B;  1NO8 A;  2J5A A;  2XSJ A;  3LA0 A;  2DTJ A;  4F4K A;  2Q66 A;  5CXT A;  1B99 A;  1GNK A;  4PPZ A;  2HHH F;  3FUY A;  1S97 A;  3QGH A;  2HEK A;  3LP2 A;  3L7U A;  5KFQ A;  2EFQ A;  5EDW A;  2HGN A;  2B8Q A;  2EK6 A;  2XCP A;  3CXC R;  4QOT A;  3NCR A;  1YTY A;  1SB6 A;  4KKO B;  4X2B A;  2F1F A;  1SJ1 A;  1B70 B;  2H5J B;  3BEG B;  1P1L A;  3MTK A;  2MGZ B;  1IKX A;  1MWZ A;  1Q4R A;  2AF6 A;  2BZ2 A;  2EEY A;  1RTJ A;  3G82 A;  1UVL A;  3AOC A;  5HSP A;  4NLY A;  4B9N A;  1FRM A;  3ILJ A;  4H54 A;  1UP1 A;  5HRO A;  3IM9 A;  2VZ9 A;  4HHJ A;  2R7R A;  2FJD B;  2C28 A;  2NYI A;  3MCM A;  2PO4 A;  5DM6 Q;  1WKK A;  1HI8 A;  2P6T A;  2WVC A;  2ZWO A;  4ZJL A;  2GNK A;  4TN2 A;  4WFZ A;  3MEG A;  4K4Y A;  2BAB A;  1VR6 A;  2NSB A;  1HYS B;  1S5Z A;  2PSZ A;  2Z2Y B;  1RAI B;  1I94 J;  1FF2 A;  1WEX A;  1ELO A;  3I0S B;  4WP3 A;  1DHM A;  4YB6 A;  2XS7 A;  4FYD A;  1HW8 A;  4TYA A;  4DX7 A;  1B0P A;  2YNH B;  3ILL A;  1RT7 B;  1RT5 A;  5T14 A;  1NBE B;  2XMU A;  3NWG A;  4ZMM A;  2CQG A;  4JI7 F;  4V19 X;  4FYV B;  1DLO A;  4RNM A;  4JV2 A;  2DIT A;  3R27 A;  1RI7 A;  4ZLL A;  1FFS B;  2ZH1 A;  3V2U C;  1WHV A;  2AWZ A;  1ULR A;  4L76 A;  1Q86 T;  2R8K A;  2NXU A;  1MU2 A;  1H7X A;  2IAJ A;  2J7U A;  3IR7 B;  5ETO A;  1UPM B;  2IMO A;  3QZ8 A;  3DLG B;  2MZT A;  5JVG Q;  3MM6 B;  4ED6 A;  1D3W A;  2LP4 A;  2CZV C;  2MKH A;  2UXB J;  4XTT A;  5ETR A;  4PG7 A;  2E1M C;  4WPA A;  4B3M J;  3AQO A;  5D78 A;  2E9R X;  1RE1 B;  1MW7 A;  1VYA A;  5KFZ A;  2UXD F;  1REV B;  3UDC A;  2H54 B;  2CQD A;  4G1I A;  1S9G B;  3OV7 A;  3P6Y C;  4HDH A;  1KP6 A;  4USU A;  4N47 A;  3CUN A;  4XDD A;  3CT9 A;  2FHO B;  2LVW A;  1R8P A;  4GMK A;  4JBC A;  4LRA A;  2LEB A;  1RT2 B;  3GYG A;  3MR7 A;  3LGM A;  1NU4 A;  2FQQ B;  3KLH A;  4OJH A;  2R7U A;  1Z1Z A;  4Q7A A;  2CQC A;  5DDP C;  4MK9 A;  4ZJO A;  2OEJ A;  4BHQ A;  1RAC B;  2PII A;  2QL7 B;  4RUA A;  3HVW A;  2W24 A;  5T41 A;  3T6J A;  1N5Y A;  1M5P C;  1YJN S;  3CB4 A;  2UVU A;  5DDQ C;  4JI5 F;  4ZVR B;  4NLS A;  4WK1 A;  3T41 A;  5KFT A;  2OPR A;  3KJN B;  3SCK E;  2XMT A;  4IFV B;  4RJV A;  2YQ1 A;  3HKW A;  1RKJ A;  4B3O B;  3MUM P;  1XNQ J;  3MPV A;  1ZH5 A;  4K4U A;  1D09 B;  2DIV A;  1PBA A;  3HHD A;  3M8Z A;  3CCT A;  4M5L A;  4Q2L A;  4ZDN A;  1KQS R;  1C1C A;  2B9E A;  4FVC A;  2AT1 B;  2NZC A;  5THW A;  5LJ3 Y;  3VGU A;  2AJ2 A;  1KSP A;  1FE4 A;  1T95 A;  2Q43 A;  2X1B A;  1VIS A;  1MN7 A;  2HND A;  5HBM A;  3QGG A;  1CQM A;  3CE8 A;  2Z2M A;  4IFY A;  2PC6 A;  1GT8 A;  2FDN A;  2IM3 A;  4H4O A;  1IKV A;  3CJ0 A;  2DR6 A;  3ZTP A;  2QLJ B;  2MEW A;  2OPQ B;  3HVT B;  5KFS A;  4E0D A;  3CCS S;  4EYH B;  2A6O A;  2AD9 A;  4ALZ A;  3NMR A;  4DR5 J;  2ZH5 A;  4Y0F A;  2M3D A;  2YKO A;  3FCW A;  4USW A;  3K59 A;  2DXF A;  4OHZ A;  1CS4 B;  2CZ9 A;  4RU9 A;  3M9N B;  2UUA J;  2VFS A;  2VFT A;  2AEM A;  1H73 A;  1X8D A;  1LWX A;  2PDA A;  3OHB A;  2K3K A;  5CCM A;  4RBT A;  1WC3 A;  3R9L A;  3H90 A;  4L3N A;  4OYP A;  1CJV B;  2GVZ B;  1S6O A;  3TJ9 A;  4DR7 J;  2C2N A;  3G6Y A;  2EPI A;  4Q2M A;  4YR0 A;  2I9S A;  5E41 A;  3RJM B;  5L1I A;  4KY3 A;  1HL6 A;  4FS1 A;  2B7B B;  2VBX A;  4YEA A;  4DJB A;  5I3U B;  3R2C J;  4DZ6 A;  4OV6 A;  4F67 A;  2R2U A;  1CBK A;  2MPU A;  1TKZ A;  2R2S A;  1IWG A;  3IR6 B;  3QJJ A;  2DGW A;  2KXF A;  2ROE A;  3H2L A;  2AJQ A;  5CQG A;  3M2U A;  4KYZ A;  4NLX A;  2W9C B;  1PYT A;  3ILI A;  4HDG A;  4QIF A;  1KDN A;  4KJI A;  3RAM A;  2MHN A;  3FEY B;  1WOR A;  4HTI A;  2J9D E;  2WVF A;  4OZ3 A;  1S1T A;  5BR8 F;  4LVN P;  1R0A B;  2OPS B;  2QT7 A;  2RIJ A;  2NR0 A;  3PJW A;  4CO0 A;  4Q8F A;  4L3K A;  4OI4 A;  2LMI A;  4UZC A;  2K06 A;  2BJ3 A;  1VCT A;  4GVB B;  4A48 A;  5L46 A;  4YR2 A;  1M1G A;  2AYB A;  4ED8 A;  2HBY B;  3GJT B;  3DMJ B;  3KJV B;  3OFH A;  5KFY A;  3W9H A;  3RRH A;  4I7F A;  2DNG A;  4ECT A;  3DRP A;  2YWG A;  2G2O A;  5C24 B;  3QAU A;  4OI3 A;  4LSL B;  2FJA B;  4K7Q A;  5HK4 A;  1O6X A;  1RKI A;  5IXU A;  4XPE A;  3G9C A;  1IR0 A;  2HQI A;  2U2F A;  2XLK A;  1HQU A;  4DL7 A;  4J9O A;  3NXZ A;  1VQS A;  3CJT A;  1PYS B;  4CLK A;  3I6P A;  5D4P A;  4EYI B;  4WZQ A;  2CPY A;  2BYC A;  3MD1 A;  3CSK A;  3C16 B;  3TJA A;  2WAQ D;  4KTQ A;  2B9X A;  4LF6 J;  1FEE A;  3JTN A;  4DPW A;  2GJF A;  3T5J A;  1JLG B;  2RRA A;  3PY8 A;  2CUY A;  2BJE A;  3N5F A;  1H2V Z;  5SZT A;  2DO4 A;  1L3K A;  2G2Z A;  2PE8 A;  3HHN B;  1U02 A;  2KYX A;  3ZZT A;  3KLG A;  3KLE B;  4Y2C A;  1H2T Z;  2GMH A;  2UUC J;  2ZHB A;  2JX2 A;  3JAM Y;  1ZM3 A;  2FJB B;  4RW7 B;  4EI2 A;  5J2N B;  4ETZ A;  5GAG I;  3QSY B;  4NI2 A;  1S57 A;  2W2P P;  4C8N A;  1LXN A;  4FXW A;  4CO5 A;  2VG6 A;  3EGW B;  3I0R B;  3US5 A;  4DV2 F;  5HMW A;  1RZM A;  2EXU A;  4FF1 A;  4EBD A;  2D69 A;  3KG0 A;  4AFF A;  1U47 A;  3PIO Q;  3MGJ A;  4IR1 A;  3PHT A;  3E51 A;  3ISN D;  2C2Z B;  3MEC B;  4ZHR A;  4B3R F;  4U6P A;  3MED B;  5CD4 A;  2MLX A;  2E5L F;  3DRR A;  1HIY A;  2PEH A;  2EWH A;  5F0U A;  2GVD B;  2H51 B;  3C3L A;  4JI2 J;  2MKC A;  1V3R A;  3ZNJ 1;  1NME B;  2XGP A;  2OSQ A;  3V4I A;  1VQO S;  4OHV A;  2LXI A;  4JI0 J;  1WG1 A;  3P8B B;  3ENQ A;  1U2F A;  1U09 A;  1RU1 A;  3IG1 B;  5D4O A;  3N79 A;  4DR2 F;  2MZQ A;  4WFY A;  1NCL A;  5GAE I;  2O1P A;  4JI3 F;  1DQ8 A;  2PFF B;  3B8H A;  2DGT A;  5BYS A;  2EC2 A;  5FD1 A;  4A8F A;  4K4Z A;  1YGY A;  1JLA B;  4KQZ A;  1IN0 A;  3VAL A;  3DRS A;  3KK1 B;  1M5V C;  1R0B G;  5FJ4 A;  4A8M P;  3H5U A;  2W4C A;  3OPK A;  2FJX A;  1KON A;  1DBD A;  3HJV A;  1YRX A;  1QTM A;  1R27 B;  3BSN A;  2V68 A;  2B3T B;  4WYL A;  3ZTR A;  4IKA A;  4K0K J;  2D74 B;  4LRD A;  3SV3 A;  3WDO A;  2HK3 A;  1DTQ B;  4HKQ A;  3ZZZ A;  4DSE A;  1WC0 A;  1ZZF A;  4QR0 A;  4IDK A;  3G6E S;  3QWU A;  1KVJ A;  1VQ6 S;  3FFI B;  4RX6 A;  4K8R A;  4M95 A;  3HLU A;  2YNF A;  2FPH X;  1FRI A;  2A3J A;  3QLH A;  3ADA C;  4F4X A;  1W2I A;  2DK2 A;  2HRU A;  5K8N A;  4F0K A;  3BQ2 A;  2KXH A;  3OXL A;  4QPX A;  2HWI A;  3Q8S B;  1FD8 A;  1C0T A;  3BBC A;  3LF0 A;  3NLC A;  2VG5 A;  5CZV A;  3R97 A;  1WDD A;  2C3P A;  1EJ7 L;  5A8R A;  4IO9 Q;  2CPI A;  2RDI A;  2BQ3 A;  3ISZ A;  1SIW B;  5CYJ A;  4UZB A;  3V6K A;  4F36 A;  5LMN F;  4O4G A;  2JEJ A;  3JQM A;  3SCJ E;  1SH3 A;  4F02 A;  1PSD A;  1UL3 A;  2LKZ A;  2X51 A;  3HHL D;  3W8P A;  3CCE S;  3MFH A;  1JJ2 R;  2UVR A;  2CG4 A;  3MMC B;  4W98 A;  3ELH A;  5FLX U;  1ZTW A;  4DV4 F;  1JLB A;  4OX8 A;  5ETK A;  4AD6 A;  2MQP A;  4KHP F;  2Q1L A;  5C2G A;  3TAN A;  1SJ4 P;  1VS3 A;  1TL3 B;  1YSJ A;  4ED2 A;  3EXC X;  5C42 A;  4KB7 A;  3EPI A;  1V6H A;  1I5O B;  4V1A k;  1HMV B;  2VH7 A;  4ZVU B;  5J1N A;  4ILL A;  4Q0B B;  4B9U A;  2YVS A;  1WHY A;  3EGV A;  1QSY A;  2UUC F;  4LF7 J;  4NLR A;  5KFV A;  2MSS A;  2HQC A;  5T7L B;  5BJR A;  4K59 A;  2FYX A;  4JV0 A;  3SIP B;  4DL0 C;  2KYZ A;  4PKD B;  1FJG J;  3AJ1 A;  3QT7 A;  4F25 A;  1SUQ B;  1HNX J;  2QGF B;  1JX4 A;  4QZV B;  2WK4 A;  3M8P A;  3R1L A;  4W90 B;  3M30 B;  2HG4 A;  3M2R A;  4WWS A;  4Y2A A;  3T19 A;  1RXO B;  1PO6 A;  3I56 S;  3DXS X;  2K7J A;  2DNZ A;  2UV8 G;  3JYT B;  2V4Q A;  4IRD A;  3OD2 A;  2IC3 A;  2QLF B;  2VBY A;  2YKA A;  3FSY A;  7AT1 B;  1YG0 A;  3FBB A;  3UNG C;  1RSC A;  4OJ1 A;  1TL1 B;  4LR9 A;  2JLE A;  3OL8 A;  1S99 A;  1SPB P;  1SJF A;  3CCW A;  5B0E A;  4ZN3 A;  1UZD A;  1R7I A;  2EKY A;  2NXJ A;  4WFX A;  3H2U B;  1XC9 A;  3KMQ A;  3ZO7 A;  1X4B A;  2GX8 A;  4HTJ A;  3N6N A;  4I4B A;  5E2Q A;  2E29 A;  5RUB A;  4N5S A;  1B3T A;  2CNK B;  1DTT B;  2RAQ A;  3B4D A;  1WF0 A;  5U47 A;  5A8W A;  3ULH A;  3MMB A;  2HS3 A;  4JI3 J;  5F8N A;  3J81 Y;  4GKK J;  2OUG A;  1UVJ A;  1IKW B;  4KAI A;  4CWB A;  1SKS A;  3GP9 A;  1PJ6 A;  3I87 A;  3CJS A;  1IM6 A;  3RW6 A;  1TL5 A;  2JEG A;  1RT4 A;  4CO1 A;  4J9S A;  3BV8 A;  3DCA A;  2W9A A;  1TL7 B;  4MK7 A;  1FRH A;  3JSR A;  2IDL A;  1MMD A;  2ASL A;  1FWP A;  2WZ1 A;  2XMW A;  1N32 J;  2HGL A;  3DU6 A;  2Z58 B;  4F2S A;  1UJ5 A;  2BA9 A;  3LH2 S;  4M5G A;  5KFF A;  2F5G A;  4DF4 A;  4YB5 A;  3BKU A;  2JOQ A;  1U4B A;  1RWK B;  3TYT A;  4I67 A;  2EVZ A;  3MDF A;  3R6G B;  1SVD A;  3MM8 A;  3EJM A;  4O3O A;  2XYH B;  3PEH A;  3HO1 A;  1KLN A;  2QL9 B;  3M05 A;  2AX0 A;  3EZU A;  3TW0 A;  1NSQ A;  1VQN S;  2KFZ A;  2Q6C A;  2Z4P A;  5A8K B;  1N33 F;  1JLF A;  1RA6 A;  4KO0 A;  2V8P A;  5DG9 A;  1HBO A;  2HIY A;  2RNE A;  3T5K A;  4LF4 J;  5DDO C;  4WCE Q;  3KK3 A;  1HWI A;  3DI6 A;  2J6T A;  2VIH A;  3HZE A;  1U1K A;  2VON A;  1NPR A;  3KHL A;  4WJB A;  2C22 A;  4O23 A;  5C25 B;  3MM7 B;  4LQ9 A;  1S7H A;  3M2V A;  2HSE B;  2F4V J;  4MKY A;  4USJ C;  2X1F A;  2XSJ B;  2IVF B;  1H2U X;  3LGN A;  2APO A;  2CPE A;  4G65 A;  4ZS6 A;  2NLW A;  3QZ7 A;  2XEX A;  2BM1 A;  4K2X A;  3T3F A;  1CLF A;  3EM1 A;  5CYQ A;  4PG8 A;  2A18 A;  3LP2 B;  3EMT A;  3R8Y A;  1QLN A;  3BPD A;  3SXL A;  4FF3 A;  4ZVT B;  3FQL A;  4KKO A;  4ZP7 A;  2MGZ A;  3IBW A;  2GHV C;  4O3Q A;  4YY3 J;  3IO1 A;  5H9F J;  4TU7 A;  1RTJ B;  3KHR A;  3MPY A;  3BJY A;  2MKI A;  2HHP A;  4G1P A;  4TKT A;  4X62 J;  3DLJ A;  4DHV A;  4LFB J;  2F65 A;  1YBA A;  5DO2 A;  3MPW A;  1FE0 A;  3OR2 A;  4Z7C A;  4KSE B;  3M7V A;  4OYZ A;  1N5Q A;  1VQP S;  1G3O A;  3MMJ A;  3TR5 A;  4K4W A;  3R6L B;  1NJW A;  2DBB A;  4YP3 A;  2QG9 B;  3DGV A;  2FVC A;  4QQB A;  1WTF A;  5JJB A;  4ED7 A;  3T1Y J;  1IBC B;  3M8S A;  4NLU A;  1UEV A;  1SI9 A;  1SKR A;  2CFX A;  3I0S A;  3OFG A;  2A0F B;  1EZZ B;  4L74 A;  3TAQ A;  3EZ5 A;  3CJ8 A;  4PUO A;  2EBG A;  3NGT A;  2R7T A;  2XO7 A;  5EN1 A;  3UR0 A;  2BKP A;  2QX0 A;  1GXU A;  2PT0 A;  2HWT A;  4PXE A;  3QYY A;  2FJV A;  3DLL Q;  2IJN A;  3IWN C;  3HKZ D;  3PW4 A;  2P9E A;  4Y65 A;  2Y0B B;  1RT5 B;  3H7H B;  4OI1 A;  1R89 A;  5KFU A;  5KFO A;  3IN5 A;  4FNI A;  3PKY A;  3DLK B;  2WSF C;  1AB8 A;  1FKO B;  1VMB A;  3IWX A;  5L9X A;  3GV8 B;  3TZX A;  5D0E A;  2Y1I A;  1T0T V;  2BW2 A;  5F8H A;  2JHE A;  2CVI A;  1BGX T;  2OH2 A;  1YJR A;  4B3S J;  1F5A A;  4F3O A;  1UCN A;  4U96 A;  1V3Z A;  1ZPW X;  3J7Z 5;  2DCU B;  4EBE A;  2VG7 B;  3H59 A;  4DV1 F;  3DLG A;  3VAM A;  1PC4 A;  1Q79 A;  5AE1 A;  3RB3 A;  4AQY J;  1NND A;  3MM6 A;  4RBU A;  3MM9 B;  1FK9 B;  3OTD A;  1XNR F;  4YME A;  1S77 D;  4ZCM A;  3P96 A;  1REV A;  3MWB A;  2D3U A;  1FDB A;  4ILR A;  1NUE A;  4ELU A;  1ZAX A;  2VDI A;  3NOC A;  3GIM A;  2ZNY A;  3OFF A;  4X4V A;  4ETX A;  5ETN A;  2XTJ P;  3HFV A;  4YB7 A;  2HHV A;  1IBL F;  1Q8K A;  1XIQ A;  1YRT A;  3AFG A;  3KLH B;  1NK5 A;  3M6W A;  5G0R B;  4RW9 B;  2E1R A;  1MWQ A;  2GMJ A;  3U7J A;  1FRL A;  4FVM A;  2FGC A;  4M5N A;  1ZTT A;  1NKC A;  1NK0 A;  1A9N B;  4M5M A;  5AE3 A;  2ZBI A;  4B9S A;  3NG8 A;  1Y9O A;  2F7V A;  4KT0 C;  3TEG A;  3KOA A;  2DH8 A;  2GQ2 A;  1W7W A;  2ZC3 A;  4AUK A;  1SL0 A;  4AE5 A;  4B3O A;  2HAF A;  2F4V F;  1RAG B;  1YZ7 A;  2MY7 A;  3SSS A;  1F0X A;  1JMT A;  1OQ3 A;  2K2P A;  1Y4Z B;  2R4F A;  4G3I A;  4HH0 A;  2CDQ A;  1FTR A;  2WSC C;  1U48 A;  4A8O A;  4KFB A;  3CO0 P;  3JB9 k;  1JXL A;  4RNF A;  3PRB A;  3EVM A;  4H4O B;  2HBQ B;  1IKV B;  2G9O A;  4B3R J;  2AZ1 A;  3LOU A;  3VCD A;  3HVT A;  1WI6 A;  1IBM F;  3IBF B;  1WD6 A;  2QV6 A;  2BW7 A;  2CJB A;  2RML A;  2YQ0 A;  3ZTS A;  5HMY A;  3RR8 A;  3FQK A;  5D4N A;  4BCA A;  4X62 F;  2JLG A;  2HYI B;  4IOB A;  3N01 A;  2XZT B;  3NL0 A; 
#chains in the Genus database with same CATH homology
 2Y8Y A;  2Y8W A;  5CD4 A;  3QRP A;  4QYZ K;  2Y9H A;  4DZD A;  5H9E K;  1WJ9 A;  3QRR A;  4U7U D;  3QRQ A;  5H9F K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...