3QRPA

Structure of thermus thermophilus cse3 bound to an rna representing a product mimic complex
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
214
structure length
214
Chain Sequence
b'YFQMWLTKLVLNPASRAARRDLANPYEMHRTLSKAVSRALEEGRERLLWRLEPARGLEPPVVLVQTLTEPDWSVLDEGYAQVFPPKPFHPALKPGQRLRFRLRANPAKRLAATGKRVALKTPAEKVAWLERRLEEGGFRLLEGERGPWVQILQDTFLEVRRKKDGEEAGKLLQVQAVLFEGRLEVVDPERALATLRRGVGPGKALGLGLLSVAP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein TTHB192
publication title Recognition and maturation of effector RNAs in a CRISPR interference pathway.
pubmed doi rcsb
source organism Thermus thermophilus hb8
molecule tags Rna binding protein/rna
total genus 53
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2011-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08798 CRISPR_assoc CRISPR associated protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1200 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Crispr-associated protein; domain 1 3qrpA01
3.30.70.1210 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Crispr-associated protein; domain 2 3qrpA02
3QRPA 2Y8WA 3QRRA 4U7UD 4DZDA 4QYZK 2Y9HA 5CD4A 5H9FK 5H9EK 3QRQA 1WJ9A 2Y8YA
chains in the Genus database with same CATH superfamily
3R6LB 3EXYA 1QVFR 4I7FB 2NQPA 3UVJB 3R5GA 1KLMB 2OFHX 2H48B 2HS4A 4BC9A 2LA6A 3SCLE 3DLKA 1FFGB 1RUSA 2WBRA 2OEJA 2G9OA 1NLKL 4QYRA 3I56S 2Y1LB 1MROB 2PO4A 4DV0J 4JI3J 4IOAQ 2D1CA 2EFQA 2H4WB 5G0RA 1LW0A 3NS5A 4TYAA 4ZK7M 4EUVA 2J6SA 4MKVA 4P7VA 4RWXA 3LWLA 2V8PA 1L3UA 4LBPA 3I5BA 2NZCA 4ICLA 2J7UA 2DXFA 1MN9A 1YK9A 5MAOA 4AFFA 4USMA 2ZZMA 4OYIA 4DV6J 1YRTA 4M5NA 2G1DA 3DRSB 5A76A 2PEBA 3G87A 1CJKB 1DBDA 3OTDA 2W9CA 2C42A 4ED6A 2RD5C 2KXHA 1WD6A 5L46A 3GG0A 2X51A 4ZVGA 2UVWA 1X4GA 2BR0A 3HHDA 1T9TA 2ZBCA 3CCQS 3OSNA 5DG8A 4CNYA 2C22A 1S1WA 2FJDB 3UPFA 4DN0A 2R9LA 3FNNA 1Q81T 1GTEA 2B4PA 2VH7A 4DV1F 2F8MA 1D0EA 3OR2B 4NXMJ 5F0WA 1HQ2A 3CIZA 3H5YA 3KLGB 4E2FB 5F8MA 3ZTRA 2CRLA 4YP3A 4LF6F 1SQFA 1QAXA 1URNA 5A0YA 3CPWR 2IYIA 1C0UA 1MW7A 1HNZJ 4WXWA 5EX3A 2VUGA 1Y9OA 1DRZA 1QTNB 4J5OA 4QIGA 2JC1A 3QO9A 1VDHA 3FMBA 1XN9A 1M5KC 2GVDB 3MPUB 5SUHA 1RT5B 3CUNA 3D1QA 3DC2A 2FJBB 3TJ8A 5HJXA 1CULB 3RBZA 2R2SA 4F3OA 1VRUB 4M5LA 1VLYA 1ZOTA 1EAYC 1RWVB 2HVIA 4KSEB 4X84A 1UWBA 4IG0A 4DSJA 2EI5A 3VQSA 2LU1A 4DSKA 1S9EA 3N0VA 4U95A 1SKWA 2XS5A 2PI4A 1TAUA 5C25B 1WSRA 4OI4A 3TVKA 2FJXA 3I9V9 4USJC 2BE2B 3QT5A 4RJVA 1RT1A 3NGRA 1RWXB 2LDIA 1UETA 2IAJB 2H4YB 2QSWA 2RILA 2YNIB 3N5BA 2H65B 3BGRB 4LIWA 2Z4PA 3Q8YA 3MEGB 4PWDA 1KHWA 1W2IA 4GKJJ 2J0QD 3KDOA 2MJNA 3MAAB 3U02A 2E7XA 3V4IA 4JOUA 1JLQA 2AQ4A 3E01B 7FD1A 4X4UA 2H5IB 3QSIA 2RU3A 3C15B 1T7PA 1IQZA 4PPDA 5KTQA 3CT9A 2V69A 1KWMA 5KG5A 4H4MA 1M0SA 1PAEX 2XO6A 4DCPB 1VQYA 3Q8UA 4A46A 4DL2A 4YHHJ 3H5XA 1NPKA 5J2PB 2GVZB 3VVTA 1QUVA 3BZQA 3G6ES 3BBCA 4QIFA 4CLZA 3Q8SB 3K5LA 2RUSA 1C1BB 2CQGA 2ZD1A 3NAIA 3DFEA 3O8WA 4JI6J 3IRXA 5IC4B 3PW5A 4WKRA 2XMWA 1XWLA 5A8RA 5KFEA 3OHAA 2K8GA 1IQTA 3S7RA 2YWHA 5F9LA 5F8JA 3ZZYA 4PR6A 4NLUA 1DLOB 1S10A 3RB4A 3KLIB 2FHKA 5CYMB 3IBCB 4DPUA 2ZHAA 2KRBA 2GHWA 2PMHA 3AD7C 4C97A 1S49A 1U1PA 2I0XA 2PA3A 4CH1A 5LMNF 3L3CA 4YDXA 4ZS6A 3DDKA 1NB2A 4RW4A 3DLGA 1T95A 4JB8B 2JJ4D 4ID8A 1KFDA 2GZOA 4FYYB 1EP4A 4Y65A 5KFGA 2BYCA 1YGYA 1RDRA 2BM1A 4LSLA 3GSDA 1EJ7L 2RQCA 1HNVA 1KR4A 1CLFA 1H72C 4LR9A 3BGLA 1FF2A 1YHQS 1P9QC 1WOSA 3C46A 2C2OB 1TU0B 1YJTA 3KG1A 3DRPA 4DQIA 1NPPA 3J7A1 4ETZA 4NLSA 2O67A 4IR9A 2XMVA 2GAGC 2GGPA 1RXOB 2B9XA 3ZFVA 2CA9A 4DV0F 3GJQB 4EU0A 4NLRA 4JI3F 4ZPDA 2QRRA 3GLJA 4PG6A 2ZKUA 2BUNA 4WYWA 3LGMA 4CYUB 3IR6B 3AODA 2KG1A 4USUA 1EHWA 1VS3A 3AQOA 4C3MA 3VAJA 3KMSA 4ZJLA 4DUZJ 4QIVA 2RKIB 4D3GA 4QU7A 1HA1A 4LVOP 3EZUA 3FJ2A 1HMVA 2Q3PA 1MWZA 2R7XA 3I4HX 2IA0A 5B0EA 2EBGA 2RJZA 5ITHA 1I94J 1NDPA 2HFUA 3HVWA 4JI4J 2IIHA 4IDKA 3MM7A 4DV6F 4PUOB 1IR1A 4RNHA 3FCVA 2ZH4A 3UWTA 1N48A 5KG6A 2AWZA 2FHJA 3IM8A 1Q7YT 1S1TA 1PYSB 2FVCA 1KEKA 1RT6B 1Q78A 4UY8T 4P71A 1AXQA 1GNKA 1IUJA 4NMXA 1SJQA 1Q8IA 4KKOA 5GAGI 3LGNA 3UNYA 4DPXA 4HT7A 2MHEA 7FDRA 4NLXA 1RK8A 1VQSA 2XWXA 5K8OA 3F56A 2KTQA 4NXMF 2JVOA 1S9GA 3FEZA 2DKOB 2AYBA 2ZBRA 5CYQB 3QZ7A 2OPQB 5ETPA 4WFZA 1H73A 2NCKL 1IM4A 4N7TA 1XMOJ 2YKPA 5KFWA 3K57A 2D3O1 2P9EA 3S8SA 1PILA 1Q7LB 1HNZF 1ZZNA 4OI6A 4ZHRB 2FC9A 3C6TA 4ZPCA 5D4NA 5HQLA 3D0HE 3SSQA 5GMDA 5HP1A 2MB0B 2ZUGA 1WC4A 3C6UB 3TR5A 3BN7A 1PAUB 2DT9A 1IR0A 4K2XA 4FPRA 3O1LA 2AW0A 4NX9A 1CC7A 4QQBA 2QLFB 5B0BA 3CB4A 2X1AA 4HDHA 1X0PA 2B4VA 4OHVA 1KS2A 3KWMA 4RU2A 3GFHA 2ROPA 5J1NA 1L5UA 2IJFA 4ITSA 4C8KA 3KK1B 2HHXA 4FYVB 3QFHA 1URRA 4MJKA 4X66F 2XI2A 5I3UB 2CNNB 1P1LA 2VBWA 5HAOA 3PJXA 4KQZA 1JQGA 1ZYQA 3ZZTA 4AL6A 5FIIA 2W4PA 1N6QA 1JWWA 3SFUA 4N8OA 1VBZA 3PKYA 4XO0A 2OIHA 3G8TA 2BW2A 3A13A 4O44A 2MKSA 1KOHA 4PEOA 4OZ2A 1UW4A 2N3LA 4WK3A 2WVBA 3CMQA 3QQCD 1LWEA 1U1MA 2M5YA 4QZVB 3TA0A 5GAHU 5BR8J 2MLYA 1IM6A 1JIHA 3BGUA 1R6YA 5RUBA 5C24A 2A3JA 3OTCA 2HVDA 4CI0B 4PQUB 4HI2A 3KUGA 1Y5NB 2FJWA 3BKTA 4PXBA 1FXLA 4GO7X 3NGDA 1V5IB 1U4BA 4YHHF 2UVUA 3MM5B 2UUAJ 3C3LA 2BJ1A 4J9MA 3PRDA 1ZM9A 2E1RA 4B9NA 1TKDA 1CEZA 1Q95G 3JQMA 3RB3A 2KU7A 4OZNA 2K2PA 2BBEA 1B0TA 2F8EX 2R2TA 4F67A 1CVJA 5HL7Q 2V4JA 5HROA 2OPPA 1CS4B 4PKDB 1UCNA 1FFSB 2BRKA 3MUVP 4JI6F 5KT2A 3DHXA 4WE1B 2VJUA 1DJ0A 3MI7X 3OVAA 4DPOA 3QT8A 4PYAA 3C8YA 1BQNA 1HBMB 4ZVQB 2IM3A 4KH1B 4USVA 1V3RA 3GB0A 4RBVA 3QGPA 2IMOA 2QMUB 2WOMA 4KO0A 4FXWA 1SH2A 2LKZA 5M2PA 2L9WA 4DR3J 1XTZA 1N5QA 5KFNA 4EZ9A 2MKJA 5L8RC 3DU5A 5F3ZA 1Y3JA 1DQAA 4V1Ak 5KFQA 1XC9A 4HACB 2F1FA 2OKQA 3IGVA 4EGLA 1B70B 1VIXA 2UU9J 2DNPA 4LT6A 1DTQA 1ZAWA 2J8SA 3VF0B 1AT1B 2RVJA 3DM2A 3MFHA 1F9HA 3PYDA 2PA8D 3PDNA 1FK9A 4OYZA 4ZPBA 1L3KA 1LFPA 1Y7PA 2P6TA 2RF2B 4RW7A 1FX2A 1WC3A 1HWIA 4K2JA 4MKYA 3AQPA 3SYZA 3FGVA 2ZOGA 3DRXA 3QT7A 1GFWB 2CPHA 2VC0A 3R27A 1W26A 4TVAB 4GC6A 3CCZA 3NOCA 4ZN3A 3HDSA 1RT3A 2MQNA 4K4XA 1O8BA 6AT1B 2XYGB 1WKJA 1Q0NA 1N5YA 3VZIA 3M6VA 2B5JA 4DUZF 4DLEA 4Z2XA 5HSPA 3UR3C 1RACB 3GYXB 1T9VA 5DZ7A 2PT0A 3GSIA 3M8RA 1VBYA 3KLEB 1UVNA 3V6HA 1I94F 1SUQA 3NGSA 3LANA 4JI4F 4ZVUB 1JXEA 3NBPB 5DQHA 4WJBA 5KFJA 2RSQA 2OD6A 3ZZOA 4NLYA 2YNHB 2LMIA 3RTVA 2VFTA 4M5DB 2Z56B 2QMWA 2W4CA 2OPRB 3UE2A 1JLAA 1O51A 4DXLA 4Y2CA 1FEEA 4ZPTR 2GAHC 4O3SA 2FYXA 4R8UA 1K0TA 3DLJA 3TARA 4HHJA 2XYHB 3TJAA 3W2WB 4UTGA 2GC8A 2N82B 1CG2A 3C16A 2BJDA 4J9LA 4LREA 1SH0A 4YFUA 4B9LA 1BQXA 1XMOF 1UFWA 2H51B 1FXDA 1S5ZA 3H42A 2XCPA 1RBOB 2DNKA 4K59A 4QR0A 1U49A 4U7UK 5KFHA 4NASA 3P45B 2XZTB 1O5JA 2HHPA 4Q44A 1VYAA 3NGUA 3TZYA 3KUEA 4TU9A 3K59A 1KDNA 2LQJA 1OSCA 1NM2A 4L6V3 1RE1B 2WB1D 4A8XA 4A8MP 5J2MA 1O6XA 1TUGB 1EETB 2DNLA 5KFIA 2POKA 2V8VA 3HSGA 5CHCB 3MF5A 2F9JA 1TKTB 1ZPWX 4F4ZA 1TP7A 5J1EB 5LSOA 4Y6IA 4Z37A 3K7RA 3JAMY 1BQMA 5HANA 1DQ9A 1TKZA 1TL1A 3UDVA 1FWLA 4H4OA 1NH8A 2AJ1A 5BXIA 3D1OA 2O01C 3EVMA 5B08A 1HPZA 1ZPVA 1HWKA 2HYIB 3CCTA 2ZUAA 4KT0C 3MMCA 2CPYA 2EPIA 1N56A 1HQUA 4C8OA 2E9RX 4EEYA 3US5A 1GH8A 2GQCA 1IKYA 1S0NA 3IC1A 4EBEA 1U2RA 2VV5A 4WIQA 2E66A 2FJAB 4RUBA 5LT5A 3B4MA 2G2YA 4KV8B 2DO4A 3R7NB 3TRGA 2AJ0A 1WG4A 5D15A 3NL0A 1HI8A 4AD6A 4YB1P 2KJVA 4IH7A 2RQKA 3ZC4A 2FVPA 5K8NA 3MUMP 4FF3A 1HWUA 3TYTA 3MEEA 3UN5A 2YNGB 1G7CB 4K7QA 1JLGB 4TXSA 4RBUA 9RUBA 2XB2D 2ZC3A 4RPFA 1RWNB 5K5MA 2UUAF 1T03A 4MIWA 1YBUA 1XR6A 1CQNA 3U1NA 2ZVSA 1D9FA 2CJQA 3CJKB 4K4VA 2KFYA 3NWRA 2WONA 1RHJB 3RRHA 5A8WB 1ITPA 1JXVA 1RZMA 4BCAA 4L75A 4MK9A 5LMUF 1TMMA 5DJBA 1UL3A 4HL9A 1B7YB 1J5EF 1RLCL 2UXDJ 2IJNA 3KJFB 3QRPA 1C2PA 1FX4A 1V5VA 3G6XA 5HLFB 2MKKA 4PQAA 2EFGA 3GJTB 2HMIB 4AQYJ 1VBKA 1N34J 2ZOFA 1D8YA 1A0OB 1ZAXA 1VHIA 4DR3F 4P9SA 4OI3A 4OLOA 3EDRB 4CH0S 3UDEA 4C8YA 4KHMA 4ATNA 3GIJA 3T5JA 4F36A 2V2ZA 2ZJPQ 3VGTA 3FFIB 4UOHA 2AGPA 2ZJRQ 4C3LA 2UU9F 3ISNC 4HT5A 3N6LA 2VG5A 2CPZA 5HO4A 3CSKA 4FVMA 4ZP7A 2W2NP 1FERA 1VISA 5CA5A 3KK2A 3JQJA 1LV5A 2ALZA 1ZH5A 2M52A 2HNDB 1L3TA 4FYDA 3ILLA 1H6KX 4LF2A 3M6XA 3BBBA 2HGNA 4G65A 3X3UA 1NXIA 1ZTTA 1WHVA 2E5HA 4U8VA 4C98A 3DLEA 4C8MA 1CPZA 1T9UA 4B3OA 3NXZA 2GS8A 3K8WA 4ED4A 3CO0P 2E7WA 2K3KA 4NE9C 3QIPB 1VQ8S 3RG6A 3T1HJ 1D9AA 4IO9Q 2GHVC 3FMWA 1M5PC 4OYAA 1VQ4S 2BXJA 3JYTA 2HFZA 1KQGB 1SVDA 4L76A 4H4KC 3FSXA 3L7OA 1JLEB 2DISA 2D9OA 5CCLA 2Y3YA 1S0OA 3PIOQ 3PV8A 5L38A 1EKRA 1VQ9S 3I5AA 4KY3A 1BLUA 2HAFA 4N56A 1RTIA 4CRJA 5H9EJ 2IDEA 3TQ1A 3K5NA 3DGVA 3LPYA 1SJFA 1NHVA 3DDNA 4UZCA 5AE3A 4DQRA 2B4OA 3CD0A 2XMUA 1IKWA 2YQ3A 2D41A 2KG0A 4QJVA 2E1AA 2K1RB 4ED5A 2KL8A 1F2HA 1S79A 4IKAA 2XLJA 3PX0A 1S9FA 4J7CA 4DQQA 4DG1A 3DLKB 1FDBA 1XIQA 3BN4A 4DV4J 2J9CA 1BXNA 4DJBA 1U0HB 3O3LA 4K4SA 4DSIA 1RQ0A 2A6OA 1S1VB 3CEDA 3W2VA 1AZSA 4M1KA 3G82A 3RB0A 3IA0A 2EEYA 5G0RB 2AYGA 1LW0B 2DR8A 1VQOS 1PG5B 4M5GA 2KFNA 1RTJB 1H98A 3I5CA 1VMBA 5D77A 3SBMA 3KHLA 4NLOA 1K44A 2VFVA 4OHXA 4FF4A 1NBEB 1Y4ZB 4OZJA 2Z2YB 1Q1KA 4O4GA 1UP1A 4DHVA 3ZNUA 4ICLB 4OHZA 1S12A 3AOCA 3K5OA 4YR0A 4RUAA 1ELOA 1MWQA 3QGHA 2BKPA 2ZBPA 5DETA 4ZPVR 2HVHA 2DHHA 1SC6A 4DR7J 4LJMA 2R7RA 1K47A 2NLWA 4FKYA 3Q2SC 3T41A 4DV3J 3NNAA 5KFSA 3MMAA 1M5HA 4C11A 3H4DA 2LEBA 5F0UA 3V6JA 3AH6A 2C3OA 1TL3A 2HGLA 1HD1A 4X4TA 2DNMA 3WZ0A 1NKEA 1FRJA 2ERRA 2KXFA 5IV3A 1E6VB 4NEYA 2V4RA 2CQIA 2X1FA 3RUBL 2CQ4A 3T1YJ 4CLUA 3I6PA 1X8DA 4NL5A 2BA9A 4RBTA 3G6VA 3MMJA 1IKVB 1R31A 2HVEA 1S76D 2AJ4A 3GILA 3OR1A 3QRRA 2C3MA 2V4QA 4Q0BB 2X1GA 4OMFG 2M70A 2NXEA 1SB6A 1A9NB 2GHPA 1T05A 4OIXA 1H2UX 3OPKA 3KK3B 1C0UB 1ROFA 4ER8A 1RGVA 3RRGA 3IBWA 3J7AN 1X9SA 1W25A 3QO9B 2BQ3A 2XQCA 2L41A 3W64A 5DRKA 4UZBA 4XK8C 4L3NA 1QJHA 2GW8A 2GQ2A 1OYDA 2WVEA 3IS9A 4F0HA 2CJKA 3CTRA 5KFPA 3A3OB 5K14A 3LO3A 1S7IA 2QL9B 4B9SA 2YKNA 4DUYJ 2PSZA 2EFNA 3ISND 3WX4A 3VGUA 3HX9A 2RRBA 3HF5A 3AD9C 3PACA 4IG0B 2M2BA 4O3RA 2UV8A 2C2EA 1L3SA 1CQMA 8RUCA 1FFWB 4KFBA 5F8NA 1X9MA 3CD7A 3EVWA 1F9FA 4NOHA 1OPZA 5L39A 5AE2A 1RT1B 2DNQA 2HWHA 4G1QB 1VC0A 2HNYA 4AQYF 2GFFA 1N34F 1X4FA 3MOZA 3PNIA 1CSJA 2KVIA 3W5XA 4WBFA 1GAOA 1WC5A 4PG8A 4OV1A 3T6BA 1HARA 4WZQA 1Q5YA 2YVSA 2IRXA 3ET6B 2RAQA 4HHUA 2HNZA 1OY9A 5U47A 3V4IB 1WWHA 1HQEB 3EYZA 1JLQB 3KOAA 4C7QA 4N5SA 4XDDA 2LQ8A 2KH9A 1TK0A 2ACMA 2DXEA 3PM9A 5C2CA 1FKAF 3WQPA 2GMHA 2HURA 4LVNP 1TFWA 1NKBA 3AFGA 1HNXJ 4ELVA 4UQTA 3N6MA 3HSZA 4H4MB 3KJVA 3VV2B 3A8IA 2DXDA 4N8NA 4ECXA 4K50A 2CDRB 2DCLA 4DL0C 1SPBP 1F5CA 2IM1A 2F65A 5D4PA 2ZDPA 2UXBJ 4CDIA 1JLCB 2RDDA 1R43A 3HPOA 4HEA9 3PCOB 1JLFA 3L7UA 2ZD1B 5B0FA 3CJQA 4B08A 2V0NA 5HBMA 2MEWA 5D3GB 3MMBA 1KOOA 2CPEA 3MTKA 4QW8A 2U1AA 2D7SA 3K0JA 4NLVA 3BQ2A 3T1HF 4P10A 1VK8A 4NCAA 2HPUA 4ZJOA 5IV4A 1LWCA 4I1TA 1W2BR 2XS7A 2XS2A 2P9CA 4FXVA 4N77A 1KBRA 2I38A 2ZH5A 1OY6A 1KRPA 3I0RA 3E8OA 2HLTA 3NNHA 2FHOB 1RT7A 4QIWD 3W60A 1N0VC 3BO4A 3BGFA 1B64A 1SH3A 1U6ZA 3I31A 2R8GA 1EP4B 3OUYB 2I8EA 1BUXA 1HI1A 3R7SB 1HNVB 4R5PB 3LPEA 3N5FA 2XLIA 4CIOA 3IMQJ 3M2VA 2VB6A 4DSEA 3MPYA 4GO5X 5ETNA 4KYZA 1ZAVA 4WPAA 2FJEB 4DV4F 3RR8A 3HP6A 3MR2A 1WACA 4EMDA 2RB7A 3PRVA 2OPSA 2MZTA 1EKSA 3FC9A 2FB0A 1J5OA 4MKAA 2ZH8A 5DGBA 4OYMA 3BYRA 5F8IA 1RAJA 4LSNA 4ED0A 3GG1A 1M5OC 3NP5A 1HMVB 2AMCB 5KG7A 4ZOSA 5CH7B 3P49B 2H54B 1GX5A 2G0CA 3V4MA 2RMLA 3PRBA 2Z2MA 4LF1A 5LSRA 1YJUA 5FLXY 2HBRB 1H7XA 2PE8A 2R8IA 4DR7F 5D0HA 4YEAA 2GIQA 4LFAJ 4ZKAA 4WU2A 5E41A 1FHTA 1FRMA 3LP1A 4DV3F 2J5AA 3LP0A 1CBKA 4C0BA 2YXLA 1S1TB 5L9XA 2CXEA 3GPAA 4LRDA 3Q89A 3KXDA 3W66A 2B4UA 4UOFA 1PJ7A 3NY0A 4KKOB 3QNWB 5KT4A 2GJIA 2D69A 3T1YF 1B7FA 3F73A 3A4TA 1S9GB 5KG3A 1REVB 3DCAA 1YJ7A 8ATCB 3NS7B 3IXQA 4LF7J 1OSDA 1KVJA 3KLHB 1T3NA 1Y00A 4NLPA 3FEXB 3GJRB 1EIYB 2R7TA 2RU9A 3ILJA 3SV4A 2BVZA 5AXKA 1KFSA 1MWYA 1PBAA 4CQ1A 1BWEA 2JEIA 4ZN1A 3PEHA 3IR7B 4TY8B 4OX9J 3CJ5A 5G4DA 1FI4A 1RCXB 2NYIA 3MUTP 5HP1B 3GE9A 5HI7A 1QE1A 1WELA 1GXTA 2Q43A 5I3PA 4B3TJ 3JQKA 2MGZA 4DUYF 3HVTA 4WK1A 3PR4A 3M32A 1S48A 4TQRA 4I0WA 3DOMB 1R89A 1I6JA 1N33J 3QMQA 4F4WA 4I2QB 5I42A 3GTYX 3BS9A 5J2NB 2W7OA 1YIJS 2WSFC 2HVZA 1F5BA 2IHR1 1YDLA 2CQ2A 3CC4S 2JEGA 2W24A 2EG2A 4L3KA 3LP2A 1AUSL 2QL5B 2CJ9A 2V5HG 4CCHA 1RA7A 2KB2A 1QDUB 3OTEA 2YBVA 4QWDA 1N6QB 2PMZD 4I7FA 3UVJA 4B9VA 3SQGA 2FIUA 4C8LA 1KVIA 2FC8A 2YTCA 4O44B 1U6FA 3MEKA 2XMAA 3KLFB 1SCJB 3CJ3A 4DL7A 3W9IA 3TO8A 1BY9A 2PFFB 3CCMS 2C2ZB 1QD1A 3D28A 1UJ4A 1N5TA 1SQEA 1RAIB 1LWEB 2Z2LA 4OZ3A 1WEYA 2CAJA 1NSPA 2V8GA 3EDQB 3OT9A 2WW4A 4FF1A 2HSEB 1KC8T 2YH0A 4P2FA 5C24B 3NKYA 2YWKA 1HNXF 2ZM6J 1T9XA 3QT6A 2AU0A 2LEPA 2DITA 3DI6A 3BPSP 3PW4A 1UZHA 2BJ3A 3VAKA 2LDYA 4TKTA 3VR1A 1BHNA 2JL9A 2JZ5A 1K73T 2PIIA 4C6AA 2ASYA 1VC6A 3IG1B 2UXBF 4KPCA 1LK7A 2ZOMA 2XNRA 4J9QA 3OTOJ 2V4JB 2OPPB 1X4HA 2DVIA 3J80U 3VAMA 3T5KA 4P7TA 2B0GA 2VZ9A 4DOZA 3H25A 4C0HA 2WBMA 3UDCA 1BQNB 3EGNA 1PBUA 4F4AA 1RABB 5HVHA 3SFGA 5KFLA 2HBYB 4KO0B 7AT1B 1RISA 4WFAQ 1PGZA 4K8RA 5MLCV 1OS5A 4ENOA 3TX0A 3OR2A 2E9ZA 2H9ZA 4KGXB 1U48A 4FF2A 3KLGA 5GAHI 1WI8A 3EGWB 3PIPQ 4IO1A 2DJWA 2YKAA 5DLGA 2CPXA 1QSLA 3U27A 2WW8A 4OZ5A 1APSA 1FKOA 1K8AT 2C2RA 4DX6A 1VGYA 1RWKB 3B82A 1DTQB 2F9DA 3MD1A 2IDLA 1GXLA 4QR1A 3DM2B 4D3HA 1S0MA 2Y0SD 3A1YG 2ALYB 1FK9B 2GVDA 3TW0A 3TAQA 2NXJA 2HQIA 3H4BA 5JJBA 2EXUA 4F25A 2E5GA 3DRYA 2XY5A 2LLZA 1CULA 2D3ZA 3LTOA 2CZ4A 3K5PA 2MLXA 2VU5A 1VRUA 4RNMA 1TK8A 4LQ9A 2HZVA 4DL4A 2X1BA 3EICA 4YR2A 3CULA 2CZ9A 3CCUS 3CIMA 1RAFB 2OUGA 2F63A 4B3RF 3MAQA 1RT3B 1ZTWA 1UAWA 2YWEA 1VQ5S 3C2PA 3IWNC 2NPIA 2L08A 2HW3A 1VRTB 1N5YB 3SSRA 2W25A 3BPDA 2I1RA 2QLBB 3M4XA 3W9JA 3C14B 2AEFA 3ZTPA 2DCUB 2BE2A 2OSQA 5IC6B 5F41A 5I3QA 1HBUA 1IN0A 4W90B 5AXNA 5F8LA 2ZC4A 3DHWC 4ED3A 1HYSB 4OI0A 1RAHB 3BGRA 4IG3B 2BMBA 2I6WA 1X5OA 4LFAF 1GQEA 2C1EB 2D9PA 2CQ1A 5D78A 3CE8A 1DTTB 3EJMA 3CDAA 4QCLA 3OBIA 1MNEA 1PJ5A 2XMJA 5BYSA 2IC3A 1OWXA 1GTHA 3MAAA 4YDDB 5JXSA 2FZGB 1FVSA 2G1HA 3HHNB 3EXCX 1YBTA 4J90A 3CJ0A 4YQWA 5C42A 3E01A 2QO3A 1SV5B 4AUKA 2EKNA 5DGAA 3HJVA 5H9FK 2HEKA 1IVZA 2QIFA 4CM0A 5CXTA 2R8JA 3TOQA 3UN2A 1FRXA 4R8UB 4NRUA 1IBCB 2ZZNA 1YITS 3CC7S 1D9DA 4QW9A 5ETKA 3GCWP 2Z8QA 2ZE2B 4OI2A 1VOMA 4KGVB 3AB4B 3C16B 5J2PA 4RU9A 3HO1A 2RRNA 4MIAA 1PYOB 4U9RA 3R2DJ 3M1VB 1C1BA 2W9BA 2LCWA 1U8WA 4URGA 5L1IA 3D6HB 1FNXH 4FP9A 2YWWA 4DCOB 4OX9F 5EGYA 4W4MA 2UVRA 4CLLA 1I51B 2XYPB 2VFRA 4NA2A 1AROP 3SZ2A 1SBRA 4XAKA 4OFZA 4YR3A 4B3TF 1H7WA 1TQLA 4ANEA 3I4PA 4E8UA 3D5MA 1BGXT 1CJUB 5HMWA 3M2RB 3EX7B 1N33F 1BE4A 4B17A 4EO8A 1TKZB 2R7UA 2JOQA 5CABA 4H4OB 3SQOP 3GV5B 3J7YU 2QLWA 3R5AA 4GC7A 3MOJB 2QC3A 1SJ1A 2PI5A 2DGVA 3TJ9A 2BEFA 4EO6A 1S4FA 2B7CB 1HQUB 4JV5J 5KG0A 3M8YA 4ECTA 2ZNZA 3CCLS 2GMLA 5KFOA 2A18A 2JVRA 3EGVA 3POTA 3T9ZA 1XERA 3QYYA 4RO0A 1DY3A 2YNFB 3AB2B 1L3VA 4DN9A 3QWPA 2ADBA 5FD1A 2B43A 5D6GA 2XI3A 4X4NA 4DZ6A 1GMVA 2ATLA 4OZ0A 1KKHA 4RW8B 2B56A 4CYUA 1VLOA 1U1QA 2FLOA 3DGPB 1AA1B 4HHHA 2ZM6F 4DWIA 2CQHA 2ZEJA 1R8AA 3PHTA 2M0GB 3MR5A 2DGOA 1NJZA 4USTA 4FS2A 3Q23A 4PZVA 4WP9A 3DRRB 2NYHA 3HD2A 1S99A 3BSCA 1WEXA 3OTOF 1MU2B 1RHRB 4W92B 2J9DE 4RW9A 3J81U 4QBUA 4DL5A 2A2CA 4PUOA 1NK0A 2RE1A 4I4BA 2OSRA 1F3VA 2V34A 3GONA 4FBUA 1FESA 2W01A 2BANA 3Q0AA 3M2UA 3M9OB 1R0BG 4QR2A 2QZ8A 4QU6A 4ZVTB 5KOWA 1X60A 4WCEQ 1NRKA 4CH7A 4DU8A 4TU7A 3THVA 3TNVA 1HI0P 4OX8A 2XBPA 2VASA 3WBZA 4OZLA 4LF8J 2V63A 1HBNA 3G86A 5K8PA 3B78A 4ZIWA 3J81j 4YB6A 3ITHA 3BKUA 4ZLJA 1S0VA 1LFWA 1HWJA 2V67A 2HBZB 3Q8PB 1EB0A 2FJVA 3VGVA 1T9WA 3FZ2A 1SL1A 2FLNA 4MT1A 1UJ6A 5KFDA 3VGSA 2FQQB 1F5AA 4XDCA 4I2PB 4IFYB 6FD1A 2VBZA 1RWUA 2OO4A 2N4DA 3IR5B 2LEAA 3KK2B 1RYRA 1WOPA 5THWA 1QAJA 1QM9A 1TL4A 2QL7B 1Q5VA 5DLFA 1R0AA 3RBDA 5C2GA 4F4KA 3C6UA 2R3VA 1Q8LA 1V6HA 5BYRA 4QYZK 1YTYA 2OMLA 4UUXA 4CLYA 5LSLA 3DLEB 4ZITA 4B3OB 3M7VA 2A6MA 3G9CA 5LOQA 1IKXB 1U24A 4C3KA 5E0OA 4X66J 4JYAJ 1NAQA 3KK1A 3RAQA 2BJ8A 2FY1A 2R8KA 4CT8A 3FBFA 4ALZA 5FJ4A 2WAQD 1C1CB 5FDLB 3ENQA 2N7CA 5I3UA 1VQLS 4KB7A 3JYTB 1MMNA 1RA6A 3RAXA 3MPDA 4BS2A 1KHVA 1FRHA 2YWFA 4DZDA 3KHRA 2VDHA 3D3CJ 3KG4A 2QA4S 1FT8A 2XMTA 1FNOA 2MSSA 3MPWA 2AF6A 4MMOA 2CADA 2KXNB 1FJ7A 4I64A 1J27A 3HHKA 4LRCA 5DQGA 4F7VA 2M3DA 1Y5IB 5F8HA 4QPTA 4JV1A 4A8WA 2VPXB 4EI2A 3KMQA 5KFUA 3MEDB 2VPYB 4ZLLA 4I6WA 5EDWA 3THPA 4CZCA 2KT2A 4PQUA 3MXHP 4IQMA 2F8HA 5IT9U 2CNKB 4O23A 4DG1B 1M1HA 5K8MA 2LU2A 1DQ8A 4KTQA 4JV2A 1QY7A 4X4QA 4DPTA 3A3PB 2L3MA 1KLNA 4LQ3A 5A2QU 3AD8C 2JC0A 2PN6A 1TVRB 4OZ1A 1P27B 3SCKE 3U7JA 2DR5A 2UVVA 3DXBA 4ZVPB 1X4CA 3PO5A 4WFBQ 4EBDA 1CS4A 2MYFA 4NI2B 2LECA 4WIIA 4LBHA 3M30A 2HHQA 3UCUP 1Q16B 1N4LA 3DOLB 2L9DA 4LFBJ 4FBTA 3GR1A 4PG7A 1HBMA 2JWNA 2HAIA 5HMXA 1KNZA 3QBCA 3P5TL 1FE0A 2QFIA 1Z2LA 2DRDA 2J9DA 1IR2A 5DQIA 2MY8A 2IM2A 3FBEA 3NAHA 4MK7A 1U1OA 2QMXA 1RB0A 3DOKB 2XCAA 4DR4J 1LK5A 3R5BA 4O3QA 2J0WA 2O66A 4J9KA 1PCAA 2MY7A 4C11B 1FEHA 2AT1B 1X9WA 4DS4A 4HACA 4NZ7A 1VJWA 4NLQA 3VQTA 4WXOA 1FXRA 3HULA 3RAMA 4OJHA 3BKFA 1HW8A 2DO0A 3QFWA 3TI0A 2EFOA 4JV5F 4HH0A 2YX1A 2R2UA 1VQ6S 4S0MA 3H59A 4WF9Q 2I5JA 3PFOA 1VQPS 2HZAA 3OR1B 2Z0GA 1ICEB 2RRAA 4BC7A 1B0PA 1RT4B 3HKZD 2KZMA 2DH8A 2CQBA 3AXMA 2JFDA 3J7Z5 4K5SA 4GVBA 2AYMA 4CO5A 1Q4RA 3S1TA 3MR7A 2VF3A 3GFXA 3Q24A 1RT2A 2XZWA 1NCLA 1Q8KA 3OFFA 1SXLA 3PKMA 3CJ2A 2ZZTA 2W4DA 2FTRA 3MCNA 4Z7CA 4G3IA 3P6YC 2P2CB 1FKPB 2VOPA 4GMKA 3V6DA 4ZVRB 3EGZA 2IPOB 2Q6CA 5K14B 2MQPA 4Y2KA 4OQJA 2VPZB 2OFGX 4Q2MA 1Q79A 1UPPA 8AT1B 3CGIA 1FRKA 3NBPA 3ZTSA 1S6UA 4QPXA 4FDFA 2E1CA 2IY5B 4EBCA 2KFZA 4R25A 2JHEA 2HRYA 1UPMB 4USIA 4K5RA 3OV7A 2Y1IA 3B4DA 2VONA 2J6TA 4M5DA 1NHUA 2KYZA 3BREA 3CDWA 2OPRA 1LW2A 2X3DA 4LF8F 2VC1A 3IP0A 2NXNA 2CQDA 1CJVB 5JVHQ 3AA9A 1V9OA 3PJ9A 2R7QA 1HW9A 2YH1A 2V8DA 4PWUA 4LRFA 2DHAA 4A8QA 3TQEA 1N5SA 1RTDA 2LQBA 4LBIA 2FDNA 2VG7B 1R8PA 2FLLA 2YX7A 4YS2A 4UUWA 5E3QA 5AXMA 1VQMS 4ERDA 3BH6B 1Y0HA 2DY1A 3DU6A 3L4BC 2XEXA 4ED8A 1NJXA 1S59A 4OJGA 4M5JA 1CJTA 5IS2A 4KH0B 2Q6BA 1RTHA 1U02A 1EETA 1NK9A 2GJFA 3L95X 4ECVA 4NA3A 4OX7A 4X4RA 4MTPA 3LW5C 4EZ6A 2HQ3A 2RT3A 5K9FA 1VHFA 2RQMA 5ETMA 3BJYA 3L9ZA 2J6UA 1N5VA 2QV6A 4NLWA 2DRBA 2G2ZA 3CXCR 2W2MP 3MMBB 1X4DA 4ED1A 4DEZA 1U1RA 1GMWA 1S77D 4TY9A 1JJ4A 1TV6A 5IQ6A 3W9HA 1GX6A 2Z30B 5LXRA 2VA3A 4JYAF 2C3PA 2ZFHA 4ZP6A 5CD4A 2MQMA 4X65F 1YJWS 1JJHA 1XJWB 3ZO7A 4BLGA 4DPYA 3V6KA 4ES3A 4NA1A 2EVZA 3KNGA 1NSQA 3T5LA 2DIUA 3H5UA 4FS1A 5CCMA 2YX4A 2N4CA 1X5PA 3CDEA 1SL2A 3HHLA 3R8YA 1RT7B 2BQUA 2GQQA 2QN6B 1YBAA 4Q8FA 3CD5A 3IRWP 2RHSB 5JMNA 2AYEA 2AD9A 4F3MA 1LWFA 4DU7A 4P75A 1UVIA 3DLLQ 5F9NA 2GO8A 4DX7A 1M5VC 3N4WA 4CP5A 3ZTOA 2MQLA 3KHGA 2YKOA 3BGOP 1TL7A 1A6LA 4RWWA 2DBBA 2YNGA 4NCGB 5IZHA 2DIVA 2UUWA 4Y2MA 4IFVB 2HBQB 3NEKA 4F02A 2R8HA 4KGZB 5A6WA 3MM9A 3HFVA 5HJYA 3BYPA 3O2IA 4IH5A 1Q82T 3CJKA 3VVUA 3GFYA 3OVBA 5CZVA 5LMUJ 1FDAA 1FRLA 2DGTA 5A8WA 3D2WA 4WP8A 1K0VA 1J5EJ 4X4PA 2B9EA 3PW7A 3ONQA 2OEMA 4JI8F 2DHSA 5J2QB 2VL1A 1FE4A 4PG4A 4LFBF 5KT6A 1IBLJ 2E5IA 1X7VA 2QEXS 2FHJD 3P5BP 1XQIA 5HLFA 3OLBA 4QWBA 2Q79A 5DZ6A 1FVQA 3OXFA 2QA1A 2C2MB 1X0FA 2FZKB 1FD2A 2F3JA 4CWBA 2B6AA 2F4VJ 4DI6A 2XSJA 3DMJB 4UW2A 5KFMA 2O1PA 3LF0A 3KUHA 2COLA 2PD1A 4DFMA 2ACYA 4DR4F 1RLDA 3LP1B 3LP0B 4J9VA 3V81A 3CWJA 3OFHA 3GV8B 1JJCB 2AJFE 3AOBA 1UW9A 1S1XA 4E0DA 3OW2R 1HFEL 3D66A 3FFIA 3LH2S 3I96A 3Q83A 1VI7A 4KGMA 1C0TA 3M8QA 5DM6Q 1S7HA 1IBKJ 4P2MA 1SQGA 3MECB 3HVRA 1M5SA 3SCJE 1QAYA 2XULA 1ACMB 2VFUA 3FZBA 3SDEA 4ZCIA 1FTRA 2VKZG 2DNGA 4U6PA 3CDBA 5KFXA 3ILOA 4YB7A 3KDNA 3BR9A 5C5JA 2V2KA 2Q1LA 2XO7A 3QLHA 3PY8A 1TR0A 2HHHJ 2MKCA 1VK3A 2N7YA 3R3TA 3QJPA 1JMTA 2EBEA 4X2BA 1TAQA 1HWLA 1KQKA 2BDPA 2G2OA 2QLXA 5B0GA 4P74A 3CD6S 1XMBA 1IXKA 3ZZZA 2FPHX 3H98A 3RRKA 1YVFA 2WHOA 2XLKA 3K2YA 3M32B 4NYOA 4X4OA 4U8YA 5M2RA 5I42B 4JI0J 2MZQA 3JXOA 4Q2LA 3AJDA 3W8PA 3UDLA 5D8HB 3MWBA 3BSNA 1RBAA 2IA6A 3DYAB 3ILIA 2HRUA 3LP2B 4CM2A 3E51A 3RBXA 3T9NA 1SI9A 4HKQA 4KR0B 4K4TA 2BKNA 2YKMA 3NGKA 2K1RA 4DR1J 3IBFB 3O44A 1HHQA 2DB1A 3SQGB 2ASJA 5HMYA 1TELA 2CPDA 3CJTA 4ZP8A 4B9TA 3G8SA 4OLPA 4LMZA 1U0HA 4NZ6A 1FJCA 2IM0A 2E5JA 1S1VA 5DDOC 2WVDA 4Q43A 5D0RA 4LIRA 2V68A 4Y0FA 4JI1J 5L1KA 1YLXA 1UVJA 3ZTQA 2CG8A 3NMRA 1RTJA 2VOOA 3AJ1A 2IVFB 2XG8A 3QWUA 3DI6B 2OGUA 3KKFA 1R3NA 3JSMA 2Y9HA 3R7BB 4ZMMA 4CO1A 2ZWOA 2W1BA 1U47A 4DUTA 1U6BA 2ZWPA 4DBQA 2CDQA 4HYKA 5T7LA 2X3GA 4NZ0A 3HMJG 1F60B 1OO0B 2BKOA 3PO4A 3TANA 5B09A 4WFYA 3GWCA 2KKHA 3CCRS 2RS2A 3WC0A 1VQ7S 3FDSA 2MQQA 1YJ9S 3NCRA 4CO0A 2EG1A 2OEKA 2MZJA 3RW7A 3BF4A 3D68A 4PAAA 1WC0A 3HD1A 3C66A 4HR2A 3OHBA 1E6VA 3UN3A 2BX6A 1Y10A 2JLEA 2IMWP 2CPFA 2BJ7A 3ZNJ1 3Q86A 2XGPA 4FVCA 1IKVA 2BRLA 3HZEA 2K3IA 2KHDA 5GADU 5KFVA 4Q0BA 4KRWA 1N88A 2VBXA 3EPIA 4YMEA 4ID5B 1WI6A 2HS3A 2ROGA 3PX4A 2EC2A 1FKOB 1U1NA 1XEZA 3D6MB 3MR3A 3CCSS 1K9MT 1S1UB 3KK3A 2RNEA 3CF5Q 3SV3A 1BWVA 1N8RT 4JBCA 3OL6A 1H0HB 3OD2A 3D4JA 4CTAB 1HKAA 2E29A 5DS7A 5KT3A 3TUIC 2H5JB 5ETLA 4ED2A 5HQMA 3ULHA 1Y3KA 4ELTA 3FEYB 2G4BA 1REGX 3PYEA 3NOGA 2VDIA 5IM0A 3HFKA 4WTOB 2EWHA 4FNHA 3PXGa 5EWFA 1KTVA 1FTCA 1IBLF 2DGXA 3SEOA 1PSDA 4ZVOB 4DR6J 2WSEC 3IM9A 4M5HA 2UP1A 4G1QA 1HBUB 4J9PA 3N6NA 2RH3A 4DSLA 2R4FA 2E7VA 2F4VF 1NSAA 3M8PA 4XIUA 1XBWA 4KJIA 2HK2A 2M4MA 3FK4A 3PR5B 2GX8A 1TKXA 2K06A 3MM8B 2QJ3A 2V8HA 4DV7J 1PJ6A 1UZDA 5A6PA 1I5OB 1NDCA 4A48A 3ET6A 4CO4A 3SMZA 2IC3B 2CQ0A 1LKZA 1JB0C 1YSJA 4IUFA 3UD3P 1HQEA 2DNZA 3MURP 5C42B 1XR7A 2L9NA 5LJ5Y 3GQCA 4BWJA 1RTZA 3N28A 2FVQA 3IO1A 1XNQJ 3W61A 4W98A 1IBKF 2OAUA 4ECWA 1KVKA 2VQEJ 3M9NB 2VBYA 5KOXA 2YQ1A 1U2CA 5EUHA 3DXSX 3GV7B 1B0VA 4M63A 3QRQA 1P9YA 4P2XA 4R0EA 3VAGA 2ZHBA 1HLWA 3FKBA 2W7AA 1EARA 1JLCA 3I55S 1MG7A 1HD0A 2DR6A 2AJQA 5ADZA 2W9BB 3PHEA 3A8EA 5D3GA 2HRTA 1Q8BA 2DNHA 1E6YA 1NZAA 3GP9A 4L72B 5EX0A 2HHHF 5A8KB 5E33A 1VCTA 4I56A 2C2DA 3R97A 3IFEA 3FUYA 4OJ1A 2DGWA 3A8JA 3HI9A 2APOA 3JS9A 4X4VA 3W5ZA 3VAFA 1PYTA 1HBOA 4JI0F 2FHMA 4WWSA 5CAAA 1U45A 3BBFA 2BV3A 3R6GB 2NPFA 3L09A 3FSYA 1RHMB 3OUYA 1JNZB 4Y28C 4OYPA 2LXUA 2BE7D 5AE1A 3TAMB 4R5PA 3PYGA 3HKWA 4AXJA 4YB5A 3OL8A 4ELUA 1AUDA 1T94A 2FZCB 2R7VA 4PPZA 4DR1F 1SKRA 2LQ9A 2W9AA 3WC2A 1LWXA 2A0FB 2DNYA 3CMES 3BSAA 3POTB 1VJQA 4DX8H 2XWYA 3B54A 4PXDA 4M8LA 2UUBJ 4PRFA 4F0KA 1SL0A 5IOLA 2DGUA 3BO3A 2AHOB 3KJQB 4ECQA 1PKUA 4B3MJ 4JI1F 4C0OC 4YUDA 3TP2A 4USHA 1R8BA 1F9EB 4NYPA 3FSIA 2E1MC 5T41A 3CCES 5IT4A 2ATCB 3UW1A 1S6PA 4QIEA 3J7ZT 4DQPA 1X31C 1R8CA 2OLWA 1EQMA 3I0SA 3X1LB 3TEGA 3R1HA 2WSCC 2F5GA 1FO1A 1JXLA 1T8EA 2NSCA 3OFEA 4RL1A 1RYSA 3GR0A 3K89A 3M8ZA 3DLHA 2N3OA 3QAEA 1S6QA 4RW9B 3J7YI 2KJWA 2Y1RI 2BW7A 2W9CB 4URSA 1HR0J 1G6BA 1ZM3A 5IWAJ 4RKUC 2BANB 2H1YA 3M2UB 1NPRA 3RGIA 1J2VA 1LQ9A 2JDJA 2HS0A 2CUYA 3GIKA 1DHMA 3FRYA 3GCXP 2CQCA 1S1WB 2P6SA 4MFBA 1KD1T 3HHEA 1S97A 4U7CA 3LGHA 4LR8A 2C3YA 2W8LA 4PG5A 3SI8A 4DDFA 2IJRA 1HBNB 2ZH2A 3OL7A 3D54A 1RWPB 2ZBIA 1NK8A 3ITHB 3KNAA 3Q8QB 3TUPA 4BWMA 5GMKa 3HT0A 4JI2J 2VFSA 1REVA 2MMYA 2IBKA 3IWLA 2RS8A 3JSBA 5A0YB 3W1YC 2Z58B 1RHUB 3TVZA 3KLHA 4K4YA 5CZXA 4P2SA 4DV2J 2DGSA 4O0NA 4K0KJ 1GK8A 3R5CA 3MHYA 3QZ8A 3QATA 4F26A 1WHWA 4TY8A 5ETRA 4WU3A 3SSSA 4WP3A 3K5MA 4CLTA 4HDGA 1RP5A 1ZM4A 3A12A 1QVGR 4EK2A 4M5KA 1R0AB 3T3FA 1F1BB 3IAM9 2J76E 2HK3A 4MAKA 4ZPWR 1UWBB 2OELA 2Y8YA 3NG8A 4M5IA 4ECUA 3DOMA 1S9EB 3CDUA 2BABA 4I2QA 1RADB 1WORA 1DFDA 5DDRC 3KHHA 3CCJS 3T19A 2WVFA 3ZZUA 2PEHA 1RU2A 5J2NA 2OTLS 5L1JA 1YKWA 3AOAA 2AJ2A 4DR6F 2GV1A 3LOUA 2JLFA 2PDAA 2B7BB 1NSKL 3ETMA 4N47A 1NB7A 1RCOB 3P3DA 4U96A 4I68A 4OHYA 2ZJQQ 3RR7A 4ILMA 4RW6A 4PWDB 1PIEA 3ADAC 1KQFB 3H40A 4DV7F 2FGCA 4GKJF 3KLFA 4J91A 4PWWA 3QSYB 1FCAA 2LXFA 4RNOA 3GJSB 4X4SA 4DFKA 4J9UE 1TFYA 4DSFA 1XNQF 3MDFA 2MTLA 2MLZA 2XSFA 1JLBA 2V9KA 3TUZC 2O3DA 2VQEF 2HFOA 1MMLA 2IVMA 4Y34A 1X5SA 3OVSA 1VIOA 3E3XA 1F3FA 2MPUA 4ZLPA 3D0IE 4XTTA 2IBOA 3WDOA 1X4EA 3BB5A 4GKKJ 1LXNA 2QGFB 1T02A 3IG1A 2VICA 1NK7A 1KN6A 3GFZA 5D0EA 3IRXB 5EN1A 4KHPJ 1HHSA 5A8RB 4K4WA 2QA4G 2GNKA 2VD3A 1D1UA 1FDDA 3M30B 3AY0A 1ZETA 4HTJA 1MSWD 1WHXA 2V94A 2Y1JA 2UV8G 2M7SA 3MM6A 5I4MA 1NDKA 2FY8A 3LAKA 3V2UC 2AEMA 4MKBA 2AX0A 3QAUA 3AA8A 3BQ1A 4TQSA 3B6BA 4RW4B 3DLGB 4LRAA 5L1LA 1T11A 2DHXA 3O6QA 1SC4B 2J9EA 2QYCA 1X4AA 1ZZFA 3TEHB 3FVYA 4ZVHA 4LSLB 4QWEA 2P9GA 1N32J 1C4AA 2XMKA 1HNIA 3HFZB 4A8FA 4I69A 2ZH1A 2DPJA 2CQPA 3DRPB 2PC6A 1NK6A 3DNCA 1OQ6A 2I5JB 2HQDA 3GYGA 2ZH3A 3D1HA 2DTJA 1I1GA 5HVGA 2NSBA 2HZCA 2GGPB 4G1IA 2D3OR 3OJSA 2GIRA 2UUBF 1X5TA 2YPYA 5ETOA 4N41A 3J80Y 5DG7A 1N52B 3K17A 1WEZA 4B3RJ 4TNOA 1BC6A 2ABYA 4ZJQA 3IGNA 3BO2A 3ICLA 4C48A 4B3MF 1IWGA 4GVBB 5E2QA 1JKHA 3CNQP 1RT2B 1VRTA 1WSVA 2MKYA 4YN3B 1OMSA 2VG6A 5KFTA 3CJ4A 1Y11A 3V6DB 4DMZA 3C14A 2CWKA 2V50A 2QG9B 3CW2C 5HVFA 5BYQA 1O0PA 2FGOA 4A8SA 1NKCA 4IDKB 3HSJA 3JSYA 3MM7B 2B51A 5E3RA 1NU4A 1WDDA 2OD4A 3Q8RB 1HYSA 1OJ4A 3VCDA 4B3SJ 3GIMA 4IG3A 3RBEA 1HR0F 3BEGB 3MD3A 3TUJC 5IWAF 1UFKA 1D8ZA 1DTTA 2SXLA 1IJEB 2O5DA 2G0JA 4PABA 3JTNA 4LSZB 2KM8B 2V2QA 4CO2A 3H2VE 4JUZA 4JP8A 5M2UA 1YRXA 4LF9J 2VPWB 1N36J 2JEFA 4C8ZA 2HHUA 1ULRA 1SV5A 1G4CA 1LW2B 4F4YA 3PZPA 2E44A 4ZVSB 4A8YA 3NWGA 3D9BA 1HHTP 2HGMA 5HK4A 4JI2F 2ZNYA 2ZE2A 2K7KA 2LA4A 2LYVA 1RTDB 3H5SA 1AYEA 2AZ1A 2Z57B 4P52A 4DV2F 3UCZP 1NZ8A 4OYWA 3M1VA 1TZ0A 4K0KF 3C6TB 1UEUA 2DY9A 3THTA 3Q8VA 1D09B 4ES2A 1WJ9A 4IQXA 1RBLA 4IOCQ 4USWA 3GMGA 5KFRA 1K1SA 3FQLA 1CJTB 2R7WA 3BDPA 1RTHB 5F3TA 3G96A 3ISZA 2HIQA 3FCWA 1UTAA 2AZ3A 3P4UB 2MSTA 2NXCA 1SJ4P 1NJIT 3F41A 5GVQA 3QIDA 4EYIB 4ECRA 3KYLA 1CJUA 3CVKA 3OTBA 4RLEA 3M2RA 3LALA 1OYEA 4RUHA 2MZSA 5F8GA 3A8KA 5GAEI 2HQGA 1C4CA 4XPEA 2AX1A 1QTMA 1TV6B 5GMEA 1B3TA 5EWGA 1P1TA 5AXLA 3NGTA 2R2RA 5KT7A 4JI5J 3KFWX 4ECSA 3TZZA 1KLMA 3SIPB 2ZVIA 1WTFA 4OL8A 5KFKA 3HHLB 4MK8A 3HSDA 3S6EA 3MR6A 4LF4J 4RR5A 1FJGJ 4TN2A 1MROA 2LQ5A 2YNFA 4KC5A 2DK2A 2V6AA 2XMMA 1LWFB 4HVZA 5DDPC 3KLVA 5BR8F 3CJ8A 1MMDA 2JNJA 5EHHA 4RW8A 1TL7B 1YX2A 3DGPA 5DG9A 4CNZA 2KDOA 3BM7A 5AJ3J 2RDJA 3OSPA 1H2TZ 2XTJP 4J9NA 4CLWA 1UWAA 3OLAA 5ETQA 2VIHA 3SXLA 3MM9B 3CJRA 2B9WA 5E5NA 4GKKF 4HLBA 5HROB 4F4XA 3DRRA 4F50A 2DGQA 2YWGA 1MU2A 3DRSA 4CO3A 4KHPF 1CJKA 3T6JA 3WIUA 4RNFA 4YOEA 2UZAA 2HFNA 2JSXA 3U1LA 3MGJA 2CJAA 1JJ2R 1YJNS 1UA0A 3R9LA 3AT1B 1JX4A 4DPWA 1R7IA 3I87A 1PO6A 4ZIVA 4EYHB 2WOMB 3EWGA 2B6AB 2XSJB 2NR0A 5D0GA 4ECZA 4WKYA 3IN5A 4XPCA 1UEKA 4KPYA 4LFCJ 3TA2A 2RIJA 3V81B 4TU8A 4ZCKA 1UEVA 1S1XB 2XM3A 2XHCA 1N32F 3CJSA 1IJFB 2EK6A 1C0TB 2Y0BB 3M8QB 2A10A 4I2PA 3N9UC 4IFYA 2P5VA 1VFJA 5L9NA 3EZOA 3KTQA 2HWTA 5E3PA 1RAEB 2LP4A 4RZRA 1SJ3P 3HLUA 1R27B 1RT5A 4OYBA 4RW7B 3WHIA 3ETOA 1RKJA 5H9FJ 3L7PA 2GA7A 2VKRA 2AV5A 3LAMA 3ENVA 3BH7B 3J81Y 1V3ZA 2F40A 3SDEB 3ELHA 3VAIA 2DR7A 5B0DA 1XR5A 2BJEA 2KVQE 3PW2A 1BD6A 2QYGA 3QGGA 1T3OA 9ATCB 1GT8A 4A8KA 2B5JB 2XC9A 4NMLA 3QLHB 1OQ3A 4IH6A 3EE3A 1A7GE 2DH7A 3F0NA 3TX8A 3PX6A 2DR9A 2CPIA 5C25A 2YKQA 4ZDNA 4Z7YA 1RJJA 1IKXA 2EC0A 1SUQB 2IAJA 1C1CA 5FDLA 1HL6A 4NLTA 2EKYA 3HXMA 2YNIA 1MN7A 5HN0A 4Q8EA 1LXJA 3VWSA 4WZMA 4ZP9A 4BBYA 1WF0A 2OP5A 3MEGA 2AP6A 4TLQA 4QWCA 4B3SF 4ILRA 5LXYA 2JRSA 1KP6A 2DD8S 1PC4A 3JAMU 1ZM2A 2C2NA 2WCXA 3RZAA 4LF9F 1WC1A 1N36F 3P96A 1JLAB 2PFDA 3FBCA 3I9ZA 5H1SV 2UXCJ 3C15A 3OQ2A 2HKEA 4ECYA 4RNNA 2IYGA 3MEDA 1I3OB 2YKMB 4WYLA 4Q7AA 1IBMJ 3HVAA 2AGOA 2R7OA 3M6UA 1OY8A 3A3NB 4QOTA 2CVIA 1UJ5A 4JV0A 2GVZA 2KO1A 2ZH7A 4V19X 1LOUA 4NLDA 4WTYA 4NPOA 2LXIA 3D0GE 1Q86T 1TVRA 1SJRA 3GIIA 3SCIE 2RUGA 4FPIA 4UF4A 4H4KA 4ZVFA 3RB6A 1SIZA 2DHGA 1NH7A 3H0PA 1D3WA 4YY3J 1U26A 1NDLA 4NI2A 1M1KT 2VQFJ 3OJUA 4FXDA 3HK2A 3DOLA 2KI2A 4DV5J 2HLUA 5E7OB 1DLOA 3JSMB 5J2MB 2U2FA 1QAIA 3RYLA 3KLIA 3TWZA 4P6QA 5CYMA 4Y2IA 2J7KA 3RU0A 3HCXA 1F2GA 2XNQA 1DARA 4UT4A 3NS6A 2KZZA 2Q66A 5T7LB 3EPGA 4E98A 5H9EK 1BQMB 2K7JA 3PJWA 1TL1B 1WC6A 3DOKA 3MCSA 1FDNA 4X62J 2EW9A 1HNWJ 3U1MA 2GJ2A 4OI1A 1FJEB 1U0SA 1HPZB 1ZA2B 3MMCB 3OXGA 1R6VA 1F0XA 1NHKL 2CZVC 3PYFA 1Y5LB 1UMJA 2MZ1A 3H2UB 4JI5F 5IT9Y 1AFIA 2AKWB 2CIMA 3CMAS 2MHNA 3IWXA 1QSSA 4G6VB 2OHDA 2DNOA 4A8OA 1IKYB 3S01A 5GAGU 2ASDA 4ZLNA 1R8HA 5A2QY 3FRZA 1W7WA 1T9YA 3QGIA 1U25A 2WB4A 3HZGA 5LJ3Y 3GU0A 3GIRA 1WNEA 4LF4F 3BR8A 1FJGF 3H7HB 5KG2A 4K4ZA 1EX8A 4NYZA 4JI7J 3I32A 1RT4A 2CG4A 4B9MA 5B0AA 2HHWA 2DEIA 3WX8A 3FCHA 3MEEB 5ETSA 3D7SB 4DL3A 2WK4A 2X7IA 3MCMA 3TA1A 2RKIA 1NJWA 4OYOA 4C8NA 1EQ0A 1XK8A 1RHQB 4NWBA 2G0IA 4GRSA 5IXUA 1FNMA 5AJ3F 2L48A 1UKUA 4G1PA 4USKA 1T03B 3N79A 1FKPA 5ETTA 2EFPA 4MYTA 4BDPA 5E3CA 1QSYA 5B7WA 2WONB 2JH3A 4OJ3A 3MPVA 2WZ1A 1H3DA 4PYDA 3IAS9 3LUYA 4IOBA 3VAHA 2AEJA 1SC1B 5IM0B 5IT0A 2WTFA 2MQ8A 2B8PA 3V5RA 4QYZJ 4DR2J 3QPIA 2UXDF 1RT6A 4O4RA 2HWIA 3ENAA 3JB9k 4ILLA 2P8IA 1KSPA 1AB8A 2OTJS 5KFFA 4UOGA 2QTWA 5GADI 3M8PB 2FUG9 2QLJB 1CJVA 4F8RA 3ZZPA 2DRAA 4RX6A 4Q45A 2JFKA 1LEOA 4LFCF 1TKXB 4O3NA 3F44A 4UQGA 5CYQA 2OPQA 4NLGA 5LL6d 2HHVA 2QA2A 3DLBA 4HI1A 4MH8A 5AT1B 2B3TB 2VG5B 3EUNA 1GEHA 1YWXA 3C19A 2VG7A 3G4SS 2CWXA 4C2MA 3UCGA 3EMTA 2OMOA 2HHTA 2ASLA 4ZHRA 3CC2S 4ES1A 2QFJA 2C3UA 2M8HA 1U2FA 2IVYA 1NK5A 1VBXA 2J0SD 2W2QP 3DDIA 2I9SA 4Y2AA 4IRCA 3AXKA 4L74A 3TAPA 4I6AA 4M95A 4ZCMA 1V3SA 4C9DA 2GCFA 4B02A 3TVYA 2ILZA 1YJVA 3R5DA 3W63A 1NJYA 3H20A 4FZVA 4LF5J 3AJ2A 1KTQA 1FWKA 3TZWA 5ETVA 2FD2A 3GYNA 1RHKB 1YI2S 3UI3A 3JSRA 2Z2ZA 3NRBA 3HM9A 1E6YB 5DDQC 2XY6A 3M05A 1B4SA 2ZKTA 5DO2A 1RWWB 1VRQC 1VQKS 3T1AA 4X65J 4DCJB 1YRUA 1UVKA 4IRKA 1S57A 3W8GA 1TL5A 1T0TV 3BV8A 3D3BJ 4CLFA 4IYQA 1PC5A 3K8VA 4LRBA 2YPZA 1FD8A 1VQNS 1ZS6A 2WVCA 1HBOB 1XMQJ 1YG0A 5J1PA 5K20B 1RTIB 5IQQA 4DS5A 6FDRA 1RI7A 3EM1A 3Q2TC 2ZH6A 1IKWB 2IRUA 2UXCF 4J9SA 2HQCA 4M94A 3O5TB 3JTOA 2BACA 1IBMF 3PTWA 2E5LJ 1YQHA 1K1QA 4NCGA 3KJNB 1HIYA 4J37A 4IFVA 2KT3A 2NS1B 1Q53A 3MM5A 2F7VA 1KQSR 2KHCA 3M9MB 2PMWA 3W2VB 5HQ8A 1AZSB 4RUCA 3G82B 1XNRJ 4AL5A 2YY3A 5BJRA 4J9OA 4JI8J 3VZHA 4YY3F 4WE1A 4HH1A 4PCQA 2J0XA 2JEJA 4MYUA 2VQFF 3AHPA 4DX5A 5J2QA 4AE5A 4HTIA 2CJYB 1S6PB 4O4GB 4K4UA 4DV5F 3I0SB 4ED7A 2G13A 3FQKA 1VC5A 1WOOA 3UO0A 5KT5A 3CO9A 3DMJA 3PEJA 1S6QB 1WTBA 1TTHB 4DL6A 4EWTA 1UFLA 3MMAB 1WG1A 2UUTA 3T5HA 3BDEA 4CT9A 4X62F 2FVSA 2ILYA 1HNWF 3RJMB 2HHSA 4FKXA 1RWOB 2GMJA 1TL3B 3NCQA 3ZXWA 3DN9A 3VHQA 4MFBB 1U09A 2VODA 4ANDA 2GO9A 4O3PA 3CCVS 2I2YA 1OIAA 2C2KB 3AAWB 4PXEA 1LNQA 3K58A 1TUVA 5B0CA 4FYXB 3W3SA 3MECA 1IWAA 1KONA 2VHGA 3ZZ0A 4J9RA 2RF2A 3MFIA 3R1LA 2NZ4A 1VR6A 1T05B 4NEZA 4P72A 2KM8C 4UOCA 3OXLA 1FA0A 5CQGA 3G71S 1H38A 2MJUA 2B9YA 4OHWA 4B9UA 4DR5J 4JI7F 2JLGA 1TK5A 1UVLA 2UUCJ 1WF1A 3RW6A 2BE9B 2DYAA 4CLSA 2IFXA 2CJXB 4P73A 3PW0A 1SC3B 4M5MA 5D4OA 1DURA 2WRMA 3CCWA 1RSCA 1U7LA 1ZA1B 2QE5A 2D74B 3ENWA 2F4FA 4DLGA 3IS9B 4FNIA 3KLEA 1F6TA 4ANCA 1WUUA 4WFXA 2YKNB 1NEEA 4DF4A 5KFYA 5SZTA 2W7PA 1QLNA 5KG4A 4UY85 1R0CB 2M8DB 3NNCA 2ROEA 3UD4P 4I67A 4KFBB 4MIBA 2YNHA 1JNRB 2W2PP 1RU1A 2DPIA 4DR2F 4X64J 1FRIA 2EK1A 4DFJA 5T14A 5GAEU 4NXNJ 3OFGA 4Y3CA 2HNYB 3DYAA 1NK4A 2BZ2A 2AIRB 5KFBA 2B8QA 1JK9B 5HATA 1NO8A 1M90T 2H3EB 1Z4UA 1ZBTA 2CNOB 4RW6B 1WKKA 1U1KA 5C7PA 4BHQA 2HIYA 2MKHA 3W2WA 3G2XA 4KGKA 2MXYA 3N01A 5KG1A 2BQRA 2HNZB 4DF8A 5E3AA 2RQ4A 4ETXA 2QX0A 1NNDA 2W8KA 2VJVA 4CLKA 1RAAB 2VA2A 2XZDB 3MTJA 2V9WA 2KYXA 3LWMA 3W62A 2DNNA 3KJVB 4OYXA 1JLBB 3TZXA 2ZH9A 2E9TA 4ZCLA 3HHLC 3H8YA 4QWAA 5JUMA 1RWMB 4CLPA 1U1LA 4H54A 2HQFA 2NUHA 1SKUB 2AGQA 3EVOA 5DM7Q 3LA0A 1TKTA 2ZHOA 1JLFB 5J1EA 4U67Q 5HBMB 2OI2A 1MLAA 2J7WA 3R2CJ 3UFCX 4LF5F 3UQSA 1P6TA 1H74A 2KRRA 4L73A 1S72S 1H2VZ 4KHRA 3W65A 4KBIA 2OH2A 3D67A 1YZ7A 2BOPA 2IRYA 5KAKA 4AL7A 3MM6B 1P8GA 5JVGQ 3R5JB 1LWCB 1SIWB 1U8SA 3VTIA 2R42A 4DV1J 3WIVA 2NXUA 2A1BA 3I0RB 4V19J 5FLXU 2KN4A 1G2EA 1TUWA 4ZVEA 4KIAA 3ZZRA 1UVMA 2XHWA 1RKIA 5EWEA 1WF2A 2QSFA 1XMQF 2MZRA 4O0IA 4LF6J 4LR7A 3UNGC 3M6WA 2Y8WA 4KV8A 2C28A 1WKLA 1QUPA 2D3UA 4ID5A 2MKIA 3PVXA 1HNIB 5IFMA 3B8HA 3W5YA 4R0JA 2LFVA 1X4BA 2ZBQA 1S1UA 4ZPAA 3M2VB 1OPIA 3NMAA 1TMJA 4NCBA 5CD4H 3PG9A 4PXCA 3MCOA 3I82A 3Q22A 2NREA 2E5LF 3M8WA 1JLGA 1FWPA 2LVWA 3QJLA 4AYBD 4CTAA 2HFSA 1Z1ZA 2DNRA 4NRTA 2W2OP 1DAXA 2OPSB 1EZZB 2HFVA 4KE5A 3H90A 2GIFA 2EFVA 3VALA 1GMUA 3H2LA 3G6YA 2MDAA 5CYJA 4TYBA 1XNRF 2H5EA 1J5OB 1G1XA 2E1PA 3JTPA 3D6TB 2NUUG 3E2EA 3P8BB 3G8QA 4LSNB 2QT7A 2XY7A 2CVEA 1JKHB 4OX6A 1WDTA 4GVLA 4AT1B 2VG6B 1YJRA 4TLRA 1M1GA 3GZ7A 2FVRA 4AXIA 2OJ3A 1DZ5A 4F0MA 2HMIA 2JX2A 3QJJA 2A2DA 5KFAA 2YQ0A 1BMQB 2CPJA 4FYWB 1SKSA 1N54B 5KFCA 1NMEB 2M9KA 4F2RA 4DFPA 3MM8A 3MZIA 3W7BA 3NLCA 4URQU 4A47A 3BSOA 1WG5A 3UD5A 2XGQA 2CQ3A 1UA1A 4EFAC 3UR0A 1B99A 4WFNQ 3D6FB 4I6YA 2RHQB 1AW0A 2HG4A 3HT3A 4F04B 1N0UA 2CFXA 1S6OA 4C4WA 2V2VA 4U7UD 3M8SA 2HNDA 1RAGB 3BQ0A 3OL9A 4O3OA 1Z2ZA 4N76A 1GXUA 4LF7F 3DKDA 4IR1A 2FLPA 2BOAA 1AFJA 2DH9A 4DR5F 2UUCF 2CKWA 5HMZA 4FN5A 2M88A 1NUEA 1CC8A 2RDIA 3QIPA 1WHYA 4F3QA 3LQVA 2KT5A 5A8KA 4IRDA 1GMWD 4OV6A 1QE1B 4Q5VA 3EZ5A 4ZA1A 2ADCA 4KAIA 1G3OA 1S4EA 2MGZB 3HVTB 5LM7E 2DEJA 4A4JA 2PGCA 2ZDOA 4DQSA 2ZITA 3NCPA 5LMNJ 1JLEA 4Y00A 1RAOA 3KG0A 3HJFA 2J8AA 2CYYA 3FBBA 5KFZA 3PFEA 2CNLB 2BJ9A 2CJBA 2R7SA 3HHLD 4X64F 4NXNF 4LUBA 4F2SA 1YZ6A 2BM0A 3MAHA 5D4LA 3TAMA 2MQOA
chains in the Genus database with same CATH topology
3QRPA 2Y8WA 3QRRA 4U7UD 4DZDA 4QYZK 2Y9HA 5CD4A 5H9FK 5H9EK 3QRQA 1WJ9A 2Y8YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QRP A;  2Y8W A;  3QRR A;  4U7U D;  4DZD A;  4QYZ K;  2Y9H A;  5CD4 A;  5H9F K;  5H9E K;  3QRQ A;  1WJ9 A;  2Y8Y A; 
#chains in the Genus database with same CATH topology
 3R6L B;  3EXY A;  1QVF R;  4I7F B;  2NQP A;  3UVJ B;  3R5G A;  1KLM B;  2OFH X;  2H48 B;  2HS4 A;  4BC9 A;  2LA6 A;  3SCL E;  3DLK A;  1FFG B;  1RUS A;  2WBR A;  2OEJ A;  2G9O A;  1NLK L;  4QYR A;  3I56 S;  2Y1L B;  1MRO B;  2PO4 A;  4DV0 J;  4JI3 J;  4IOA Q;  2D1C A;  2EFQ A;  2H4W B;  5G0R A;  1LW0 A;  3NS5 A;  4TYA A;  4ZK7 M;  4EUV A;  2J6S A;  4MKV A;  4P7V A;  4RWX A;  3LWL A;  2V8P A;  1L3U A;  4LBP A;  3I5B A;  2NZC A;  4ICL A;  2J7U A;  2DXF A;  1MN9 A;  1YK9 A;  5MAO A;  4AFF A;  4USM A;  2ZZM A;  4OYI A;  4DV6 J;  1YRT A;  4M5N A;  2G1D A;  3DRS B;  5A76 A;  2PEB A;  3G87 A;  1CJK B;  1DBD A;  3OTD A;  2W9C A;  2C42 A;  4ED6 A;  2RD5 C;  2KXH A;  1WD6 A;  5L46 A;  3GG0 A;  2X51 A;  4ZVG A;  2UVW A;  1X4G A;  2BR0 A;  3HHD A;  1T9T A;  2ZBC A;  3CCQ S;  3OSN A;  5DG8 A;  4CNY A;  2C22 A;  1S1W A;  2FJD B;  3UPF A;  4DN0 A;  2R9L A;  3FNN A;  1Q81 T;  1GTE A;  2B4P A;  2VH7 A;  4DV1 F;  2F8M A;  1D0E A;  3OR2 B;  4NXM J;  5F0W A;  1HQ2 A;  3CIZ A;  3H5Y A;  3KLG B;  4E2F B;  5F8M A;  3ZTR A;  2CRL A;  4YP3 A;  4LF6 F;  1SQF A;  1QAX A;  1URN A;  5A0Y A;  3CPW R;  2IYI A;  1C0U A;  1MW7 A;  1HNZ J;  4WXW A;  5EX3 A;  2VUG A;  1Y9O A;  1DRZ A;  1QTN B;  4J5O A;  4QIG A;  2JC1 A;  3QO9 A;  1VDH A;  3FMB A;  1XN9 A;  1M5K C;  2GVD B;  3MPU B;  5SUH A;  1RT5 B;  3CUN A;  3D1Q A;  3DC2 A;  2FJB B;  3TJ8 A;  5HJX A;  1CUL B;  3RBZ A;  2R2S A;  4F3O A;  1VRU B;  4M5L A;  1VLY A;  1ZOT A;  1EAY C;  1RWV B;  2HVI A;  4KSE B;  4X84 A;  1UWB A;  4IG0 A;  4DSJ A;  2EI5 A;  3VQS A;  2LU1 A;  4DSK A;  1S9E A;  3N0V A;  4U95 A;  1SKW A;  2XS5 A;  2PI4 A;  1TAU A;  5C25 B;  1WSR A;  4OI4 A;  3TVK A;  2FJX A;  3I9V 9;  4USJ C;  2BE2 B;  3QT5 A;  4RJV A;  1RT1 A;  3NGR A;  1RWX B;  2LDI A;  1UET A;  2IAJ B;  2H4Y B;  2QSW A;  2RIL A;  2YNI B;  3N5B A;  2H65 B;  3BGR B;  4LIW A;  2Z4P A;  3Q8Y A;  3MEG B;  4PWD A;  1KHW A;  1W2I A;  4GKJ J;  2J0Q D;  3KDO A;  2MJN A;  3MAA B;  3U02 A;  2E7X A;  3V4I A;  4JOU A;  1JLQ A;  2AQ4 A;  3E01 B;  7FD1 A;  4X4U A;  2H5I B;  3QSI A;  2RU3 A;  3C15 B;  1T7P A;  1IQZ A;  4PPD A;  5KTQ A;  3CT9 A;  2V69 A;  1KWM A;  5KG5 A;  4H4M A;  1M0S A;  1PAE X;  2XO6 A;  4DCP B;  1VQY A;  3Q8U A;  4A46 A;  4DL2 A;  4YHH J;  3H5X A;  1NPK A;  5J2P B;  2GVZ B;  3VVT A;  1QUV A;  3BZQ A;  3G6E S;  3BBC A;  4QIF A;  4CLZ A;  3Q8S B;  3K5L A;  2RUS A;  1C1B B;  2CQG A;  2ZD1 A;  3NAI A;  3DFE A;  3O8W A;  4JI6 J;  3IRX A;  5IC4 B;  3PW5 A;  4WKR A;  2XMW A;  1XWL A;  5A8R A;  5KFE A;  3OHA A;  2K8G A;  1IQT A;  3S7R A;  2YWH A;  5F9L A;  5F8J A;  3ZZY A;  4PR6 A;  4NLU A;  1DLO B;  1S10 A;  3RB4 A;  3KLI B;  2FHK A;  5CYM B;  3IBC B;  4DPU A;  2ZHA A;  2KRB A;  2GHW A;  2PMH A;  3AD7 C;  4C97 A;  1S49 A;  1U1P A;  2I0X A;  2PA3 A;  4CH1 A;  5LMN F;  3L3C A;  4YDX A;  4ZS6 A;  3DDK A;  1NB2 A;  4RW4 A;  3DLG A;  1T95 A;  4JB8 B;  2JJ4 D;  4ID8 A;  1KFD A;  2GZO A;  4FYY B;  1EP4 A;  4Y65 A;  5KFG A;  2BYC A;  1YGY A;  1RDR A;  2BM1 A;  4LSL A;  3GSD A;  1EJ7 L;  2RQC A;  1HNV A;  1KR4 A;  1CLF A;  1H72 C;  4LR9 A;  3BGL A;  1FF2 A;  1YHQ S;  1P9Q C;  1WOS A;  3C46 A;  2C2O B;  1TU0 B;  1YJT A;  3KG1 A;  3DRP A;  4DQI A;  1NPP A;  3J7A 1;  4ETZ A;  4NLS A;  2O67 A;  4IR9 A;  2XMV A;  2GAG C;  2GGP A;  1RXO B;  2B9X A;  3ZFV A;  2CA9 A;  4DV0 F;  3GJQ B;  4EU0 A;  4NLR A;  4JI3 F;  4ZPD A;  2QRR A;  3GLJ A;  4PG6 A;  2ZKU A;  2BUN A;  4WYW A;  3LGM A;  4CYU B;  3IR6 B;  3AOD A;  2KG1 A;  4USU A;  1EHW A;  1VS3 A;  3AQO A;  4C3M A;  3VAJ A;  3KMS A;  4ZJL A;  4DUZ J;  4QIV A;  2RKI B;  4D3G A;  4QU7 A;  1HA1 A;  4LVO P;  3EZU A;  3FJ2 A;  1HMV A;  2Q3P A;  1MWZ A;  2R7X A;  3I4H X;  2IA0 A;  5B0E A;  2EBG A;  2RJZ A;  5ITH A;  1I94 J;  1NDP A;  2HFU A;  3HVW A;  4JI4 J;  2IIH A;  4IDK A;  3MM7 A;  4DV6 F;  4PUO B;  1IR1 A;  4RNH A;  3FCV A;  2ZH4 A;  3UWT A;  1N48 A;  5KG6 A;  2AWZ A;  2FHJ A;  3IM8 A;  1Q7Y T;  1S1T A;  1PYS B;  2FVC A;  1KEK A;  1RT6 B;  1Q78 A;  4UY8 T;  4P71 A;  1AXQ A;  1GNK A;  1IUJ A;  4NMX A;  1SJQ A;  1Q8I A;  4KKO A;  5GAG I;  3LGN A;  3UNY A;  4DPX A;  4HT7 A;  2MHE A;  7FDR A;  4NLX A;  1RK8 A;  1VQS A;  2XWX A;  5K8O A;  3F56 A;  2KTQ A;  4NXM F;  2JVO A;  1S9G A;  3FEZ A;  2DKO B;  2AYB A;  2ZBR A;  5CYQ B;  3QZ7 A;  2OPQ B;  5ETP A;  4WFZ A;  1H73 A;  2NCK L;  1IM4 A;  4N7T A;  1XMO J;  2YKP A;  5KFW A;  3K57 A;  2D3O 1;  2P9E A;  3S8S A;  1PIL A;  1Q7L B;  1HNZ F;  1ZZN A;  4OI6 A;  4ZHR B;  2FC9 A;  3C6T A;  4ZPC A;  5D4N A;  5HQL A;  3D0H E;  3SSQ A;  5GMD A;  5HP1 A;  2MB0 B;  2ZUG A;  1WC4 A;  3C6U B;  3TR5 A;  3BN7 A;  1PAU B;  2DT9 A;  1IR0 A;  4K2X A;  4FPR A;  3O1L A;  2AW0 A;  4NX9 A;  1CC7 A;  4QQB A;  2QLF B;  5B0B A;  3CB4 A;  2X1A A;  4HDH A;  1X0P A;  2B4V A;  4OHV A;  1KS2 A;  3KWM A;  4RU2 A;  3GFH A;  2ROP A;  5J1N A;  1L5U A;  2IJF A;  4ITS A;  4C8K A;  3KK1 B;  2HHX A;  4FYV B;  3QFH A;  1URR A;  4MJK A;  4X66 F;  2XI2 A;  5I3U B;  2CNN B;  1P1L A;  2VBW A;  5HAO A;  3PJX A;  4KQZ A;  1JQG A;  1ZYQ A;  3ZZT A;  4AL6 A;  5FII A;  2W4P A;  1N6Q A;  1JWW A;  3SFU A;  4N8O A;  1VBZ A;  3PKY A;  4XO0 A;  2OIH A;  3G8T A;  2BW2 A;  3A13 A;  4O44 A;  2MKS A;  1KOH A;  4PEO A;  4OZ2 A;  1UW4 A;  2N3L A;  4WK3 A;  2WVB A;  3CMQ A;  3QQC D;  1LWE A;  1U1M A;  2M5Y A;  4QZV B;  3TA0 A;  5GAH U;  5BR8 J;  2MLY A;  1IM6 A;  1JIH A;  3BGU A;  1R6Y A;  5RUB A;  5C24 A;  2A3J A;  3OTC A;  2HVD A;  4CI0 B;  4PQU B;  4HI2 A;  3KUG A;  1Y5N B;  2FJW A;  3BKT A;  4PXB A;  1FXL A;  4GO7 X;  3NGD A;  1V5I B;  1U4B A;  4YHH F;  2UVU A;  3MM5 B;  2UUA J;  3C3L A;  2BJ1 A;  4J9M A;  3PRD A;  1ZM9 A;  2E1R A;  4B9N A;  1TKD A;  1CEZ A;  1Q95 G;  3JQM A;  3RB3 A;  2KU7 A;  4OZN A;  2K2P A;  2BBE A;  1B0T A;  2F8E X;  2R2T A;  4F67 A;  1CVJ A;  5HL7 Q;  2V4J A;  5HRO A;  2OPP A;  1CS4 B;  4PKD B;  1UCN A;  1FFS B;  2BRK A;  3MUV P;  4JI6 F;  5KT2 A;  3DHX A;  4WE1 B;  2VJU A;  1DJ0 A;  3MI7 X;  3OVA A;  4DPO A;  3QT8 A;  4PYA A;  3C8Y A;  1BQN A;  1HBM B;  4ZVQ B;  2IM3 A;  4KH1 B;  4USV A;  1V3R A;  3GB0 A;  4RBV A;  3QGP A;  2IMO A;  2QMU B;  2WOM A;  4KO0 A;  4FXW A;  1SH2 A;  2LKZ A;  5M2P A;  2L9W A;  4DR3 J;  1XTZ A;  1N5Q A;  5KFN A;  4EZ9 A;  2MKJ A;  5L8R C;  3DU5 A;  5F3Z A;  1Y3J A;  1DQA A;  4V1A k;  5KFQ A;  1XC9 A;  4HAC B;  2F1F A;  2OKQ A;  3IGV A;  4EGL A;  1B70 B;  1VIX A;  2UU9 J;  2DNP A;  4LT6 A;  1DTQ A;  1ZAW A;  2J8S A;  3VF0 B;  1AT1 B;  2RVJ A;  3DM2 A;  3MFH A;  1F9H A;  3PYD A;  2PA8 D;  3PDN A;  1FK9 A;  4OYZ A;  4ZPB A;  1L3K A;  1LFP A;  1Y7P A;  2P6T A;  2RF2 B;  4RW7 A;  1FX2 A;  1WC3 A;  1HWI A;  4K2J A;  4MKY A;  3AQP A;  3SYZ A;  3FGV A;  2ZOG A;  3DRX A;  3QT7 A;  1GFW B;  2CPH A;  2VC0 A;  3R27 A;  1W26 A;  4TVA B;  4GC6 A;  3CCZ A;  3NOC A;  4ZN3 A;  3HDS A;  1RT3 A;  2MQN A;  4K4X A;  1O8B A;  6AT1 B;  2XYG B;  1WKJ A;  1Q0N A;  1N5Y A;  3VZI A;  3M6V A;  2B5J A;  4DUZ F;  4DLE A;  4Z2X A;  5HSP A;  3UR3 C;  1RAC B;  3GYX B;  1T9V A;  5DZ7 A;  2PT0 A;  3GSI A;  3M8R A;  1VBY A;  3KLE B;  1UVN A;  3V6H A;  1I94 F;  1SUQ A;  3NGS A;  3LAN A;  4JI4 F;  4ZVU B;  1JXE A;  3NBP B;  5DQH A;  4WJB A;  5KFJ A;  2RSQ A;  2OD6 A;  3ZZO A;  4NLY A;  2YNH B;  2LMI A;  3RTV A;  2VFT A;  4M5D B;  2Z56 B;  2QMW A;  2W4C A;  2OPR B;  3UE2 A;  1JLA A;  1O51 A;  4DXL A;  4Y2C A;  1FEE A;  4ZPT R;  2GAH C;  4O3S A;  2FYX A;  4R8U A;  1K0T A;  3DLJ A;  3TAR A;  4HHJ A;  2XYH B;  3TJA A;  3W2W B;  4UTG A;  2GC8 A;  2N82 B;  1CG2 A;  3C16 A;  2BJD A;  4J9L A;  4LRE A;  1SH0 A;  4YFU A;  4B9L A;  1BQX A;  1XMO F;  1UFW A;  2H51 B;  1FXD A;  1S5Z A;  3H42 A;  2XCP A;  1RBO B;  2DNK A;  4K59 A;  4QR0 A;  1U49 A;  4U7U K;  5KFH A;  4NAS A;  3P45 B;  2XZT B;  1O5J A;  2HHP A;  4Q44 A;  1VYA A;  3NGU A;  3TZY A;  3KUE A;  4TU9 A;  3K59 A;  1KDN A;  2LQJ A;  1OSC A;  1NM2 A;  4L6V 3;  1RE1 B;  2WB1 D;  4A8X A;  4A8M P;  5J2M A;  1O6X A;  1TUG B;  1EET B;  2DNL A;  5KFI A;  2POK A;  2V8V A;  3HSG A;  5CHC B;  3MF5 A;  2F9J A;  1TKT B;  1ZPW X;  4F4Z A;  1TP7 A;  5J1E B;  5LSO A;  4Y6I A;  4Z37 A;  3K7R A;  3JAM Y;  1BQM A;  5HAN A;  1DQ9 A;  1TKZ A;  1TL1 A;  3UDV A;  1FWL A;  4H4O A;  1NH8 A;  2AJ1 A;  5BXI A;  3D1O A;  2O01 C;  3EVM A;  5B08 A;  1HPZ A;  1ZPV A;  1HWK A;  2HYI B;  3CCT A;  2ZUA A;  4KT0 C;  3MMC A;  2CPY A;  2EPI A;  1N56 A;  1HQU A;  4C8O A;  2E9R X;  4EEY A;  3US5 A;  1GH8 A;  2GQC A;  1IKY A;  1S0N A;  3IC1 A;  4EBE A;  1U2R A;  2VV5 A;  4WIQ A;  2E66 A;  2FJA B;  4RUB A;  5LT5 A;  3B4M A;  2G2Y A;  4KV8 B;  2DO4 A;  3R7N B;  3TRG A;  2AJ0 A;  1WG4 A;  5D15 A;  3NL0 A;  1HI8 A;  4AD6 A;  4YB1 P;  2KJV A;  4IH7 A;  2RQK A;  3ZC4 A;  2FVP A;  5K8N A;  3MUM P;  4FF3 A;  1HWU A;  3TYT A;  3MEE A;  3UN5 A;  2YNG B;  1G7C B;  4K7Q A;  1JLG B;  4TXS A;  4RBU A;  9RUB A;  2XB2 D;  2ZC3 A;  4RPF A;  1RWN B;  5K5M A;  2UUA F;  1T03 A;  4MIW A;  1YBU A;  1XR6 A;  1CQN A;  3U1N A;  2ZVS A;  1D9F A;  2CJQ A;  3CJK B;  4K4V A;  2KFY A;  3NWR A;  2WON A;  1RHJ B;  3RRH A;  5A8W B;  1ITP A;  1JXV A;  1RZM A;  4BCA A;  4L75 A;  4MK9 A;  5LMU F;  1TMM A;  5DJB A;  1UL3 A;  4HL9 A;  1B7Y B;  1J5E F;  1RLC L;  2UXD J;  2IJN A;  3KJF B;  3QRP A;  1C2P A;  1FX4 A;  1V5V A;  3G6X A;  5HLF B;  2MKK A;  4PQA A;  2EFG A;  3GJT B;  2HMI B;  4AQY J;  1VBK A;  1N34 J;  2ZOF A;  1D8Y A;  1A0O B;  1ZAX A;  1VHI A;  4DR3 F;  4P9S A;  4OI3 A;  4OLO A;  3EDR B;  4CH0 S;  3UDE A;  4C8Y A;  4KHM A;  4ATN A;  3GIJ A;  3T5J A;  4F36 A;  2V2Z A;  2ZJP Q;  3VGT A;  3FFI B;  4UOH A;  2AGP A;  2ZJR Q;  4C3L A;  2UU9 F;  3ISN C;  4HT5 A;  3N6L A;  2VG5 A;  2CPZ A;  5HO4 A;  3CSK A;  4FVM A;  4ZP7 A;  2W2N P;  1FER A;  1VIS A;  5CA5 A;  3KK2 A;  3JQJ A;  1LV5 A;  2ALZ A;  1ZH5 A;  2M52 A;  2HND B;  1L3T A;  4FYD A;  3ILL A;  1H6K X;  4LF2 A;  3M6X A;  3BBB A;  2HGN A;  4G65 A;  3X3U A;  1NXI A;  1ZTT A;  1WHV A;  2E5H A;  4U8V A;  4C98 A;  3DLE A;  4C8M A;  1CPZ A;  1T9U A;  4B3O A;  3NXZ A;  2GS8 A;  3K8W A;  4ED4 A;  3CO0 P;  2E7W A;  2K3K A;  4NE9 C;  3QIP B;  1VQ8 S;  3RG6 A;  3T1H J;  1D9A A;  4IO9 Q;  2GHV C;  3FMW A;  1M5P C;  4OYA A;  1VQ4 S;  2BXJ A;  3JYT A;  2HFZ A;  1KQG B;  1SVD A;  4L76 A;  4H4K C;  3FSX A;  3L7O A;  1JLE B;  2DIS A;  2D9O A;  5CCL A;  2Y3Y A;  1S0O A;  3PIO Q;  3PV8 A;  5L38 A;  1EKR A;  1VQ9 S;  3I5A A;  4KY3 A;  1BLU A;  2HAF A;  4N56 A;  1RTI A;  4CRJ A;  5H9E J;  2IDE A;  3TQ1 A;  3K5N A;  3DGV A;  3LPY A;  1SJF A;  1NHV A;  3DDN A;  4UZC A;  5AE3 A;  4DQR A;  2B4O A;  3CD0 A;  2XMU A;  1IKW A;  2YQ3 A;  2D41 A;  2KG0 A;  4QJV A;  2E1A A;  2K1R B;  4ED5 A;  2KL8 A;  1F2H A;  1S79 A;  4IKA A;  2XLJ A;  3PX0 A;  1S9F A;  4J7C A;  4DQQ A;  4DG1 A;  3DLK B;  1FDB A;  1XIQ A;  3BN4 A;  4DV4 J;  2J9C A;  1BXN A;  4DJB A;  1U0H B;  3O3L A;  4K4S A;  4DSI A;  1RQ0 A;  2A6O A;  1S1V B;  3CED A;  3W2V A;  1AZS A;  4M1K A;  3G82 A;  3RB0 A;  3IA0 A;  2EEY A;  5G0R B;  2AYG A;  1LW0 B;  2DR8 A;  1VQO S;  1PG5 B;  4M5G A;  2KFN A;  1RTJ B;  1H98 A;  3I5C A;  1VMB A;  5D77 A;  3SBM A;  3KHL A;  4NLO A;  1K44 A;  2VFV A;  4OHX A;  4FF4 A;  1NBE B;  1Y4Z B;  4OZJ A;  2Z2Y B;  1Q1K A;  4O4G A;  1UP1 A;  4DHV A;  3ZNU A;  4ICL B;  4OHZ A;  1S12 A;  3AOC A;  3K5O A;  4YR0 A;  4RUA A;  1ELO A;  1MWQ A;  3QGH A;  2BKP A;  2ZBP A;  5DET A;  4ZPV R;  2HVH A;  2DHH A;  1SC6 A;  4DR7 J;  4LJM A;  2R7R A;  1K47 A;  2NLW A;  4FKY A;  3Q2S C;  3T41 A;  4DV3 J;  3NNA A;  5KFS A;  3MMA A;  1M5H A;  4C11 A;  3H4D A;  2LEB A;  5F0U A;  3V6J A;  3AH6 A;  2C3O A;  1TL3 A;  2HGL A;  1HD1 A;  4X4T A;  2DNM A;  3WZ0 A;  1NKE A;  1FRJ A;  2ERR A;  2KXF A;  5IV3 A;  1E6V B;  4NEY A;  2V4R A;  2CQI A;  2X1F A;  3RUB L;  2CQ4 A;  3T1Y J;  4CLU A;  3I6P A;  1X8D A;  4NL5 A;  2BA9 A;  4RBT A;  3G6V A;  3MMJ A;  1IKV B;  1R31 A;  2HVE A;  1S76 D;  2AJ4 A;  3GIL A;  3OR1 A;  3QRR A;  2C3M A;  2V4Q A;  4Q0B B;  2X1G A;  4OMF G;  2M70 A;  2NXE A;  1SB6 A;  1A9N B;  2GHP A;  1T05 A;  4OIX A;  1H2U X;  3OPK A;  3KK3 B;  1C0U B;  1ROF A;  4ER8 A;  1RGV A;  3RRG A;  3IBW A;  3J7A N;  1X9S A;  1W25 A;  3QO9 B;  2BQ3 A;  2XQC A;  2L41 A;  3W64 A;  5DRK A;  4UZB A;  4XK8 C;  4L3N A;  1QJH A;  2GW8 A;  2GQ2 A;  1OYD A;  2WVE A;  3IS9 A;  4F0H A;  2CJK A;  3CTR A;  5KFP A;  3A3O B;  5K14 A;  3LO3 A;  1S7I A;  2QL9 B;  4B9S A;  2YKN A;  4DUY J;  2PSZ A;  2EFN A;  3ISN D;  3WX4 A;  3VGU A;  3HX9 A;  2RRB A;  3HF5 A;  3AD9 C;  3PAC A;  4IG0 B;  2M2B A;  4O3R A;  2UV8 A;  2C2E A;  1L3S A;  1CQM A;  8RUC A;  1FFW B;  4KFB A;  5F8N A;  1X9M A;  3CD7 A;  3EVW A;  1F9F A;  4NOH A;  1OPZ A;  5L39 A;  5AE2 A;  1RT1 B;  2DNQ A;  2HWH A;  4G1Q B;  1VC0 A;  2HNY A;  4AQY F;  2GFF A;  1N34 F;  1X4F A;  3MOZ A;  3PNI A;  1CSJ A;  2KVI A;  3W5X A;  4WBF A;  1GAO A;  1WC5 A;  4PG8 A;  4OV1 A;  3T6B A;  1HAR A;  4WZQ A;  1Q5Y A;  2YVS A;  2IRX A;  3ET6 B;  2RAQ A;  4HHU A;  2HNZ A;  1OY9 A;  5U47 A;  3V4I B;  1WWH A;  1HQE B;  3EYZ A;  1JLQ B;  3KOA A;  4C7Q A;  4N5S A;  4XDD A;  2LQ8 A;  2KH9 A;  1TK0 A;  2ACM A;  2DXE A;  3PM9 A;  5C2C A;  1FKA F;  3WQP A;  2GMH A;  2HUR A;  4LVN P;  1TFW A;  1NKB A;  3AFG A;  1HNX J;  4ELV A;  4UQT A;  3N6M A;  3HSZ A;  4H4M B;  3KJV A;  3VV2 B;  3A8I A;  2DXD A;  4N8N A;  4ECX A;  4K50 A;  2CDR B;  2DCL A;  4DL0 C;  1SPB P;  1F5C A;  2IM1 A;  2F65 A;  5D4P A;  2ZDP A;  2UXB J;  4CDI A;  1JLC B;  2RDD A;  1R43 A;  3HPO A;  4HEA 9;  3PCO B;  1JLF A;  3L7U A;  2ZD1 B;  5B0F A;  3CJQ A;  4B08 A;  2V0N A;  5HBM A;  2MEW A;  5D3G B;  3MMB A;  1KOO A;  2CPE A;  3MTK A;  4QW8 A;  2U1A A;  2D7S A;  3K0J A;  4NLV A;  3BQ2 A;  3T1H F;  4P10 A;  1VK8 A;  4NCA A;  2HPU A;  4ZJO A;  5IV4 A;  1LWC A;  4I1T A;  1W2B R;  2XS7 A;  2XS2 A;  2P9C A;  4FXV A;  4N77 A;  1KBR A;  2I38 A;  2ZH5 A;  1OY6 A;  1KRP A;  3I0R A;  3E8O A;  2HLT A;  3NNH A;  2FHO B;  1RT7 A;  4QIW D;  3W60 A;  1N0V C;  3BO4 A;  3BGF A;  1B64 A;  1SH3 A;  1U6Z A;  3I31 A;  2R8G A;  1EP4 B;  3OUY B;  2I8E A;  1BUX A;  1HI1 A;  3R7S B;  1HNV B;  4R5P B;  3LPE A;  3N5F A;  2XLI A;  4CIO A;  3IMQ J;  3M2V A;  2VB6 A;  4DSE A;  3MPY A;  4GO5 X;  5ETN A;  4KYZ A;  1ZAV A;  4WPA A;  2FJE B;  4DV4 F;  3RR8 A;  3HP6 A;  3MR2 A;  1WAC A;  4EMD A;  2RB7 A;  3PRV A;  2OPS A;  2MZT A;  1EKS A;  3FC9 A;  2FB0 A;  1J5O A;  4MKA A;  2ZH8 A;  5DGB A;  4OYM A;  3BYR A;  5F8I A;  1RAJ A;  4LSN A;  4ED0 A;  3GG1 A;  1M5O C;  3NP5 A;  1HMV B;  2AMC B;  5KG7 A;  4ZOS A;  5CH7 B;  3P49 B;  2H54 B;  1GX5 A;  2G0C A;  3V4M A;  2RML A;  3PRB A;  2Z2M A;  4LF1 A;  5LSR A;  1YJU A;  5FLX Y;  2HBR B;  1H7X A;  2PE8 A;  2R8I A;  4DR7 F;  5D0H A;  4YEA A;  2GIQ A;  4LFA J;  4ZKA A;  4WU2 A;  5E41 A;  1FHT A;  1FRM A;  3LP1 A;  4DV3 F;  2J5A A;  3LP0 A;  1CBK A;  4C0B A;  2YXL A;  1S1T B;  5L9X A;  2CXE A;  3GPA A;  4LRD A;  3Q89 A;  3KXD A;  3W66 A;  2B4U A;  4UOF A;  1PJ7 A;  3NY0 A;  4KKO B;  3QNW B;  5KT4 A;  2GJI A;  2D69 A;  3T1Y F;  1B7F A;  3F73 A;  3A4T A;  1S9G B;  5KG3 A;  1REV B;  3DCA A;  1YJ7 A;  8ATC B;  3NS7 B;  3IXQ A;  4LF7 J;  1OSD A;  1KVJ A;  3KLH B;  1T3N A;  1Y00 A;  4NLP A;  3FEX B;  3GJR B;  1EIY B;  2R7T A;  2RU9 A;  3ILJ A;  3SV4 A;  2BVZ A;  5AXK A;  1KFS A;  1MWY A;  1PBA A;  4CQ1 A;  1BWE A;  2JEI A;  4ZN1 A;  3PEH A;  3IR7 B;  4TY8 B;  4OX9 J;  3CJ5 A;  5G4D A;  1FI4 A;  1RCX B;  2NYI A;  3MUT P;  5HP1 B;  3GE9 A;  5HI7 A;  1QE1 A;  1WEL A;  1GXT A;  2Q43 A;  5I3P A;  4B3T J;  3JQK A;  2MGZ A;  4DUY F;  3HVT A;  4WK1 A;  3PR4 A;  3M32 A;  1S48 A;  4TQR A;  4I0W A;  3DOM B;  1R89 A;  1I6J A;  1N33 J;  3QMQ A;  4F4W A;  4I2Q B;  5I42 A;  3GTY X;  3BS9 A;  5J2N B;  2W7O A;  1YIJ S;  2WSF C;  2HVZ A;  1F5B A;  2IHR 1;  1YDL A;  2CQ2 A;  3CC4 S;  2JEG A;  2W24 A;  2EG2 A;  4L3K A;  3LP2 A;  1AUS L;  2QL5 B;  2CJ9 A;  2V5H G;  4CCH A;  1RA7 A;  2KB2 A;  1QDU B;  3OTE A;  2YBV A;  4QWD A;  1N6Q B;  2PMZ D;  4I7F A;  3UVJ A;  4B9V A;  3SQG A;  2FIU A;  4C8L A;  1KVI A;  2FC8 A;  2YTC A;  4O44 B;  1U6F A;  3MEK A;  2XMA A;  3KLF B;  1SCJ B;  3CJ3 A;  4DL7 A;  3W9I A;  3TO8 A;  1BY9 A;  2PFF B;  3CCM S;  2C2Z B;  1QD1 A;  3D28 A;  1UJ4 A;  1N5T A;  1SQE A;  1RAI B;  1LWE B;  2Z2L A;  4OZ3 A;  1WEY A;  2CAJ A;  1NSP A;  2V8G A;  3EDQ B;  3OT9 A;  2WW4 A;  4FF1 A;  2HSE B;  1KC8 T;  2YH0 A;  4P2F A;  5C24 B;  3NKY A;  2YWK A;  1HNX F;  2ZM6 J;  1T9X A;  3QT6 A;  2AU0 A;  2LEP A;  2DIT A;  3DI6 A;  3BPS P;  3PW4 A;  1UZH A;  2BJ3 A;  3VAK A;  2LDY A;  4TKT A;  3VR1 A;  1BHN A;  2JL9 A;  2JZ5 A;  1K73 T;  2PII A;  4C6A A;  2ASY A;  1VC6 A;  3IG1 B;  2UXB F;  4KPC A;  1LK7 A;  2ZOM A;  2XNR A;  4J9Q A;  3OTO J;  2V4J B;  2OPP B;  1X4H A;  2DVI A;  3J80 U;  3VAM A;  3T5K A;  4P7T A;  2B0G A;  2VZ9 A;  4DOZ A;  3H25 A;  4C0H A;  2WBM A;  3UDC A;  1BQN B;  3EGN A;  1PBU A;  4F4A A;  1RAB B;  5HVH A;  3SFG A;  5KFL A;  2HBY B;  4KO0 B;  7AT1 B;  1RIS A;  4WFA Q;  1PGZ A;  4K8R A;  5MLC V;  1OS5 A;  4ENO A;  3TX0 A;  3OR2 A;  2E9Z A;  2H9Z A;  4KGX B;  1U48 A;  4FF2 A;  3KLG A;  5GAH I;  1WI8 A;  3EGW B;  3PIP Q;  4IO1 A;  2DJW A;  2YKA A;  5DLG A;  2CPX A;  1QSL A;  3U27 A;  2WW8 A;  4OZ5 A;  1APS A;  1FKO A;  1K8A T;  2C2R A;  4DX6 A;  1VGY A;  1RWK B;  3B82 A;  1DTQ B;  2F9D A;  3MD1 A;  2IDL A;  1GXL A;  4QR1 A;  3DM2 B;  4D3H A;  1S0M A;  2Y0S D;  3A1Y G;  2ALY B;  1FK9 B;  2GVD A;  3TW0 A;  3TAQ A;  2NXJ A;  2HQI A;  3H4B A;  5JJB A;  2EXU A;  4F25 A;  2E5G A;  3DRY A;  2XY5 A;  2LLZ A;  1CUL A;  2D3Z A;  3LTO A;  2CZ4 A;  3K5P A;  2MLX A;  2VU5 A;  1VRU A;  4RNM A;  1TK8 A;  4LQ9 A;  2HZV A;  4DL4 A;  2X1B A;  3EIC A;  4YR2 A;  3CUL A;  2CZ9 A;  3CCU S;  3CIM A;  1RAF B;  2OUG A;  2F63 A;  4B3R F;  3MAQ A;  1RT3 B;  1ZTW A;  1UAW A;  2YWE A;  1VQ5 S;  3C2P A;  3IWN C;  2NPI A;  2L08 A;  2HW3 A;  1VRT B;  1N5Y B;  3SSR A;  2W25 A;  3BPD A;  2I1R A;  2QLB B;  3M4X A;  3W9J A;  3C14 B;  2AEF A;  3ZTP A;  2DCU B;  2BE2 A;  2OSQ A;  5IC6 B;  5F41 A;  5I3Q A;  1HBU A;  1IN0 A;  4W90 B;  5AXN A;  5F8L A;  2ZC4 A;  3DHW C;  4ED3 A;  1HYS B;  4OI0 A;  1RAH B;  3BGR A;  4IG3 B;  2BMB A;  2I6W A;  1X5O A;  4LFA F;  1GQE A;  2C1E B;  2D9P A;  2CQ1 A;  5D78 A;  3CE8 A;  1DTT B;  3EJM A;  3CDA A;  4QCL A;  3OBI A;  1MNE A;  1PJ5 A;  2XMJ A;  5BYS A;  2IC3 A;  1OWX A;  1GTH A;  3MAA A;  4YDD B;  5JXS A;  2FZG B;  1FVS A;  2G1H A;  3HHN B;  3EXC X;  1YBT A;  4J90 A;  3CJ0 A;  4YQW A;  5C42 A;  3E01 A;  2QO3 A;  1SV5 B;  4AUK A;  2EKN A;  5DGA A;  3HJV A;  5H9F K;  2HEK A;  1IVZ A;  2QIF A;  4CM0 A;  5CXT A;  2R8J A;  3TOQ A;  3UN2 A;  1FRX A;  4R8U B;  4NRU A;  1IBC B;  2ZZN A;  1YIT S;  3CC7 S;  1D9D A;  4QW9 A;  5ETK A;  3GCW P;  2Z8Q A;  2ZE2 B;  4OI2 A;  1VOM A;  4KGV B;  3AB4 B;  3C16 B;  5J2P A;  4RU9 A;  3HO1 A;  2RRN A;  4MIA A;  1PYO B;  4U9R A;  3R2D J;  3M1V B;  1C1B A;  2W9B A;  2LCW A;  1U8W A;  4URG A;  5L1I A;  3D6H B;  1FNX H;  4FP9 A;  2YWW A;  4DCO B;  4OX9 F;  5EGY A;  4W4M A;  2UVR A;  4CLL A;  1I51 B;  2XYP B;  2VFR A;  4NA2 A;  1ARO P;  3SZ2 A;  1SBR A;  4XAK A;  4OFZ A;  4YR3 A;  4B3T F;  1H7W A;  1TQL A;  4ANE A;  3I4P A;  4E8U A;  3D5M A;  1BGX T;  1CJU B;  5HMW A;  3M2R B;  3EX7 B;  1N33 F;  1BE4 A;  4B17 A;  4EO8 A;  1TKZ B;  2R7U A;  2JOQ A;  5CAB A;  4H4O B;  3SQO P;  3GV5 B;  3J7Y U;  2QLW A;  3R5A A;  4GC7 A;  3MOJ B;  2QC3 A;  1SJ1 A;  2PI5 A;  2DGV A;  3TJ9 A;  2BEF A;  4EO6 A;  1S4F A;  2B7C B;  1HQU B;  4JV5 J;  5KG0 A;  3M8Y A;  4ECT A;  2ZNZ A;  3CCL S;  2GML A;  5KFO A;  2A18 A;  2JVR A;  3EGV A;  3POT A;  3T9Z A;  1XER A;  3QYY A;  4RO0 A;  1DY3 A;  2YNF B;  3AB2 B;  1L3V A;  4DN9 A;  3QWP A;  2ADB A;  5FD1 A;  2B43 A;  5D6G A;  2XI3 A;  4X4N A;  4DZ6 A;  1GMV A;  2ATL A;  4OZ0 A;  1KKH A;  4RW8 B;  2B56 A;  4CYU A;  1VLO A;  1U1Q A;  2FLO A;  3DGP B;  1AA1 B;  4HHH A;  2ZM6 F;  4DWI A;  2CQH A;  2ZEJ A;  1R8A A;  3PHT A;  2M0G B;  3MR5 A;  2DGO A;  1NJZ A;  4UST A;  4FS2 A;  3Q23 A;  4PZV A;  4WP9 A;  3DRR B;  2NYH A;  3HD2 A;  1S99 A;  3BSC A;  1WEX A;  3OTO F;  1MU2 B;  1RHR B;  4W92 B;  2J9D E;  4RW9 A;  3J81 U;  4QBU A;  4DL5 A;  2A2C A;  4PUO A;  1NK0 A;  2RE1 A;  4I4B A;  2OSR A;  1F3V A;  2V34 A;  3GON A;  4FBU A;  1FES A;  2W01 A;  2BAN A;  3Q0A A;  3M2U A;  3M9O B;  1R0B G;  4QR2 A;  2QZ8 A;  4QU6 A;  4ZVT B;  5KOW A;  1X60 A;  4WCE Q;  1NRK A;  4CH7 A;  4DU8 A;  4TU7 A;  3THV A;  3TNV A;  1HI0 P;  4OX8 A;  2XBP A;  2VAS A;  3WBZ A;  4OZL A;  4LF8 J;  2V63 A;  1HBN A;  3G86 A;  5K8P A;  3B78 A;  4ZIW A;  3J81 j;  4YB6 A;  3ITH A;  3BKU A;  4ZLJ A;  1S0V A;  1LFW A;  1HWJ A;  2V67 A;  2HBZ B;  3Q8P B;  1EB0 A;  2FJV A;  3VGV A;  1T9W A;  3FZ2 A;  1SL1 A;  2FLN A;  4MT1 A;  1UJ6 A;  5KFD A;  3VGS A;  2FQQ B;  1F5A A;  4XDC A;  4I2P B;  4IFY B;  6FD1 A;  2VBZ A;  1RWU A;  2OO4 A;  2N4D A;  3IR5 B;  2LEA A;  3KK2 B;  1RYR A;  1WOP A;  5THW A;  1QAJ A;  1QM9 A;  1TL4 A;  2QL7 B;  1Q5V A;  5DLF A;  1R0A A;  3RBD A;  5C2G A;  4F4K A;  3C6U A;  2R3V A;  1Q8L A;  1V6H A;  5BYR A;  4QYZ K;  1YTY A;  2OML A;  4UUX A;  4CLY A;  5LSL A;  3DLE B;  4ZIT A;  4B3O B;  3M7V A;  2A6M A;  3G9C A;  5LOQ A;  1IKX B;  1U24 A;  4C3K A;  5E0O A;  4X66 J;  4JYA J;  1NAQ A;  3KK1 A;  3RAQ A;  2BJ8 A;  2FY1 A;  2R8K A;  4CT8 A;  3FBF A;  4ALZ A;  5FJ4 A;  2WAQ D;  1C1C B;  5FDL B;  3ENQ A;  2N7C A;  5I3U A;  1VQL S;  4KB7 A;  3JYT B;  1MMN A;  1RA6 A;  3RAX A;  3MPD A;  4BS2 A;  1KHV A;  1FRH A;  2YWF A;  4DZD A;  3KHR A;  2VDH A;  3D3C J;  3KG4 A;  2QA4 S;  1FT8 A;  2XMT A;  1FNO A;  2MSS A;  3MPW A;  2AF6 A;  4MMO A;  2CAD A;  2KXN B;  1FJ7 A;  4I64 A;  1J27 A;  3HHK A;  4LRC A;  5DQG A;  4F7V A;  2M3D A;  1Y5I B;  5F8H A;  4QPT A;  4JV1 A;  4A8W A;  2VPX B;  4EI2 A;  3KMQ A;  5KFU A;  3MED B;  2VPY B;  4ZLL A;  4I6W A;  5EDW A;  3THP A;  4CZC A;  2KT2 A;  4PQU A;  3MXH P;  4IQM A;  2F8H A;  5IT9 U;  2CNK B;  4O23 A;  4DG1 B;  1M1H A;  5K8M A;  2LU2 A;  1DQ8 A;  4KTQ A;  4JV2 A;  1QY7 A;  4X4Q A;  4DPT A;  3A3P B;  2L3M A;  1KLN A;  4LQ3 A;  5A2Q U;  3AD8 C;  2JC0 A;  2PN6 A;  1TVR B;  4OZ1 A;  1P27 B;  3SCK E;  3U7J A;  2DR5 A;  2UVV A;  3DXB A;  4ZVP B;  1X4C A;  3PO5 A;  4WFB Q;  4EBD A;  1CS4 A;  2MYF A;  4NI2 B;  2LEC A;  4WII A;  4LBH A;  3M30 A;  2HHQ A;  3UCU P;  1Q16 B;  1N4L A;  3DOL B;  2L9D A;  4LFB J;  4FBT A;  3GR1 A;  4PG7 A;  1HBM A;  2JWN A;  2HAI A;  5HMX A;  1KNZ A;  3QBC A;  3P5T L;  1FE0 A;  2QFI A;  1Z2L A;  2DRD A;  2J9D A;  1IR2 A;  5DQI A;  2MY8 A;  2IM2 A;  3FBE A;  3NAH A;  4MK7 A;  1U1O A;  2QMX A;  1RB0 A;  3DOK B;  2XCA A;  4DR4 J;  1LK5 A;  3R5B A;  4O3Q A;  2J0W A;  2O66 A;  4J9K A;  1PCA A;  2MY7 A;  4C11 B;  1FEH A;  2AT1 B;  1X9W A;  4DS4 A;  4HAC A;  4NZ7 A;  1VJW A;  4NLQ A;  3VQT A;  4WXO A;  1FXR A;  3HUL A;  3RAM A;  4OJH A;  3BKF A;  1HW8 A;  2DO0 A;  3QFW A;  3TI0 A;  2EFO A;  4JV5 F;  4HH0 A;  2YX1 A;  2R2U A;  1VQ6 S;  4S0M A;  3H59 A;  4WF9 Q;  2I5J A;  3PFO A;  1VQP S;  2HZA A;  3OR1 B;  2Z0G A;  1ICE B;  2RRA A;  4BC7 A;  1B0P A;  1RT4 B;  3HKZ D;  2KZM A;  2DH8 A;  2CQB A;  3AXM A;  2JFD A;  3J7Z 5;  4K5S A;  4GVB A;  2AYM A;  4CO5 A;  1Q4R A;  3S1T A;  3MR7 A;  2VF3 A;  3GFX A;  3Q24 A;  1RT2 A;  2XZW A;  1NCL A;  1Q8K A;  3OFF A;  1SXL A;  3PKM A;  3CJ2 A;  2ZZT A;  2W4D A;  2FTR A;  3MCN A;  4Z7C A;  4G3I A;  3P6Y C;  2P2C B;  1FKP B;  2VOP A;  4GMK A;  3V6D A;  4ZVR B;  3EGZ A;  2IPO B;  2Q6C A;  5K14 B;  2MQP A;  4Y2K A;  4OQJ A;  2VPZ B;  2OFG X;  4Q2M A;  1Q79 A;  1UPP A;  8AT1 B;  3CGI A;  1FRK A;  3NBP A;  3ZTS A;  1S6U A;  4QPX A;  4FDF A;  2E1C A;  2IY5 B;  4EBC A;  2KFZ A;  4R25 A;  2JHE A;  2HRY A;  1UPM B;  4USI A;  4K5R A;  3OV7 A;  2Y1I A;  3B4D A;  2VON A;  2J6T A;  4M5D A;  1NHU A;  2KYZ A;  3BRE A;  3CDW A;  2OPR A;  1LW2 A;  2X3D A;  4LF8 F;  2VC1 A;  3IP0 A;  2NXN A;  2CQD A;  1CJV B;  5JVH Q;  3AA9 A;  1V9O A;  3PJ9 A;  2R7Q A;  1HW9 A;  2YH1 A;  2V8D A;  4PWU A;  4LRF A;  2DHA A;  4A8Q A;  3TQE A;  1N5S A;  1RTD A;  2LQB A;  4LBI A;  2FDN A;  2VG7 B;  1R8P A;  2FLL A;  2YX7 A;  4YS2 A;  4UUW A;  5E3Q A;  5AXM A;  1VQM S;  4ERD A;  3BH6 B;  1Y0H A;  2DY1 A;  3DU6 A;  3L4B C;  2XEX A;  4ED8 A;  1NJX A;  1S59 A;  4OJG A;  4M5J A;  1CJT A;  5IS2 A;  4KH0 B;  2Q6B A;  1RTH A;  1U02 A;  1EET A;  1NK9 A;  2GJF A;  3L95 X;  4ECV A;  4NA3 A;  4OX7 A;  4X4R A;  4MTP A;  3LW5 C;  4EZ6 A;  2HQ3 A;  2RT3 A;  5K9F A;  1VHF A;  2RQM A;  5ETM A;  3BJY A;  3L9Z A;  2J6U A;  1N5V A;  2QV6 A;  4NLW A;  2DRB A;  2G2Z A;  3CXC R;  2W2M P;  3MMB B;  1X4D A;  4ED1 A;  4DEZ A;  1U1R A;  1GMW A;  1S77 D;  4TY9 A;  1JJ4 A;  1TV6 A;  5IQ6 A;  3W9H A;  1GX6 A;  2Z30 B;  5LXR A;  2VA3 A;  4JYA F;  2C3P A;  2ZFH A;  4ZP6 A;  5CD4 A;  2MQM A;  4X65 F;  1YJW S;  1JJH A;  1XJW B;  3ZO7 A;  4BLG A;  4DPY A;  3V6K A;  4ES3 A;  4NA1 A;  2EVZ A;  3KNG A;  1NSQ A;  3T5L A;  2DIU A;  3H5U A;  4FS1 A;  5CCM A;  2YX4 A;  2N4C A;  1X5P A;  3CDE A;  1SL2 A;  3HHL A;  3R8Y A;  1RT7 B;  2BQU A;  2GQQ A;  2QN6 B;  1YBA A;  4Q8F A;  3CD5 A;  3IRW P;  2RHS B;  5JMN A;  2AYE A;  2AD9 A;  4F3M A;  1LWF A;  4DU7 A;  4P75 A;  1UVI A;  3DLL Q;  5F9N A;  2GO8 A;  4DX7 A;  1M5V C;  3N4W A;  4CP5 A;  3ZTO A;  2MQL A;  3KHG A;  2YKO A;  3BGO P;  1TL7 A;  1A6L A;  4RWW A;  2DBB A;  2YNG A;  4NCG B;  5IZH A;  2DIV A;  2UUW A;  4Y2M A;  4IFV B;  2HBQ B;  3NEK A;  4F02 A;  2R8H A;  4KGZ B;  5A6W A;  3MM9 A;  3HFV A;  5HJY A;  3BYP A;  3O2I A;  4IH5 A;  1Q82 T;  3CJK A;  3VVU A;  3GFY A;  3OVB A;  5CZV A;  5LMU J;  1FDA A;  1FRL A;  2DGT A;  5A8W A;  3D2W A;  4WP8 A;  1K0V A;  1J5E J;  4X4P A;  2B9E A;  3PW7 A;  3ONQ A;  2OEM A;  4JI8 F;  2DHS A;  5J2Q B;  2VL1 A;  1FE4 A;  4PG4 A;  4LFB F;  5KT6 A;  1IBL J;  2E5I A;  1X7V A;  2QEX S;  2FHJ D;  3P5B P;  1XQI A;  5HLF A;  3OLB A;  4QWB A;  2Q79 A;  5DZ6 A;  1FVQ A;  3OXF A;  2QA1 A;  2C2M B;  1X0F A;  2FZK B;  1FD2 A;  2F3J A;  4CWB A;  2B6A A;  2F4V J;  4DI6 A;  2XSJ A;  3DMJ B;  4UW2 A;  5KFM A;  2O1P A;  3LF0 A;  3KUH A;  2COL A;  2PD1 A;  4DFM A;  2ACY A;  4DR4 F;  1RLD A;  3LP1 B;  3LP0 B;  4J9V A;  3V81 A;  3CWJ A;  3OFH A;  3GV8 B;  1JJC B;  2AJF E;  3AOB A;  1UW9 A;  1S1X A;  4E0D A;  3OW2 R;  1HFE L;  3D66 A;  3FFI A;  3LH2 S;  3I96 A;  3Q83 A;  1VI7 A;  4KGM A;  1C0T A;  3M8Q A;  5DM6 Q;  1S7H A;  1IBK J;  4P2M A;  1SQG A;  3MEC B;  3HVR A;  1M5S A;  3SCJ E;  1QAY A;  2XUL A;  1ACM B;  2VFU A;  3FZB A;  3SDE A;  4ZCI A;  1FTR A;  2VKZ G;  2DNG A;  4U6P A;  3CDB A;  5KFX A;  3ILO A;  4YB7 A;  3KDN A;  3BR9 A;  5C5J A;  2V2K A;  2Q1L A;  2XO7 A;  3QLH A;  3PY8 A;  1TR0 A;  2HHH J;  2MKC A;  1VK3 A;  2N7Y A;  3R3T A;  3QJP A;  1JMT A;  2EBE A;  4X2B A;  1TAQ A;  1HWL A;  1KQK A;  2BDP A;  2G2O A;  2QLX A;  5B0G A;  4P74 A;  3CD6 S;  1XMB A;  1IXK A;  3ZZZ A;  2FPH X;  3H98 A;  3RRK A;  1YVF A;  2WHO A;  2XLK A;  3K2Y A;  3M32 B;  4NYO A;  4X4O A;  4U8Y A;  5M2R A;  5I42 B;  4JI0 J;  2MZQ A;  3JXO A;  4Q2L A;  3AJD A;  3W8P A;  3UDL A;  5D8H B;  3MWB A;  3BSN A;  1RBA A;  2IA6 A;  3DYA B;  3ILI A;  2HRU A;  3LP2 B;  4CM2 A;  3E51 A;  3RBX A;  3T9N A;  1SI9 A;  4HKQ A;  4KR0 B;  4K4T A;  2BKN A;  2YKM A;  3NGK A;  2K1R A;  4DR1 J;  3IBF B;  3O44 A;  1HHQ A;  2DB1 A;  3SQG B;  2ASJ A;  5HMY A;  1TEL A;  2CPD A;  3CJT A;  4ZP8 A;  4B9T A;  3G8S A;  4OLP A;  4LMZ A;  1U0H A;  4NZ6 A;  1FJC A;  2IM0 A;  2E5J A;  1S1V A;  5DDO C;  2WVD A;  4Q43 A;  5D0R A;  4LIR A;  2V68 A;  4Y0F A;  4JI1 J;  5L1K A;  1YLX A;  1UVJ A;  3ZTQ A;  2CG8 A;  3NMR A;  1RTJ A;  2VOO A;  3AJ1 A;  2IVF B;  2XG8 A;  3QWU A;  3DI6 B;  2OGU A;  3KKF A;  1R3N A;  3JSM A;  2Y9H A;  3R7B B;  4ZMM A;  4CO1 A;  2ZWO A;  2W1B A;  1U47 A;  4DUT A;  1U6B A;  2ZWP A;  4DBQ A;  2CDQ A;  4HYK A;  5T7L A;  2X3G A;  4NZ0 A;  3HMJ G;  1F60 B;  1OO0 B;  2BKO A;  3PO4 A;  3TAN A;  5B09 A;  4WFY A;  3GWC A;  2KKH A;  3CCR S;  2RS2 A;  3WC0 A;  1VQ7 S;  3FDS A;  2MQQ A;  1YJ9 S;  3NCR A;  4CO0 A;  2EG1 A;  2OEK A;  2MZJ A;  3RW7 A;  3BF4 A;  3D68 A;  4PAA A;  1WC0 A;  3HD1 A;  3C66 A;  4HR2 A;  3OHB A;  1E6V A;  3UN3 A;  2BX6 A;  1Y10 A;  2JLE A;  2IMW P;  2CPF A;  2BJ7 A;  3ZNJ 1;  3Q86 A;  2XGP A;  4FVC A;  1IKV A;  2BRL A;  3HZE A;  2K3I A;  2KHD A;  5GAD U;  5KFV A;  4Q0B A;  4KRW A;  1N88 A;  2VBX A;  3EPI A;  4YME A;  4ID5 B;  1WI6 A;  2HS3 A;  2ROG A;  3PX4 A;  2EC2 A;  1FKO B;  1U1N A;  1XEZ A;  3D6M B;  3MR3 A;  3CCS S;  1K9M T;  1S1U B;  3KK3 A;  2RNE A;  3CF5 Q;  3SV3 A;  1BWV A;  1N8R T;  4JBC A;  3OL6 A;  1H0H B;  3OD2 A;  3D4J A;  4CTA B;  1HKA A;  2E29 A;  5DS7 A;  5KT3 A;  3TUI C;  2H5J B;  5ETL A;  4ED2 A;  5HQM A;  3ULH A;  1Y3K A;  4ELT A;  3FEY B;  2G4B A;  1REG X;  3PYE A;  3NOG A;  2VDI A;  5IM0 A;  3HFK A;  4WTO B;  2EWH A;  4FNH A;  3PXG a;  5EWF A;  1KTV A;  1FTC A;  1IBL F;  2DGX A;  3SEO A;  1PSD A;  4ZVO B;  4DR6 J;  2WSE C;  3IM9 A;  4M5H A;  2UP1 A;  4G1Q A;  1HBU B;  4J9P A;  3N6N A;  2RH3 A;  4DSL A;  2R4F A;  2E7V A;  2F4V F;  1NSA A;  3M8P A;  4XIU A;  1XBW A;  4KJI A;  2HK2 A;  2M4M A;  3FK4 A;  3PR5 B;  2GX8 A;  1TKX A;  2K06 A;  3MM8 B;  2QJ3 A;  2V8H A;  4DV7 J;  1PJ6 A;  1UZD A;  5A6P A;  1I5O B;  1NDC A;  4A48 A;  3ET6 A;  4CO4 A;  3SMZ A;  2IC3 B;  2CQ0 A;  1LKZ A;  1JB0 C;  1YSJ A;  4IUF A;  3UD3 P;  1HQE A;  2DNZ A;  3MUR P;  5C42 B;  1XR7 A;  2L9N A;  5LJ5 Y;  3GQC A;  4BWJ A;  1RTZ A;  3N28 A;  2FVQ A;  3IO1 A;  1XNQ J;  3W61 A;  4W98 A;  1IBK F;  2OAU A;  4ECW A;  1KVK A;  2VQE J;  3M9N B;  2VBY A;  5KOX A;  2YQ1 A;  1U2C A;  5EUH A;  3DXS X;  3GV7 B;  1B0V A;  4M63 A;  3QRQ A;  1P9Y A;  4P2X A;  4R0E A;  3VAG A;  2ZHB A;  1HLW A;  3FKB A;  2W7A A;  1EAR A;  1JLC A;  3I55 S;  1MG7 A;  1HD0 A;  2DR6 A;  2AJQ A;  5ADZ A;  2W9B B;  3PHE A;  3A8E A;  5D3G A;  2HRT A;  1Q8B A;  2DNH A;  1E6Y A;  1NZA A;  3GP9 A;  4L72 B;  5EX0 A;  2HHH F;  5A8K B;  5E33 A;  1VCT A;  4I56 A;  2C2D A;  3R97 A;  3IFE A;  3FUY A;  4OJ1 A;  2DGW A;  3A8J A;  3HI9 A;  2APO A;  3JS9 A;  4X4V A;  3W5Z A;  3VAF A;  1PYT A;  1HBO A;  4JI0 F;  2FHM A;  4WWS A;  5CAA A;  1U45 A;  3BBF A;  2BV3 A;  3R6G B;  2NPF A;  3L09 A;  3FSY A;  1RHM B;  3OUY A;  1JNZ B;  4Y28 C;  4OYP A;  2LXU A;  2BE7 D;  5AE1 A;  3TAM B;  4R5P A;  3PYG A;  3HKW A;  4AXJ A;  4YB5 A;  3OL8 A;  4ELU A;  1AUD A;  1T94 A;  2FZC B;  2R7V A;  4PPZ A;  4DR1 F;  1SKR A;  2LQ9 A;  2W9A A;  3WC2 A;  1LWX A;  2A0F B;  2DNY A;  3CME S;  3BSA A;  3POT B;  1VJQ A;  4DX8 H;  2XWY A;  3B54 A;  4PXD A;  4M8L A;  2UUB J;  4PRF A;  4F0K A;  1SL0 A;  5IOL A;  2DGU A;  3BO3 A;  2AHO B;  3KJQ B;  4ECQ A;  1PKU A;  4B3M J;  4JI1 F;  4C0O C;  4YUD A;  3TP2 A;  4USH A;  1R8B A;  1F9E B;  4NYP A;  3FSI A;  2E1M C;  5T41 A;  3CCE S;  5IT4 A;  2ATC B;  3UW1 A;  1S6P A;  4QIE A;  3J7Z T;  4DQP A;  1X31 C;  1R8C A;  2OLW A;  1EQM A;  3I0S A;  3X1L B;  3TEG A;  3R1H A;  2WSC C;  2F5G A;  1FO1 A;  1JXL A;  1T8E A;  2NSC A;  3OFE A;  4RL1 A;  1RYS A;  3GR0 A;  3K89 A;  3M8Z A;  3DLH A;  2N3O A;  3QAE A;  1S6Q A;  4RW9 B;  3J7Y I;  2KJW A;  2Y1R I;  2BW7 A;  2W9C B;  4URS A;  1HR0 J;  1G6B A;  1ZM3 A;  5IWA J;  4RKU C;  2BAN B;  2H1Y A;  3M2U B;  1NPR A;  3RGI A;  1J2V A;  1LQ9 A;  2JDJ A;  2HS0 A;  2CUY A;  3GIK A;  1DHM A;  3FRY A;  3GCX P;  2CQC A;  1S1W B;  2P6S A;  4MFB A;  1KD1 T;  3HHE A;  1S97 A;  4U7C A;  3LGH A;  4LR8 A;  2C3Y A;  2W8L A;  4PG5 A;  3SI8 A;  4DDF A;  2IJR A;  1HBN B;  2ZH2 A;  3OL7 A;  3D54 A;  1RWP B;  2ZBI A;  1NK8 A;  3ITH B;  3KNA A;  3Q8Q B;  3TUP A;  4BWM A;  5GMK a;  3HT0 A;  4JI2 J;  2VFS A;  1REV A;  2MMY A;  2IBK A;  3IWL A;  2RS8 A;  3JSB A;  5A0Y B;  3W1Y C;  2Z58 B;  1RHU B;  3TVZ A;  3KLH A;  4K4Y A;  5CZX A;  4P2S A;  4DV2 J;  2DGS A;  4O0N A;  4K0K J;  1GK8 A;  3R5C A;  3MHY A;  3QZ8 A;  3QAT A;  4F26 A;  1WHW A;  4TY8 A;  5ETR A;  4WU3 A;  3SSS A;  4WP3 A;  3K5M A;  4CLT A;  4HDG A;  1RP5 A;  1ZM4 A;  3A12 A;  1QVG R;  4EK2 A;  4M5K A;  1R0A B;  3T3F A;  1F1B B;  3IAM 9;  2J76 E;  2HK3 A;  4MAK A;  4ZPW R;  1UWB B;  2OEL A;  2Y8Y A;  3NG8 A;  4M5I A;  4ECU A;  3DOM A;  1S9E B;  3CDU A;  2BAB A;  4I2Q A;  1RAD B;  1WOR A;  1DFD A;  5DDR C;  3KHH A;  3CCJ S;  3T19 A;  2WVF A;  3ZZU A;  2PEH A;  1RU2 A;  5J2N A;  2OTL S;  5L1J A;  1YKW A;  3AOA A;  2AJ2 A;  4DR6 F;  2GV1 A;  3LOU A;  2JLF A;  2PDA A;  2B7B B;  1NSK L;  3ETM A;  4N47 A;  1NB7 A;  1RCO B;  3P3D A;  4U96 A;  4I68 A;  4OHY A;  2ZJQ Q;  3RR7 A;  4ILM A;  4RW6 A;  4PWD B;  1PIE A;  3ADA C;  1KQF B;  3H40 A;  4DV7 F;  2FGC A;  4GKJ F;  3KLF A;  4J91 A;  4PWW A;  3QSY B;  1FCA A;  2LXF A;  4RNO A;  3GJS B;  4X4S A;  4DFK A;  4J9U E;  1TFY A;  4DSF A;  1XNQ F;  3MDF A;  2MTL A;  2MLZ A;  2XSF A;  1JLB A;  2V9K A;  3TUZ C;  2O3D A;  2VQE F;  2HFO A;  1MML A;  2IVM A;  4Y34 A;  1X5S A;  3OVS A;  1VIO A;  3E3X A;  1F3F A;  2MPU A;  4ZLP A;  3D0I E;  4XTT A;  2IBO A;  3WDO A;  1X4E A;  3BB5 A;  4GKK J;  1LXN A;  2QGF B;  1T02 A;  3IG1 A;  2VIC A;  1NK7 A;  1KN6 A;  3GFZ A;  5D0E A;  3IRX B;  5EN1 A;  4KHP J;  1HHS A;  5A8R B;  4K4W A;  2QA4 G;  2GNK A;  2VD3 A;  1D1U A;  1FDD A;  3M30 B;  3AY0 A;  1ZET A;  4HTJ A;  1MSW D;  1WHX A;  2V94 A;  2Y1J A;  2UV8 G;  2M7S A;  3MM6 A;  5I4M A;  1NDK A;  2FY8 A;  3LAK A;  3V2U C;  2AEM A;  4MKB A;  2AX0 A;  3QAU A;  3AA8 A;  3BQ1 A;  4TQS A;  3B6B A;  4RW4 B;  3DLG B;  4LRA A;  5L1L A;  1T11 A;  2DHX A;  3O6Q A;  1SC4 B;  2J9E A;  2QYC A;  1X4A A;  1ZZF A;  3TEH B;  3FVY A;  4ZVH A;  4LSL B;  4QWE A;  2P9G A;  1N32 J;  1C4A A;  2XMK A;  1HNI A;  3HFZ B;  4A8F A;  4I69 A;  2ZH1 A;  2DPJ A;  2CQP A;  3DRP B;  2PC6 A;  1NK6 A;  3DNC A;  1OQ6 A;  2I5J B;  2HQD A;  3GYG A;  2ZH3 A;  3D1H A;  2DTJ A;  1I1G A;  5HVG A;  2NSB A;  2HZC A;  2GGP B;  4G1I A;  2D3O R;  3OJS A;  2GIR A;  2UUB F;  1X5T A;  2YPY A;  5ETO A;  4N41 A;  3J80 Y;  5DG7 A;  1N52 B;  3K17 A;  1WEZ A;  4B3R J;  4TNO A;  1BC6 A;  2ABY A;  4ZJQ A;  3IGN A;  3BO2 A;  3ICL A;  4C48 A;  4B3M F;  1IWG A;  4GVB B;  5E2Q A;  1JKH A;  3CNQ P;  1RT2 B;  1VRT A;  1WSV A;  2MKY A;  4YN3 B;  1OMS A;  2VG6 A;  5KFT A;  3CJ4 A;  1Y11 A;  3V6D B;  4DMZ A;  3C14 A;  2CWK A;  2V50 A;  2QG9 B;  3CW2 C;  5HVF A;  5BYQ A;  1O0P A;  2FGO A;  4A8S A;  1NKC A;  4IDK B;  3HSJ A;  3JSY A;  3MM7 B;  2B51 A;  5E3R A;  1NU4 A;  1WDD A;  2OD4 A;  3Q8R B;  1HYS A;  1OJ4 A;  3VCD A;  4B3S J;  3GIM A;  4IG3 A;  3RBE A;  1HR0 F;  3BEG B;  3MD3 A;  3TUJ C;  5IWA F;  1UFK A;  1D8Z A;  1DTT A;  2SXL A;  1IJE B;  2O5D A;  2G0J A;  4PAB A;  3JTN A;  4LSZ B;  2KM8 B;  2V2Q A;  4CO2 A;  3H2V E;  4JUZ A;  4JP8 A;  5M2U A;  1YRX A;  4LF9 J;  2VPW B;  1N36 J;  2JEF A;  4C8Z A;  2HHU A;  1ULR A;  1SV5 A;  1G4C A;  1LW2 B;  4F4Y A;  3PZP A;  2E44 A;  4ZVS B;  4A8Y A;  3NWG A;  3D9B A;  1HHT P;  2HGM A;  5HK4 A;  4JI2 F;  2ZNY A;  2ZE2 A;  2K7K A;  2LA4 A;  2LYV A;  1RTD B;  3H5S A;  1AYE A;  2AZ1 A;  2Z57 B;  4P52 A;  4DV2 F;  3UCZ P;  1NZ8 A;  4OYW A;  3M1V A;  1TZ0 A;  4K0K F;  3C6T B;  1UEU A;  2DY9 A;  3THT A;  3Q8V A;  1D09 B;  4ES2 A;  1WJ9 A;  4IQX A;  1RBL A;  4IOC Q;  4USW A;  3GMG A;  5KFR A;  1K1S A;  3FQL A;  1CJT B;  2R7W A;  3BDP A;  1RTH B;  5F3T A;  3G96 A;  3ISZ A;  2HIQ A;  3FCW A;  1UTA A;  2AZ3 A;  3P4U B;  2MST A;  2NXC A;  1SJ4 P;  1NJI T;  3F41 A;  5GVQ A;  3QID A;  4EYI B;  4ECR A;  3KYL A;  1CJU A;  3CVK A;  3OTB A;  4RLE A;  3M2R A;  3LAL A;  1OYE A;  4RUH A;  2MZS A;  5F8G A;  3A8K A;  5GAE I;  2HQG A;  1C4C A;  4XPE A;  2AX1 A;  1QTM A;  1TV6 B;  5GME A;  1B3T A;  5EWG A;  1P1T A;  5AXL A;  3NGT A;  2R2R A;  5KT7 A;  4JI5 J;  3KFW X;  4ECS A;  3TZZ A;  1KLM A;  3SIP B;  2ZVI A;  1WTF A;  4OL8 A;  5KFK A;  3HHL B;  4MK8 A;  3HSD A;  3S6E A;  3MR6 A;  4LF4 J;  4RR5 A;  1FJG J;  4TN2 A;  1MRO A;  2LQ5 A;  2YNF A;  4KC5 A;  2DK2 A;  2V6A A;  2XMM A;  1LWF B;  4HVZ A;  5DDP C;  3KLV A;  5BR8 F;  3CJ8 A;  1MMD A;  2JNJ A;  5EHH A;  4RW8 A;  1TL7 B;  1YX2 A;  3DGP A;  5DG9 A;  4CNZ A;  2KDO A;  3BM7 A;  5AJ3 J;  2RDJ A;  3OSP A;  1H2T Z;  2XTJ P;  4J9N A;  4CLW A;  1UWA A;  3OLA A;  5ETQ A;  2VIH A;  3SXL A;  3MM9 B;  3CJR A;  2B9W A;  5E5N A;  4GKK F;  4HLB A;  5HRO B;  4F4X A;  3DRR A;  4F50 A;  2DGQ A;  2YWG A;  1MU2 A;  3DRS A;  4CO3 A;  4KHP F;  1CJK A;  3T6J A;  3WIU A;  4RNF A;  4YOE A;  2UZA A;  2HFN A;  2JSX A;  3U1L A;  3MGJ A;  2CJA A;  1JJ2 R;  1YJN S;  1UA0 A;  3R9L A;  3AT1 B;  1JX4 A;  4DPW A;  1R7I A;  3I87 A;  1PO6 A;  4ZIV A;  4EYH B;  2WOM B;  3EWG A;  2B6A B;  2XSJ B;  2NR0 A;  5D0G A;  4ECZ A;  4WKY A;  3IN5 A;  4XPC A;  1UEK A;  4KPY A;  4LFC J;  3TA2 A;  2RIJ A;  3V81 B;  4TU8 A;  4ZCK A;  1UEV A;  1S1X B;  2XM3 A;  2XHC A;  1N32 F;  3CJS A;  1IJF B;  2EK6 A;  1C0T B;  2Y0B B;  3M8Q B;  2A10 A;  4I2P A;  3N9U C;  4IFY A;  2P5V A;  1VFJ A;  5L9N A;  3EZO A;  3KTQ A;  2HWT A;  5E3P A;  1RAE B;  2LP4 A;  4RZR A;  1SJ3 P;  3HLU A;  1R27 B;  1RT5 A;  4OYB A;  4RW7 B;  3WHI A;  3ETO A;  1RKJ A;  5H9F J;  3L7P A;  2GA7 A;  2VKR A;  2AV5 A;  3LAM A;  3ENV A;  3BH7 B;  3J81 Y;  1V3Z A;  2F40 A;  3SDE B;  3ELH A;  3VAI A;  2DR7 A;  5B0D A;  1XR5 A;  2BJE A;  2KVQ E;  3PW2 A;  1BD6 A;  2QYG A;  3QGG A;  1T3O A;  9ATC B;  1GT8 A;  4A8K A;  2B5J B;  2XC9 A;  4NML A;  3QLH B;  1OQ3 A;  4IH6 A;  3EE3 A;  1A7G E;  2DH7 A;  3F0N A;  3TX8 A;  3PX6 A;  2DR9 A;  2CPI A;  5C25 A;  2YKQ A;  4ZDN A;  4Z7Y A;  1RJJ A;  1IKX A;  2EC0 A;  1SUQ B;  2IAJ A;  1C1C A;  5FDL A;  1HL6 A;  4NLT A;  2EKY A;  3HXM A;  2YNI A;  1MN7 A;  5HN0 A;  4Q8E A;  1LXJ A;  3VWS A;  4WZM A;  4ZP9 A;  4BBY A;  1WF0 A;  2OP5 A;  3MEG A;  2AP6 A;  4TLQ A;  4QWC A;  4B3S F;  4ILR A;  5LXY A;  2JRS A;  1KP6 A;  2DD8 S;  1PC4 A;  3JAM U;  1ZM2 A;  2C2N A;  2WCX A;  3RZA A;  4LF9 F;  1WC1 A;  1N36 F;  3P96 A;  1JLA B;  2PFD A;  3FBC A;  3I9Z A;  5H1S V;  2UXC J;  3C15 A;  3OQ2 A;  2HKE A;  4ECY A;  4RNN A;  2IYG A;  3MED A;  1I3O B;  2YKM B;  4WYL A;  4Q7A A;  1IBM J;  3HVA A;  2AGO A;  2R7O A;  3M6U A;  1OY8 A;  3A3N B;  4QOT A;  2CVI A;  1UJ5 A;  4JV0 A;  2GVZ A;  2KO1 A;  2ZH7 A;  4V19 X;  1LOU A;  4NLD A;  4WTY A;  4NPO A;  2LXI A;  3D0G E;  1Q86 T;  1TVR A;  1SJR A;  3GII A;  3SCI E;  2RUG A;  4FPI A;  4UF4 A;  4H4K A;  4ZVF A;  3RB6 A;  1SIZ A;  2DHG A;  1NH7 A;  3H0P A;  1D3W A;  4YY3 J;  1U26 A;  1NDL A;  4NI2 A;  1M1K T;  2VQF J;  3OJU A;  4FXD A;  3HK2 A;  3DOL A;  2KI2 A;  4DV5 J;  2HLU A;  5E7O B;  1DLO A;  3JSM B;  5J2M B;  2U2F A;  1QAI A;  3RYL A;  3KLI A;  3TWZ A;  4P6Q A;  5CYM A;  4Y2I A;  2J7K A;  3RU0 A;  3HCX A;  1F2G A;  2XNQ A;  1DAR A;  4UT4 A;  3NS6 A;  2KZZ A;  2Q66 A;  5T7L B;  3EPG A;  4E98 A;  5H9E K;  1BQM B;  2K7J A;  3PJW A;  1TL1 B;  1WC6 A;  3DOK A;  3MCS A;  1FDN A;  4X62 J;  2EW9 A;  1HNW J;  3U1M A;  2GJ2 A;  4OI1 A;  1FJE B;  1U0S A;  1HPZ B;  1ZA2 B;  3MMC B;  3OXG A;  1R6V A;  1F0X A;  1NHK L;  2CZV C;  3PYF A;  1Y5L B;  1UMJ A;  2MZ1 A;  3H2U B;  4JI5 F;  5IT9 Y;  1AFI A;  2AKW B;  2CIM A;  3CMA S;  2MHN A;  3IWX A;  1QSS A;  4G6V B;  2OHD A;  2DNO A;  4A8O A;  1IKY B;  3S01 A;  5GAG U;  2ASD A;  4ZLN A;  1R8H A;  5A2Q Y;  3FRZ A;  1W7W A;  1T9Y A;  3QGI A;  1U25 A;  2WB4 A;  3HZG A;  5LJ3 Y;  3GU0 A;  3GIR A;  1WNE A;  4LF4 F;  3BR8 A;  1FJG F;  3H7H B;  5KG2 A;  4K4Z A;  1EX8 A;  4NYZ A;  4JI7 J;  3I32 A;  1RT4 A;  2CG4 A;  4B9M A;  5B0A A;  2HHW A;  2DEI A;  3WX8 A;  3FCH A;  3MEE B;  5ETS A;  3D7S B;  4DL3 A;  2WK4 A;  2X7I A;  3MCM A;  3TA1 A;  2RKI A;  1NJW A;  4OYO A;  4C8N A;  1EQ0 A;  1XK8 A;  1RHQ B;  4NWB A;  2G0I A;  4GRS A;  5IXU A;  1FNM A;  5AJ3 F;  2L48 A;  1UKU A;  4G1P A;  4USK A;  1T03 B;  3N79 A;  1FKP A;  5ETT A;  2EFP A;  4MYT A;  4BDP A;  5E3C A;  1QSY A;  5B7W A;  2WON B;  2JH3 A;  4OJ3 A;  3MPV A;  2WZ1 A;  1H3D A;  4PYD A;  3IAS 9;  3LUY A;  4IOB A;  3VAH A;  2AEJ A;  1SC1 B;  5IM0 B;  5IT0 A;  2WTF A;  2MQ8 A;  2B8P A;  3V5R A;  4QYZ J;  4DR2 J;  3QPI A;  2UXD F;  1RT6 A;  4O4R A;  2HWI A;  3ENA A;  3JB9 k;  4ILL A;  2P8I A;  1KSP A;  1AB8 A;  2OTJ S;  5KFF A;  4UOG A;  2QTW A;  5GAD I;  3M8P B;  2FUG 9;  2QLJ B;  1CJV A;  4F8R A;  3ZZP A;  2DRA A;  4RX6 A;  4Q45 A;  2JFK A;  1LEO A;  4LFC F;  1TKX B;  4O3N A;  3F44 A;  4UQG A;  5CYQ A;  2OPQ A;  4NLG A;  5LL6 d;  2HHV A;  2QA2 A;  3DLB A;  4HI1 A;  4MH8 A;  5AT1 B;  2B3T B;  2VG5 B;  3EUN A;  1GEH A;  1YWX A;  3C19 A;  2VG7 A;  3G4S S;  2CWX A;  4C2M A;  3UCG A;  3EMT A;  2OMO A;  2HHT A;  2ASL A;  4ZHR A;  3CC2 S;  4ES1 A;  2QFJ A;  2C3U A;  2M8H A;  1U2F A;  2IVY A;  1NK5 A;  1VBX A;  2J0S D;  2W2Q P;  3DDI A;  2I9S A;  4Y2A A;  4IRC A;  3AXK A;  4L74 A;  3TAP A;  4I6A A;  4M95 A;  4ZCM A;  1V3S A;  4C9D A;  2GCF A;  4B02 A;  3TVY A;  2ILZ A;  1YJV A;  3R5D A;  3W63 A;  1NJY A;  3H20 A;  4FZV A;  4LF5 J;  3AJ2 A;  1KTQ A;  1FWK A;  3TZW A;  5ETV A;  2FD2 A;  3GYN A;  1RHK B;  1YI2 S;  3UI3 A;  3JSR A;  2Z2Z A;  3NRB A;  3HM9 A;  1E6Y B;  5DDQ C;  2XY6 A;  3M05 A;  1B4S A;  2ZKT A;  5DO2 A;  1RWW B;  1VRQ C;  1VQK S;  3T1A A;  4X65 J;  4DCJ B;  1YRU A;  1UVK A;  4IRK A;  1S57 A;  3W8G A;  1TL5 A;  1T0T V;  3BV8 A;  3D3B J;  4CLF A;  4IYQ A;  1PC5 A;  3K8V A;  4LRB A;  2YPZ A;  1FD8 A;  1VQN S;  1ZS6 A;  2WVC A;  1HBO B;  1XMQ J;  1YG0 A;  5J1P A;  5K20 B;  1RTI B;  5IQQ A;  4DS5 A;  6FDR A;  1RI7 A;  3EM1 A;  3Q2T C;  2ZH6 A;  1IKW B;  2IRU A;  2UXC F;  4J9S A;  2HQC A;  4M94 A;  3O5T B;  3JTO A;  2BAC A;  1IBM F;  3PTW A;  2E5L J;  1YQH A;  1K1Q A;  4NCG A;  3KJN B;  1HIY A;  4J37 A;  4IFV A;  2KT3 A;  2NS1 B;  1Q53 A;  3MM5 A;  2F7V A;  1KQS R;  2KHC A;  3M9M B;  2PMW A;  3W2V B;  5HQ8 A;  1AZS B;  4RUC A;  3G82 B;  1XNR J;  4AL5 A;  2YY3 A;  5BJR A;  4J9O A;  4JI8 J;  3VZH A;  4YY3 F;  4WE1 A;  4HH1 A;  4PCQ A;  2J0X A;  2JEJ A;  4MYU A;  2VQF F;  3AHP A;  4DX5 A;  5J2Q A;  4AE5 A;  4HTI A;  2CJY B;  1S6P B;  4O4G B;  4K4U A;  4DV5 F;  3I0S B;  4ED7 A;  2G13 A;  3FQK A;  1VC5 A;  1WOO A;  3UO0 A;  5KT5 A;  3CO9 A;  3DMJ A;  3PEJ A;  1S6Q B;  1WTB A;  1TTH B;  4DL6 A;  4EWT A;  1UFL A;  3MMA B;  1WG1 A;  2UUT A;  3T5H A;  3BDE A;  4CT9 A;  4X62 F;  2FVS A;  2ILY A;  1HNW F;  3RJM B;  2HHS A;  4FKX A;  1RWO B;  2GMJ A;  1TL3 B;  3NCQ A;  3ZXW A;  3DN9 A;  3VHQ A;  4MFB B;  1U09 A;  2VOD A;  4AND A;  2GO9 A;  4O3P A;  3CCV S;  2I2Y A;  1OIA A;  2C2K B;  3AAW B;  4PXE A;  1LNQ A;  3K58 A;  1TUV A;  5B0C A;  4FYX B;  3W3S A;  3MEC A;  1IWA A;  1KON A;  2VHG A;  3ZZ0 A;  4J9R A;  2RF2 A;  3MFI A;  3R1L A;  2NZ4 A;  1VR6 A;  1T05 B;  4NEZ A;  4P72 A;  2KM8 C;  4UOC A;  3OXL A;  1FA0 A;  5CQG A;  3G71 S;  1H38 A;  2MJU A;  2B9Y A;  4OHW A;  4B9U A;  4DR5 J;  4JI7 F;  2JLG A;  1TK5 A;  1UVL A;  2UUC J;  1WF1 A;  3RW6 A;  2BE9 B;  2DYA A;  4CLS A;  2IFX A;  2CJX B;  4P73 A;  3PW0 A;  1SC3 B;  4M5M A;  5D4O A;  1DUR A;  2WRM A;  3CCW A;  1RSC A;  1U7L A;  1ZA1 B;  2QE5 A;  2D74 B;  3ENW A;  2F4F A;  4DLG A;  3IS9 B;  4FNI A;  3KLE A;  1F6T A;  4ANC A;  1WUU A;  4WFX A;  2YKN B;  1NEE A;  4DF4 A;  5KFY A;  5SZT A;  2W7P A;  1QLN A;  5KG4 A;  4UY8 5;  1R0C B;  2M8D B;  3NNC A;  2ROE A;  3UD4 P;  4I67 A;  4KFB B;  4MIB A;  2YNH A;  1JNR B;  2W2P P;  1RU1 A;  2DPI A;  4DR2 F;  4X64 J;  1FRI A;  2EK1 A;  4DFJ A;  5T14 A;  5GAE U;  4NXN J;  3OFG A;  4Y3C A;  2HNY B;  3DYA A;  1NK4 A;  2BZ2 A;  2AIR B;  5KFB A;  2B8Q A;  1JK9 B;  5HAT A;  1NO8 A;  1M90 T;  2H3E B;  1Z4U A;  1ZBT A;  2CNO B;  4RW6 B;  1WKK A;  1U1K A;  5C7P A;  4BHQ A;  2HIY A;  2MKH A;  3W2W A;  3G2X A;  4KGK A;  2MXY A;  3N01 A;  5KG1 A;  2BQR A;  2HNZ B;  4DF8 A;  5E3A A;  2RQ4 A;  4ETX A;  2QX0 A;  1NND A;  2W8K A;  2VJV A;  4CLK A;  1RAA B;  2VA2 A;  2XZD B;  3MTJ A;  2V9W A;  2KYX A;  3LWM A;  3W62 A;  2DNN A;  3KJV B;  4OYX A;  1JLB B;  3TZX A;  2ZH9 A;  2E9T A;  4ZCL A;  3HHL C;  3H8Y A;  4QWA A;  5JUM A;  1RWM B;  4CLP A;  1U1L A;  4H54 A;  2HQF A;  2NUH A;  1SKU B;  2AGQ A;  3EVO A;  5DM7 Q;  3LA0 A;  1TKT A;  2ZHO A;  1JLF B;  5J1E A;  4U67 Q;  5HBM B;  2OI2 A;  1MLA A;  2J7W A;  3R2C J;  3UFC X;  4LF5 F;  3UQS A;  1P6T A;  1H74 A;  2KRR A;  4L73 A;  1S72 S;  1H2V Z;  4KHR A;  3W65 A;  4KBI A;  2OH2 A;  3D67 A;  1YZ7 A;  2BOP A;  2IRY A;  5KAK A;  4AL7 A;  3MM6 B;  1P8G A;  5JVG Q;  3R5J B;  1LWC B;  1SIW B;  1U8S A;  3VTI A;  2R42 A;  4DV1 J;  3WIV A;  2NXU A;  2A1B A;  3I0R B;  4V19 J;  5FLX U;  2KN4 A;  1G2E A;  1TUW A;  4ZVE A;  4KIA A;  3ZZR A;  1UVM A;  2XHW A;  1RKI A;  5EWE A;  1WF2 A;  2QSF A;  1XMQ F;  2MZR A;  4O0I A;  4LF6 J;  4LR7 A;  3UNG C;  3M6W A;  2Y8W A;  4KV8 A;  2C28 A;  1WKL A;  1QUP A;  2D3U A;  4ID5 A;  2MKI A;  3PVX A;  1HNI B;  5IFM A;  3B8H A;  3W5Y A;  4R0J A;  2LFV A;  1X4B A;  2ZBQ A;  1S1U A;  4ZPA A;  3M2V B;  1OPI A;  3NMA A;  1TMJ A;  4NCB A;  5CD4 H;  3PG9 A;  4PXC A;  3MCO A;  3I82 A;  3Q22 A;  2NRE A;  2E5L F;  3M8W A;  1JLG A;  1FWP A;  2LVW A;  3QJL A;  4AYB D;  4CTA A;  2HFS A;  1Z1Z A;  2DNR A;  4NRT A;  2W2O P;  1DAX A;  2OPS B;  1EZZ B;  2HFV A;  4KE5 A;  3H90 A;  2GIF A;  2EFV A;  3VAL A;  1GMU A;  3H2L A;  3G6Y A;  2MDA A;  5CYJ A;  4TYB A;  1XNR F;  2H5E A;  1J5O B;  1G1X A;  2E1P A;  3JTP A;  3D6T B;  2NUU G;  3E2E A;  3P8B B;  3G8Q A;  4LSN B;  2QT7 A;  2XY7 A;  2CVE A;  1JKH B;  4OX6 A;  1WDT A;  4GVL A;  4AT1 B;  2VG6 B;  1YJR A;  4TLR A;  1M1G A;  3GZ7 A;  2FVR A;  4AXI A;  2OJ3 A;  1DZ5 A;  4F0M A;  2HMI A;  2JX2 A;  3QJJ A;  2A2D A;  5KFA A;  2YQ0 A;  1BMQ B;  2CPJ A;  4FYW B;  1SKS A;  1N54 B;  5KFC A;  1NME B;  2M9K A;  4F2R A;  4DFP A;  3MM8 A;  3MZI A;  3W7B A;  3NLC A;  4URQ U;  4A47 A;  3BSO A;  1WG5 A;  3UD5 A;  2XGQ A;  2CQ3 A;  1UA1 A;  4EFA C;  3UR0 A;  1B99 A;  4WFN Q;  3D6F B;  4I6Y A;  2RHQ B;  1AW0 A;  2HG4 A;  3HT3 A;  4F04 B;  1N0U A;  2CFX A;  1S6O A;  4C4W A;  2V2V A;  4U7U D;  3M8S A;  2HND A;  1RAG B;  3BQ0 A;  3OL9 A;  4O3O A;  1Z2Z A;  4N76 A;  1GXU A;  4LF7 F;  3DKD A;  4IR1 A;  2FLP A;  2BOA A;  1AFJ A;  2DH9 A;  4DR5 F;  2UUC F;  2CKW A;  5HMZ A;  4FN5 A;  2M88 A;  1NUE A;  1CC8 A;  2RDI A;  3QIP A;  1WHY A;  4F3Q A;  3LQV A;  2KT5 A;  5A8K A;  4IRD A;  1GMW D;  4OV6 A;  1QE1 B;  4Q5V A;  3EZ5 A;  4ZA1 A;  2ADC A;  4KAI A;  1G3O A;  1S4E A;  2MGZ B;  3HVT B;  5LM7 E;  2DEJ A;  4A4J A;  2PGC A;  2ZDO A;  4DQS A;  2ZIT A;  3NCP A;  5LMN J;  1JLE A;  4Y00 A;  1RAO A;  3KG0 A;  3HJF A;  2J8A A;  2CYY A;  3FBB A;  5KFZ A;  3PFE A;  2CNL B;  2BJ9 A;  2CJB A;  2R7S A;  3HHL D;  4X64 F;  4NXN F;  4LUB A;  4F2S A;  1YZ6 A;  2BM0 A;  3MAH A;  5D4L A;  3TAM A;  2MQO A; 
#chains in the Genus database with same CATH homology
 3QRP A;  2Y8W A;  3QRR A;  4U7U D;  4DZD A;  4QYZ K;  2Y9H A;  5CD4 A;  5H9F K;  5H9E K;  3QRQ A;  1WJ9 A;  2Y8Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...