3QRPA

Structure of thermus thermophilus cse3 bound to an rna representing a product mimic complex
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
214
structure length
214
Chain Sequence
YFQMWLTKLVLNPASRAARRDLANPYEMHRTLSKAVSRALEEGRERLLWRLEPARGLEPPVVLVQTLTEPDWSVLDEGYAQVFPPKPFHPALKPGQRLRFRLRANPAKRLAATGKRVALKTPAEKVAWLERRLEEGGFRLLEGERGPWVQILQDTFLEVRRKKDGEEAGKLLQVQAVLFEGRLEVVDPERALATLRRGVGPGKALGLGLLSVAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein TTHB192
publication title Recognition and maturation of effector RNAs in a CRISPR interference pathway.
pubmed doi rcsb
source organism Thermus thermophilus hb8
molecule tags Rna binding protein/rna
total genus 53
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2011-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08798 CRISPR_assoc CRISPR associated protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1200 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Crispr-associated protein; domain 1 3qrpA01
3.30.70.1210 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Crispr-associated protein; domain 2 3qrpA02
3QRPA 4QYZK 5H9FK 3QRRA 2Y8WA 4U7UD 5H9EK 3QRQA 1WJ9A 4DZDA 5CD4A 2Y8YA 2Y9HA
chains in the Genus database with same CATH superfamily
4U7UK 4ED2A 4AFFA 3R2CJ 2YNIB 3EVWA 1RACB 3RAQA 4KT0C 2B8QA 4WKYA 2ALZA 4X4UA 4DV7J 5BYRA 2WSFC 2OGUA 2DH8A 1LWEA 3IBWA 1HQEB 1R27B 3NGSA 4OI2A 3WHIA 4WP8A 4P72A 5HL7Q 2HIQA 2VQEF 3C8YA 3PX4A 3I9V9 3D6FB 3CDAA 3AD9C 3BREA 3QNWB 4EK2A 2D74B 3FKBA 3A12A 3CJKA 1KOHA 3CULA 4HT7A 5AXMA 1Q86T 1NJWA 2CDQA 5E33A 3OUYA 1IKVA 2DR8A 5E3RA 2Y0SD 5G0RB 4B9LA 3CJ2A 4DR6J 2VB6A 1RBLA 1WC5A 4NEYA 1YZ7A 4DUYJ 2MKYA 2HVDA 2GJ2A 3A4TA 4I2PB 1IM4A 5T7LB 4X4OA 1FXRA 2CRLA 1YBAA 2PI5A 1UZDA 3FBCA 1TK8A 1NK7A 4L3KA 3UD4P 4P74A 2WSEC 1JLCB 4CO4A 3RR8A 2RHQB 5IS2A 3KHRA 3MMAB 5EN1A 5IC6B 2L9NA 1KQFB 1AXQA 4N76A 6FD1A 5ADZA 3BO3A 3AFGA 2GS8A 1TL5A 1SB6A 3DLJA 4WE1A 2XS7A 4YOEA 2FHOB 1T02A 4CO5A 3EZOA 3V6KA 4I6AA 1AROP 5DZ7A 4B3OB 2B7BB 2R7WA 3NKYA 1WDTA 2W2PP 3M30B 9ATCB 5IM0B 1HNIB 3MUTP 5ETRA 3H5SA 4WK1A 4WYLA 1X0PA 5IT9Y 3M9OB 3Q8SB 1S1TB 2WB1D 4RW8A 1UFKA 1T05A 1RT7A 3OFGA 1F3FA 4QWAA 3OPKA 4M63A 5CYQA 1WC6A 3TQ1A 1RQ0A 2XEXA 1D9FA 2OPPB 4LQ9A 4C9DA 3DOKB 1KN6A 1PIEA 5KFQA 2D7SA 2RD5C 1U24A 2MKSA 3N6NA 3QQCD 5D3GA 4B3MF 4DWIA 4ALZA 2ZBCA 1I94F 3PXGa 2KN4A 1FX2A 3JS9A 4MTPA 1H2VZ 3QFWA 1RT1A 1FKAF 3KUEA 2R7SA 1VQOS 4NXNF 2A1BA 1OS5A 4Z37A 1HBMA 3RBXA 1F5AA 1X4EA 1NZ8A 3G8SA 2FC9A 2BKNA 2V9WA 5J1NA 2AJQA 3CJ4A 1NKBA 2EFVA 3C66A 3LGNA 1VRUB 3POTA 4QZVB 4QCLA 2UVUA 1WDDA 2EFNA 2ZBIA 1IKYA 5CYMA 4KIAA 5KFAA 2DGVA 3NAHA 4AL5A 2IAJA 3EJMA 3S1TA 1HBUA 1WTBA 1S9EA 2BJ8A 3OTEA 2XMWA 1V6HA 2WHOA 5C42B 3VCDA 2ZJPQ 2VICA 2MLXA 4B9MA 1FJGJ 5B0BA 3B78A 4OZNA 2IMOA 2DR5A 1RWNB 5D77A 2LXUA 5BR8F 3JB9k 4PUOA 1FDNA 3FEYB 3H2LA 3VTIA 3HSGA 4PR6A 2Z0GA 2X3DA 2KL8A 2KRBA 4LR9A 1D9AA 2A6MA 3I82A 4DPWA 4P2MA 3D0HE 2W4CA 4ER8A 3MOJB 1D0EA 1DY3A 2MMYA 2R4FA 3MAHA 3WC0A 5C7PA 1KVKA 4KTQA 1IKVB 3LTOA 3IFEA 5T41A 5KFTA 2XGQA 1BXNA 1JLEA 1YWXA 3LQVA 3UN5A 3L4BC 1U1MA 3LAKA 1RB0A 3BDEA 1FWKA 3EDQB 2C2ZB 1WD6A 2XNQA 4DV5J 2HFSA 3QSYB 1OY6A 1UJ5A 4D3HA 5L46A 4ZPDA 4OFZA 2G2YA 4CH7A 2V8VA 4DDFA 3NLCA 1VI7A 3CDUA 1R7IA 4DJBA 4DV1F 1BUXA 1F9FA 3X1LB 2IHR1 4JV1A 1BE4A 2FQQB 1MWZA 5KG0A 4OZ0A 3WC2A 3T5HA 3M8PB 3I9ZA 4J9LA 1OYDA 5AT1B 3AB2B 2WVFA 2Y1LB 3HO1A 2XBPA 2HBZB 2XHWA 2UVWA 4ED8A 1JNRB 4WE1B 1S9GA 1K0TA 2BBEA 2CNOB 1M5HA 2B9EA 4DG1B 3R5JB 2RRAA 4CRJA 2QIFA 4K8RA 3J80U 1HNXJ 3A8EA 2XB2D 1TKDA 2DCUB 1VK8A 3PW5A 5H1SV 2KT2A 2CJQA 2DB1A 2HNZA 4EZ9A 1N0VC 4G1QB 2FHJA 4IH6A 1R3NA 4W98A 4DUZJ 2Z2YB 4U96A 2ZC4A 3UD5A 3TA1A 3ETMA 3L95X 3H2UB 1GX5A 2XI2A 4C8ZA 1YJTA 1RTDA 3CD5A 2J6UA 5DG8A 4YEAA 1PJ5A 3P96A 4JBCA 3GWCA 3U1LA 3H2VE 3KK2A 5FD1A 4CO0A 3OR1B 3V6DA 4JV0A 4UUWA 4MYUA 1JLAB 2NSCA 3DOMA 2ZE2A 1IR0A 4K5RA 4DSKA 1SXLA 3NNAA 1R0BG 1Q4RA 2CKWA 2OO4A 1MWYA 3I0SA 3C6UA 3TZWA 1GFWB 4IG3B 1RZMA 3B82A 4F7VA 4C4WA 1RU1A 5KG7A 1RT1B 3PJ9A 1K0VA 4K2JA 7FDRA 5DS7A 4HLBA 4ED5A 3T3FA 5C24B 4OLOA 3THPA 2XY7A 2CZ4A 3BGLA 3VQTA 1R31A 1VRTB 1AB8A 1N5YB 2RS2A 1SL0A 5KFMA 4RNHA 1Q79A 1WG5A 1O51A 3JQJA 3EUNA 2RU3A 1HWUA 4CTAB 2AYGA 3JAMY 1C0UA 5E7OB 2ZH9A 2VG6A 3PEHA 4MMOA 1G4CA 2HBYB 2LQJA 4NLQA 5AJ3J 5IOLA 1IKWB 5CYMB 4DCOB 4IR9A 2N4DA 2MZRA 4IOBA 2I1RA 5DDRC 2HNYB 5HMWA 1PGZA 4AD6A 4ZP6A 1HQUB 2HFOA 3ISZA 1B7YB 1UWAA 2DHSA 1WC0A 3N5FA 1YTYA 1F1BB 2CPZA 3GIMA 3C6TA 2H3EB 5HROB 3VAKA 2CJXB 4DPOA 4MKVA 3FBEA 3VVUA 4C8MA 1NPPA 3GPAA 2ZM6J 1RK8A 4OX7A 1T03B 1D3WA 1S6UA 2DGUA 1V3SA 3S7RA 2H5JB 1Q8KA 2D9OA 2ZBQA 3JQMA 2HHHJ 2PA8D 3V81A 1HWJA 3PO5A 3MR2A 1XWLA 1RAHB 2PI4A 1KEKA 1YITS 1XR5A 4I4BA 3MOZA 4XK8C 3R1LA 2V8HA 2XWXA 3M32A 5DLGA 3ZZRA 2RQ4A 2ILZA 4DLGA 5ETMA 3AD8C 3T1AA 3LGMA 4CLLA 1RCXB 2J8AA 4CO3A 3PRVA 3MTJA 2BV3A 2AQ4A 4QJVA 2PMHA 3N28A 4XTTA 3T1YF 3U1NA 2MQLA 1VQ8S 3CD7A 2JH3A 3BZQA 4F04B 3SFGA 3AD7C 4ATNA 3W5XA 2KXNB 3QLHA 2VIHA 2R8JA 2UZAA 3GE9A 4X64F 5CXTA 1XNQF 2M3DA 5HP1A 2HZAA 3CCES 2HQDA 5I4MA 1TL3A 1VBXA 4F4KA 2OLWA 1XMOJ 2EC0A 2F8EX 1S4EA 3JXOA 5CCMA 5LJ3Y 3VR1A 2WOMB 3HHLA 2V2VA 2DKOB 3IAM9 3ISNC 2VDIA 2RS8A 1T3NA 1U0HB 5M2PA 1IBLF 4ZPCA 4MFBB 2QSWA 1RHKB 1UVLA 2X1FA 3BKTA 3I4PA 3KJVA 1EAYC 5F0UA 1SC3B 4O3RA 3DGPB 1T0TV 4ED0A 1X60A 2LQ5A 2VBWA 5HVGA 3SV4A 3I0SB 1IQTA 3IS9B 4BBYA 1TUWA 1WOOA 1HNZF 3MM7A 3GYGA 3JTPA 5K5MA 2XS5A 1DTTB 3MCSA 1N34J 1FRJA 2VA2A 5EDWA 2HHPA 1LV5A 3GR1A 2IM3A 3CCLS 5HAOA 2DNGA 4FF4A 1NDPA 1YI2S 4GC7A 1IN0A 3GIRA 5D4NA 2EC2A 2XZWA 2FZKB 4USWA 2YWFA 3D68A 4M5LA 2R2TA 3BH6B 4JI4J 2KKHA 1FKPB 4FKXA 3I87A 2N3OA 2ZZMA 3VQSA 1EKSA 4K5SA 4KGXB 4QQBA 3E8OA 3MM5A 4HTJA 4J5OA 2CAJA 3PR5B 4LRCA 5F3TA 2W01A 3NP5A 4C8OA 3FGVA 1EX8A 1APSA 3TJ8A 2FTRA 1UEKA 3MWBA 3FZBA 3KLIA 2KFYA 3ZNJ1 1X9SA 3KLEB 3PRBA 1S1WA 2IVYA 4C3KA 4LFCJ 1TZ0A 5FLXY 2MPUA 3J7A1 4RW9B 4HI1A 3O6QA 1BQNA 1RHUB 2AZ3A 1NCLA 4ZVGA 1URNA 3GFZA 3I56S 3PO4A 4HT5A 1M5OC 5IT9U 2W9BA 3CJ3A 2MSTA 5E3AA 2VHGA 3NY0A 4GKKJ 3DHWC 3IRXA 2L9WA 1TUVA 2DEIA 2AT1B 2D69A 4ZMMA 2I0XA 3DCAA 1J2VA 1FDBA 3FQLA 3QWPA 2YQ0A 2KXHA 3UO0A 3DRXA 1N5VA 3R7NB 1RAEB 2W7AA 2PMZD 1N33J 2Q66A 5DGAA 4OLPA 1WSRA 3W60A 3BDPA 1CEZA 3OHBA 3VHQA 5DDOC 2XY5A 4X4PA 3JTNA 2ZC3A 2UVVA 1KVIA 2W24A 1ZOTA 3OJSA 1U1LA 4Y2IA 3OQ2A 4TY8A 1HBOA 3P5TL 5F41A 1FVQA 3B54A 2AGQA 4PQAA 4I1TA 2NS1B 4OV6A 2R7OA 4KGZB 4DFPA 4LF4F 3CCUS 2C28A 2HS4A 2AIRB 2BOPA 3PJXA 5M2UA 2OPRB 4K7QA 3FSYA 1MU2B 1TL3B 3C3LA 3CO9A 3UR0A 2M8DB 1NU4A 3DXSX 5C5JA 5HLFB 3AXMA 1YZ6A 1S6QB 4XPCA 1TKZA 2ZFHA 1RJJA 1UW9A 3PHEA 1YJVA 3R5DA 1SJQA 2R2RA 4ZITA 4YN3B 2IDEA 1V3RA 4WIQA 1QSLA 4ZA1A 3HHLC 1F6TA 1PC4A 1X0FA 3M7VA 2DBBA 2J0XA 3M2UB 2DHAA 3AODA 1RWXB 2B5JB 4UQGA 1CVJA 4F3MA 3MEEA 1WI8A 3QO9B 4LSLA 3GJRB 1EQ0A 2MLYA 4TU7A 4FP9A 4HACA 3CD6S 2P9GA 2WONB 3KG0A 4NX9A 4OYZA 4OYXA 4CLTA 2ASJA 2VFSA 2BANB 4U95A 1DTQB 4NI2A 5E2QA 2R2SA 2Z30B 3H59A 2DIUA 1S0MA 2MQQA 3NNHA 1X5TA 4F25A 2H9ZA 4M5NA 2H54B 4ZIWA 1FESA 4BDPA 1RGVA 3RB6A 2EWHA 1BHNA 4JI2F 4TNOA 3TAQA 3WQPA 1KFDA 3TUJC 3JQKA 3K57A 1SKUB 1P1LA 5KFIA 2YBVA 4LF6J 2DRDA 5CABA 4DR1F 4HH0A 1N5QA 4JI1J 1Q7LB 4RX6A 2M9KA 3ONQA 2JLGA 1S72S 1S7HA 4C8NA 4EEYA 4ECSA 2HHXA 1B0TA 5D6GA 1PG5B 3KNGA 4KO0A 5ETKA 1AA1B 3PKYA 1EHWA 2QV6A 1UWBA 3HVAA 2V69A 1FI4A 3A13A 3KLIB 3KTQA 6FDRA 1VRQC 3CE8A 3MAAA 3FFIA 4YR2A 3TUIC 4W90B 1H0HB 2M5YA 2YKQA 2EXUA 1JLBB 1UJ4A 1TAQA 1F9EB 2BE7D 1IJFB 1J5OB 2EBGA 3QWUA 4KHMA 3OVBA 4UOFA 2AW0A 5J2QA 3LH2S 4LF9J 3DLEB 4GO7X 2C2KB 3KFWX 5DQIA 1FVSA 3DMJA 2RQCA 4ES3A 4IFYB 2MQPA 3DRRA 1H38A 3QIPB 2BOAA 3GSIA 3LP2A 3DRSB 4EU0A 2LYVA 2Z57B 3PVXA 3CCVS 2XI3A 3CDBA 1RYSA 1GK8A 4I2QB 1RT4A 4WJBA 1T9VA 1HBOB 2KJVA 1HYSB 3D3CJ 4A8KA 2OSQA 4KH1B 3R8YA 3LW5C 3FC9A 2G0JA 1EB0A 4ELUA 4J9MA 2RE1A 4ZLJA 3MCMA 1S5ZA 3SQGA 5DG7A 3JAMU 4ZCLA 1UKUA 1SIZA 3ZZYA 3SI8A 1H3DA 3WIVA 3HJVA 5KFOA 4X66F 2HVHA 2F4VF 3DDIA 5FJ4A 5IZHA 2E7VA 3MEKA 4FPIA 1UPPA 3BQ1A 2K3KA 2KH9A 1U2FA 1S1UA 4EI2A 3VAGA 1WKLA 1UW4A 3P49B 3TVKA 1V5IB 3SEOA 4IQXA 3PW7A 2CYYA 1JLFA 4TKTA 4R8UB 2PN6A 2F3JA 4B3RJ 2V67A 3GFYA 5H9EJ 2VASA 4LSLB 1TUGB 3PIPQ 1X4FA 2KG0A 1XQIA 1PJ6A 2ZUAA 2XYHB 4HACB 4KV8A 2ZOGA 3Q2SC 4RNMA 3QRPA 1YX2A 2C3PA 2KM8B 3AOAA 1Y5LB 1HR0F 4J9OA 5F8LA 3CMAS 1NDLA 2I8EA 3V2UC 3JSYA 2QA2A 1FHTA 2CQ4A 1RWMB 1T9YA 1SH2A 2UUWA 3BF4A 1LOUA 1VDHA 1LWFA 1X4HA 2RF2A 3NGRA 5F9NA 3H90A 3PHTA 1VS3A 3HK2A 3BO2A 2YNHA 3CVKA 2C2RA 2VBXA 4C3MA 4F67A 5DG9A 4PWDA 2JFKA 2E7XA 3DNCA 5KFPA 4M8LA 1YRTA 3K5OA 4ERDA 2W7PA 1SPBP 4EBCA 2HQFA 2FGOA 7AT1B 2Y1IA 4CZCA 4ZPBA 4A47A 2J9DE 1ZM3A 3MHYA 2BJ3A 4NASA 3BJYA 1UWBB 3N5BA 2EKYA 1KNZA 4EBEA 2RRNA 4K4UA 1RAFB 4UOCA 4OYWA 2ZNZA 1BC6A 2DHHA 4UZBA 4FVMA 3KLFA 3KMSA 2KFNA 1GXUA 1HI0P 2RDDA 1NXIA 1G6BA 1CJKB 4ID8A 3GB0A 1O6XA 4MH8A 2OEJA 2OPSB 3K58A 3KK3B 1M5SA 1NKEA 4PWWA 4DV2F 1YLXA 2OHDA 2B7CB 4DR5J 4TVAB 3DU6A 5D0GA 4DBQA 1N6QA 3SZ2A 4CH1A 3Q8QB 1T9TA 5HANA 3VGVA 4DR4F 4NLXA 4OQJA 1HD1A 4NCGB 1GXLA 5H9FJ 1K9MT 4EYHB 3MCOA 1NZAA 1Q16B 2IFXA 4X4VA 5CZVA 2ILYA 4RWXA 5D78A 4DV0F 1S1VA 1FT8A 1X31C 2J7WA 5KG6A 4DV4F 4XDDA 5GAEU 1N8RT 4RU2A 4O44A 4OZLA 3I55S 2GQ2A 4K4XA 4IYQA 2QO3A 2PDAA 1SI9A 5KG4A 4A8QA 3TAMA 4DMZA 1FDDA 3E01B 2M4MA 3RRKA 1S7IA 2A18A 2BX6A 4WF9Q 2B3TB 2NPFA 1XMQF 4LT6A 3MM8A 3NS6A 4OX9F 4USTA 2E5HA 4UZCA 1EP4A 4LR7A 2F8HA 2W2MP 1Q78A 4A4JA 3CTRA 1YJNS 2ACMA 4ED6A 4NMLA 4B9SA 2YH0A 4PG8A 2FVCA 2VD3A 2X7IA 1D8ZA 1KTVA 3GU0A 1M90T 3PFOA 3UWTA 3OT9A 1ITPA 1P1TA 3FK4A 3W63A 1VQ6S 3DOLA 4X4NA 2B9XA 2RU9A 3PEJA 3HSJA 4ZPWR 3O5TB 4MKYA 1E6VB 4FYXB 2HURA 1WEXA 2ZDOA 4NLRA 2CJ9A 2OP5A 2HVEA 4KGKA 4GC6A 1B3TA 2GMLA 2UU9J 1ZH5A 5FLXU 2ZJRQ 3ULHA 5K8OA 4B3SF 2GMHA 3BPDA 2HBQB 2Z2MA 1TVRB 1XIQA 1VQ7S 1L5UA 4KFBB 2LECA 2G0CA 5L39A 1GMUA 3L7PA 2G2ZA 3G6XA 5D0EA 3MM6A 1AZSA 1NJXA 3RW7A 2W7OA 3V6HA 4M5HA 3CT9A 4KHPF 4YB6A 1LWXA 5E3PA 4PXBA 3NCRA 1Z4UA 2M88A 4C11A 1FERA 3M6XA 4QIFA 4UTGA 2KFZA 9RUBA 3VAMA 2UV8G 1RWVB 2XQCA 2VPYB 4A8WA 3SDEB 3G82A 3NGKA 4PWDB 1L3SA 2JEJA 3IM9A 1HBNA 4L6V3 2HHSA 4IRKA 3WBZA 2C3OA 3PJWA 1KQSR 4LFAF 5HMYA 1HA1A 1Q8IA 2NYHA 3DLGB 4O3NA 3UCZP 4DV7F 4FF3A 4OJHA 5HBMB 3A3PB 3IGVA 4MIWA 1PKUA 3Q8PB 1FO1A 1NK6A 2A10A 2G4BA 3BBCA 4NLUA 1A7GE 2VBZA 1OJ4A 2ZKTA 2QLJB 4FDFA 3GP9A 4Y2AA 1N52B 4KQZA 2R9LA 4X62J 5MLCV 5THWA 2EI5A 2K7KA 2KJWA 3KLFB 2DXFA 3W2VB 1TQLA 5A0YA 2LEPA 1JWWA 1JQGA 1H7XA 1MSWD 2YWGA 3OXGA 4QWEA 1GTHA 1VLOA 1B7FA 1YKWA 1G2EA 3H7HB 4EFAC 3M8YA 4DR6F 4M5GA 4WTYA 4DUYF 3CXCR 3OD2A 1N5TA 4HHJA 5KFXA 5KFDA 2UXDJ 4UOHA 2KG1A 2AEFA 3KWMA 5I3QA 2F9DA 5GMEA 2DR7A 4M5MA 4X4TA 2C2OB 3A1YG 3ET6B 1GMWD 3IG1A 3NMRA 4LMZA 2HVIA 1TR0A 2B6AA 3B6BA 1TK5A 2V8GA 1XTZA 4AXIA 3BEGB 2H4WB 1LFWA 4LRDA 4F2RA 4H4OA 1VC5A 3Q0AA 5GAEI 1YVFA 5IQ6A 5B09A 3CEDA 4C8KA 3CCWA 2R7QA 3W66A 4DSEA 3CNQP 5KG5A 1EP4B 1VIXA 1C1BA 1DQ9A 3BS9A 2J6SA 4NLWA 1T11A 3FNNA 2KI2A 3QGIA 3NBPB 1SUQA 3M2RB 5KFSA 2IVFB 1VC0A 3QRRA 2HAIA 3UDLA 3NGTA 5CD4H 4KGMA 5KT2A 5A6PA 2CPFA 1RWWB 4DR7J 1RT6B 3DOLB 1IBKF 2VC0A 4CYUB 1P6TA 1BY9A 1LW2A 2B56A 4ZCMA 4JI7J 5EX3A 2DNNA 1TL1A 2GVZA 4DF8A 2D3OR 1OYEA 1YIJS 2VKZG 2E5LJ 1RTIA 3EE3A 3QYYA 1S0VA 1T95A 2JNJA 5KG2A 4DX6A 3HKZD 4DL2A 2A0FB 1S57A 4DUTA 3I4HX 1LW0A 3OXFA 1FA0A 3ZXWA 5GADU 2GVDB 3T1HJ 2VKRA 2ZH8A 2R8GA 1SH0A 4USHA 1V3ZA 2KHDA 1LWCA 1WF0A 2ZD1A 2LXFA 4PYDA 1RU2A 4P6QA 4B3TJ 4ECZA 3S6EA 5IXUA 2EKNA 1S48A 1HNVA 2BACA 2DXEA 2IA6A 4JB8B 3MM9A 2VC1A 1F0XA 2C42A 4X4SA 4XDCA 4R5PA 3RBZA 3KXDA 1TL7A 1ZAVA 2HK3A 3PM9A 1FJGF 1X5OA 1C1CB 2F40A 1FJCA 3GG1A 4KC5A 1VQ5S 4FXWA 3W7BA 1U26A 3PR4A 2QJ3A 1HLWA 1QM9A 3MI7X 1WKKA 2YKNB 3RW6A 1G7CB 3EZ5A 1YJRA 1DHMA 4TY9A 4ECUA 4DPXA 4LF5J 1WOSA 5J2NB 2VG5A 2YPZA 4YHHJ 3E3XA 1OSDA 4MAKA 3L9ZA 1HQ2A 2YXLA 3FEZA 1U48A 4FNIA 4CNYA 3PYFA 3DN9A 4BLGA 4RUAA 3VGTA 3DKDA 1G3OA 1J5EJ 3AOBA 2HQ3A 4WFZA 5B08A 2GV1A 3BSNA 4DV5F 3BO4A 5EWFA 1BQMA 2HWIA 2RKIB 1WF2A 3SCJE 1QAYA 2MQ8A 1IWAA 1DRZA 5K8MA 1OQ3A 3PY8A 3CCRS 3PKMA 1KBRA 2B6AB 1RT3A 2PA3A 4L73A 2W9CA 3DLLQ 2VJVA 3DU5A 5DZ6A 2YKOA 3M4XA 4L3NA 5F8NA 3F56A 4I56A 1IVZA 1ELOA 1HNXF 1S1XB 2O1PA 2RT3A 3DRYA 4P7VA 2LMIA 4OHVA 4ZPVR 1C1BB 3O1LA 3CMES 3Q23A 1IWGA 3FDSA 2MKIA 3PX6A 4DUZF 2DNMA 3HDSA 3PW4A 1L3VA 4PAAA 3G8TA 1XMBA 2NUHA 2BA9A 3PNIA 2HHQA 1NRKA 2DGWA 2VG7B 3GR0A 4ZHRA 3D1HA 5HATA 4DR3J 1U8WA 3I6PA 2QZ8A 4N47A 3BQ2A 4NCBA 1TFWA 1HPZA 4P9SA 1CG2A 1MNEA 1S76D 2VU5A 5H9EK 1LK5A 1P9QC 1WSVA 3ZO7A 2BM0A 1G1XA 2K1RA 2HFZA 3AXKA 2OSRA 4W4MA 3X3UA 1B4SA 4ZK7M 2FHMA 1PAUB 5IWAJ 2J9CA 4QU6A 2BKOA 1FK9B 2DT9A 2HFUA 2HWTA 2DD8S 3C19A 3HVTB 3UNGC 3FUYA 2F1FA 1X4DA 2AZ1A 1LXJA 1NKCA 3GZ7A 4MK9A 4LF7J 5F8GA 3MPWA 1QTMA 4W92B 3GQCA 4H4MA 2FVSA 1LWCB 3QT8A 3MDFA 4ZPAA 3CC2S 2UXBJ 1NK0A 5ETQA 2VOPA 3Q8RB 3H5YA 2YQ3A 1NSQA 3J7Z5 2QA4G 5GADI 1VQ4S 2XLKA 5ETLA 4KPYA 3LF0A 2JSXA 4R5PB 3MEDB 2CQDA 1PC5A 3I32A 4EUVA 2HMIB 1CQNA 4X4RA 1XERA 4A8MP 1NH7A 5KFVA 2W4PA 3HLUA 1UMJA 1X5PA 4PZVA 3M2VB 4OI0A 2GA7A 2GW8A 4RNFA 4DU7A 1M5PC 1VJQA 3H98A 1SBRA 1DLOB 1NUEA 2ZM6F 2W2QP 2R7TA 5DDPC 3CDEA 3K0JA 5KFJA 1Q8BA 1W25A 2YNIA 3PG9A 2MKJA 3W62A 1R0AB 2AGOA 2AP6A 2NPIA 3MPDA 3BGUA 4OYBA 2QGFB 1VQKS 3I5BA 2HHHF 3SSQA 2HFVA 2KDOA 3TX8A 1HQEA 3R6LB 2EFQA 2FLNA 3PFEA 2Y9HA 5H9FK 2QL9B 3CJTA 3RB4A 4ZOSA 5EUHA 3KHHA 2MLZA 5GMDA 4DL3A 3PYDA 5DETA 3HMJG 3EMTA 1ACMB 3CCJS 3HF5A 2HIYA 3TUPA 1OMSA 2CQCA 4PABA 2WW8A 5B7WA 2J8SA 2NYIA 1U02A 1S49A 2EEYA 1RT3B 1F2HA 5G0RA 3K5PA 3OTOJ 2ASYA 3IMQJ 2YWWA 4M5IA 4DN0A 1CJVB 1XR6A 1FRLA 2JZ5A 4I2PA 4IG0A 4HDGA 2ZH6A 1JNZB 2QLWA 4QU7A 3KUHA 3UVJB 4ENOA 2DK2A 2BE2B 5CZXA 2K06A 2CG4A 4DV0J 1XMOF 2DVIA 3MMAA 2X1AA 3BGOP 4WK3A 2F8MA 5KT7A 3AH6A 1RCOB 1XBWA 3N79A 2E1MC 3R7BB 3EM1A 2GGPB 1WHWA 4MIBA 1QTNB 1ZM2A 3KUGA 2LDYA 3TR5A 4ZHRB 5I42B 4ZP9A 2YKMB 1RTHB 4M1KA 3IR6B 2Y8WA 2VFUA 2GIFA 2ROPA 4B3OA 2XYPB 1HWIA 3OTDA 4GVLA 3AJ1A 3QT6A 3M30A 1FNXH 2FJXA 1HNIA 5IM0A 5KFFA 3G87A 2YWKA 3B8HA 4USMA 3GG0A 3OXLA 3R5CA 1F60B 4E98A 3WX4A 2BJ7A 2M52A 1EETB 2Z4PA 4URQU 4X84A 1S1TA 1N34F 3LAMA 4Q44A 4GKJF 3Q8UA 5D4OA 5A8WB 4LSZB 1U25A 4CNZA 3KK1A 2VFVA 3NEKA 2ZOMA 1KRPA 3CMQA 3QGGA 2CQPA 2QA4S 3DOKA 1IKXB 3UPFA 1Q5VA 4Y3CA 1GMVA 3GTYX 2FLOA 4JI4F 3EXCX 1NSAA 4NWBA 2YH1A 5D4LA 1RT2B 1JLGB 2VPXB 3VZIA 1MROB 1UVJA 4Y2CA 4ED4A 4PG5A 3DGVA 4B3SJ 4J90A 4JI5J 1TU0B 2HAFA 4HHHA 3MEGB 1VGYA 2I9SA 1FTRA 2VZ9A 4ILRA 1NK4A 1Z1ZA 3H5UA 1VBKA 2ROEA 4QR2A 2AYEA 1FCAA 3D1QA 4ANEA 4OV1A 1YJWS 4HYKA 1VRUA 2L48A 2WSCC 1UPMB 4BWMA 3PIOQ 3TANA 4ZVEA 2A2DA 4LFCF 4DX8H 3KKFA 4ZPTR 2AYMA 3HVRA 2XMUA 2JFDA 5KFNA 3T6BA 4WKRA 2CG8A 1TL4A 3FCVA 3FZ2A 5C42A 1RBAA 4F0HA 4GKKF 2D9PA 4ZVSB 4LFAJ 2AD9A 4FZVA 1FRHA 3TUZC 3G4SS 4F4AA 4DOZA 2HSEB 1UP1A 4H4KA 5KOXA 3DI6B 4EWTA 5L9NA 4YUDA 4J9QA 4WP9A 1N33F 1ICEB 1OY8A 2VL1A 4KBIA 4OYIA 1VBYA 4DL7A 4A8YA 4CIOA 5J2PB 3UQSA 3OL9A 3FMWA 2HGLA 1EARA 2VOOA 2OD6A 5K20B 2WVBA 1K73T 4LBHA 4TN2A 2COLA 3IO1A 4OZ5A 2DGSA 4K4ZA 2BYCA 3D7SB 2PC6A 4OI4A 4FYDA 1RP5A 2IPOB 3J7ZT 2DR9A 2IC3B 4HR2A 4IG0B 4ZN1A 7FD1A 1N4LA 1JXEA 4TQSA 1ZYQA 4MK7A 4A8SA 4ELTA 2JVRA 4KKOB 1UAWA 3TNVA 5LOQA 3Q89A 1HHSA 3OFHA 4PYAA 4Q2LA 1E6YB 3M6VA 1T3OA 4Z7CA 4DL0C 1LKZA 3V5RA 4ZP7A 4TLQA 4AQYF 4C97A 4LF8F 4J91A 1RWKB 3M8PA 5C25B 3D54A 4YDDB 3QIDA 2K8GA 1QDUB 5HO4A 2M0GB 2M7SA 2ZH5A 2QL7B 3TZXA 4TXSA 1RI7A 1RTZA 2MQNA 1Y3JA 2WBMA 3D66A 2C22A 1JXVA 3QBCA 3ILLA 4DG1A 4C0HA 2CPIA 1AYEA 4DHVA 3NCPA 4ILLA 3QJLA 4U67Q 5KFWA 3BR9A 2VQFJ 1TK0A 1R89A 4A48A 2Y0BB 4I69A 4G1QA 2J6TA 5EHHA 2O66A 1R6YA 3KHLA 2DNHA 1HD0A 2KXFA 4OYMA 4F0MA 1GTEA 5B0AA 2KVQE 3C14A 3KK1B 1HI1A 2WAQD 1IBKJ 3OR1A 1VCTA 1JLAA 2ASLA 2FY8A 2RQMA 2I2YA 4DQPA 2DNYA 2RH3A 2AGPA 3IWNC 3D6TB 2XMAA 4FS2A 1QSYA 4PEOA 2JEGA 4IG3A 2DNZA 2EK1A 3O3LA 3ENAA 1XEZA 5LSLA 2NZCA 5C24A 3TEGA 1HMVA 3K17A 4LF6F 2NR0A 1VRTA 1N5YA 4ETXA 3U7JA 3ZTPA 4JI1F 3BBFA 4OI1A 4DS4A 3CWJA 1SV5B 4XIUA 2GFFA 4OIXA 4WFBQ 5ETPA 4BCAA 1U6ZA 2DO4A 4CTAA 3CJ5A 3G71S 2UUCJ 2IA0A 5JXSA 2XSJA 2KB2A 5J2MB 4IFVB 3NOGA 4O4GA 1IKWA 3RAMA 2LA4A 3D67A 2UXCF 1LQ9A 3K8VA 4HVZA 4OHWA 3CO0P 1CS4B 1S97A 1VQYA 1ZA1B 2CXEA 4CO1A 2HNYA 2EG2A 3R7SB 4CI0B 1HQUA 4MIAA 5BXIA 1KWMA 2XSFA 3T9NA 4IRDA 2EFPA 2V4JB 4Z7YA 3CC4S 3E51A 3MFIA 4RLEA 3GJSB 4LF9F 3CGIA 1AUDA 5HROA 1S6OA 8AT1B 3HFZB 3SXLA 2GHWA 4NRUA 4RW6B 2CJBA 1HNWJ 1RWOB 1YJ9S 4HEA9 2OAUA 3G6VA 3LWMA 2PFFB 1T03A 5HQ8A 1UVKA 1H2TZ 3KOAA 2LDIA 3LP1B 2FGCA 2JEFA 2ALYB 5SZTA 3QZ8A 1VQLS 5HJYA 4RR5A 5JJBA 4QIGA 2B4UA 3D5MA 1WWHA 3U27A 2QEXS 3W5ZA 1Y9OA 1ZM9A 4F36A 3HX9A 3I96A 3CJSA 2X1BA 3ZTQA 3A3NB 3IBCB 2F65A 4JI8J 5AE3A 3RGIA 4IDKB 4S0MA 2JRSA 2J0WA 3IM8A 3EGZA 1RWPB 4M5JA 2GJFA 4M5KA 3FMBA 1MN9A 1O8BA 2XHCA 4JV2A 4JI0J 2DNPA 2YNGB 2V5HG 1UZHA 4LF2A 1EZZB 1SIWB 1WG1A 4A8FA 2MHNA 3US5A 3MXHP 2JX2A 1U49A 1Q5YA 2QYGA 5E41A 1FE4A 4IR1A 4U9RA 3PYEA 4EGLA 3LANA 4B3RF 4LRAA 3TA2A 2FVQA 3C15B 3OJUA 1TELA 2DRBA 3SCIE 3T41A 2CPEA 4R0EA 2WOMA 5E5NA 2IIHA 4TYBA 1KC8T 2AJ1A 1RBOB 2HRYA 2XC9A 4ANCA 2CNLB 2MKKA 1NEEA 1U0HA 4LIWA 5JUMA 4MFBA 3H8YA 3C14B 1VLYA 2V34A 5KFGA 1I5OB 1YSJA 2PGCA 3KNAA 2BQUA 1WC4A 2GC8A 4DEZA 4MJKA 2YKAA 4Y28C 1OY9A 2PMWA 3DGPA 2B4OA 2Y8YA 2IM1A 2BR0A 2OELA 2FHKA 4M5DB 3KLGA 1FNOA 3IS9A 2CZ9A 4NLPA 4ZJOA 1V9OA 1KHWA 2HWHA 1CC8A 1DTTA 2HS0A 1M0SA 4NLVA 1HMVB 1RAJA 4L76A 2ZH4A 3NXZA 3I31A 3S01A 1UJ6A 3UDVA 1KS2A 1CJTB 2U1AA 3RB3A 2VF3A 3K5NA 2IY5B 1UFWA 2NSBA 1T9XA 3B4MA 2XSJB 1FKPA 2ZJQQ 1QAXA 5IT0A 2LQBA 1W2BR 3GYXB 2POKA 1RLDA 4O4GB 3ENQA 4IO9Q 4F02A 1CLFA 2DITA 1RTJB 2QTWA 3HVWA 1TTHB 2RDJA 4DQQA 4N5SA 1DBDA 4DSJA 2YQ1A 4YB5A 3QFHA 1H6KX 1WHXA 4ZVUB 4WWSA 4DR5F 3KJNB 1TKXB 5KFZA 4K0KJ 1N36F 3UW1A 4V1Ak 3DRPB 3KLEA 2XY6A 1V5VA 1YJ7A 3DM2B 3MD3A 2YNFB 4CDIA 4F4WA 1QVFR 4DLEA 1KDNA 5L1IA 2JC0A 4RW9A 4QW9A 1GEHA 3H25A 4RL1A 2IBOA 4DR2J 2I5JB 2V8DA 3W1YC 2E9TA 4OYAA 4C98A 2BW7A 2RRBA 1HFEL 3RRGA 2EFOA 1U2CA 2QFJA 2MY8A 4QPTA 2V68A 2XTJP 2C2MB 4RWWA 5EGYA 1T9UA 1RSCA 4OZJA 1ZETA 3H5XA 3HULA 3W2WB 2BKPA 4QW8A 4USVA 4JV5J 5BYSA 3K8WA 4RKUC 3H42A 2W8KA 2C3UA 1TV6B 2HHWA 3CJRA 4YQWA 2Q79A 3W9JA 4LRFA 4QIVA 3K2YA 2ZBPA 2JLFA 1XN9A 3N4WA 4B17A 4CCHA 2EVZA 3MR7A 1XC9A 2YX7A 1OPZA 3JSMB 2ZHOA 3DDNA 2LCWA 2NXCA 2OPRA 1MU2A 1Z2ZA 2MDAA 4WTOB 1TKTB 5LMUJ 2AF6A 4OMFG 3NS5A 1GMWA 2UU9F 5HLFA 1S6QA 5DDQC 2MB0B 1JLQB 1FRIA 1QSSA 3WIUA 2CQ3A 2OEMA 4C7QA 3IP0A 5CA5A 4YR3A 2DGTA 4AL7A 3PW0A 3CF5Q 2W2NP 2OPQB 5F8IA 4J9KA 3M2UA 4IO1A 2B5JA 2YWEA 3I0RA 3AJDA 3QO9A 4C3LA 4QIEA 4HH1A 3HPOA 2L9DA 4ITSA 5I3PA 1LXNA 3CCQS 1X4GA 4O0NA 3H40A 4CLYA 1D9DA 3KLGB 2WONA 3GCXP 1AFIA 1UEUA 2MZ1A 2NUUG 1BMQB 1S6PB 5B0DA 5MAOA 4GKJJ 3QATA 3M9MB 3EVOA 2KTQA 2BANA 4J9VA 3RBDA 4X65J 1DTQA 4KPCA 1SJ1A 2RAQA 2QMXA 1RHRB 3HZGA 4ZLPA 2DY9A 3Q83A 2A3JA 4WBFA 3VGUA 1JIHA 1VOMA 2V4RA 2DEJA 2QL5B 4X62F 2DY1A 3KMQA 2E5IA 2CADA 2XGPA 5HN0A 1U1KA 1WACA 2AJ4A 1NAQA 4J37A 2MTLA 4ICLB 2RB7A 1KLMB 2ROGA 6AT1B 1HHTP 4ETZA 1DQAA 3G2XA 1HWKA 2OI2A 1OPIA 1LK7A 1FRXA 1W7WA 2UXDF 4V19J 1KD1T 2EG1A 3T19A 2FPHX 4NPOA 4USKA 4ECXA 3ZZOA 1DFDA 1U0SA 2MZTA 3GCWP 2XCAA 5A8RB 2HHVA 3EVMA 1NSKL 1JLBA 2P8IA 2R3VA 4G6VB 1H72C 3OL6A 5F8JA 1SKWA 4KH0B 3ENVA 4UF4A 3TW0A 4RNOA 1J5OA 2H5EA 3ITHB 2MZQA 1R6VA 3DLEA 1IBMJ 3BYRA 5A8KB 1ZTWA 2XMMA 1NPKA 2CQ1A 4TYAA 1SJ4P 4IFYA 1W2IA 2WBRA 2DNOA 2HPUA 3QIPA 3DRSA 2HGMA 2KZZA 2ZDPA 1F9HA 3K59A 4ECQA 2NQPA 1TMMA 5GAHU 3OTBA 3ETOA 3JYTB 1WJ9A 5ETTA 2KU7A 4I2QA 4RO0A 3J81j 2XYGB 3SMZA 4WFAQ 3LUYA 2R8KA 4DF4A 1HYSA 2H5IB 5JVHQ 3D9BA 3M1VB 1LFPA 3W8PA 4DR7F 3HP6A 2GX8A 4WFNQ 4E8UA 1JJCB 1U1RA 4Q43A 1U1QA 4OZ2A 2D3O1 4P52A 2BJ9A 2OH2A 4JI7F 5KFUA 5L1LA 1FKOB 4J9RA 1N56A 2G2OA 4A8XA 1YK9A 1N32J 4HDHA 1XJWB 3M8QA 3V4IA 4I7FB 2QYCA 4QBUA 3I5CA 2A6OA 2E5LF 2Q43A 4AQYJ 1B99A 5F9LA 4LF8J 2JEIA 3ILOA 2BJEA 4CLFA 3IA0A 3VGSA 2QFIA 4LSNA 5L1KA 4HL9A 2IJRA 3OW2R 1KLNA 4FBUA 1A6LA 5U47A 3T1HF 4ECYA 4RBTA 1SJRA 3MECA 4EBDA 3BBBA 4DZDA 4R8UA 4OZ1A 2E1PA 4K4YA 3GLJA 4CLKA 2AEJA 3I0RB 4DX5A 2OTJS 1PO6A 3UD3P 1CBKA 1EIYB 2WW4A 2WVEA 3L7UA 4B3TF 3BQ0A 5A2QY 1QUVA 5F8HA 1U6FA 4I64A 1CULB 2ZITA 2E5JA 4JI6J 1QE1B 2DTJA 2H65B 4CM2A 1BD6A 5KG3A 1EKRA 5B0FA 2W25A 2BVZA 3MMCB 2ZBRA 2FLPA 3R2DJ 3DLBA 1FEHA 5AXNA 2Y1JA 1S9FA 2XWYA 3G9CA 3N6LA 2WZ1A 3T5JA 4LFBJ 1MWQA 4Q8FA 2UP1A 1LEOA 2K2PA 2LLZA 5DGBA 1MW7A 3GMGA 3OVSA 4DSLA 4NE9C 1ZAWA 4ZVPB 4LF5F 4YHHF 1I1GA 4O4RA 4GVBB 4FKYA 3ZZTA 2EPIA 5EWGA 3EICA 2OIHA 4Y2KA 3M8SA 3BGRB 1B0PA 2SXLA 3C16B 4NXMJ 3M05A 4PG7A 2FVRA 2D1CA 2QN6B 1J5EF 1NMEB 1SJFA 4OYOA 5HMXA 1SC1B 3KLHB 4IOAQ 3DLHA 1WHVA 2E9ZA 4AUKA 4H54A 1EQMA 2VUGA 4YY3J 3Q24A 2UXCJ 4OL8A 1SCJB 4B9TA 2QX0A 1CJKA 3IBFB 5I3UB 1Y5IB 2OPSA 3KK3A 3OFEA 1RWUA 3D0GE 1S99A 2V4QA 4ZVHA 2UUTA 1C0TB 3W65A 3FCHA 1R8HA 4NCGA 2IM2A 3J7YU 2V0NA 3LALA 2U2FA 3ZZ0A 3KDOA 3GFXA 3CDWA 1FRMA 2QLBB 3HJFA 4GRSA 2NZ4A 1UFLA 2YWHA 4K4SA 2DNRA 3MPYA 3ADAC 5F0WA 4DFJA 2CJAA 3HZEA 4NA1A 4ZLLA 4Y34A 4U7UD 3UCGA 2IVMA 3UFCX 1D09B 1WEYA 2V50A 5B0CA 2G1DA 3R5GA 2H1YA 3HFKA 2DO0A 4Q0BB 3D2WA 3E01A 4DR3F 4OHYA 3QMQA 1HHQA 2V6AA 1GT8A 4G1IA 2VPZB 4MYTA 1C4AA 4MKAA 4ZN3A 2JL9A 4WZQA 3DLKA 5GAHI 4JYAF 1Q81T 1JJ4A 2OJ3A 1CJUB 2MZJA 4LVNP 2RILA 2Z8QA 4K4WA 3CJ8A 3M8QB 3ZTSA 3V4IB 1YG0A 4NZ0A 1D1UA 2BXJA 4CWBA 5IWAF 3CPWR 4FXVA 2MGZA 4LSNB 5E3QA 3T5KA 3EYZA 3V6JA 3A3OB 2C2EA 2CVIA 1LWEB 3MECB 1HARA 4LF7F 4K50A 1E6VA 2RMLA 1Y3KA 4ZJQA 4AYBD 2H51B 2CWXA 1T9WA 1ZM4A 2YVSA 5L9XA 4F26A 5IV3A 5B0EA 3QAUA 4HHUA 3GV8B 1H74A 3BSAA 2UXBF 4YS2A 2V2QA 3CJKB 1TVRA 5L38A 4KFBA 1QLNA 5J1EA 3OBIA 3FBBA 3OUYB 2ZZNA 2XO6A 1UA1A 2OFHX 2Q6BA 2HBRB 4BC9A 2NXUA 2ASDA 2KM8C 1RT5A 1SQGA 3BB5A 3DXBA 1NSPA 4LIRA 3GIKA 3AAWB 1F3VA 2Z56B 1IJEB 3SDEA 1WKJA 3L3CA 4CT9A 2JWNA 2NCKL 1KKHA 1KQKA 2DR6A 4PPZA 4TU8A 4JI3J 3OTCA 2Y1RI 5HJXA 1NJZA 2ZVIA 1M1HA 1X4BA 5HVFA 4I6WA 2V8PA 2RUGA 4C2MA 2GAGC 4OYPA 1WELA 4WFYA 2VA3A 1GQEA 2XNRA 3DLGA 5HBMA 4ZCKA 1XNRJ 4IOCQ 2FD2A 5D0HA 1I3OB 4NLYA 5GAGU 2DCLA 4PXCA 4DV3J 1WG4A 2J5AA 5LXRA 3R1HA 2LU1A 4RUHA 5DRKA 3HHEA 4FYVB 1VC6A 2HHUA 2IYIA 1VR6A 4C0BA 2M2BA 2IJFA 1N48A 3W2VA 2PD1A 2FZCB 4CLUA 2CQBA 5HQMA 2N7YA 2O3DA 4BC7A 2MY7A 3TARA 4P2SA 4I67A 3OTOF 3MMJA 2RHSB 4RW8B 2D41A 4OJ3A 1UL3A 1T05B 1RT7B 4DL6A 3Q8YA 2VBYA 5CYQB 1N36J 3J81Y 2BJ1A 1N88A 3G96A 1N54B 3Q2TC 3N01A 2P2CB 2ZH7A 5D3GB 4LBIA 4ECRA 1X8DA 4IH5A 2XMJA 4FPRA 1NDCA 3ET6A 3OFFA 1X4AA 1IXKA 2ATLA 1WI6A 3HI9A 4G3IA 8RUCA 2LEBA 3J7YI 4NRTA 5M2RA 1HBMB 3RB0A 4YB7A 2X1GA 4DL5A 3MCNA 2GAHC 2J9DA 3DLKB 2JDJA 3OR2A 5SUHA 3GIJA 4ILMA 3IGNA 3POTB 2K3IA 4A46A 2H48B 3QSIA 1IBCB 3G6ES 3A8IA 3KJFB 1IKYB 3NBPA 3M2RA 3SV3A 3QAEA 1MG7A 4DCJB 2IAJB 3UNYA 1HBUB 1S9EB 4K4VA 1FD8A 2JC1A 4U6PA 2XMTA 1RLCL 2MGZB 3HT3A 2BQRA 1RT6A 1YBUA 3HSDA 1U8SA 3SCLE 1J27A 4PG4A 4U7CA 4CYUA 4N41A 1O0PA 5DM6Q 4DSFA 4DFMA 2PIIA 4PUOB 2IRUA 3EWGA 2EFGA 2CQ0A 2PT0A 3NS7B 2DGQA 3OHAA 2KHCA 1RA6A 1I51B 3RU0A 3CIMA 5F3ZA 4JI5F 3W64A 1WEZA 5ITHA 1PYTA 5LJ5Y 4J7CA 3CCTA 5J1EB 1B70B 3IRWP 5DO2A 3W9IA 1AUSL 1UCNA 2C3MA 4OX6A 1BQXA 4YDXA 2GVDA 4Y6IA 2Z2LA 1JLEB 1WTFA 1RT5B 4EMDA 2NXNA 4FN5A 4LRBA 1T8EA 3BR8A 4AL6A 4LBPA 2DXDA 3MUMP 2RSQA 3LGHA 4OJ1A 4ES2A 2B9YA 3OL8A 3S8SA 5GVQA 4DFKA 4RBVA 2DHXA 3EZUA 3HSZA 2HFNA 3PDNA 2G0IA 4QPXA 1S0OA 1SC4B 5LMNJ 3D6MB 1KVJA 1C1CA 1XR7A 2F7VA 1Y10A 4ZLNA 2E66A 2F9JA 3RG6A 4LJMA 2KVIA 1S9GB 1TP7A 2CWKA 2F63A 2YKNA 4WXWA 4P2XA 4TQRA 1OO0B 2HQIA 1OSCA 2YX4A 5CYJA 5J2NA 4F4ZA 4BWJA 5B0GA 3LOUA 4Y2MA 1JJ2R 2HNZB 3UN3A 3VZHA 3OLAA 1NHUA 5C2GA 3SSSA 3SFUA 4X4QA 1ZBTA 5GAGI 1KQGB 1WNEA 3VV2B 3AJ2A 3H0PA 1NO8A 2B43A 4ZIVA 1RTDB 1NDKA 3BM7A 4KY3A 4F2SA 3KK2B 1SL2A 3TVYA 1NB2A 2VH7A 5ETNA 3V6DB 2RKIA 1VMBA 3DOMB 4C6AA 3TAPA 3TA0A 2ZE2B 2RDIA 3SQOP 1NJYA 3Q86A 3SSRA 5A2QU 2HLUA 3C6UB 3HHKA 2ZVSA 1NK5A 2Z2ZA 2XO7A 1AT1B 1Q53A 1NH8A 4WIIA 4JOUA 1GXTA 2O67A 3NNCA 4X2BA 2BJDA 1R8BA 4AXJA 2CQHA 2HKEA 3UCUP 3EGVA 2OTLS 1S1XA 3OR2B 1FFWB 1HIYA 1C0UB 1YRUA 2CQ2A 4ZCIA 2VG6B 1REVA 2C2NA 2VQFF 4XAKA 4C8LA 4O3SA 2UUBJ 3RR7A 1QY7A 5KT5A 1RKIA 2CDRB 1NHKL 2MQMA 2I38A 2V2ZA 2VG7A 2HYIB 1S0NA 2XS2A 4U8YA 3MURP 1KHVA 1R8CA 3C6TB 3ZTRA 2RNEA 2XLIA 1L3TA 1REGX 3W8GA 1I6JA 3U02A 1PILA 4E0DA 3MFHA 2DGXA 4USUA 4ZVTB 3GONA 1DURA 2OMLA 1X9WA 2KYZA 3ILJA 5DJBA 5KT3A 3OVAA 2GMJA 1FK9A 3BN7A 1BWVA 3EPGA 3CUNA 2E44A 3HVTA 3V81B 1JKHA 4NZ7A 2UUCF 3MPVA 4GO5X 4FVCA 3M32B 2AU0A 1R8AA 2ZZTA 3UE2A 2VQEJ 2BRKA 1VQNS 4UW2A 2BEFA 2VDHA 4WU3A 1Z2LA 1IR1A 1ZPWX 2BW2A 4KB7A 2YPYA 3G6YA 4GMKA 3W9HA 2VJUA 3CJ0A 2GNKA 2LXIA 3MEDA 4F3QA 2HMIA 1NJIT 1X9MA 5KFBA 5KFHA 3VALA 4DN9A 3QJJA 3M2VA 1PAEX 2ZEJA 3QLHB 4ECVA 4DS5A 3VVTA 2CA9A 4QYRA 2CPXA 5HP1B 1F5BA 2NXJA 4P2FA 1UEVA 2EK6A 1DLOA 2MKHA 1QAIA 3TVZA 1HNWF 1KONA 5LL6d 2DNLA 1HWLA 1GAOA 3K5LA 4WXOA 2VONA 1JX4A 2DIVA 5J1PA 1WC1A 3TRGA 1VISA 3HHLB 1R0AA 3RUBL 3WX8A 4ECTA 3OLBA 3DFEA 2VFTA 3NRBA 3QPIA 1KOOA 4TU9A 5BJRA 4G1PA 2G13A 4RW7A 5KT6A 4RJVA 2HRTA 2ZH2A 2HEKA 4CP5A 5HMZA 2HZVA 4B02A 4D3GA 4OHXA 3P3DA 1QJHA 4JI8F 3KJVB 1R43A 4C48A 2QE5A 4EYIB 1P9YA 2CQIA 2HW3A 3L09A 2LQ9A 4RW4A 3D0IE 1H98A 2YY3A 8ATCB 5F8MA 4DPYA 4YP3A 3MM7B 4JI0F 1SL1A 1RISA 2GJIA 3CC7S 2FJDB 1CJVA 2L3MA 4DSIA 3AA8A 4USIA 5C2CA 2XZDB 4O3QA 1UTAA 2ZHAA 3UVJA 3MMBA 2BE2A 2JHEA 2GO9A 1TFYA 4B3MJ 3VAHA 1SVDA 3D4JA 1RE1B 1FWLA 1REVB 4J9SA 3EDRB 1I94J 4KAIA 5IFMA 3VAFA 3MR3A 2CJYB 3FRZA 4NLTA 4JUZA 2GGPA 1Q95G 3UR3C 4F0KA 2H4YB 3KLVA 3RYLA 4Y00A 4OI6A 4NXNJ 4QR0A 4DZ6A 4P71A 3MM5B 1Y11A 1ULRA 4URSA 1IM6A 5I42A 5HQLA 4Q45A 2YKMA 1RTHA 3FSIA 5DQHA 4QR1A 3F44A 2QG9B 4JYAJ 4KR0B 3M9NB 1PSDA 1U09A 1EJ7L 4NA2A 2QRRA 2WK4A 5LXYA 5CH7B 1PCAA 2FB0A 1S1WB 3THVA 3AB4B 2YX1A 4O0IA 4DL4A 1UVMA 3J7AN 4DV6F 1HW8A 1BQNB 4MK8A 1EETA 4N77A 1S10A 1D8YA 5ETVA 4I6YA 3O2IA 5A8WA 2W9BB 1OWXA 5AE1A 1U1PA 1N5SA 3IRXB 4WPAA 4AT1B 1IKXA 2UUAF 4ZP8A 3O8WA 3AY0A 2GCFA 2VFRA 1JKHB 2FY1A 3J81U 3IR5B 1QVGR 5BR8J 3MR6A 4BS2A 1YGYA 3UDEA 4RNNA 1RT2A 1AW0A 1JLGA 4KGVB 4CLWA 3QT7A 1MROA 4NEZA 2M70A 2HVZA 5HVHA 2PSZA 4JP8A 2GQCA 1XK8A 3KG4A 3IWLA 4ECWA 1U4BA 3MEGA 4N7TA 4NLSA 2D3ZA 2CFXA 3RZAA 1DJ0A 3F73A 2HS3A 2C1EB 2J76E 4YR0A 4I0WA 4CT8A 1PJ7A 4TY8B 4K0KF 3BH7B 3ZC4A 2XZTB 4PKDB 5KFEA 3CD0A 1ZZFA 1RUSA 1FFGB 2PE8A 3TO8A 3EGWB 1QD1A 1VHIA 4O23A 2HQCA 2HK2A 4E2FB 2HGNA 4QYZJ 2CZVC 4DR2F 1NB7A 4DV1J 1TKZB 2W4DA 3MUVP 1FXDA 4P73A 3KHGA 3B4DA 5K8PA 1Y4ZB 4OZ3A 4LVOP 4IRCA 5KAKA 1RXOB 4B9VA 1X5SA 4RW7B 1NBEB 1JK9B 3EGNA 1K8AT 3DI6A 3ZTOA 4A8OA 4WYWA 3R27A 4DQSA 2ZNYA 3MEEB 4OX8A 4JV5F 5J2PA 4FF2A 5ETOA 4FS1A 2ATCB 4RW4B 5D4PA 4DCPB 1Q1KA 1RAOA 4FYWB 1FJEB 1VJWA 4F50A 3RAXA 3OSNA 1VFJA 3GJTB 2XMVA 2B4PA 2IC3A 4NI2B 3MGJA 2HHTA 1MMNA 2FJEB 4KKOA 3D3BJ 3MMBB 5T14A 2P6SA 2B0GA 3K5MA 2AEMA 5LSRA 5LMUF 1E6YA 2HNDA 3EPIA 1YJUA 4YMEA 2DGOA 1AFJA 5C25A 1GNKA 5KFCA 3H20A 2YTCA 2QSFA 5GMKa 1RHQB 1R0CB 1Y0HA 1MMDA 3MF5A 2R8IA 1FD2A 5AXLA 2Y3YA 1RAIB 4QWDA 4UT4A 4NZ6A 1YHQS 3TI0A 1CQMA 3G86A 4KO0B 3R6GB 2IM0A 2LU2A 1WC3A 4Q2MA 4CM0A 2CUYA 1IQZA 3MAQA 3EXYA 3MAAB 1FRKA 3FFIB 3IAS9 1Q82T 2LKZA 1U7LA 3OL7A 4WP3A 4AE5A 2RVJA 2KT5A 1RAGB 5K9FA 3TEHB 4X65F 2J9EA 4C0OC 3A8KA 3CIZA 3JSRA 3BKUA 2IRXA 1UA0A 5J2QB 3QRQA 5CQGA 2GIQA 5BYQA 3DMJB 4ZS6A 3LPEA 4PRFA 2J7UA 1UVIA 3DRRB 4ID5A 4ZVFA 3LP2B 3ISND 5KTQA 3CCMS 3OSPA 3WDOA 1F2GA 2R8HA 3T9ZA 2JVOA 5A6WA 3NWGA 3HHNB 3QGHA 3NMAA 4PG6A 2FDNA 2FHJD 3NAIA 5A76A 1RT4B 2XM3A 1FF2A 1SV5A 1KP6A 4NMXA 3UDCA 1PYSB 2HQGA 2MQOA 2OMOA 3QT5A 3MTKA 4KJIA 5J2MA 2PEBA 4IFVA 1NLKL 1SKSA 3SQGB 4EZ6A 2DH9A 1MN7A 4P10A 1B64A 4CO2A 1W26A 2KRRA 2CVEA 4M95A 3O44A 3RTVA 1CS4A 4Y0FA 5KFKA 1U47A 3CB4A 1NNDA 1LNQA 3CSKA 3TP2A 3T1YJ 3BKFA 4PXEA 3PCOB 3R9LA 1S59A 3A8JA 1S1UB 2V4JA 1FFSB 4UY85 2WVCA 3HD1A 1IBMF 1ZA2B 4Q7AA 1A9NB 1RKJA 2R7RA 4X64J 1XNQJ 1NK9A 2R42A 3SCKE 3VWSA 4UUXA 1JLFB 2E1RA 2XCPA 2P9CA 1ZTTA 2HRUA 4RW6A 2JOQA 3WZ0A 1FWPA 4DQRA 2JLEA 2QC3A 4EO6A 3LP1A 1ZAXA 4NLOA 2B51A 3PRDA 1OIAA 2CIMA 4KV8B 2FJWA 3DC2A 4TLRA 1IUJA 4PQUA 4F8RA 4DPTA 3FQKA 3DYAA 4IH7A 1U1OA 1IBLJ 2E29A 4QWBA 2L41A 1LWFB 4ZJLA 2RF2B 4CLPA 1FEEA 5EWEA 2WTFA 4K4TA 2AX0A 3KDNA 1GX6A 4PCQA 1PYOB 2AJ0A 4RUBA 3ZZZA 2YNHB 4IDKA 3TJAA 5KG1A 5AE2A 3ILIA 1N32F 2HNDB 2EBEA 1ZPVA 5L1JA 3HCXA 3NGDA 4NCAA 1HNZJ 3FJ2A 2YNGA 3CJQA 3TZZA 4NYZA 2BM1A 5HSPA 3N6MA 1Y5NB 2V63A 3FCWA 1VIOA 2R7UA 3DDKA 1RYRA 4QWCA 2ZOFA 1RA7A 3H4BA 3AT1B 2DH7A 3HT0A 2N82B 5DM7Q 3C15A 4RUCA 3V4MA 1UVNA 3IWXA 1HW9A 3U1MA 2R2UA 4FBTA 1QAJA 3M8WA 3ZNUA 4KHRA 1SC6A 2ADBA 4R0JA 4JI6F 3BSCA 3GV7B 3TZYA 5HI7A 1WHYA 2G9OA 2PO4A 3G8QA 1NM2A 1DQ8A 1KSPA 5LT5A 1N6QB 4FNHA 1VHFA 4QOTA 1RAAB 2DISA 2KT3A 2C3YA 2W2OP 4LFBF 2XG8A 2DHGA 3GILA 4ELVA 4N56A 3N0VA 1A0OB 3MPUB 4M5DA 3DHXA 3LPYA 1M5VC 4ID5B 4RBUA 1S1VB 1S12A 1U1NA 3CCSS 4N8OA 3K89A 3NL0A 3NWRA 4F4XA 4O44B 1CJTA 3HHLD 1M1GA 4NXMF 4ZVQB 3K7RA 1WUUA 2F5GA 1YDLA 1WF1A 5JVGQ 2UV8A 1OQ6A 3QZ7A 5JMNA 3LP0A 3P8BB 3TAMB 4IQMA 2W1BA 2DNKA 3I5AA 2GO8A 1KR4A 2LQ8A 5AXKA 2CPJA 2DPJA 2WCXA 4PXDA 3MM8B 4YY3F 5KFYA 1ZS6A 1RTJA 1RABB 3RJMB 4HI2A 1VK3A 1JJHA 2P9EA 2KO1A 2OFGX 2MHEA 1FDAA 1TKXA 1H2UX 5IV4A 1SJ3P 3LA0A 3IXQA 5FDLA 5HK4A 4IUFA 4P75A 5K14A 3UI3A 2PEHA 3Q8VA 3BSOA 1BWEA 2ZUGA 2B4VA 3DRPA 4YB1P 4LQ3A 4OJGA 3GYNA 4LF4J 2Z58B 4F3OA 2QLFB 3DM2A 3L7OA 3BYPA 2YNFA 1SKRA 3H4DA 1DARA 2LP4A 4J9PA 1U2RA 4M94A 1RADB 3HD2A 1FX4A 4H4KC 2I5JA 4RPFA 2Q3PA 4PWUA 1IR2A 4KYZA 2AJFE 2FYXA 4KRWA 4PQUB 2OD4A 1FE0A 2LEAA 2DRAA 2N7CA 4L75A 3ICLA 3DYAB 1U6BA 2GHPA 1X4CA 2ZH1A 4F4YA 3MM6B 1AZSB 4URGA 3M6UA 3HFVA 2IRYA 2BMBA 1RHJB 2R7VA 3D1OA 3W2WA 1Y00A 1VYAA 3P5BP 4C11B 4I68A 2LVWA 5KOWA 1VQMS 4CLZA 2BE9B 3D6HB 3G82B 1TV6A 1P27B 4K59A 2CPDA 2IJNA 2QT7A 3N9UC 3HKWA 2OUGA 1HBNB 2CPYA 3CCZA 2AYBA 3P45B 3TX0A 2W8LA 1WOPA 2MXYA 2CNNB 3FSXA 3HM9A 3EX7B 5LSOA 1CPZA 4ZDNA 3JSMA 2M8HA 1L3UA 3PW2A 1SH3A 3CW2C 1B0VA 4EO8A 1HKAA 5KFRA 4DI6A 1TKTA 4UY8T 4XO0A 2WRMA 4JI2J 2X51A 1BLUA 3W5YA 3W61A 1FJ7A 1S79A 2MZSA 2JJ4D 5DQGA 3QGPA 1JLQA 1MMLA 4Q5VA 5A0YB 3F41A 1URRA 2MJUA 4RU9A 1T7PA 2GQQA 3NGUA 2BABA 4NYOA 1SQEA 5G4DA 4KE5A 3GV5B 4DR1J 3BPSP 2AHOB 2BZ2A 2OPQA 3P6YC 2RJZA 2YKPA 4NA3A 1HL6A 1C4CA 1Y7PA 1K44A 5KT4A 1ROFA 5D8HB 2NLWA 2MEWA 4BHQA 4B9NA 3ZZPA 1KFSA 4WCEQ 3AQOA 4L72B 4DV6J 2FC8A 1HI8A 4JI3F 3PV8A 2HZCA 1FNMA 1U45A 2XULA 3TYTA 1TMJA 1S6PA 2GIRA 1NPRA 2ZHBA 3AOCA 3IG1B 3GSDA 3M8RA 4ES1A 2VODA 4WU2A 1TAUA 4NL5A 4C8YA 2XLJA 4O3OA 2QLXA 3IC1A 1XNRF 2MSSA 4OHZA 2R7XA 2UUAJ 3LP0B 3AQPA 2CJKA 1K1QA 2GHVC 2RQKA 4DV3F 4H4OB 4ED1A 3JSBA 2ADCA 1RDRA 3LWLA 4MKBA 3M8ZA 1FTCA 3SIPB 4DQIA 2FJVA 2K7JA 5DLFA 3JTOA 2I6WA 4QYZK 1T94A 4ICLA 1KLMA 1SUQB 4WZMA 5L8RC 2EW9A 4UOGA 3GIIA 3KG1A 2LA6A 2CPHA 4ED3A 2FIUA 1C2PA 3TQEA 5FDLB 3LO3A 5K14B 4LR8A 4IKAA 4P7TA 2MKCA 4FYYB 2V94A 4G65A 5D0RA 1LW2B 3IN5A 4Z2XA 3THTA 1CC7A 4ED7A 3QJPA 4XPEA 2N4CA 1TL1B 4R25A 5A8RA 2GVZB 2ERRA 3ELHA 4MT1A 1MLAA 3NOCA 1K1SA 4X66J 4ZKAA 2F4VJ 2IDLA 4NLDA 1RTIB 2ZWPA 2BDPA 1VQ9S 2QA1A 2DPIA 2FJAB 4UQTA 2DYAA 3PTWA 3BV8A 4FF1A 3ITHA 5EX0A 3OV7A 4N8NA 2QMWA 4CLSA 1F5CA 4DPUA 5A8KA 1LW0B 2UVRA 2E7WA 4NLGA 1FXLA 2DJWA 2E5GA 1YBTA 4B9UA 1SQFA 3W3SA 2ZD1B 1X7VA 3MZIA 3PYGA 2Q1LA 3JYTA 5AJ3F 1H7WA 3KJQB 3R5BA 1N0UA 3ENWA 4B08A 4ZVOB 1HNVB 4Y65A 2P6TA 3MM9B 1HR0J 3R97A 3M1VA 1O5JA 2RIJA 2OKQA 2AMCB 5CD4A 4NOHA 3C46A 1TL7B 2E1CA 5IT4A 1WORA 1NK8A 4KSEB 3J80Y 4ZVRB 1FKOA 1YRXA 2APOA 3F0NA 2FZGB 3T5LA 1GH8A 4I7FA 3RBEA 2XMKA 2LFVA 2CQGA 5CCLA 5E3CA 3FRYA 2VG5B 2FUG9 2MYFA 1Q0NA 1JXLA 1QUPA 4K2XA 2O5DA 4V19X 3HXMA 3IR7B 1Q7YT 1BQMB 2D3UA 1P8GA 1JB0C 2O01C 2V2KA 2J0QD 1ZZNA 1CULA 1QE1A 2X3GA 2NREA 1VQPS 5FIIA 4WFXA 2CNKB 5LMNF 2ZH3A 4LREA 4DV2J 3MD1A 2W9CB 4DU8A 2WB4A 3BN4A 3MMCA 2HG4A 2GZOA 1BGXT 2G1HA 2KZMA 4HTIA 4LUBA 4OI3A 2B8PA 3Q22A 4DR4J 2FLLA 5T7LA 2AWZA 2J7KA 4HKQA 2BRLA 1YQHA 2C2DA 2FVPA 1JLCA 2BQ3A 1Q8LA 5CHCB 2BUNA 2E9RX 4DV4J 4GVBA 4FXDA 5RUBA 2KYXA 4CQ1A 3BGRA 3SYZA 3M6WA 3HHDA 5IC4B 3T6JA 3FVYA 4LF1A 3SBMA 1DZ5A 2ABYA 3C16A 1R8PA 2N3LA 2FJBB 2AKWB 2IYGA 3PX0A 1RHMB 5K8NA 2Q6CA 2AV5A 3FBFA 2ACYA 1VQSA 3KLHA 2HLTA 2MJNA 1K47A 4DXLA 5CAAA 3VAJA 1H73A 5ETSA 4ANDA 4Q8EA 1M1KT 1HPZB 2VPWB 1XMQJ 3AHPA 4OX9J 4DX7A 3ZFVA 2VV5A 3NG8A 5LM7E 1UETA 2QMUB 5I3UA 3PZPA 2K1RB 1JMTA 3TJ9A 4O3PA 3E2EA 1PBUA 4PPDA 3RRHA 3VF0B 1C0TA 3KYLA 1PBAA 3ZZUA 4QIWD 2PFDA 2OPPA 3BGFA 1DAXA 3TWZA 2IMWP 3TOQA 2F4FA 3NCQA 3VAIA 5E0OA 4YFUA 2ZWOA 2E1AA 4J9NA 4H4MB 2NXEA 2J0SD 3UN2A 1L3KA 2AJ2A 1KTQA 1S4FA 2V9KA 2WVDA 1CSJA 2UUBF 3R3TA 2OEKA 2A2CA 3R5AA 3GFHA 3GJQB 1S77D 3P4UB 4U8VA 1NHVA 5IQQA 2ZKUA 2DNQA 4Q0BA 4USJC 3FEXB 2IBKA 2B9WA 4NYPA 2AX1A 5KFLA 4KHPJ 3AA9A 4J9UE 2RUSA 4RZRA 4L74A 1CJUA 2L08A 2W9AA 3PACA 4CH0S 3D28A 2P5VA 3C2PA 1VBZA 1M5KC 5D15A 3MR5A
chains in the Genus database with same CATH topology
3QRPA 4QYZK 5H9FK 3QRRA 2Y8WA 4U7UD 5H9EK 3QRQA 1WJ9A 4DZDA 5CD4A 2Y8YA 2Y9HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QRP A;  4QYZ K;  5H9F K;  3QRR A;  2Y8W A;  4U7U D;  5H9E K;  3QRQ A;  1WJ9 A;  4DZD A;  5CD4 A;  2Y8Y A;  2Y9H A; 
#chains in the Genus database with same CATH topology
 4U7U K;  4ED2 A;  4AFF A;  3R2C J;  2YNI B;  3EVW A;  1RAC B;  3RAQ A;  4KT0 C;  2B8Q A;  4WKY A;  2ALZ A;  4X4U A;  4DV7 J;  5BYR A;  2WSF C;  2OGU A;  2DH8 A;  1LWE A;  3IBW A;  1HQE B;  1R27 B;  3NGS A;  4OI2 A;  3WHI A;  4WP8 A;  4P72 A;  5HL7 Q;  2HIQ A;  2VQE F;  3C8Y A;  3PX4 A;  3I9V 9;  3D6F B;  3CDA A;  3AD9 C;  3BRE A;  3QNW B;  4EK2 A;  2D74 B;  3FKB A;  3A12 A;  3CJK A;  1KOH A;  3CUL A;  4HT7 A;  5AXM A;  1Q86 T;  1NJW A;  2CDQ A;  5E33 A;  3OUY A;  1IKV A;  2DR8 A;  5E3R A;  2Y0S D;  5G0R B;  4B9L A;  3CJ2 A;  4DR6 J;  2VB6 A;  1RBL A;  1WC5 A;  4NEY A;  1YZ7 A;  4DUY J;  2MKY A;  2HVD A;  2GJ2 A;  3A4T A;  4I2P B;  1IM4 A;  5T7L B;  4X4O A;  1FXR A;  2CRL A;  1YBA A;  2PI5 A;  1UZD A;  3FBC A;  1TK8 A;  1NK7 A;  4L3K A;  3UD4 P;  4P74 A;  2WSE C;  1JLC B;  4CO4 A;  3RR8 A;  2RHQ B;  5IS2 A;  3KHR A;  3MMA B;  5EN1 A;  5IC6 B;  2L9N A;  1KQF B;  1AXQ A;  4N76 A;  6FD1 A;  5ADZ A;  3BO3 A;  3AFG A;  2GS8 A;  1TL5 A;  1SB6 A;  3DLJ A;  4WE1 A;  2XS7 A;  4YOE A;  2FHO B;  1T02 A;  4CO5 A;  3EZO A;  3V6K A;  4I6A A;  1ARO P;  5DZ7 A;  4B3O B;  2B7B B;  2R7W A;  3NKY A;  1WDT A;  2W2P P;  3M30 B;  9ATC B;  5IM0 B;  1HNI B;  3MUT P;  5ETR A;  3H5S A;  4WK1 A;  4WYL A;  1X0P A;  5IT9 Y;  3M9O B;  3Q8S B;  1S1T B;  2WB1 D;  4RW8 A;  1UFK A;  1T05 A;  1RT7 A;  3OFG A;  1F3F A;  4QWA A;  3OPK A;  4M63 A;  5CYQ A;  1WC6 A;  3TQ1 A;  1RQ0 A;  2XEX A;  1D9F A;  2OPP B;  4LQ9 A;  4C9D A;  3DOK B;  1KN6 A;  1PIE A;  5KFQ A;  2D7S A;  2RD5 C;  1U24 A;  2MKS A;  3N6N A;  3QQC D;  5D3G A;  4B3M F;  4DWI A;  4ALZ A;  2ZBC A;  1I94 F;  3PXG a;  2KN4 A;  1FX2 A;  3JS9 A;  4MTP A;  1H2V Z;  3QFW A;  1RT1 A;  1FKA F;  3KUE A;  2R7S A;  1VQO S;  4NXN F;  2A1B A;  1OS5 A;  4Z37 A;  1HBM A;  3RBX A;  1F5A A;  1X4E A;  1NZ8 A;  3G8S A;  2FC9 A;  2BKN A;  2V9W A;  5J1N A;  2AJQ A;  3CJ4 A;  1NKB A;  2EFV A;  3C66 A;  3LGN A;  1VRU B;  3POT A;  4QZV B;  4QCL A;  2UVU A;  1WDD A;  2EFN A;  2ZBI A;  1IKY A;  5CYM A;  4KIA A;  5KFA A;  2DGV A;  3NAH A;  4AL5 A;  2IAJ A;  3EJM A;  3S1T A;  1HBU A;  1WTB A;  1S9E A;  2BJ8 A;  3OTE A;  2XMW A;  1V6H A;  2WHO A;  5C42 B;  3VCD A;  2ZJP Q;  2VIC A;  2MLX A;  4B9M A;  1FJG J;  5B0B A;  3B78 A;  4OZN A;  2IMO A;  2DR5 A;  1RWN B;  5D77 A;  2LXU A;  5BR8 F;  3JB9 k;  4PUO A;  1FDN A;  3FEY B;  3H2L A;  3VTI A;  3HSG A;  4PR6 A;  2Z0G A;  2X3D A;  2KL8 A;  2KRB A;  4LR9 A;  1D9A A;  2A6M A;  3I82 A;  4DPW A;  4P2M A;  3D0H E;  2W4C A;  4ER8 A;  3MOJ B;  1D0E A;  1DY3 A;  2MMY A;  2R4F A;  3MAH A;  3WC0 A;  5C7P A;  1KVK A;  4KTQ A;  1IKV B;  3LTO A;  3IFE A;  5T41 A;  5KFT A;  2XGQ A;  1BXN A;  1JLE A;  1YWX A;  3LQV A;  3UN5 A;  3L4B C;  1U1M A;  3LAK A;  1RB0 A;  3BDE A;  1FWK A;  3EDQ B;  2C2Z B;  1WD6 A;  2XNQ A;  4DV5 J;  2HFS A;  3QSY B;  1OY6 A;  1UJ5 A;  4D3H A;  5L46 A;  4ZPD A;  4OFZ A;  2G2Y A;  4CH7 A;  2V8V A;  4DDF A;  3NLC A;  1VI7 A;  3CDU A;  1R7I A;  4DJB A;  4DV1 F;  1BUX A;  1F9F A;  3X1L B;  2IHR 1;  4JV1 A;  1BE4 A;  2FQQ B;  1MWZ A;  5KG0 A;  4OZ0 A;  3WC2 A;  3T5H A;  3M8P B;  3I9Z A;  4J9L A;  1OYD A;  5AT1 B;  3AB2 B;  2WVF A;  2Y1L B;  3HO1 A;  2XBP A;  2HBZ B;  2XHW A;  2UVW A;  4ED8 A;  1JNR B;  4WE1 B;  1S9G A;  1K0T A;  2BBE A;  2CNO B;  1M5H A;  2B9E A;  4DG1 B;  3R5J B;  2RRA A;  4CRJ A;  2QIF A;  4K8R A;  3J80 U;  1HNX J;  3A8E A;  2XB2 D;  1TKD A;  2DCU B;  1VK8 A;  3PW5 A;  5H1S V;  2KT2 A;  2CJQ A;  2DB1 A;  2HNZ A;  4EZ9 A;  1N0V C;  4G1Q B;  2FHJ A;  4IH6 A;  1R3N A;  4W98 A;  4DUZ J;  2Z2Y B;  4U96 A;  2ZC4 A;  3UD5 A;  3TA1 A;  3ETM A;  3L95 X;  3H2U B;  1GX5 A;  2XI2 A;  4C8Z A;  1YJT A;  1RTD A;  3CD5 A;  2J6U A;  5DG8 A;  4YEA A;  1PJ5 A;  3P96 A;  4JBC A;  3GWC A;  3U1L A;  3H2V E;  3KK2 A;  5FD1 A;  4CO0 A;  3OR1 B;  3V6D A;  4JV0 A;  4UUW A;  4MYU A;  1JLA B;  2NSC A;  3DOM A;  2ZE2 A;  1IR0 A;  4K5R A;  4DSK A;  1SXL A;  3NNA A;  1R0B G;  1Q4R A;  2CKW A;  2OO4 A;  1MWY A;  3I0S A;  3C6U A;  3TZW A;  1GFW B;  4IG3 B;  1RZM A;  3B82 A;  4F7V A;  4C4W A;  1RU1 A;  5KG7 A;  1RT1 B;  3PJ9 A;  1K0V A;  4K2J A;  7FDR A;  5DS7 A;  4HLB A;  4ED5 A;  3T3F A;  5C24 B;  4OLO A;  3THP A;  2XY7 A;  2CZ4 A;  3BGL A;  3VQT A;  1R31 A;  1VRT B;  1AB8 A;  1N5Y B;  2RS2 A;  1SL0 A;  5KFM A;  4RNH A;  1Q79 A;  1WG5 A;  1O51 A;  3JQJ A;  3EUN A;  2RU3 A;  1HWU A;  4CTA B;  2AYG A;  3JAM Y;  1C0U A;  5E7O B;  2ZH9 A;  2VG6 A;  3PEH A;  4MMO A;  1G4C A;  2HBY B;  2LQJ A;  4NLQ A;  5AJ3 J;  5IOL A;  1IKW B;  5CYM B;  4DCO B;  4IR9 A;  2N4D A;  2MZR A;  4IOB A;  2I1R A;  5DDR C;  2HNY B;  5HMW A;  1PGZ A;  4AD6 A;  4ZP6 A;  1HQU B;  2HFO A;  3ISZ A;  1B7Y B;  1UWA A;  2DHS A;  1WC0 A;  3N5F A;  1YTY A;  1F1B B;  2CPZ A;  3GIM A;  3C6T A;  2H3E B;  5HRO B;  3VAK A;  2CJX B;  4DPO A;  4MKV A;  3FBE A;  3VVU A;  4C8M A;  1NPP A;  3GPA A;  2ZM6 J;  1RK8 A;  4OX7 A;  1T03 B;  1D3W A;  1S6U A;  2DGU A;  1V3S A;  3S7R A;  2H5J B;  1Q8K A;  2D9O A;  2ZBQ A;  3JQM A;  2HHH J;  2PA8 D;  3V81 A;  1HWJ A;  3PO5 A;  3MR2 A;  1XWL A;  1RAH B;  2PI4 A;  1KEK A;  1YIT S;  1XR5 A;  4I4B A;  3MOZ A;  4XK8 C;  3R1L A;  2V8H A;  2XWX A;  3M32 A;  5DLG A;  3ZZR A;  2RQ4 A;  2ILZ A;  4DLG A;  5ETM A;  3AD8 C;  3T1A A;  3LGM A;  4CLL A;  1RCX B;  2J8A A;  4CO3 A;  3PRV A;  3MTJ A;  2BV3 A;  2AQ4 A;  4QJV A;  2PMH A;  3N28 A;  4XTT A;  3T1Y F;  3U1N A;  2MQL A;  1VQ8 S;  3CD7 A;  2JH3 A;  3BZQ A;  4F04 B;  3SFG A;  3AD7 C;  4ATN A;  3W5X A;  2KXN B;  3QLH A;  2VIH A;  2R8J A;  2UZA A;  3GE9 A;  4X64 F;  5CXT A;  1XNQ F;  2M3D A;  5HP1 A;  2HZA A;  3CCE S;  2HQD A;  5I4M A;  1TL3 A;  1VBX A;  4F4K A;  2OLW A;  1XMO J;  2EC0 A;  2F8E X;  1S4E A;  3JXO A;  5CCM A;  5LJ3 Y;  3VR1 A;  2WOM B;  3HHL A;  2V2V A;  2DKO B;  3IAM 9;  3ISN C;  2VDI A;  2RS8 A;  1T3N A;  1U0H B;  5M2P A;  1IBL F;  4ZPC A;  4MFB B;  2QSW A;  1RHK B;  1UVL A;  2X1F A;  3BKT A;  3I4P A;  3KJV A;  1EAY C;  5F0U A;  1SC3 B;  4O3R A;  3DGP B;  1T0T V;  4ED0 A;  1X60 A;  2LQ5 A;  2VBW A;  5HVG A;  3SV4 A;  3I0S B;  1IQT A;  3IS9 B;  4BBY A;  1TUW A;  1WOO A;  1HNZ F;  3MM7 A;  3GYG A;  3JTP A;  5K5M A;  2XS5 A;  1DTT B;  3MCS A;  1N34 J;  1FRJ A;  2VA2 A;  5EDW A;  2HHP A;  1LV5 A;  3GR1 A;  2IM3 A;  3CCL S;  5HAO A;  2DNG A;  4FF4 A;  1NDP A;  1YI2 S;  4GC7 A;  1IN0 A;  3GIR A;  5D4N A;  2EC2 A;  2XZW A;  2FZK B;  4USW A;  2YWF A;  3D68 A;  4M5L A;  2R2T A;  3BH6 B;  4JI4 J;  2KKH A;  1FKP B;  4FKX A;  3I87 A;  2N3O A;  2ZZM A;  3VQS A;  1EKS A;  4K5S A;  4KGX B;  4QQB A;  3E8O A;  3MM5 A;  4HTJ A;  4J5O A;  2CAJ A;  3PR5 B;  4LRC A;  5F3T A;  2W01 A;  3NP5 A;  4C8O A;  3FGV A;  1EX8 A;  1APS A;  3TJ8 A;  2FTR A;  1UEK A;  3MWB A;  3FZB A;  3KLI A;  2KFY A;  3ZNJ 1;  1X9S A;  3KLE B;  3PRB A;  1S1W A;  2IVY A;  4C3K A;  4LFC J;  1TZ0 A;  5FLX Y;  2MPU A;  3J7A 1;  4RW9 B;  4HI1 A;  3O6Q A;  1BQN A;  1RHU B;  2AZ3 A;  1NCL A;  4ZVG A;  1URN A;  3GFZ A;  3I56 S;  3PO4 A;  4HT5 A;  1M5O C;  5IT9 U;  2W9B A;  3CJ3 A;  2MST A;  5E3A A;  2VHG A;  3NY0 A;  4GKK J;  3DHW C;  3IRX A;  2L9W A;  1TUV A;  2DEI A;  2AT1 B;  2D69 A;  4ZMM A;  2I0X A;  3DCA A;  1J2V A;  1FDB A;  3FQL A;  3QWP A;  2YQ0 A;  2KXH A;  3UO0 A;  3DRX A;  1N5V A;  3R7N B;  1RAE B;  2W7A A;  2PMZ D;  1N33 J;  2Q66 A;  5DGA A;  4OLP A;  1WSR A;  3W60 A;  3BDP A;  1CEZ A;  3OHB A;  3VHQ A;  5DDO C;  2XY5 A;  4X4P A;  3JTN A;  2ZC3 A;  2UVV A;  1KVI A;  2W24 A;  1ZOT A;  3OJS A;  1U1L A;  4Y2I A;  3OQ2 A;  4TY8 A;  1HBO A;  3P5T L;  5F41 A;  1FVQ A;  3B54 A;  2AGQ A;  4PQA A;  4I1T A;  2NS1 B;  4OV6 A;  2R7O A;  4KGZ B;  4DFP A;  4LF4 F;  3CCU S;  2C28 A;  2HS4 A;  2AIR B;  2BOP A;  3PJX A;  5M2U A;  2OPR B;  4K7Q A;  3FSY A;  1MU2 B;  1TL3 B;  3C3L A;  3CO9 A;  3UR0 A;  2M8D B;  1NU4 A;  3DXS X;  5C5J A;  5HLF B;  3AXM A;  1YZ6 A;  1S6Q B;  4XPC A;  1TKZ A;  2ZFH A;  1RJJ A;  1UW9 A;  3PHE A;  1YJV A;  3R5D A;  1SJQ A;  2R2R A;  4ZIT A;  4YN3 B;  2IDE A;  1V3R A;  4WIQ A;  1QSL A;  4ZA1 A;  3HHL C;  1F6T A;  1PC4 A;  1X0F A;  3M7V A;  2DBB A;  2J0X A;  3M2U B;  2DHA A;  3AOD A;  1RWX B;  2B5J B;  4UQG A;  1CVJ A;  4F3M A;  3MEE A;  1WI8 A;  3QO9 B;  4LSL A;  3GJR B;  1EQ0 A;  2MLY A;  4TU7 A;  4FP9 A;  4HAC A;  3CD6 S;  2P9G A;  2WON B;  3KG0 A;  4NX9 A;  4OYZ A;  4OYX A;  4CLT A;  2ASJ A;  2VFS A;  2BAN B;  4U95 A;  1DTQ B;  4NI2 A;  5E2Q A;  2R2S A;  2Z30 B;  3H59 A;  2DIU A;  1S0M A;  2MQQ A;  3NNH A;  1X5T A;  4F25 A;  2H9Z A;  4M5N A;  2H54 B;  4ZIW A;  1FES A;  4BDP A;  1RGV A;  3RB6 A;  2EWH A;  1BHN A;  4JI2 F;  4TNO A;  3TAQ A;  3WQP A;  1KFD A;  3TUJ C;  3JQK A;  3K57 A;  1SKU B;  1P1L A;  5KFI A;  2YBV A;  4LF6 J;  2DRD A;  5CAB A;  4DR1 F;  4HH0 A;  1N5Q A;  4JI1 J;  1Q7L B;  4RX6 A;  2M9K A;  3ONQ A;  2JLG A;  1S72 S;  1S7H A;  4C8N A;  4EEY A;  4ECS A;  2HHX A;  1B0T A;  5D6G A;  1PG5 B;  3KNG A;  4KO0 A;  5ETK A;  1AA1 B;  3PKY A;  1EHW A;  2QV6 A;  1UWB A;  3HVA A;  2V69 A;  1FI4 A;  3A13 A;  3KLI B;  3KTQ A;  6FDR A;  1VRQ C;  3CE8 A;  3MAA A;  3FFI A;  4YR2 A;  3TUI C;  4W90 B;  1H0H B;  2M5Y A;  2YKQ A;  2EXU A;  1JLB B;  1UJ4 A;  1TAQ A;  1F9E B;  2BE7 D;  1IJF B;  1J5O B;  2EBG A;  3QWU A;  4KHM A;  3OVB A;  4UOF A;  2AW0 A;  5J2Q A;  3LH2 S;  4LF9 J;  3DLE B;  4GO7 X;  2C2K B;  3KFW X;  5DQI A;  1FVS A;  3DMJ A;  2RQC A;  4ES3 A;  4IFY B;  2MQP A;  3DRR A;  1H38 A;  3QIP B;  2BOA A;  3GSI A;  3LP2 A;  3DRS B;  4EU0 A;  2LYV A;  2Z57 B;  3PVX A;  3CCV S;  2XI3 A;  3CDB A;  1RYS A;  1GK8 A;  4I2Q B;  1RT4 A;  4WJB A;  1T9V A;  1HBO B;  2KJV A;  1HYS B;  3D3C J;  4A8K A;  2OSQ A;  4KH1 B;  3R8Y A;  3LW5 C;  3FC9 A;  2G0J A;  1EB0 A;  4ELU A;  4J9M A;  2RE1 A;  4ZLJ A;  3MCM A;  1S5Z A;  3SQG A;  5DG7 A;  3JAM U;  4ZCL A;  1UKU A;  1SIZ A;  3ZZY A;  3SI8 A;  1H3D A;  3WIV A;  3HJV A;  5KFO A;  4X66 F;  2HVH A;  2F4V F;  3DDI A;  5FJ4 A;  5IZH A;  2E7V A;  3MEK A;  4FPI A;  1UPP A;  3BQ1 A;  2K3K A;  2KH9 A;  1U2F A;  1S1U A;  4EI2 A;  3VAG A;  1WKL A;  1UW4 A;  3P49 B;  3TVK A;  1V5I B;  3SEO A;  4IQX A;  3PW7 A;  2CYY A;  1JLF A;  4TKT A;  4R8U B;  2PN6 A;  2F3J A;  4B3R J;  2V67 A;  3GFY A;  5H9E J;  2VAS A;  4LSL B;  1TUG B;  3PIP Q;  1X4F A;  2KG0 A;  1XQI A;  1PJ6 A;  2ZUA A;  2XYH B;  4HAC B;  4KV8 A;  2ZOG A;  3Q2S C;  4RNM A;  3QRP A;  1YX2 A;  2C3P A;  2KM8 B;  3AOA A;  1Y5L B;  1HR0 F;  4J9O A;  5F8L A;  3CMA S;  1NDL A;  2I8E A;  3V2U C;  3JSY A;  2QA2 A;  1FHT A;  2CQ4 A;  1RWM B;  1T9Y A;  1SH2 A;  2UUW A;  3BF4 A;  1LOU A;  1VDH A;  1LWF A;  1X4H A;  2RF2 A;  3NGR A;  5F9N A;  3H90 A;  3PHT A;  1VS3 A;  3HK2 A;  3BO2 A;  2YNH A;  3CVK A;  2C2R A;  2VBX A;  4C3M A;  4F67 A;  5DG9 A;  4PWD A;  2JFK A;  2E7X A;  3DNC A;  5KFP A;  4M8L A;  1YRT A;  3K5O A;  4ERD A;  2W7P A;  1SPB P;  4EBC A;  2HQF A;  2FGO A;  7AT1 B;  2Y1I A;  4CZC A;  4ZPB A;  4A47 A;  2J9D E;  1ZM3 A;  3MHY A;  2BJ3 A;  4NAS A;  3BJY A;  1UWB B;  3N5B A;  2EKY A;  1KNZ A;  4EBE A;  2RRN A;  4K4U A;  1RAF B;  4UOC A;  4OYW A;  2ZNZ A;  1BC6 A;  2DHH A;  4UZB A;  4FVM A;  3KLF A;  3KMS A;  2KFN A;  1GXU A;  1HI0 P;  2RDD A;  1NXI A;  1G6B A;  1CJK B;  4ID8 A;  3GB0 A;  1O6X A;  4MH8 A;  2OEJ A;  2OPS B;  3K58 A;  3KK3 B;  1M5S A;  1NKE A;  4PWW A;  4DV2 F;  1YLX A;  2OHD A;  2B7C B;  4DR5 J;  4TVA B;  3DU6 A;  5D0G A;  4DBQ A;  1N6Q A;  3SZ2 A;  4CH1 A;  3Q8Q B;  1T9T A;  5HAN A;  3VGV A;  4DR4 F;  4NLX A;  4OQJ A;  1HD1 A;  4NCG B;  1GXL A;  5H9F J;  1K9M T;  4EYH B;  3MCO A;  1NZA A;  1Q16 B;  2IFX A;  4X4V A;  5CZV A;  2ILY A;  4RWX A;  5D78 A;  4DV0 F;  1S1V A;  1FT8 A;  1X31 C;  2J7W A;  5KG6 A;  4DV4 F;  4XDD A;  5GAE U;  1N8R T;  4RU2 A;  4O44 A;  4OZL A;  3I55 S;  2GQ2 A;  4K4X A;  4IYQ A;  2QO3 A;  2PDA A;  1SI9 A;  5KG4 A;  4A8Q A;  3TAM A;  4DMZ A;  1FDD A;  3E01 B;  2M4M A;  3RRK A;  1S7I A;  2A18 A;  2BX6 A;  4WF9 Q;  2B3T B;  2NPF A;  1XMQ F;  4LT6 A;  3MM8 A;  3NS6 A;  4OX9 F;  4UST A;  2E5H A;  4UZC A;  1EP4 A;  4LR7 A;  2F8H A;  2W2M P;  1Q78 A;  4A4J A;  3CTR A;  1YJN S;  2ACM A;  4ED6 A;  4NML A;  4B9S A;  2YH0 A;  4PG8 A;  2FVC A;  2VD3 A;  2X7I A;  1D8Z A;  1KTV A;  3GU0 A;  1M90 T;  3PFO A;  3UWT A;  3OT9 A;  1ITP A;  1P1T A;  3FK4 A;  3W63 A;  1VQ6 S;  3DOL A;  4X4N A;  2B9X A;  2RU9 A;  3PEJ A;  3HSJ A;  4ZPW R;  3O5T B;  4MKY A;  1E6V B;  4FYX B;  2HUR A;  1WEX A;  2ZDO A;  4NLR A;  2CJ9 A;  2OP5 A;  2HVE A;  4KGK A;  4GC6 A;  1B3T A;  2GML A;  2UU9 J;  1ZH5 A;  5FLX U;  2ZJR Q;  3ULH A;  5K8O A;  4B3S F;  2GMH A;  3BPD A;  2HBQ B;  2Z2M A;  1TVR B;  1XIQ A;  1VQ7 S;  1L5U A;  4KFB B;  2LEC A;  2G0C A;  5L39 A;  1GMU A;  3L7P A;  2G2Z A;  3G6X A;  5D0E A;  3MM6 A;  1AZS A;  1NJX A;  3RW7 A;  2W7O A;  3V6H A;  4M5H A;  3CT9 A;  4KHP F;  4YB6 A;  1LWX A;  5E3P A;  4PXB A;  3NCR A;  1Z4U A;  2M88 A;  4C11 A;  1FER A;  3M6X A;  4QIF A;  4UTG A;  2KFZ A;  9RUB A;  3VAM A;  2UV8 G;  1RWV B;  2XQC A;  2VPY B;  4A8W A;  3SDE B;  3G82 A;  3NGK A;  4PWD B;  1L3S A;  2JEJ A;  3IM9 A;  1HBN A;  4L6V 3;  2HHS A;  4IRK A;  3WBZ A;  2C3O A;  3PJW A;  1KQS R;  4LFA F;  5HMY A;  1HA1 A;  1Q8I A;  2NYH A;  3DLG B;  4O3N A;  3UCZ P;  4DV7 F;  4FF3 A;  4OJH A;  5HBM B;  3A3P B;  3IGV A;  4MIW A;  1PKU A;  3Q8P B;  1FO1 A;  1NK6 A;  2A10 A;  2G4B A;  3BBC A;  4NLU A;  1A7G E;  2VBZ A;  1OJ4 A;  2ZKT A;  2QLJ B;  4FDF A;  3GP9 A;  4Y2A A;  1N52 B;  4KQZ A;  2R9L A;  4X62 J;  5MLC V;  5THW A;  2EI5 A;  2K7K A;  2KJW A;  3KLF B;  2DXF A;  3W2V B;  1TQL A;  5A0Y A;  2LEP A;  1JWW A;  1JQG A;  1H7X A;  1MSW D;  2YWG A;  3OXG A;  4QWE A;  1GTH A;  1VLO A;  1B7F A;  1YKW A;  1G2E A;  3H7H B;  4EFA C;  3M8Y A;  4DR6 F;  4M5G A;  4WTY A;  4DUY F;  3CXC R;  3OD2 A;  1N5T A;  4HHJ A;  5KFX A;  5KFD A;  2UXD J;  4UOH A;  2KG1 A;  2AEF A;  3KWM A;  5I3Q A;  2F9D A;  5GME A;  2DR7 A;  4M5M A;  4X4T A;  2C2O B;  3A1Y G;  3ET6 B;  1GMW D;  3IG1 A;  3NMR A;  4LMZ A;  2HVI A;  1TR0 A;  2B6A A;  3B6B A;  1TK5 A;  2V8G A;  1XTZ A;  4AXI A;  3BEG B;  2H4W B;  1LFW A;  4LRD A;  4F2R A;  4H4O A;  1VC5 A;  3Q0A A;  5GAE I;  1YVF A;  5IQ6 A;  5B09 A;  3CED A;  4C8K A;  3CCW A;  2R7Q A;  3W66 A;  4DSE A;  3CNQ P;  5KG5 A;  1EP4 B;  1VIX A;  1C1B A;  1DQ9 A;  3BS9 A;  2J6S A;  4NLW A;  1T11 A;  3FNN A;  2KI2 A;  3QGI A;  3NBP B;  1SUQ A;  3M2R B;  5KFS A;  2IVF B;  1VC0 A;  3QRR A;  2HAI A;  3UDL A;  3NGT A;  5CD4 H;  4KGM A;  5KT2 A;  5A6P A;  2CPF A;  1RWW B;  4DR7 J;  1RT6 B;  3DOL B;  1IBK F;  2VC0 A;  4CYU B;  1P6T A;  1BY9 A;  1LW2 A;  2B56 A;  4ZCM A;  4JI7 J;  5EX3 A;  2DNN A;  1TL1 A;  2GVZ A;  4DF8 A;  2D3O R;  1OYE A;  1YIJ S;  2VKZ G;  2E5L J;  1RTI A;  3EE3 A;  3QYY A;  1S0V A;  1T95 A;  2JNJ A;  5KG2 A;  4DX6 A;  3HKZ D;  4DL2 A;  2A0F B;  1S57 A;  4DUT A;  3I4H X;  1LW0 A;  3OXF A;  1FA0 A;  3ZXW A;  5GAD U;  2GVD B;  3T1H J;  2VKR A;  2ZH8 A;  2R8G A;  1SH0 A;  4USH A;  1V3Z A;  2KHD A;  1LWC A;  1WF0 A;  2ZD1 A;  2LXF A;  4PYD A;  1RU2 A;  4P6Q A;  4B3T J;  4ECZ A;  3S6E A;  5IXU A;  2EKN A;  1S48 A;  1HNV A;  2BAC A;  2DXE A;  2IA6 A;  4JB8 B;  3MM9 A;  2VC1 A;  1F0X A;  2C42 A;  4X4S A;  4XDC A;  4R5P A;  3RBZ A;  3KXD A;  1TL7 A;  1ZAV A;  2HK3 A;  3PM9 A;  1FJG F;  1X5O A;  1C1C B;  2F40 A;  1FJC A;  3GG1 A;  4KC5 A;  1VQ5 S;  4FXW A;  3W7B A;  1U26 A;  3PR4 A;  2QJ3 A;  1HLW A;  1QM9 A;  3MI7 X;  1WKK A;  2YKN B;  3RW6 A;  1G7C B;  3EZ5 A;  1YJR A;  1DHM A;  4TY9 A;  4ECU A;  4DPX A;  4LF5 J;  1WOS A;  5J2N B;  2VG5 A;  2YPZ A;  4YHH J;  3E3X A;  1OSD A;  4MAK A;  3L9Z A;  1HQ2 A;  2YXL A;  3FEZ A;  1U48 A;  4FNI A;  4CNY A;  3PYF A;  3DN9 A;  4BLG A;  4RUA A;  3VGT A;  3DKD A;  1G3O A;  1J5E J;  3AOB A;  2HQ3 A;  4WFZ A;  5B08 A;  2GV1 A;  3BSN A;  4DV5 F;  3BO4 A;  5EWF A;  1BQM A;  2HWI A;  2RKI B;  1WF2 A;  3SCJ E;  1QAY A;  2MQ8 A;  1IWA A;  1DRZ A;  5K8M A;  1OQ3 A;  3PY8 A;  3CCR S;  3PKM A;  1KBR A;  2B6A B;  1RT3 A;  2PA3 A;  4L73 A;  2W9C A;  3DLL Q;  2VJV A;  3DU5 A;  5DZ6 A;  2YKO A;  3M4X A;  4L3N A;  5F8N A;  3F56 A;  4I56 A;  1IVZ A;  1ELO A;  1HNX F;  1S1X B;  2O1P A;  2RT3 A;  3DRY A;  4P7V A;  2LMI A;  4OHV A;  4ZPV R;  1C1B B;  3O1L A;  3CME S;  3Q23 A;  1IWG A;  3FDS A;  2MKI A;  3PX6 A;  4DUZ F;  2DNM A;  3HDS A;  3PW4 A;  1L3V A;  4PAA A;  3G8T A;  1XMB A;  2NUH A;  2BA9 A;  3PNI A;  2HHQ A;  1NRK A;  2DGW A;  2VG7 B;  3GR0 A;  4ZHR A;  3D1H A;  5HAT A;  4DR3 J;  1U8W A;  3I6P A;  2QZ8 A;  4N47 A;  3BQ2 A;  4NCB A;  1TFW A;  1HPZ A;  4P9S A;  1CG2 A;  1MNE A;  1S76 D;  2VU5 A;  5H9E K;  1LK5 A;  1P9Q C;  1WSV A;  3ZO7 A;  2BM0 A;  1G1X A;  2K1R A;  2HFZ A;  3AXK A;  2OSR A;  4W4M A;  3X3U A;  1B4S A;  4ZK7 M;  2FHM A;  1PAU B;  5IWA J;  2J9C A;  4QU6 A;  2BKO A;  1FK9 B;  2DT9 A;  2HFU A;  2HWT A;  2DD8 S;  3C19 A;  3HVT B;  3UNG C;  3FUY A;  2F1F A;  1X4D A;  2AZ1 A;  1LXJ A;  1NKC A;  3GZ7 A;  4MK9 A;  4LF7 J;  5F8G A;  3MPW A;  1QTM A;  4W92 B;  3GQC A;  4H4M A;  2FVS A;  1LWC B;  3QT8 A;  3MDF A;  4ZPA A;  3CC2 S;  2UXB J;  1NK0 A;  5ETQ A;  2VOP A;  3Q8R B;  3H5Y A;  2YQ3 A;  1NSQ A;  3J7Z 5;  2QA4 G;  5GAD I;  1VQ4 S;  2XLK A;  5ETL A;  4KPY A;  3LF0 A;  2JSX A;  4R5P B;  3MED B;  2CQD A;  1PC5 A;  3I32 A;  4EUV A;  2HMI B;  1CQN A;  4X4R A;  1XER A;  4A8M P;  1NH7 A;  5KFV A;  2W4P A;  3HLU A;  1UMJ A;  1X5P A;  4PZV A;  3M2V B;  4OI0 A;  2GA7 A;  2GW8 A;  4RNF A;  4DU7 A;  1M5P C;  1VJQ A;  3H98 A;  1SBR A;  1DLO B;  1NUE A;  2ZM6 F;  2W2Q P;  2R7T A;  5DDP C;  3CDE A;  3K0J A;  5KFJ A;  1Q8B A;  1W25 A;  2YNI A;  3PG9 A;  2MKJ A;  3W62 A;  1R0A B;  2AGO A;  2AP6 A;  2NPI A;  3MPD A;  3BGU A;  4OYB A;  2QGF B;  1VQK S;  3I5B A;  2HHH F;  3SSQ A;  2HFV A;  2KDO A;  3TX8 A;  1HQE A;  3R6L B;  2EFQ A;  2FLN A;  3PFE A;  2Y9H A;  5H9F K;  2QL9 B;  3CJT A;  3RB4 A;  4ZOS A;  5EUH A;  3KHH A;  2MLZ A;  5GMD A;  4DL3 A;  3PYD A;  5DET A;  3HMJ G;  3EMT A;  1ACM B;  3CCJ S;  3HF5 A;  2HIY A;  3TUP A;  1OMS A;  2CQC A;  4PAB A;  2WW8 A;  5B7W A;  2J8S A;  2NYI A;  1U02 A;  1S49 A;  2EEY A;  1RT3 B;  1F2H A;  5G0R A;  3K5P A;  3OTO J;  2ASY A;  3IMQ J;  2YWW A;  4M5I A;  4DN0 A;  1CJV B;  1XR6 A;  1FRL A;  2JZ5 A;  4I2P A;  4IG0 A;  4HDG A;  2ZH6 A;  1JNZ B;  2QLW A;  4QU7 A;  3KUH A;  3UVJ B;  4ENO A;  2DK2 A;  2BE2 B;  5CZX A;  2K06 A;  2CG4 A;  4DV0 J;  1XMO F;  2DVI A;  3MMA A;  2X1A A;  3BGO P;  4WK3 A;  2F8M A;  5KT7 A;  3AH6 A;  1RCO B;  1XBW A;  3N79 A;  2E1M C;  3R7B B;  3EM1 A;  2GGP B;  1WHW A;  4MIB A;  1QTN B;  1ZM2 A;  3KUG A;  2LDY A;  3TR5 A;  4ZHR B;  5I42 B;  4ZP9 A;  2YKM B;  1RTH B;  4M1K A;  3IR6 B;  2Y8W A;  2VFU A;  2GIF A;  2ROP A;  4B3O A;  2XYP B;  1HWI A;  3OTD A;  4GVL A;  3AJ1 A;  3QT6 A;  3M30 A;  1FNX H;  2FJX A;  1HNI A;  5IM0 A;  5KFF A;  3G87 A;  2YWK A;  3B8H A;  4USM A;  3GG0 A;  3OXL A;  3R5C A;  1F60 B;  4E98 A;  3WX4 A;  2BJ7 A;  2M52 A;  1EET B;  2Z4P A;  4URQ U;  4X84 A;  1S1T A;  1N34 F;  3LAM A;  4Q44 A;  4GKJ F;  3Q8U A;  5D4O A;  5A8W B;  4LSZ B;  1U25 A;  4CNZ A;  3KK1 A;  2VFV A;  3NEK A;  2ZOM A;  1KRP A;  3CMQ A;  3QGG A;  2CQP A;  2QA4 S;  3DOK A;  1IKX B;  3UPF A;  1Q5V A;  4Y3C A;  1GMV A;  3GTY X;  2FLO A;  4JI4 F;  3EXC X;  1NSA A;  4NWB A;  2YH1 A;  5D4L A;  1RT2 B;  1JLG B;  2VPX B;  3VZI A;  1MRO B;  1UVJ A;  4Y2C A;  4ED4 A;  4PG5 A;  3DGV A;  4B3S J;  4J90 A;  4JI5 J;  1TU0 B;  2HAF A;  4HHH A;  3MEG B;  1VGY A;  2I9S A;  1FTR A;  2VZ9 A;  4ILR A;  1NK4 A;  1Z1Z A;  3H5U A;  1VBK A;  2ROE A;  4QR2 A;  2AYE A;  1FCA A;  3D1Q A;  4ANE A;  4OV1 A;  1YJW S;  4HYK A;  1VRU A;  2L48 A;  2WSC C;  1UPM B;  4BWM A;  3PIO Q;  3TAN A;  4ZVE A;  2A2D A;  4LFC F;  4DX8 H;  3KKF A;  4ZPT R;  2AYM A;  3HVR A;  2XMU A;  2JFD A;  5KFN A;  3T6B A;  4WKR A;  2CG8 A;  1TL4 A;  3FCV A;  3FZ2 A;  5C42 A;  1RBA A;  4F0H A;  4GKK F;  2D9P A;  4ZVS B;  4LFA J;  2AD9 A;  4FZV A;  1FRH A;  3TUZ C;  3G4S S;  4F4A A;  4DOZ A;  2HSE B;  1UP1 A;  4H4K A;  5KOX A;  3DI6 B;  4EWT A;  5L9N A;  4YUD A;  4J9Q A;  4WP9 A;  1N33 F;  1ICE B;  1OY8 A;  2VL1 A;  4KBI A;  4OYI A;  1VBY A;  4DL7 A;  4A8Y A;  4CIO A;  5J2P B;  3UQS A;  3OL9 A;  3FMW A;  2HGL A;  1EAR A;  2VOO A;  2OD6 A;  5K20 B;  2WVB A;  1K73 T;  4LBH A;  4TN2 A;  2COL A;  3IO1 A;  4OZ5 A;  2DGS A;  4K4Z A;  2BYC A;  3D7S B;  2PC6 A;  4OI4 A;  4FYD A;  1RP5 A;  2IPO B;  3J7Z T;  2DR9 A;  2IC3 B;  4HR2 A;  4IG0 B;  4ZN1 A;  7FD1 A;  1N4L A;  1JXE A;  4TQS A;  1ZYQ A;  4MK7 A;  4A8S A;  4ELT A;  2JVR A;  4KKO B;  1UAW A;  3TNV A;  5LOQ A;  3Q89 A;  1HHS A;  3OFH A;  4PYA A;  4Q2L A;  1E6Y B;  3M6V A;  1T3O A;  4Z7C A;  4DL0 C;  1LKZ A;  3V5R A;  4ZP7 A;  4TLQ A;  4AQY F;  4C97 A;  4LF8 F;  4J91 A;  1RWK B;  3M8P A;  5C25 B;  3D54 A;  4YDD B;  3QID A;  2K8G A;  1QDU B;  5HO4 A;  2M0G B;  2M7S A;  2ZH5 A;  2QL7 B;  3TZX A;  4TXS A;  1RI7 A;  1RTZ A;  2MQN A;  1Y3J A;  2WBM A;  3D66 A;  2C22 A;  1JXV A;  3QBC A;  3ILL A;  4DG1 A;  4C0H A;  2CPI A;  1AYE A;  4DHV A;  3NCP A;  4ILL A;  3QJL A;  4U67 Q;  5KFW A;  3BR9 A;  2VQF J;  1TK0 A;  1R89 A;  4A48 A;  2Y0B B;  4I69 A;  4G1Q A;  2J6T A;  5EHH A;  2O66 A;  1R6Y A;  3KHL A;  2DNH A;  1HD0 A;  2KXF A;  4OYM A;  4F0M A;  1GTE A;  5B0A A;  2KVQ E;  3C14 A;  3KK1 B;  1HI1 A;  2WAQ D;  1IBK J;  3OR1 A;  1VCT A;  1JLA A;  2ASL A;  2FY8 A;  2RQM A;  2I2Y A;  4DQP A;  2DNY A;  2RH3 A;  2AGP A;  3IWN C;  3D6T B;  2XMA A;  4FS2 A;  1QSY A;  4PEO A;  2JEG A;  4IG3 A;  2DNZ A;  2EK1 A;  3O3L A;  3ENA A;  1XEZ A;  5LSL A;  2NZC A;  5C24 A;  3TEG A;  1HMV A;  3K17 A;  4LF6 F;  2NR0 A;  1VRT A;  1N5Y A;  4ETX A;  3U7J A;  3ZTP A;  4JI1 F;  3BBF A;  4OI1 A;  4DS4 A;  3CWJ A;  1SV5 B;  4XIU A;  2GFF A;  4OIX A;  4WFB Q;  5ETP A;  4BCA A;  1U6Z A;  2DO4 A;  4CTA A;  3CJ5 A;  3G71 S;  2UUC J;  2IA0 A;  5JXS A;  2XSJ A;  2KB2 A;  5J2M B;  4IFV B;  3NOG A;  4O4G A;  1IKW A;  3RAM A;  2LA4 A;  3D67 A;  2UXC F;  1LQ9 A;  3K8V A;  4HVZ A;  4OHW A;  3CO0 P;  1CS4 B;  1S97 A;  1VQY A;  1ZA1 B;  2CXE A;  4CO1 A;  2HNY A;  2EG2 A;  3R7S B;  4CI0 B;  1HQU A;  4MIA A;  5BXI A;  1KWM A;  2XSF A;  3T9N A;  4IRD A;  2EFP A;  2V4J B;  4Z7Y A;  3CC4 S;  3E51 A;  3MFI A;  4RLE A;  3GJS B;  4LF9 F;  3CGI A;  1AUD A;  5HRO A;  1S6O A;  8AT1 B;  3HFZ B;  3SXL A;  2GHW A;  4NRU A;  4RW6 B;  2CJB A;  1HNW J;  1RWO B;  1YJ9 S;  4HEA 9;  2OAU A;  3G6V A;  3LWM A;  2PFF B;  1T03 A;  5HQ8 A;  1UVK A;  1H2T Z;  3KOA A;  2LDI A;  3LP1 B;  2FGC A;  2JEF A;  2ALY B;  5SZT A;  3QZ8 A;  1VQL S;  5HJY A;  4RR5 A;  5JJB A;  4QIG A;  2B4U A;  3D5M A;  1WWH A;  3U27 A;  2QEX S;  3W5Z A;  1Y9O A;  1ZM9 A;  4F36 A;  3HX9 A;  3I96 A;  3CJS A;  2X1B A;  3ZTQ A;  3A3N B;  3IBC B;  2F65 A;  4JI8 J;  5AE3 A;  3RGI A;  4IDK B;  4S0M A;  2JRS A;  2J0W A;  3IM8 A;  3EGZ A;  1RWP B;  4M5J A;  2GJF A;  4M5K A;  3FMB A;  1MN9 A;  1O8B A;  2XHC A;  4JV2 A;  4JI0 J;  2DNP A;  2YNG B;  2V5H G;  1UZH A;  4LF2 A;  1EZZ B;  1SIW B;  1WG1 A;  4A8F A;  2MHN A;  3US5 A;  3MXH P;  2JX2 A;  1U49 A;  1Q5Y A;  2QYG A;  5E41 A;  1FE4 A;  4IR1 A;  4U9R A;  3PYE A;  4EGL A;  3LAN A;  4B3R F;  4LRA A;  3TA2 A;  2FVQ A;  3C15 B;  3OJU A;  1TEL A;  2DRB A;  3SCI E;  3T41 A;  2CPE A;  4R0E A;  2WOM A;  5E5N A;  2IIH A;  4TYB A;  1KC8 T;  2AJ1 A;  1RBO B;  2HRY A;  2XC9 A;  4ANC A;  2CNL B;  2MKK A;  1NEE A;  1U0H A;  4LIW A;  5JUM A;  4MFB A;  3H8Y A;  3C14 B;  1VLY A;  2V34 A;  5KFG A;  1I5O B;  1YSJ A;  2PGC A;  3KNA A;  2BQU A;  1WC4 A;  2GC8 A;  4DEZ A;  4MJK A;  2YKA A;  4Y28 C;  1OY9 A;  2PMW A;  3DGP A;  2B4O A;  2Y8Y A;  2IM1 A;  2BR0 A;  2OEL A;  2FHK A;  4M5D B;  3KLG A;  1FNO A;  3IS9 A;  2CZ9 A;  4NLP A;  4ZJO A;  1V9O A;  1KHW A;  2HWH A;  1CC8 A;  1DTT A;  2HS0 A;  1M0S A;  4NLV A;  1HMV B;  1RAJ A;  4L76 A;  2ZH4 A;  3NXZ A;  3I31 A;  3S01 A;  1UJ6 A;  3UDV A;  1KS2 A;  1CJT B;  2U1A A;  3RB3 A;  2VF3 A;  3K5N A;  2IY5 B;  1UFW A;  2NSB A;  1T9X A;  3B4M A;  2XSJ B;  1FKP A;  2ZJQ Q;  1QAX A;  5IT0 A;  2LQB A;  1W2B R;  3GYX B;  2POK A;  1RLD A;  4O4G B;  3ENQ A;  4IO9 Q;  4F02 A;  1CLF A;  2DIT A;  1RTJ B;  2QTW A;  3HVW A;  1TTH B;  2RDJ A;  4DQQ A;  4N5S A;  1DBD A;  4DSJ A;  2YQ1 A;  4YB5 A;  3QFH A;  1H6K X;  1WHX A;  4ZVU B;  4WWS A;  4DR5 F;  3KJN B;  1TKX B;  5KFZ A;  4K0K J;  1N36 F;  3UW1 A;  4V1A k;  3DRP B;  3KLE A;  2XY6 A;  1V5V A;  1YJ7 A;  3DM2 B;  3MD3 A;  2YNF B;  4CDI A;  4F4W A;  1QVF R;  4DLE A;  1KDN A;  5L1I A;  2JC0 A;  4RW9 A;  4QW9 A;  1GEH A;  3H25 A;  4RL1 A;  2IBO A;  4DR2 J;  2I5J B;  2V8D A;  3W1Y C;  2E9T A;  4OYA A;  4C98 A;  2BW7 A;  2RRB A;  1HFE L;  3RRG A;  2EFO A;  1U2C A;  2QFJ A;  2MY8 A;  4QPT A;  2V68 A;  2XTJ P;  2C2M B;  4RWW A;  5EGY A;  1T9U A;  1RSC A;  4OZJ A;  1ZET A;  3H5X A;  3HUL A;  3W2W B;  2BKP A;  4QW8 A;  4USV A;  4JV5 J;  5BYS A;  3K8W A;  4RKU C;  3H42 A;  2W8K A;  2C3U A;  1TV6 B;  2HHW A;  3CJR A;  4YQW A;  2Q79 A;  3W9J A;  4LRF A;  4QIV A;  3K2Y A;  2ZBP A;  2JLF A;  1XN9 A;  3N4W A;  4B17 A;  4CCH A;  2EVZ A;  3MR7 A;  1XC9 A;  2YX7 A;  1OPZ A;  3JSM B;  2ZHO A;  3DDN A;  2LCW A;  2NXC A;  2OPR A;  1MU2 A;  1Z2Z A;  2MDA A;  4WTO B;  1TKT B;  5LMU J;  2AF6 A;  4OMF G;  3NS5 A;  1GMW A;  2UU9 F;  5HLF A;  1S6Q A;  5DDQ C;  2MB0 B;  1JLQ B;  1FRI A;  1QSS A;  3WIU A;  2CQ3 A;  2OEM A;  4C7Q A;  3IP0 A;  5CA5 A;  4YR3 A;  2DGT A;  4AL7 A;  3PW0 A;  3CF5 Q;  2W2N P;  2OPQ B;  5F8I A;  4J9K A;  3M2U A;  4IO1 A;  2B5J A;  2YWE A;  3I0R A;  3AJD A;  3QO9 A;  4C3L A;  4QIE A;  4HH1 A;  3HPO A;  2L9D A;  4ITS A;  5I3P A;  1LXN A;  3CCQ S;  1X4G A;  4O0N A;  3H40 A;  4CLY A;  1D9D A;  3KLG B;  2WON A;  3GCX P;  1AFI A;  1UEU A;  2MZ1 A;  2NUU G;  1BMQ B;  1S6P B;  5B0D A;  5MAO A;  4GKJ J;  3QAT A;  3M9M B;  3EVO A;  2KTQ A;  2BAN A;  4J9V A;  3RBD A;  4X65 J;  1DTQ A;  4KPC A;  1SJ1 A;  2RAQ A;  2QMX A;  1RHR B;  3HZG A;  4ZLP A;  2DY9 A;  3Q83 A;  2A3J A;  4WBF A;  3VGU A;  1JIH A;  1VOM A;  2V4R A;  2DEJ A;  2QL5 B;  4X62 F;  2DY1 A;  3KMQ A;  2E5I A;  2CAD A;  2XGP A;  5HN0 A;  1U1K A;  1WAC A;  2AJ4 A;  1NAQ A;  4J37 A;  2MTL A;  4ICL B;  2RB7 A;  1KLM B;  2ROG A;  6AT1 B;  1HHT P;  4ETZ A;  1DQA A;  3G2X A;  1HWK A;  2OI2 A;  1OPI A;  1LK7 A;  1FRX A;  1W7W A;  2UXD F;  4V19 J;  1KD1 T;  2EG1 A;  3T19 A;  2FPH X;  4NPO A;  4USK A;  4ECX A;  3ZZO A;  1DFD A;  1U0S A;  2MZT A;  3GCW P;  2XCA A;  5A8R B;  2HHV A;  3EVM A;  1NSK L;  1JLB A;  2P8I A;  2R3V A;  4G6V B;  1H72 C;  3OL6 A;  5F8J A;  1SKW A;  4KH0 B;  3ENV A;  4UF4 A;  3TW0 A;  4RNO A;  1J5O A;  2H5E A;  3ITH B;  2MZQ A;  1R6V A;  3DLE A;  1IBM J;  3BYR A;  5A8K B;  1ZTW A;  2XMM A;  1NPK A;  2CQ1 A;  4TYA A;  1SJ4 P;  4IFY A;  1W2I A;  2WBR A;  2DNO A;  2HPU A;  3QIP A;  3DRS A;  2HGM A;  2KZZ A;  2ZDP A;  1F9H A;  3K59 A;  4ECQ A;  2NQP A;  1TMM A;  5GAH U;  3OTB A;  3ETO A;  3JYT B;  1WJ9 A;  5ETT A;  2KU7 A;  4I2Q A;  4RO0 A;  3J81 j;  2XYG B;  3SMZ A;  4WFA Q;  3LUY A;  2R8K A;  4DF4 A;  1HYS A;  2H5I B;  5JVH Q;  3D9B A;  3M1V B;  1LFP A;  3W8P A;  4DR7 F;  3HP6 A;  2GX8 A;  4WFN Q;  4E8U A;  1JJC B;  1U1R A;  4Q43 A;  1U1Q A;  4OZ2 A;  2D3O 1;  4P52 A;  2BJ9 A;  2OH2 A;  4JI7 F;  5KFU A;  5L1L A;  1FKO B;  4J9R A;  1N56 A;  2G2O A;  4A8X A;  1YK9 A;  1N32 J;  4HDH A;  1XJW B;  3M8Q A;  3V4I A;  4I7F B;  2QYC A;  4QBU A;  3I5C A;  2A6O A;  2E5L F;  2Q43 A;  4AQY J;  1B99 A;  5F9L A;  4LF8 J;  2JEI A;  3ILO A;  2BJE A;  4CLF A;  3IA0 A;  3VGS A;  2QFI A;  4LSN A;  5L1K A;  4HL9 A;  2IJR A;  3OW2 R;  1KLN A;  4FBU A;  1A6L A;  5U47 A;  3T1H F;  4ECY A;  4RBT A;  1SJR A;  3MEC A;  4EBD A;  3BBB A;  4DZD A;  4R8U A;  4OZ1 A;  2E1P A;  4K4Y A;  3GLJ A;  4CLK A;  2AEJ A;  3I0R B;  4DX5 A;  2OTJ S;  1PO6 A;  3UD3 P;  1CBK A;  1EIY B;  2WW4 A;  2WVE A;  3L7U A;  4B3T F;  3BQ0 A;  5A2Q Y;  1QUV A;  5F8H A;  1U6F A;  4I64 A;  1CUL B;  2ZIT A;  2E5J A;  4JI6 J;  1QE1 B;  2DTJ A;  2H65 B;  4CM2 A;  1BD6 A;  5KG3 A;  1EKR A;  5B0F A;  2W25 A;  2BVZ A;  3MMC B;  2ZBR A;  2FLP A;  3R2D J;  3DLB A;  1FEH A;  5AXN A;  2Y1J A;  1S9F A;  2XWY A;  3G9C A;  3N6L A;  2WZ1 A;  3T5J A;  4LFB J;  1MWQ A;  4Q8F A;  2UP1 A;  1LEO A;  2K2P A;  2LLZ A;  5DGB A;  1MW7 A;  3GMG A;  3OVS A;  4DSL A;  4NE9 C;  1ZAW A;  4ZVP B;  4LF5 F;  4YHH F;  1I1G A;  4O4R A;  4GVB B;  4FKY A;  3ZZT A;  2EPI A;  5EWG A;  3EIC A;  2OIH A;  4Y2K A;  3M8S A;  3BGR B;  1B0P A;  2SXL A;  3C16 B;  4NXM J;  3M05 A;  4PG7 A;  2FVR A;  2D1C A;  2QN6 B;  1J5E F;  1NME B;  1SJF A;  4OYO A;  5HMX A;  1SC1 B;  3KLH B;  4IOA Q;  3DLH A;  1WHV A;  2E9Z A;  4AUK A;  4H54 A;  1EQM A;  2VUG A;  4YY3 J;  3Q24 A;  2UXC J;  4OL8 A;  1SCJ B;  4B9T A;  2QX0 A;  1CJK A;  3IBF B;  5I3U B;  1Y5I B;  2OPS A;  3KK3 A;  3OFE A;  1RWU A;  3D0G E;  1S99 A;  2V4Q A;  4ZVH A;  2UUT A;  1C0T B;  3W65 A;  3FCH A;  1R8H A;  4NCG A;  2IM2 A;  3J7Y U;  2V0N A;  3LAL A;  2U2F A;  3ZZ0 A;  3KDO A;  3GFX A;  3CDW A;  1FRM A;  2QLB B;  3HJF A;  4GRS A;  2NZ4 A;  1UFL A;  2YWH A;  4K4S A;  2DNR A;  3MPY A;  3ADA C;  5F0W A;  4DFJ A;  2CJA A;  3HZE A;  4NA1 A;  4ZLL A;  4Y34 A;  4U7U D;  3UCG A;  2IVM A;  3UFC X;  1D09 B;  1WEY A;  2V50 A;  5B0C A;  2G1D A;  3R5G A;  2H1Y A;  3HFK A;  2DO0 A;  4Q0B B;  3D2W A;  3E01 A;  4DR3 F;  4OHY A;  3QMQ A;  1HHQ A;  2V6A A;  1GT8 A;  4G1I A;  2VPZ B;  4MYT A;  1C4A A;  4MKA A;  4ZN3 A;  2JL9 A;  4WZQ A;  3DLK A;  5GAH I;  4JYA F;  1Q81 T;  1JJ4 A;  2OJ3 A;  1CJU B;  2MZJ A;  4LVN P;  2RIL A;  2Z8Q A;  4K4W A;  3CJ8 A;  3M8Q B;  3ZTS A;  3V4I B;  1YG0 A;  4NZ0 A;  1D1U A;  2BXJ A;  4CWB A;  5IWA F;  3CPW R;  4FXV A;  2MGZ A;  4LSN B;  5E3Q A;  3T5K A;  3EYZ A;  3V6J A;  3A3O B;  2C2E A;  2CVI A;  1LWE B;  3MEC B;  1HAR A;  4LF7 F;  4K50 A;  1E6V A;  2RML A;  1Y3K A;  4ZJQ A;  4AYB D;  2H51 B;  2CWX A;  1T9W A;  1ZM4 A;  2YVS A;  5L9X A;  4F26 A;  5IV3 A;  5B0E A;  3QAU A;  4HHU A;  3GV8 B;  1H74 A;  3BSA A;  2UXB F;  4YS2 A;  2V2Q A;  3CJK B;  1TVR A;  5L38 A;  4KFB A;  1QLN A;  5J1E A;  3OBI A;  3FBB A;  3OUY B;  2ZZN A;  2XO6 A;  1UA1 A;  2OFH X;  2Q6B A;  2HBR B;  4BC9 A;  2NXU A;  2ASD A;  2KM8 C;  1RT5 A;  1SQG A;  3BB5 A;  3DXB A;  1NSP A;  4LIR A;  3GIK A;  3AAW B;  1F3V A;  2Z56 B;  1IJE B;  3SDE A;  1WKJ A;  3L3C A;  4CT9 A;  2JWN A;  2NCK L;  1KKH A;  1KQK A;  2DR6 A;  4PPZ A;  4TU8 A;  4JI3 J;  3OTC A;  2Y1R I;  5HJX A;  1NJZ A;  2ZVI A;  1M1H A;  1X4B A;  5HVF A;  4I6W A;  2V8P A;  2RUG A;  4C2M A;  2GAG C;  4OYP A;  1WEL A;  4WFY A;  2VA3 A;  1GQE A;  2XNR A;  3DLG A;  5HBM A;  4ZCK A;  1XNR J;  4IOC Q;  2FD2 A;  5D0H A;  1I3O B;  4NLY A;  5GAG U;  2DCL A;  4PXC A;  4DV3 J;  1WG4 A;  2J5A A;  5LXR A;  3R1H A;  2LU1 A;  4RUH A;  5DRK A;  3HHE A;  4FYV B;  1VC6 A;  2HHU A;  2IYI A;  1VR6 A;  4C0B A;  2M2B A;  2IJF A;  1N48 A;  3W2V A;  2PD1 A;  2FZC B;  4CLU A;  2CQB A;  5HQM A;  2N7Y A;  2O3D A;  4BC7 A;  2MY7 A;  3TAR A;  4P2S A;  4I67 A;  3OTO F;  3MMJ A;  2RHS B;  4RW8 B;  2D41 A;  4OJ3 A;  1UL3 A;  1T05 B;  1RT7 B;  4DL6 A;  3Q8Y A;  2VBY A;  5CYQ B;  1N36 J;  3J81 Y;  2BJ1 A;  1N88 A;  3G96 A;  1N54 B;  3Q2T C;  3N01 A;  2P2C B;  2ZH7 A;  5D3G B;  4LBI A;  4ECR A;  1X8D A;  4IH5 A;  2XMJ A;  4FPR A;  1NDC A;  3ET6 A;  3OFF A;  1X4A A;  1IXK A;  2ATL A;  1WI6 A;  3HI9 A;  4G3I A;  8RUC A;  2LEB A;  3J7Y I;  4NRT A;  5M2R A;  1HBM B;  3RB0 A;  4YB7 A;  2X1G A;  4DL5 A;  3MCN A;  2GAH C;  2J9D A;  3DLK B;  2JDJ A;  3OR2 A;  5SUH A;  3GIJ A;  4ILM A;  3IGN A;  3POT B;  2K3I A;  4A46 A;  2H48 B;  3QSI A;  1IBC B;  3G6E S;  3A8I A;  3KJF B;  1IKY B;  3NBP A;  3M2R A;  3SV3 A;  3QAE A;  1MG7 A;  4DCJ B;  2IAJ B;  3UNY A;  1HBU B;  1S9E B;  4K4V A;  1FD8 A;  2JC1 A;  4U6P A;  2XMT A;  1RLC L;  2MGZ B;  3HT3 A;  2BQR A;  1RT6 A;  1YBU A;  3HSD A;  1U8S A;  3SCL E;  1J27 A;  4PG4 A;  4U7C A;  4CYU A;  4N41 A;  1O0P A;  5DM6 Q;  4DSF A;  4DFM A;  2PII A;  4PUO B;  2IRU A;  3EWG A;  2EFG A;  2CQ0 A;  2PT0 A;  3NS7 B;  2DGQ A;  3OHA A;  2KHC A;  1RA6 A;  1I51 B;  3RU0 A;  3CIM A;  5F3Z A;  4JI5 F;  3W64 A;  1WEZ A;  5ITH A;  1PYT A;  5LJ5 Y;  4J7C A;  3CCT A;  5J1E B;  1B70 B;  3IRW P;  5DO2 A;  3W9I A;  1AUS L;  1UCN A;  2C3M A;  4OX6 A;  1BQX A;  4YDX A;  2GVD A;  4Y6I A;  2Z2L A;  1JLE B;  1WTF A;  1RT5 B;  4EMD A;  2NXN A;  4FN5 A;  4LRB A;  1T8E A;  3BR8 A;  4AL6 A;  4LBP A;  2DXD A;  3MUM P;  2RSQ A;  3LGH A;  4OJ1 A;  4ES2 A;  2B9Y A;  3OL8 A;  3S8S A;  5GVQ A;  4DFK A;  4RBV A;  2DHX A;  3EZU A;  3HSZ A;  2HFN A;  3PDN A;  2G0I A;  4QPX A;  1S0O A;  1SC4 B;  5LMN J;  3D6M B;  1KVJ A;  1C1C A;  1XR7 A;  2F7V A;  1Y10 A;  4ZLN A;  2E66 A;  2F9J A;  3RG6 A;  4LJM A;  2KVI A;  1S9G B;  1TP7 A;  2CWK A;  2F63 A;  2YKN A;  4WXW A;  4P2X A;  4TQR A;  1OO0 B;  2HQI A;  1OSC A;  2YX4 A;  5CYJ A;  5J2N A;  4F4Z A;  4BWJ A;  5B0G A;  3LOU A;  4Y2M A;  1JJ2 R;  2HNZ B;  3UN3 A;  3VZH A;  3OLA A;  1NHU A;  5C2G A;  3SSS A;  3SFU A;  4X4Q A;  1ZBT A;  5GAG I;  1KQG B;  1WNE A;  3VV2 B;  3AJ2 A;  3H0P A;  1NO8 A;  2B43 A;  4ZIV A;  1RTD B;  1NDK A;  3BM7 A;  4KY3 A;  4F2S A;  3KK2 B;  1SL2 A;  3TVY A;  1NB2 A;  2VH7 A;  5ETN A;  3V6D B;  2RKI A;  1VMB A;  3DOM B;  4C6A A;  3TAP A;  3TA0 A;  2ZE2 B;  2RDI A;  3SQO P;  1NJY A;  3Q86 A;  3SSR A;  5A2Q U;  2HLU A;  3C6U B;  3HHK A;  2ZVS A;  1NK5 A;  2Z2Z A;  2XO7 A;  1AT1 B;  1Q53 A;  1NH8 A;  4WII A;  4JOU A;  1GXT A;  2O67 A;  3NNC A;  4X2B A;  2BJD A;  1R8B A;  4AXJ A;  2CQH A;  2HKE A;  3UCU P;  3EGV A;  2OTL S;  1S1X A;  3OR2 B;  1FFW B;  1HIY A;  1C0U B;  1YRU A;  2CQ2 A;  4ZCI A;  2VG6 B;  1REV A;  2C2N A;  2VQF F;  4XAK A;  4C8L A;  4O3S A;  2UUB J;  3RR7 A;  1QY7 A;  5KT5 A;  1RKI A;  2CDR B;  1NHK L;  2MQM A;  2I38 A;  2V2Z A;  2VG7 A;  2HYI B;  1S0N A;  2XS2 A;  4U8Y A;  3MUR P;  1KHV A;  1R8C A;  3C6T B;  3ZTR A;  2RNE A;  2XLI A;  1L3T A;  1REG X;  3W8G A;  1I6J A;  3U02 A;  1PIL A;  4E0D A;  3MFH A;  2DGX A;  4USU A;  4ZVT B;  3GON A;  1DUR A;  2OML A;  1X9W A;  2KYZ A;  3ILJ A;  5DJB A;  5KT3 A;  3OVA A;  2GMJ A;  1FK9 A;  3BN7 A;  1BWV A;  3EPG A;  3CUN A;  2E44 A;  3HVT A;  3V81 B;  1JKH A;  4NZ7 A;  2UUC F;  3MPV A;  4GO5 X;  4FVC A;  3M32 B;  2AU0 A;  1R8A A;  2ZZT A;  3UE2 A;  2VQE J;  2BRK A;  1VQN S;  4UW2 A;  2BEF A;  2VDH A;  4WU3 A;  1Z2L A;  1IR1 A;  1ZPW X;  2BW2 A;  4KB7 A;  2YPY A;  3G6Y A;  4GMK A;  3W9H A;  2VJU A;  3CJ0 A;  2GNK A;  2LXI A;  3MED A;  4F3Q A;  2HMI A;  1NJI T;  1X9M A;  5KFB A;  5KFH A;  3VAL A;  4DN9 A;  3QJJ A;  3M2V A;  1PAE X;  2ZEJ A;  3QLH B;  4ECV A;  4DS5 A;  3VVT A;  2CA9 A;  4QYR A;  2CPX A;  5HP1 B;  1F5B A;  2NXJ A;  4P2F A;  1UEV A;  2EK6 A;  1DLO A;  2MKH A;  1QAI A;  3TVZ A;  1HNW F;  1KON A;  5LL6 d;  2DNL A;  1HWL A;  1GAO A;  3K5L A;  4WXO A;  2VON A;  1JX4 A;  2DIV A;  5J1P A;  1WC1 A;  3TRG A;  1VIS A;  3HHL B;  1R0A A;  3RUB L;  3WX8 A;  4ECT A;  3OLB A;  3DFE A;  2VFT A;  3NRB A;  3QPI A;  1KOO A;  4TU9 A;  5BJR A;  4G1P A;  2G13 A;  4RW7 A;  5KT6 A;  4RJV A;  2HRT A;  2ZH2 A;  2HEK A;  4CP5 A;  5HMZ A;  2HZV A;  4B02 A;  4D3G A;  4OHX A;  3P3D A;  1QJH A;  4JI8 F;  3KJV B;  1R43 A;  4C48 A;  2QE5 A;  4EYI B;  1P9Y A;  2CQI A;  2HW3 A;  3L09 A;  2LQ9 A;  4RW4 A;  3D0I E;  1H98 A;  2YY3 A;  8ATC B;  5F8M A;  4DPY A;  4YP3 A;  3MM7 B;  4JI0 F;  1SL1 A;  1RIS A;  2GJI A;  3CC7 S;  2FJD B;  1CJV A;  2L3M A;  4DSI A;  3AA8 A;  4USI A;  5C2C A;  2XZD B;  4O3Q A;  1UTA A;  2ZHA A;  3UVJ A;  3MMB A;  2BE2 A;  2JHE A;  2GO9 A;  1TFY A;  4B3M J;  3VAH A;  1SVD A;  3D4J A;  1RE1 B;  1FWL A;  1REV B;  4J9S A;  3EDR B;  1I94 J;  4KAI A;  5IFM A;  3VAF A;  3MR3 A;  2CJY B;  3FRZ A;  4NLT A;  4JUZ A;  2GGP A;  1Q95 G;  3UR3 C;  4F0K A;  2H4Y B;  3KLV A;  3RYL A;  4Y00 A;  4OI6 A;  4NXN J;  4QR0 A;  4DZ6 A;  4P71 A;  3MM5 B;  1Y11 A;  1ULR A;  4URS A;  1IM6 A;  5I42 A;  5HQL A;  4Q45 A;  2YKM A;  1RTH A;  3FSI A;  5DQH A;  4QR1 A;  3F44 A;  2QG9 B;  4JYA J;  4KR0 B;  3M9N B;  1PSD A;  1U09 A;  1EJ7 L;  4NA2 A;  2QRR A;  2WK4 A;  5LXY A;  5CH7 B;  1PCA A;  2FB0 A;  1S1W B;  3THV A;  3AB4 B;  2YX1 A;  4O0I A;  4DL4 A;  1UVM A;  3J7A N;  4DV6 F;  1HW8 A;  1BQN B;  4MK8 A;  1EET A;  4N77 A;  1S10 A;  1D8Y A;  5ETV A;  4I6Y A;  3O2I A;  5A8W A;  2W9B B;  1OWX A;  5AE1 A;  1U1P A;  1N5S A;  3IRX B;  4WPA A;  4AT1 B;  1IKX A;  2UUA F;  4ZP8 A;  3O8W A;  3AY0 A;  2GCF A;  2VFR A;  1JKH B;  2FY1 A;  3J81 U;  3IR5 B;  1QVG R;  5BR8 J;  3MR6 A;  4BS2 A;  1YGY A;  3UDE A;  4RNN A;  1RT2 A;  1AW0 A;  1JLG A;  4KGV B;  4CLW A;  3QT7 A;  1MRO A;  4NEZ A;  2M70 A;  2HVZ A;  5HVH A;  2PSZ A;  4JP8 A;  2GQC A;  1XK8 A;  3KG4 A;  3IWL A;  4ECW A;  1U4B A;  3MEG A;  4N7T A;  4NLS A;  2D3Z A;  2CFX A;  3RZA A;  1DJ0 A;  3F73 A;  2HS3 A;  2C1E B;  2J76 E;  4YR0 A;  4I0W A;  4CT8 A;  1PJ7 A;  4TY8 B;  4K0K F;  3BH7 B;  3ZC4 A;  2XZT B;  4PKD B;  5KFE A;  3CD0 A;  1ZZF A;  1RUS A;  1FFG B;  2PE8 A;  3TO8 A;  3EGW B;  1QD1 A;  1VHI A;  4O23 A;  2HQC A;  2HK2 A;  4E2F B;  2HGN A;  4QYZ J;  2CZV C;  4DR2 F;  1NB7 A;  4DV1 J;  1TKZ B;  2W4D A;  3MUV P;  1FXD A;  4P73 A;  3KHG A;  3B4D A;  5K8P A;  1Y4Z B;  4OZ3 A;  4LVO P;  4IRC A;  5KAK A;  1RXO B;  4B9V A;  1X5S A;  4RW7 B;  1NBE B;  1JK9 B;  3EGN A;  1K8A T;  3DI6 A;  3ZTO A;  4A8O A;  4WYW A;  3R27 A;  4DQS A;  2ZNY A;  3MEE B;  4OX8 A;  4JV5 F;  5J2P A;  4FF2 A;  5ETO A;  4FS1 A;  2ATC B;  4RW4 B;  5D4P A;  4DCP B;  1Q1K A;  1RAO A;  4FYW B;  1FJE B;  1VJW A;  4F50 A;  3RAX A;  3OSN A;  1VFJ A;  3GJT B;  2XMV A;  2B4P A;  2IC3 A;  4NI2 B;  3MGJ A;  2HHT A;  1MMN A;  2FJE B;  4KKO A;  3D3B J;  3MMB B;  5T14 A;  2P6S A;  2B0G A;  3K5M A;  2AEM A;  5LSR A;  5LMU F;  1E6Y A;  2HND A;  3EPI A;  1YJU A;  4YME A;  2DGO A;  1AFJ A;  5C25 A;  1GNK A;  5KFC A;  3H20 A;  2YTC A;  2QSF A;  5GMK a;  1RHQ B;  1R0C B;  1Y0H A;  1MMD A;  3MF5 A;  2R8I A;  1FD2 A;  5AXL A;  2Y3Y A;  1RAI B;  4QWD A;  4UT4 A;  4NZ6 A;  1YHQ S;  3TI0 A;  1CQM A;  3G86 A;  4KO0 B;  3R6G B;  2IM0 A;  2LU2 A;  1WC3 A;  4Q2M A;  4CM0 A;  2CUY A;  1IQZ A;  3MAQ A;  3EXY A;  3MAA B;  1FRK A;  3FFI B;  3IAS 9;  1Q82 T;  2LKZ A;  1U7L A;  3OL7 A;  4WP3 A;  4AE5 A;  2RVJ A;  2KT5 A;  1RAG B;  5K9F A;  3TEH B;  4X65 F;  2J9E A;  4C0O C;  3A8K A;  3CIZ A;  3JSR A;  3BKU A;  2IRX A;  1UA0 A;  5J2Q B;  3QRQ A;  5CQG A;  2GIQ A;  5BYQ A;  3DMJ B;  4ZS6 A;  3LPE A;  4PRF A;  2J7U A;  1UVI A;  3DRR B;  4ID5 A;  4ZVF A;  3LP2 B;  3ISN D;  5KTQ A;  3CCM S;  3OSP A;  3WDO A;  1F2G A;  2R8H A;  3T9Z A;  2JVO A;  5A6W A;  3NWG A;  3HHN B;  3QGH A;  3NMA A;  4PG6 A;  2FDN A;  2FHJ D;  3NAI A;  5A76 A;  1RT4 B;  2XM3 A;  1FF2 A;  1SV5 A;  1KP6 A;  4NMX A;  3UDC A;  1PYS B;  2HQG A;  2MQO A;  2OMO A;  3QT5 A;  3MTK A;  4KJI A;  5J2M A;  2PEB A;  4IFV A;  1NLK L;  1SKS A;  3SQG B;  4EZ6 A;  2DH9 A;  1MN7 A;  4P10 A;  1B64 A;  4CO2 A;  1W26 A;  2KRR A;  2CVE A;  4M95 A;  3O44 A;  3RTV A;  1CS4 A;  4Y0F A;  5KFK A;  1U47 A;  3CB4 A;  1NND A;  1LNQ A;  3CSK A;  3TP2 A;  3T1Y J;  3BKF A;  4PXE A;  3PCO B;  3R9L A;  1S59 A;  3A8J A;  1S1U B;  2V4J A;  1FFS B;  4UY8 5;  2WVC A;  3HD1 A;  1IBM F;  1ZA2 B;  4Q7A A;  1A9N B;  1RKJ A;  2R7R A;  4X64 J;  1XNQ J;  1NK9 A;  2R42 A;  3SCK E;  3VWS A;  4UUX A;  1JLF B;  2E1R A;  2XCP A;  2P9C A;  1ZTT A;  2HRU A;  4RW6 A;  2JOQ A;  3WZ0 A;  1FWP A;  4DQR A;  2JLE A;  2QC3 A;  4EO6 A;  3LP1 A;  1ZAX A;  4NLO A;  2B51 A;  3PRD A;  1OIA A;  2CIM A;  4KV8 B;  2FJW A;  3DC2 A;  4TLR A;  1IUJ A;  4PQU A;  4F8R A;  4DPT A;  3FQK A;  3DYA A;  4IH7 A;  1U1O A;  1IBL J;  2E29 A;  4QWB A;  2L41 A;  1LWF B;  4ZJL A;  2RF2 B;  4CLP A;  1FEE A;  5EWE A;  2WTF A;  4K4T A;  2AX0 A;  3KDN A;  1GX6 A;  4PCQ A;  1PYO B;  2AJ0 A;  4RUB A;  3ZZZ A;  2YNH B;  4IDK A;  3TJA A;  5KG1 A;  5AE2 A;  3ILI A;  1N32 F;  2HND B;  2EBE A;  1ZPV A;  5L1J A;  3HCX A;  3NGD A;  4NCA A;  1HNZ J;  3FJ2 A;  2YNG A;  3CJQ A;  3TZZ A;  4NYZ A;  2BM1 A;  5HSP A;  3N6M A;  1Y5N B;  2V63 A;  3FCW A;  1VIO A;  2R7U A;  3DDK A;  1RYR A;  4QWC A;  2ZOF A;  1RA7 A;  3H4B A;  3AT1 B;  2DH7 A;  3HT0 A;  2N82 B;  5DM7 Q;  3C15 A;  4RUC A;  3V4M A;  1UVN A;  3IWX A;  1HW9 A;  3U1M A;  2R2U A;  4FBT A;  1QAJ A;  3M8W A;  3ZNU A;  4KHR A;  1SC6 A;  2ADB A;  4R0J A;  4JI6 F;  3BSC A;  3GV7 B;  3TZY A;  5HI7 A;  1WHY A;  2G9O A;  2PO4 A;  3G8Q A;  1NM2 A;  1DQ8 A;  1KSP A;  5LT5 A;  1N6Q B;  4FNH A;  1VHF A;  4QOT A;  1RAA B;  2DIS A;  2KT3 A;  2C3Y A;  2W2O P;  4LFB F;  2XG8 A;  2DHG A;  3GIL A;  4ELV A;  4N56 A;  3N0V A;  1A0O B;  3MPU B;  4M5D A;  3DHX A;  3LPY A;  1M5V C;  4ID5 B;  4RBU A;  1S1V B;  1S12 A;  1U1N A;  3CCS S;  4N8O A;  3K89 A;  3NL0 A;  3NWR A;  4F4X A;  4O44 B;  1CJT A;  3HHL D;  1M1G A;  4NXM F;  4ZVQ B;  3K7R A;  1WUU A;  2F5G A;  1YDL A;  1WF1 A;  5JVG Q;  2UV8 A;  1OQ6 A;  3QZ7 A;  5JMN A;  3LP0 A;  3P8B B;  3TAM B;  4IQM A;  2W1B A;  2DNK A;  3I5A A;  2GO8 A;  1KR4 A;  2LQ8 A;  5AXK A;  2CPJ A;  2DPJ A;  2WCX A;  4PXD A;  3MM8 B;  4YY3 F;  5KFY A;  1ZS6 A;  1RTJ A;  1RAB B;  3RJM B;  4HI2 A;  1VK3 A;  1JJH A;  2P9E A;  2KO1 A;  2OFG X;  2MHE A;  1FDA A;  1TKX A;  1H2U X;  5IV4 A;  1SJ3 P;  3LA0 A;  3IXQ A;  5FDL A;  5HK4 A;  4IUF A;  4P75 A;  5K14 A;  3UI3 A;  2PEH A;  3Q8V A;  3BSO A;  1BWE A;  2ZUG A;  2B4V A;  3DRP A;  4YB1 P;  4LQ3 A;  4OJG A;  3GYN A;  4LF4 J;  2Z58 B;  4F3O A;  2QLF B;  3DM2 A;  3L7O A;  3BYP A;  2YNF A;  1SKR A;  3H4D A;  1DAR A;  2LP4 A;  4J9P A;  1U2R A;  4M94 A;  1RAD B;  3HD2 A;  1FX4 A;  4H4K C;  2I5J A;  4RPF A;  2Q3P A;  4PWU A;  1IR2 A;  4KYZ A;  2AJF E;  2FYX A;  4KRW A;  4PQU B;  2OD4 A;  1FE0 A;  2LEA A;  2DRA A;  2N7C A;  4L75 A;  3ICL A;  3DYA B;  1U6B A;  2GHP A;  1X4C A;  2ZH1 A;  4F4Y A;  3MM6 B;  1AZS B;  4URG A;  3M6U A;  3HFV A;  2IRY A;  2BMB A;  1RHJ B;  2R7V A;  3D1O A;  3W2W A;  1Y00 A;  1VYA A;  3P5B P;  4C11 B;  4I68 A;  2LVW A;  5KOW A;  1VQM S;  4CLZ A;  2BE9 B;  3D6H B;  3G82 B;  1TV6 A;  1P27 B;  4K59 A;  2CPD A;  2IJN A;  2QT7 A;  3N9U C;  3HKW A;  2OUG A;  1HBN B;  2CPY A;  3CCZ A;  2AYB A;  3P45 B;  3TX0 A;  2W8L A;  1WOP A;  2MXY A;  2CNN B;  3FSX A;  3HM9 A;  3EX7 B;  5LSO A;  1CPZ A;  4ZDN A;  3JSM A;  2M8H A;  1L3U A;  3PW2 A;  1SH3 A;  3CW2 C;  1B0V A;  4EO8 A;  1HKA A;  5KFR A;  4DI6 A;  1TKT A;  4UY8 T;  4XO0 A;  2WRM A;  4JI2 J;  2X51 A;  1BLU A;  3W5Y A;  3W61 A;  1FJ7 A;  1S79 A;  2MZS A;  2JJ4 D;  5DQG A;  3QGP A;  1JLQ A;  1MML A;  4Q5V A;  5A0Y B;  3F41 A;  1URR A;  2MJU A;  4RU9 A;  1T7P A;  2GQQ A;  3NGU A;  2BAB A;  4NYO A;  1SQE A;  5G4D A;  4KE5 A;  3GV5 B;  4DR1 J;  3BPS P;  2AHO B;  2BZ2 A;  2OPQ A;  3P6Y C;  2RJZ A;  2YKP A;  4NA3 A;  1HL6 A;  1C4C A;  1Y7P A;  1K44 A;  5KT4 A;  1ROF A;  5D8H B;  2NLW A;  2MEW A;  4BHQ A;  4B9N A;  3ZZP A;  1KFS A;  4WCE Q;  3AQO A;  4L72 B;  4DV6 J;  2FC8 A;  1HI8 A;  4JI3 F;  3PV8 A;  2HZC A;  1FNM A;  1U45 A;  2XUL A;  3TYT A;  1TMJ A;  1S6P A;  2GIR A;  1NPR A;  2ZHB A;  3AOC A;  3IG1 B;  3GSD A;  3M8R A;  4ES1 A;  2VOD A;  4WU2 A;  1TAU A;  4NL5 A;  4C8Y A;  2XLJ A;  4O3O A;  2QLX A;  3IC1 A;  1XNR F;  2MSS A;  4OHZ A;  2R7X A;  2UUA J;  3LP0 B;  3AQP A;  2CJK A;  1K1Q A;  2GHV C;  2RQK A;  4DV3 F;  4H4O B;  4ED1 A;  3JSB A;  2ADC A;  1RDR A;  3LWL A;  4MKB A;  3M8Z A;  1FTC A;  3SIP B;  4DQI A;  2FJV A;  2K7J A;  5DLF A;  3JTO A;  2I6W A;  4QYZ K;  1T94 A;  4ICL A;  1KLM A;  1SUQ B;  4WZM A;  5L8R C;  2EW9 A;  4UOG A;  3GII A;  3KG1 A;  2LA6 A;  2CPH A;  4ED3 A;  2FIU A;  1C2P A;  3TQE A;  5FDL B;  3LO3 A;  5K14 B;  4LR8 A;  4IKA A;  4P7T A;  2MKC A;  4FYY B;  2V94 A;  4G65 A;  5D0R A;  1LW2 B;  3IN5 A;  4Z2X A;  3THT A;  1CC7 A;  4ED7 A;  3QJP A;  4XPE A;  2N4C A;  1TL1 B;  4R25 A;  5A8R A;  2GVZ B;  2ERR A;  3ELH A;  4MT1 A;  1MLA A;  3NOC A;  1K1S A;  4X66 J;  4ZKA A;  2F4V J;  2IDL A;  4NLD A;  1RTI B;  2ZWP A;  2BDP A;  1VQ9 S;  2QA1 A;  2DPI A;  2FJA B;  4UQT A;  2DYA A;  3PTW A;  3BV8 A;  4FF1 A;  3ITH A;  5EX0 A;  3OV7 A;  4N8N A;  2QMW A;  4CLS A;  1F5C A;  4DPU A;  5A8K A;  1LW0 B;  2UVR A;  2E7W A;  4NLG A;  1FXL A;  2DJW A;  2E5G A;  1YBT A;  4B9U A;  1SQF A;  3W3S A;  2ZD1 B;  1X7V A;  3MZI A;  3PYG A;  2Q1L A;  3JYT A;  5AJ3 F;  1H7W A;  3KJQ B;  3R5B A;  1N0U A;  3ENW A;  4B08 A;  4ZVO B;  1HNV B;  4Y65 A;  2P6T A;  3MM9 B;  1HR0 J;  3R97 A;  3M1V A;  1O5J A;  2RIJ A;  2OKQ A;  2AMC B;  5CD4 A;  4NOH A;  3C46 A;  1TL7 B;  2E1C A;  5IT4 A;  1WOR A;  1NK8 A;  4KSE B;  3J80 Y;  4ZVR B;  1FKO A;  1YRX A;  2APO A;  3F0N A;  2FZG B;  3T5L A;  1GH8 A;  4I7F A;  3RBE A;  2XMK A;  2LFV A;  2CQG A;  5CCL A;  5E3C A;  3FRY A;  2VG5 B;  2FUG 9;  2MYF A;  1Q0N A;  1JXL A;  1QUP A;  4K2X A;  2O5D A;  4V19 X;  3HXM A;  3IR7 B;  1Q7Y T;  1BQM B;  2D3U A;  1P8G A;  1JB0 C;  2O01 C;  2V2K A;  2J0Q D;  1ZZN A;  1CUL A;  1QE1 A;  2X3G A;  2NRE A;  1VQP S;  5FII A;  4WFX A;  2CNK B;  5LMN F;  2ZH3 A;  4LRE A;  4DV2 J;  3MD1 A;  2W9C B;  4DU8 A;  2WB4 A;  3BN4 A;  3MMC A;  2HG4 A;  2GZO A;  1BGX T;  2G1H A;  2KZM A;  4HTI A;  4LUB A;  4OI3 A;  2B8P A;  3Q22 A;  4DR4 J;  2FLL A;  5T7L A;  2AWZ A;  2J7K A;  4HKQ A;  2BRL A;  1YQH A;  2C2D A;  2FVP A;  1JLC A;  2BQ3 A;  1Q8L A;  5CHC B;  2BUN A;  2E9R X;  4DV4 J;  4GVB A;  4FXD A;  5RUB A;  2KYX A;  4CQ1 A;  3BGR A;  3SYZ A;  3M6W A;  3HHD A;  5IC4 B;  3T6J A;  3FVY A;  4LF1 A;  3SBM A;  1DZ5 A;  2ABY A;  3C16 A;  1R8P A;  2N3L A;  2FJB B;  2AKW B;  2IYG A;  3PX0 A;  1RHM B;  5K8N A;  2Q6C A;  2AV5 A;  3FBF A;  2ACY A;  1VQS A;  3KLH A;  2HLT A;  2MJN A;  1K47 A;  4DXL A;  5CAA A;  3VAJ A;  1H73 A;  5ETS A;  4AND A;  4Q8E A;  1M1K T;  1HPZ B;  2VPW B;  1XMQ J;  3AHP A;  4OX9 J;  4DX7 A;  3ZFV A;  2VV5 A;  3NG8 A;  5LM7 E;  1UET A;  2QMU B;  5I3U A;  3PZP A;  2K1R B;  1JMT A;  3TJ9 A;  4O3P A;  3E2E A;  1PBU A;  4PPD A;  3RRH A;  3VF0 B;  1C0T A;  3KYL A;  1PBA A;  3ZZU A;  4QIW D;  2PFD A;  2OPP A;  3BGF A;  1DAX A;  3TWZ A;  2IMW P;  3TOQ A;  2F4F A;  3NCQ A;  3VAI A;  5E0O A;  4YFU A;  2ZWO A;  2E1A A;  4J9N A;  4H4M B;  2NXE A;  2J0S D;  3UN2 A;  1L3K A;  2AJ2 A;  1KTQ A;  1S4F A;  2V9K A;  2WVD A;  1CSJ A;  2UUB F;  3R3T A;  2OEK A;  2A2C A;  3R5A A;  3GFH A;  3GJQ B;  1S77 D;  3P4U B;  4U8V A;  1NHV A;  5IQQ A;  2ZKU A;  2DNQ A;  4Q0B A;  4USJ C;  3FEX B;  2IBK A;  2B9W A;  4NYP A;  2AX1 A;  5KFL A;  4KHP J;  3AA9 A;  4J9U E;  2RUS A;  4RZR A;  4L74 A;  1CJU A;  2L08 A;  2W9A A;  3PAC A;  4CH0 S;  3D28 A;  2P5V A;  3C2P A;  1VBZ A;  1M5K C;  5D15 A;  3MR5 A; 
#chains in the Genus database with same CATH homology
 3QRP A;  4QYZ K;  5H9F K;  3QRR A;  2Y8W A;  4U7U D;  5H9E K;  3QRQ A;  1WJ9 A;  4DZD A;  5CD4 A;  2Y8Y A;  2Y9H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...