3QRRA

Structure of thermus thermophilus cse3 bound to an rna representing a product complex
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
213
structure length
204
Chain Sequence
FQMWLTKLVLNPASRAARRDLANPYEMHRTLSKAVSRALEEGRERLLWRLEPARGLEPPVVLVQTLTEPDWSVLDEGYAQVFPPKPFHPALKPGQRLRFRLRANPAKRLAATGKRVALKTPAEKVAWLERRLEEGGFRLLEGERGPWVQILQDTFLEVRRLLQVQAVLFEGRLEVVDPERALATLRRGVGPGKALGLGLLSVAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein TTHB192
publication title Recognition and maturation of effector RNAs in a CRISPR interference pathway.
pubmed doi rcsb
source organism Thermus thermophilus hb8
molecule tags Rna binding protein/rna
total genus 48
structure length 204
sequence length 213
ec nomenclature
pdb deposition date 2011-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08798 CRISPR_assoc CRISPR associated protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1200 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Crispr-associated protein; domain 1 3qrrA01
3.30.70.1210 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Crispr-associated protein; domain 2 3qrrA02
2Y8WA 4U7UD 1WJ9A 5CD4A 3QRPA 4QYZK 2Y9HA 5H9FK 3QRQA 5H9EK 3QRRA 2Y8YA 4DZDA
chains in the Genus database with same CATH superfamily
4W90B 2ZHAA 4HH1A 2IC3A 2G0CA 2KRRA 3LP0B 4DSEA 1YDLA 2D3OR 4Y0FA 2RRBA 3V2UC 4PQUB 4O4GB 5D4OA 2Q6BA 5KFEA 1KBRA 1UKUA 3IWNC 1JB0C 1PAUB 1H98A 1JLAA 3AAWB 3V6JA 3CE8A 3P49B 4N7TA 1NRKA 2RDJA 2DKOB 1Q7LB 5IXUA 5LJ3Y 2WW8A 5DG7A 3I5CA 2XB2D 4A46A 3CCUS 3T5KA 3MM9B 4AL6A 2NZ4A 3D66A 3IWLA 4Q7AA 1TFWA 3H2LA 1DTTA 5HVGA 3QRPA 2LKZA 1U4BA 1OMSA 4KV8A 5F8GA 3IA0A 2BACA 2PEHA 2XSJB 3KHLA 4OI1A 4M5NA 2AYMA 5DRKA 2HAIA 6FDRA 3WX4A 3NOGA 4P7VA 2B9WA 4F25A 2GQ2A 5DZ6A 1GXLA 1UEVA 4J90A 3EPIA 2PT0A 3DKDA 3KJVB 4O44B 4KGZB 1N5TA 2Z2MA 4P71A 3W5ZA 5GMEA 5KFJA 1B99A 3R5JB 2VJVA 3OPKA 1JLEB 1FK9A 4F36A 3NGSA 4J91A 3TWZA 4ZVPB 5A2QY 4QOTA 4Y2AA 5B7WA 3R27A 1TAUA 3I6PA 1IKVA 3MI7X 5C5JA 2DNZA 3W66A 1F3FA 4DLGA 2HVHA 1Y9OA 4DR4J 2KYXA 1RTHB 4FPIA 1NH7A 4TNOA 1RKJA 4B17A 4ZVTB 4FBTA 2JH3A 3BO3A 1D1UA 2JVRA 4NZ6A 3KHGA 5AJ3J 3QSYB 1XNQJ 4PG4A 5A8WB 5HQLA 2FVSA 1TL5A 3DOKB 3DGPA 1GX5A 4CO5A 3HO1A 4NL5A 2QT7A 3ZC4A 4DCJB 4O4RA 2DGXA 3RZAA 2JL9A 2UUAF 4WFYA 1XNRF 5T7LB 2H54B 3D1QA 2YWGA 3SXLA 1HBUB 4JP8A 2LA4A 2MQQA 2MQMA 2HFVA 3NCQA 1YK9A 3CWJA 4NLUA 2IYGA 5D6GA 5GAEU 1WEZA 5J1PA 4RNNA 1NJXA 1HQEB 3PG9A 5AXMA 1D09B 1WC0A 3GIJA 2MKCA 1FVSA 2WBMA 4OZ3A 4U67Q 2HYIB 3NGKA 2VC0A 4MK9A 4BBYA 3PIOQ 3FSYA 3F56A 1RTJB 4WU3A 2LDIA 2GIQA 4NLVA 1H6KX 5CA5A 2QSWA 2FJWA 2M88A 4DOZA 1U0HB 1DQ8A 5L9NA 3Q8UA 2VDIA 1KQSR 2HS3A 2BEFA 4DV1F 3CJ2A 2DNKA 1FXLA 3HULA 2HSEB 1XMQF 3NG8A 4ES1A 4B3RF 3HVWA 1TVRB 5LMNF 3ET6B 1U1PA 2BX6A 1A0OB 2IMOA 3OUYB 2NSCA 3C6TA 4O23A 4RU9A 1YQHA 2DD8S 2HQGA 1S0MA 1WSVA 3OL7A 3MURP 5L39A 1Y11A 5HROB 3MD3A 4N5SA 1CJUA 2BRKA 2M9KA 1L3UA 2KO1A 3S1TA 4C9DA 3EX7B 3KLFA 2H48B 1LQ9A 1FX4A 3DI6A 1SL1A 2MZTA 3IRXA 2B8QA 1MU2A 3TQ1A 3P3DA 2DO0A 3CPWR 2NPIA 2PDAA 2OD6A 4RLEA 4BLGA 2R8KA 1FD2A 2CPJA 5A0YB 1VQYA 1M1KT 2IBOA 1QVFR 3KDNA 3HF5A 2W7OA 4CLUA 3TVZA 1ELOA 2XZWA 1R31A 3OTOF 2HFSA 1IVZA 4OI2A 3HDSA 2K1RA 3OL9A 2VHGA 1UTAA 1D9FA 3CF5Q 3KUHA 2OPSA 1RZMA 2XZDB 4BS2A 2J76E 2RAQA 2C3UA 2C2ZB 4WF9Q 3CIMA 3M8PA 1SL0A 3RRHA 3AA8A 3PW2A 1X5OA 3OQ2A 4NYPA 4ES3A 3Q22A 5FDLB 4IH6A 3I82A 1T02A 1FERA 4DPXA 4N41A 3JAMY 2HNZB 3VTIA 3ZTOA 4ZPVR 1NHUA 5HP1B 2EBGA 2V2VA 3FKBA 2CPEA 5KT4A 2DGVA 3IGVA 5J2PB 1FVQA 4H4KC 1NSAA 5J2MB 1SPBP 1BQXA 3OBIA 3GP9A 2AEJA 3IBFB 2GNKA 5H1SV 3NKYA 2B9EA 4ED0A 4ZS6A 4LSLA 3H98A 3TW0A 3JYTA 4RWXA 5HBMA 1WC4A 3L09A 3HT3A 2OLWA 1RKIA 3RJMB 5RUBA 2NXNA 3V6DB 1AYEA 3MM8A 4NCGA 2XZTB 4U7CA 2CPYA 1VQOS 3AH6A 4BCAA 3MM5B 2FLLA 3W65A 4PQAA 1VI7A 3GR1A 1IWGA 3HHLA 4F7VA 2KG0A 4DR2F 1N33F 3PY8A 4LF4F 2M8HA 2KI2A 2WOMA 3W9IA 4Y2CA 4WIQA 1U6FA 2WBRA 1PYTA 1RSCA 4DS5A 1L3TA 2VG6A 4PZVA 1RT6B 2HG4A 3M8QA 2FIUA 4LSNA 3DLEA 1OYDA 4MKVA 3KJNB 4MMOA 1T95A 5I4MA 1S79A 3JSBA 2UU9F 5JXSA 3ZO7A 3IAM9 3MMCA 4FYYB 4NXNJ 3FZ2A 4AFFA 1XR6A 1L5UA 4JI4J 4ED8A 2AGQA 2XYPB 4Q8EA 2JEJA 3K5PA 4I2PA 1QSYA 4H4OA 1NEEA 1VISA 2V8HA 3MMBA 3ISND 4GRSA 1BQNA 1OQ3A 3G71S 4LQ9A 3QT5A 4HR2A 2C42A 3M8ZA 4JOUA 4PYDA 2YWWA 4F3MA 1NHKL 2JDJA 3NL0A 2OEMA 1QDUB 3HKWA 2FJEB 2HPUA 1Y5LB 5I3QA 1KNZA 1YKWA 3B82A 2NS1B 5JVHQ 3BQ0A 1XR5A 4OZ0A 3HHLC 1SQGA 1TMMA 2B51A 3C2PA 2RUSA 2C2OB 3JSRA 4ZVUB 3HLUA 5M2UA 3AHPA 4WFZA 4NZ0A 4YN3B 4I68A 4QR1A 5CYJA 1LWFB 4NLTA 3TEGA 2DNYA 2HMIA 3SV4A 4OI6A 3E8OA 2C2RA 4KV8B 2R42A 1X4EA 2F8MA 2RT3A 3BKUA 5L1KA 4ECVA 1YJRA 3FQKA 3R7NB 4USTA 3TOQA 3FEYB 2BE2B 1H7XA 1SUQA 2CJ9A 2ADCA 1JKHA 3ZZOA 3R2CJ 2P9GA 4ED2A 1WD6A 1NDLA 4J9SA 2F1FA 2DXEA 4DL2A 4EEYA 3H5YA 1CJVA 2YNIB 1G4CA 4X4TA 3NNAA 2R7XA 4OFZA 3G9CA 3R6GB 3NBPA 4Y00A 2O67A 3GV5B 2Z0GA 3POTA 2CJYB 1QD1A 4KIAA 2F65A 1XNRJ 1FK9B 3SSRA 2ASLA 3ZZPA 1RXOB 2VJUA 1MW7A 1RYSA 3K8WA 1AFJA 1O51A 2AU0A 4W4MA 1VQ6S 5D0HA 2UXCF 5BYSA 5H9FJ 1IKVB 3K5LA 3H5UA 4DV6J 3A8JA 2QFIA 2RQKA 1UCNA 3HHNB 1YHQS 2P9CA 1V3RA 5F8HA 1NZ8A 4ID5B 4WTOB 5GVQA 1TKZA 1R8PA 1B7YB 3KDOA 4JYAF 2VBYA 2XMAA 3MD1A 2UXDF 3M7VA 2J9DA 4DR5J 4HEA9 4LIWA 4FP9A 3MOJB 1S9EB 3RBXA 3DGPB 4F2RA 1G3OA 4EGLA 1S57A 2DNLA 1FKAF 4DV2F 3AXMA 3T9NA 3BV8A 3FDSA 1RWPB 2FC9A 3KLVA 4C97A 2DGSA 3IM8A 4J7CA 4TQSA 1LW0A 2F4VF 1IM6A 1WOSA 1HBMB 1HNXF 3G2XA 4TKTA 5DQIA 2QLWA 3W9HA 4F0HA 2OO4A 1WF1A 5DLGA 4C8YA 1Q5YA 1R0CB 1WOOA 2MYFA 4C8MA 2DHGA 3CEDA 3J7Z5 3D6TB 1HMVA 3R5AA 4N76A 2F9DA 4TY8A 3DLKA 3ZTRA 1HWIA 2DGTA 3E51A 2C2EA 4I6AA 3FCVA 2VV5A 4RBTA 1VC5A 2MMYA 1LOUA 2IJFA 1SH3A 2VC1A 3J81U 1F1BB 2H51B 3MR7A 2C2DA 3BGUA 3MMAB 3JQJA 4O0IA 3OHAA 3OLAA 2VPZB 4ED1A 1FDAA 4ZCLA 3Q8SB 4DR3J 5M2RA 2RKIB 4ZJOA 1F5CA 1VRUB 3VQTA 5F3TA 1N8RT 5FD1A 3W60A 3VWSA 3DLBA 5HMXA 2ZM6J 2QC3A 3BSNA 1SJFA 2E1AA 2DNPA 3FRYA 3T5HA 3D3CJ 1XK8A 4FF4A 1KLMB 1LNQA 2HVIA 1JJHA 1PC5A 3OR1B 1VQSA 3PKYA 4Y65A 3C15A 4KGVB 4ECWA 3I9V9 3TJ8A 1CJUB 2W9CA 3EZUA 4P73A 4ELVA 3UFCX 4FBUA 3T1HJ 2W7PA 3IC1A 5ETRA 5H9FK 1RWVB 3KUEA 3NS7B 2QA4S 3DI6B 2COLA 3NCRA 1S77D 3CW2C 1C1BA 4OV1A 3OVSA 1F0XA 1U1NA 2HBQB 4IYQA 2QFJA 2D9PA 2NCKL 2G2YA 5IV4A 3NWRA 2X7IA 3H5XA 5HANA 3TUZC 3PJWA 2FB0A 2ZH1A 4U8YA 3A3PB 1IUJA 3BBCA 3MEGB 4DLEA 4ILRA 3M6XA 4P2FA 3DDKA 5CYMA 2L9DA 3QRRA 1RACB 3KNAA 2DR7A 1YRUA 4CO3A 1PC4A 1NK5A 2OPSB 8AT1B 3T5JA 3MTJA 5HVHA 3Q24A 2HFZA 1RHMB 4KFBB 4PG7A 3D0HE 1FNXH 2YBVA 1RK8A 1FNMA 2YNFB 2NSBA 1RAIB 1VMBA 4C11A 2EXUA 3W62A 4NRTA 1S7HA 1Y0HA 4ALZA 2F4FA 3DLLQ 2DGQA 2P9EA 4NLQA 4HDGA 3OXGA 1OWXA 5EDWA 4ZJQA 1IBLF 3N5FA 4IR9A 1ZS6A 2XBPA 4OJ3A 1RWXB 4GO5X 3PW5A 5ETNA 2MLXA 5HBMB 1WC6A 2B7CB 1D0EA 4I7FA 3D2WA 1UWAA 4ECRA 4FYVB 1T8EA 4JUZA 3BKTA 4NCGB 3MM8B 1WELA 5I42B 3IG1A 2MGZB 3DDNA 3M2RB 5D78A 4X62J 4EMDA 3HSDA 1KTVA 1IQZA 3VAFA 2QIFA 1D9DA 4X4SA 2HLTA 2KXNB 3VAKA 3US5A 2DNHA 3NXZA 3M6VA 3DN9A 4K2XA 1RT1B 3BDPA 1A9NB 2ACYA 1FKPA 2GAGC 1HHTP 2VG6B 4KRWA 2Z56B 3RRGA 4LSNB 3I5BA 4V19J 3DLEB 1X0FA 1ACMB 2LDYA 2A10A 2AYBA 2M52A 2KU7A 3H8YA 3ETMA 4I6WA 4ZP6A 3MMCB 3D4JA 2BQUA 3SCKE 3CDEA 4P6QA 2FJDB 1VC0A 1T3OA 1YRTA 2G1DA 1X0PA 2AEFA 2E9RX 2JC1A 2V2ZA 5F8IA 2FVQA 1M5VC 2XYGB 2J7KA 2HFUA 3MMBB 2ZUGA 4ED3A 1CC8A 1P1LA 3TI0A 2XMKA 4TU8A 2IDLA 1SC1B 4G1IA 3Q0AA 3P4UB 1XQIA 2RF2A 2R8IA 1K1QA 3UN2A 1M5SA 4RPFA 3MR3A 4R25A 1TL1A 2UXBJ 3JS9A 2W7AA 2P5VA 2AEMA 1QLNA 1P9QC 1HWLA 1JXVA 1VRTA 5KFTA 1LV5A 5C42B 3MCSA 4LR8A 2R7UA 2RD5C 4ZP7A 1YJ7A 4WZQA 3HZGA 1RWMB 3TP2A 3U1MA 3DOMB 2F7VA 4K4VA 4ZJLA 4IQMA 4K5RA 4WFXA 2MSTA 1RUSA 5FLXU 2QX0A 2J0SD 3CJ8A 1U48A 3KTQA 4KR0B 5AE2A 1VQ8S 3HP6A 1YJNS 5DGAA 4NEYA 2RQ4A 2QL9B 1MSWD 2BJ9A 3UQSA 4ZIVA 4M5LA 4F0MA 2QL5B 4MIWA 3CC4S 4NCBA 5DQGA 4N8OA 3ISZA 4JBCA 5A8KA 4DL7A 3MFIA 1N34F 1C0UA 4M5DB 2MTLA 3L7UA 3VALA 2VH7A 1EZZB 4CT9A 3W64A 3EVWA 3FMBA 3GR0A 4E0DA 2CG4A 2CJXB 3I5AA 3EZOA 1RT2B 2AZ1A 4A8YA 3AD9C 3JXOA 2CQDA 1KOOA 2E44A 3DOLB 3M8SA 2B43A 4JI2F 2FHKA 1T9VA 1NDKA 3DLHA 3I0RA 1WC1A 2IFXA 1VQLS 3POTB 1FX2A 4WK3A 3J7YU 1IR1A 4USVA 4UT4A 2GVDB 2VFTA 2OMLA 4NLXA 3MPWA 4OX9F 2ASJA 2Q3PA 2G0JA 2G9OA 4RBVA 2FJXA 1B4SA 2DNGA 4AYBD 2AW0A 3CMES 1B0PA 1UEUA 2HFOA 1VIXA 3BR8A 3UDLA 1IJEB 5KFDA 4LF5F 1I3OB 2LVWA 3R1LA 4GO7X 3PRDA 4LFBF 3BS9A 3D28A 1TKZB 2DRAA 1OSCA 1SKUB 3DLGB 4KH1B 4YMEA 5KFNA 1EB0A 2WSEC 4MKAA 2PD1A 5AXNA 2N82B 1UP1A 4KC5A 4A8OA 1K0VA 3S7RA 5HMZA 1N32J 2MKYA 3O44A 4IQXA 5KFBA 4NLWA 1Z1ZA 1RA7A 1KHWA 1XR7A 1NH8A 3ZNJ1 4EFAC 2YKPA 2LMIA 4RUCA 1FRJA 3K8VA 2CJKA 3BYPA 3D68A 5HLFA 4WP3A 4W92B 2OEKA 1TKTA 1FESA 2WB4A 1HMVB 2OMOA 4MYUA 2BQRA 2YNHA 4QWBA 4TY8B 4MAKA 4XPCA 3C14A 2ZJPQ 4DPUA 3PM9A 1XMOF 4DSLA 1NKCA 4IUFA 4X65F 1UJ6A 4RW9A 1VR6A 4NZ7A 1GH8A 3DRPB 2X1FA 4IRDA 5FJ4A 4ERDA 2ZDPA 2ZKTA 5E33A 1GTEA 5IT9Y 4RJVA 1PSDA 5GAGU 3T3FA 4IH7A 1SJ1A 5KFLA 3RAXA 2EVZA 1NJIT 3TZXA 2ZH3A 2XULA 1TK8A 4JI0J 3NMAA 1MWQA 2ZH7A 1HYSA 3HX9A 2DY1A 4CO1A 2W2OP 4C0OC 3J80Y 1FXRA 1LK5A 3UCZP 2LCWA 3WIUA 5C24A 2D69A 3JTPA 3N6LA 4DR7J 2CPDA 5DJBA 3G96A 3ILLA 2W9CB 3D0GE 3LGMA 2W1BA 3GTYX 3W2WB 3KUGA 1WOPA 4F3OA 4TLRA 3PYFA 4WBFA 2GGPB 1BHNA 1S76D 2DXFA 5KG1A 3N28A 2QN6B 2HQ3A 4RNFA 1C1BB 4ETXA 2KM8C 2ACMA 2FTRA 4K0KF 1Y5NB 4C3LA 1IBLJ 1Q1KA 3BDEA 3GCXP 1RISA 1UL3A 4FYWB 3RRKA 4ZITA 3LPYA 3MEKA 4OYMA 4OIXA 1S49A 2FGOA 2V69A 1SC4B 3MM7B 2QL7B 4DJBA 2M4MA 3LGHA 1IBKJ 2J5AA 4WXOA 4B3TJ 4LIRA 4FXVA 5CYMB 1R43A 2UVVA 3SCIE 3QIDA 5T41A 1IR0A 1T03A 2VPWB 3H59A 2ATCB 4PRFA 1U45A 3T1YF 3A8IA 5HQMA 2XCAA 1VGYA 4U9RA 1S6PA 1FF2A 2DIUA 4QW8A 4YR0A 2IVYA 4QWEA 4OX8A 4L3KA 4DV4F 4C11B 4ZMMA 4HI2A 3IXQA 1EQMA 2DNMA 5K14B 4WZMA 4ZPDA 2PMZD 4OJHA 5L9XA 5JMNA 2E1RA 3IS9B 4LF6F 2QLJB 4OLOA 1SBRA 3EVMA 4N8NA 3FCWA 3NNHA 2E7VA 4QU6A 1RHUB 4J5OA 4ZPCA 3GMGA 3LPEA 1S1VB 4OZLA 4I7FB 2B4OA 1GMWD 3TA1A 3ONQA 5EN1A 3P96A 3W3SA 4K50A 5FIIA 4MH8A 2XLIA 4EU0A 3KK2A 3BBFA 3ENVA 4FS2A 4USIA 3NEKA 3LALA 1T05A 2WVCA 1VQ9S 1F2HA 3VAIA 2ZC3A 2X51A 1UA1A 2J0QD 4IRCA 1AA1B 2MKHA 4HTIA 1FKPB 3QGGA 3IR6B 1FJGJ 3TANA 4L73A 3TO8A 3OR2A 1D8YA 2MJNA 3UI3A 2Z2LA 1CJTA 1PKUA 4B9NA 1LEOA 4DF4A 4QIWD 2BOPA 5K8PA 4ZN1A 1IXKA 1KVIA 2CZ4A 1VHIA 1F60B 1QTNB 3PHEA 4RW4A 2NXCA 2KDOA 4PPDA 3M8WA 3IRWP 2KG1A 3W5XA 4CH1A 5E3CA 1KRPA 1F9FA 2J9DE 4Y28C 1N34J 3KJFB 1NPRA 2X3DA 5EWGA 3DHXA 3TAMA 3PHTA 4RKUC 4OZ1A 4CLPA 2MQPA 1LWXA 3ZTQA 4ECYA 1DQ9A 2EI5A 3GV7B 2VUGA 1KQKA 1TL1B 4UTGA 5HMYA 1WUUA 3KMSA 3HM9A 1EHWA 1VJWA 1JK9B 4YB6A 4JI6J 4I67A 2FZGB 2JEFA 1K47A 1VRTB 5SUHA 4M5KA 4PWDA 4RR5A 2Y0BB 4KO0B 4BC9A 3MAHA 3LUYA 3PEHA 2H9ZA 2G2ZA 3AB2B 2V4RA 4XAKA 2DR9A 3Q89A 2HVZA 3I4PA 2CNKB 3HSGA 3BH7B 3T9ZA 2GIFA 1U1KA 4XTTA 2CJAA 2ZD1B 3VR1A 4EZ9A 4DPYA 3VVUA 4CM2A 3AXKA 5A8KB 4FKXA 4Q45A 2GMHA 5D77A 4FNHA 4Q44A 3TUPA 1HNWF 4CO4A 4UOCA 4DS4A 2DEJA 1Q78A 2HNDA 4DFKA 1K1SA 2O3DA 4H54A 1FDBA 3PIPQ 5E3RA 5KFIA 4DQPA 5AE3A 4I4BA 2DNOA 1N36F 3UWTA 2HRTA 1I94F 1NJWA 3HKZD 1FRIA 3BF4A 3TEHB 1TELA 2FVPA 3HXMA 4DBQA 2KZZA 3K5OA 3ZXWA 2HIQA 3N0VA 2OPRA 1OJ4A 3Q8QB 1YWXA 1YI2S 2R7RA 1LW2A 4LRFA 3IM9A 4PXDA 4CO0A 3H25A 1MMNA 1RAHB 1KC8T 2VA3A 2W9BA 2BJ8A 1FKOA 1ZM3A 4O3PA 3SMZA 5K8OA 2V94A 1T94A 4GVBB 2D3ZA 1KOHA 4DX6A 1OPZA 2EKNA 1EIYB 1SJQA 1U6BA 2YTCA 3HVRA 3OLBA 3TAPA 1S0NA 4YEAA 3L95X 3TJ9A 2C1EB 2IPOB 3TVKA 2D9OA 3J7A1 3FJ2A 3LGNA 2CQGA 1F9HA 5L8RC 2EFPA 1EETA 4RBUA 2FLNA 1RBLA 1GTHA 1HR0F 1LXJA 1CSJA 4ECXA 1VQ7S 3H4BA 2Z4PA 3SCLE 4CZCA 3O1LA 1S1TA 1IKWA 3PR4A 4D3GA 1HWJA 2DH7A 4RZRA 1CJKA 1QTMA 4DI6A 3F73A 5DDQC 4ZN3A 1C0TA 4ECTA 1AUSL 1LWCA 2W2MP 1KTQA 3S8SA 4GC7A 2VFRA 1N88A 1RGVA 2A6MA 4QIVA 3NP5A 1TKTB 5M2PA 1VQNS 1BC6A 1JLBA 5K8NA 1EKRA 3QT7A 1MLAA 3O6QA 4RW9B 3D6HB 5G4DA 2YPYA 4GMKA 2BV3A 4E98A 4KT0C 2KFZA 1OY8A 1PAEX 1U0SA 1RDRA 3UNYA 4K4SA 3AQPA 2E7XA 4NRUA 3W2VB 2JLGA 4WJBA 4MJKA 1ROFA 1XMBA 4FXDA 1Y5IB 4X4PA 3CJ0A 1N6QA 2RILA 3SQGA 2F8HA 2XY7A 4RW8B 3I56S 4L6V3 1MN7A 2FZKB 4B9UA 5IWAF 2NUUG 1V5IB 3CTRA 2A2DA 2C3OA 3TZWA 5F0WA 4YFUA 2EPIA 3M2UA 2XNRA 2FHJA 2ZH8A 4F4YA 1R0AA 2R7WA 2OPPA 3MOZA 3CVKA 2WSFC 2LEBA 3TARA 4K2JA 3RW6A 1P9YA 1U02A 1ZZNA 5C24B 6FD1A 3EUNA 1QM9A 5LL6d 1I1GA 3NLCA 2QA2A 3P8BB 3MCMA 5KFCA 1MMDA 2BR0A 5EWFA 2N3OA 4PWUA 4ZHRB 1IN0A 1MWYA 4LF2A 2NREA 1GT8A 4A8XA 4DU7A 3GIKA 2RB7A 2HVEA 3EXYA 3DU5A 2DR8A 4QZVB 3W8GA 3M6WA 3TZYA 4CTAA 5ETQA 3JTNA 4WYWA 1ZM9A 5ITHA 2IM0A 1QVGR 5GADI 3TQEA 2BJ7A 4UOGA 1APSA 2GS8A 2JFKA 3DRSA 3ZZRA 2J6TA 4KTQA 1R8BA 4RU2A 2FJBB 1U1MA 3DNCA 4ITSA 3FVYA 2UVUA 2CDRB 4HACA 4NOHA 5AT1B 4UQTA 1VDHA 4PXCA 5LSOA 3GJRB 2AYGA 1NK9A 3EGVA 4Q2MA 1JLGB 5E0OA 1BWVA 3Q86A 2Z8QA 2VFVA 2JWNA 3AOCA 1FRXA 4JI8J 5KFRA 5KFZA 1BLUA 2W2QP 1M1GA 3W9JA 4Q5VA 4CLFA 1U2RA 1IKXA 2HK3A 3V6HA 1C1CA 3LAKA 3RB4A 1X4HA 3HSZA 3P6YC 3W61A 4MK8A 5E5NA 3KG0A 4MK7A 4B9VA 3D54A 5E7OB 2IBKA 4LF1A 3M1VA 4HKQA 2W8LA 4IG0A 3CO0P 4K4YA 1XJWB 3ISNC 3NMRA 3K0JA 4WCEQ 4U8VA 5DM7Q 2QA4G 2WAQD 3D1HA 2GHPA 4CCHA 3GJTB 3DGVA 5IQ6A 1HD0A 2HIYA 1VK3A 3THVA 3BPDA 4JI5J 2OTLS 3HVTA 4DR4F 4LFAJ 1T05B 1U47A 2E1MC 3LP2A 1OY9A 1XWLA 4UW2A 4L72B 2RMLA 2QRRA 2KB2A 2YKAA 4V1Ak 2M0GB 5AJ3F 1RT3B 5ETPA 5LOQA 1XNQF 2XEXA 1X9WA 4X84A 1FDDA 1H7WA 4HI1A 1CQNA 5ETVA 5KG7A 5F3ZA 1TV6B 2YKQA 3OR2B 1HNZF 2GA7A 2GJFA 7AT1B 4USMA 3BZQA 4F50A 1HBNB 1T9UA 3H4DA 2KJWA 1VBXA 1Y3KA 4CH0S 4CLYA 3HD1A 3D5MA 3Q83A 3J7AN 2Y1IA 5GAHI 2MJUA 2LU1A 5KFVA 5KFKA 2IVFB 3W63A 1XERA 2HNYB 4DL3A 4WFAQ 2RUGA 5A2QU 4HHHA 4CLSA 3PYGA 1HBOB 3TAMB 4HT7A 1B0VA 1GXUA 4M5MA 4Q2LA 3CSKA 3UCGA 1JXLA 1W2IA 2OH2A 3PW4A 2QYGA 4DV0J 2A18A 1DLOA 3AQOA 5HN0A 4NLPA 4CNZA 9ATCB 2DVIA 4B3OA 1UWBA 5L38A 1Q8BA 4LRCA 1QAYA 4ZCKA 1FHTA 3V4MA 3B78A 1DFDA 1SKSA 1WC3A 1WKKA 2GO9A 3DRRA 4WIIA 4DV3J 3UD3P 5GMDA 4RL1A 3OTDA 4DZDA 4FZVA 2D1CA 1JIHA 2K3IA 2VODA 3Q8PB 4P7TA 1KS2A 4PKDB 2RDIA 3A8EA 4NCAA 4F04B 3LTOA 5JVGQ 3CJRA 1VK8A 3ZZZA 3QRQA 1R8HA 4NLYA 2B4UA 4ECUA 1Q5VA 4QR2A 2CPFA 1FFGB 4DCPB 4C98A 4IFVA 2CNLB 2FC8A 1GQEA 3LAMA 2QMXA 1NJYA 4YY3J 2UUBJ 4YDXA 1U2CA 2CNNB 3QFHA 4F02A 4YHHJ 4X2BA 2P6SA 2XWXA 1D9AA 3AOAA 4RW7B 1RTZA 2OPRB 3OJUA 3IMQJ 5IM0A 3DCAA 3O2IA 4DV5F 4DR6F 3GYNA 1LW2B 4LFCJ 5D3GB 4M94A 2AJ2A 2WW4A 2W9BB 4ER8A 4GKKJ 2I9SA 3JB9k 4HDHA 1IKYB 1TMJA 3WBZA 1Z2LA 1SIZA 1B64A 2PO4A 4NMXA 3DHWC 5LSRA 2PMWA 2O01C 1VIOA 2Q6CA 2HHVA 2GHWA 1Z4UA 2QMWA 2CUYA 4DG1A 1V3ZA 3A3OB 2ASDA 2YX7A 1BXNA 1TL3B 2GQCA 5JUMA 3DXBA 1R8CA 3T1AA 2BVZA 5EWEA 3I31A 3B4MA 4PXBA 3CJ4A 3M30A 1FI4A 2CPZA 4RW6A 1LWCB 1HARA 1M5KC 2AD9A 4C8NA 3CT9A 4BDPA 4ZVRB 2AJ4A 2C3MA 3MEEA 1YX2A 2E9TA 1YJVA 1JLBB 4WE1B 7FD1A 3JSMA 2BBEA 1UVMA 1U24A 2V0NA 2FD2A 3PXGa 2HURA 4ZVHA 4CLLA 4DL4A 2ADBA 5J1EB 3CJ3A 4ZVGA 3G8TA 4YQWA 1UEKA 2FQQB 2YNGB 2OSRA 2CG8A 2YWFA 3X1LB 3AFGA 3JAMU 2C3PA 1N6QB 4ZP8A 2JX2A 2ATLA 4FYDA 3TVYA 4DR1J 4NXNF 4YB7A 4PWWA 3SZ2A 2V8VA 4JI4F 2V2KA 2K7JA 3M9MB 3QNWB 3P45B 2UUCJ 2VQEJ 3M2UB 4UOHA 3R3TA 3PR5B 2Y8YA 3MUVP 1RU2A 3CCJS 3I0SA 4OJ1A 4MT1A 2DK2A 4I56A 3V5RA 2E7WA 2ZZMA 3G6ES 3EVOA 3FNNA 1UPMB 2CPHA 2L41A 3W1YC 4AUKA 3K7RA 3QGHA 4U7UK 7FDRA 2YKNB 2XC9A 2LU2A 4DUYJ 4ECZA 1EAYC 1R27B 4ZCIA 4O3OA 3RR7A 3UVJA 2DTJA 1YJUA 4EUVA 2CA9A 1DTQB 3GLJA 2POKA 4LBHA 1RP5A 1N48A 3Q8VA 4MFBA 3TR5A 4WKYA 3OXLA 4KAIA 1FNOA 5IC6B 3R5DA 3GIIA 4ECSA 3C46A 4CTAB 3KK3A 2M7SA 4DUZJ 2E1CA 5H9EJ 1SB6A 1NDCA 1HWKA 1NKBA 1D3WA 2D41A 1E6YA 3DFEA 2KT5A 4NI2A 2C22A 3CD5A 2XS2A 2J7UA 4P10A 1OS5A 1EP4A 2AT1B 1UJ5A 4X4RA 3UPFA 4K4UA 4Y2IA 2XWYA 2NXEA 3EICA 3DXSX 2DY9A 3G6YA 2EC0A 4L3NA 1KDNA 4CLTA 1URNA 2RS2A 1HNZJ 2LXFA 3CJKA 4G3IA 1C1CB 3M2VA 4DL0C 3FBEA 2BYCA 3M32A 1RADB 5KFAA 1AT1B 1VS3A 4AL5A 4QCLA 4QBUA 4B3MJ 4G1QB 1FRMA 2XO7A 4N77A 2KTQA 5CQGA 1SXLA 2HHPA 3I96A 4KBIA 2HHWA 2MXYA 4YDDB 1FWPA 4OQJA 5KFMA 4EBCA 3QAUA 3VGSA 5L1JA 1T0TV 4DV6F 2A3JA 5ETKA 3HVTB 2JNJA 2XMJA 4OX6A 2D7SA 5J2NB 2ABYA 1VCTA 1ZM4A 4KB7A 3FEZA 5U47A 1UW4A 2B4VA 1G6BA 2EEYA 3GJQB 3VZIA 1WEYA 1N5SA 2QLFB 4DR5F 2J8SA 3BSCA 5E3AA 1RTIB 4DWIA 2P8IA 3MHYA 4DX8H 1YTYA 1TU0B 3P5TL 1VLOA 3KMQA 2KXHA 1RAFB 3KLHA 5B0BA 4YR3A 1G7CB 1ZOTA 5I3UA 3LA0A 4K4WA 2NUHA 3SV3A 3SSQA 4RUHA 4NPOA 4ZP9A 3IBWA 2XHWA 3K57A 2I1RA 4NLDA 3J7YI 2HW3A 5DLFA 2DIVA 4FNIA 1H2VZ 4JI1J 5H9EK 1B7FA 1TP7A 3RAQA 2HEKA 2E5JA 2ZH2A 4ANCA 1X8DA 3FQLA 4H4KA 4Y2KA 4CQ1A 3KLEA 1HWUA 1J5OA 3NOCA 2DH9A 4QQBA 4Y2MA 1DJ0A 2J7WA 1FEEA 3MAAA 4A48A 2BKNA 2YY3A 3O5TB 4CYUA 1REGX 1JLFA 1JJ4A 2OPQA 1TL7B 3UO0A 1UVJA 1S10A 2I6WA 1Y3JA 4OYPA 4ZLJA 1UA0A 1JLQA 2BM1A 1AZSB 1RB0A 2IYIA 4DSFA 1DLOB 4DR3F 2VQFJ 2CQ0A 3SEOA 2EC2A 5DDRC 1U6ZA 3ZZYA 3FFIA 1S4EA 1PO6A 4B3OB 1H3DA 3BQ1A 4L74A 2B5JA 3AT1B 2LLZA 4DXLA 2X1BA 2KZMA 2ZM6F 3CUNA 4DV5J 1NCLA 3K17A 4DR6J 2H4YB 3DRRB 4PG6A 1M5HA 4DX7A 1WKJA 2XY6A 1NB7A 3FUYA 3OSPA 3EZ5A 3BJYA 3QMQA 1S6QA 1NK0A 3OHBA 4BWMA 2FGCA 1GMUA 1X4FA 5D4PA 5HVFA 3OXFA 4ZPTR 3T1HF 2H1YA 4DV7J 2XTJP 2EFNA 4RWWA 2PEBA 1VQ4S 3NCPA 3LP0A 3T6JA 1BGXT 4DL5A 3UR3C 4QIFA 1I51B 4KHPF 4PQUA 4QYZJ 2E5HA 1ZYQA 4D3HA 1DHMA 4LMZA 4AT1B 3QPIA 2LXIA 1M5PC 4WP8A 1LK7A 4USHA 2LXUA 3MWBA 2Y1LB 4G6VB 1R8AA 1XTZA 3DM2A 1YJTA 2LEAA 2N7YA 5D4NA 2B3TB 3HFZB 3TRGA 4ZDNA 3PX0A 5IM0B 2GO8A 4TLQA 5LSLA 3NGUA 1RI7A 3ZZ0A 4DL6A 2ZBPA 2VPXB 2HBYB 2JC0A 3H20A 2E5GA 1L3VA 3I4HX 1DQAA 3NS6A 3KLIB 4C48A 1TK0A 3OW2R 1HI8A 3MECA 3R97A 3BKFA 1IM4A 4TY9A 1P8GA 1Q0NA 2X1AA 5KT3A 2MQOA 4WFBQ 3RBEA 3DMJA 4IO1A 2MEWA 2AJ0A 1S0VA 4O44A 2P6TA 2U2FA 5KG6A 4DUTA 4DQQA 2HZAA 1CG2A 3M8YA 2IA0A 3PW7A 1JLEA 2GVZA 3M30B 4JV1A 4OJGA 1VOMA 2DPJA 2UV8A 3I55S 3EE3A 4J9UE 1U1LA 4X64F 2XLKA 4NA1A 1WG1A 4J9PA 2VBWA 3V4IA 5F41A 4X62F 1BWEA 3CJQA 2WSCC 2HBZB 1F3VA 2OI2A 2WZ1A 4FF3A 5KFPA 3CJTA 2IC3B 3JSMB 5KG2A 2NXUA 2VD3A 1Q8KA 1KQFB 2ZBCA 5CCMA 3LWMA 2DGUA 3MR5A 2MDAA 4P75A 1W26A 1NK4A 3Q8RB 1JLAB 5A8WA 4QIEA 5HMWA 1ZH5A 4F26A 2AWZA 2QO3A 1VQ5S 3OVAA 1X4DA 4PABA 1SIWB 1HI1A 4PPZA 1FJ7A 4OMFG 1UAWA 4OHXA 2DEIA 1JNRB 4DN0A 3M6UA 4AXIA 1F9EB 4OHWA 4QYZK 4RUBA 1U1OA 2B0GA 1DTTB 2XCPA 2EFQA 3CGIA 4FKYA 1ZTTA 1YG0A 4ATNA 1RCOB 3G86A 2YWEA 2VZ9A 5IC4B 4M8LA 3MF5A 3UDEA 4LF8J 2L3MA 2ZOMA 5EUHA 4MYTA 5KFHA 3BGRA 2Q1LA 5LXYA 2L08A 1CULA 2UXBF 1WTFA 1W7WA 3PV8A 4ED4A 3UD4P 2V68A 1OO0B 2ZITA 1NLKL 2OKQA 1I5OB 2V9KA 1FE4A 4R8UA 2NLWA 2MZRA 4MFBB 2AV5A 5KFSA 4L75A 5J1NA 2UZAA 3PJ9A 5K5MA 3QT8A 1U0HA 1HD1A 3OL6A 3KK3B 4XK8C 2XO6A 3RR8A 3BPSP 1XIQA 2G1HA 3OVBA 4AQYJ 1DY3A 4ZKAA 1F5BA 4NI2B 2IRUA 4GKJJ 4IOBA 4F2SA 3WC0A 1S48A 4RUAA 3R5CA 1VRQC 3UE2A 3ET6A 3PYEA 2Q66A 3MPVA 3OUYA 2N3LA 4OZNA 2AKWB 5EHHA 5IS2A 4F4ZA 5HROA 4M95A 3ZZUA 1URRA 1X7VA 1WJ9A 3G4SS 4LBIA 2MLYA 1NO8A 1X9SA 5K9FA 1JXEA 2WVFA 3IFEA 2HBRB 1Q79A 2XQCA 3CXCR 1QAIA 4KE5A 2AQ4A 4N56A 1X5TA 4HLBA 3B8HA 3RU0A 3EMTA 4UF4A 4CT8A 5SZTA 1H0HB 3M2VB 3M32B 2IJRA 4WXWA 3J81j 3IO1A 1H73A 1U8WA 2GMLA 3F41A 3SSSA 2BRLA 3H90A 3PW0A 3SFGA 4ZK7M 4PG8A 2W2NP 3ILJA 5F0UA 1KVJA 1SL2A 4Q0BA 3MM6A 5CAAA 2UUTA 2EFOA 2BE7D 3QT6A 1V6HA 2FLOA 5L1IA 3RUBL 3KHRA 2RIJA 1IWAA 3GB0A 2CPIA 5KT5A 1RBOB 3ILOA 2DPIA 2H5IB 1J2VA 1W25A 2PI5A 2IMWP 4FVCA 2RSQA 4K5SA 4QPTA 1TUGB 4NE9C 2FJAB 2VICA 2JSXA 5BJRA 5FDLA 2CJQA 4NWBA 4USWA 4ED7A 2HNZA 4EI2A 2SXLA 1X4GA 4HL9A 5HP1A 1N32F 3IAS9 4EBDA 2ZJRQ 2WRMA 2GFFA 3K58A 2DBBA 2MZJA 4NX9A 1AROP 5T14A 5KT7A 3OJSA 1O8BA 1UFKA 3R7SB 2DH8A 4M5HA 1ZETA 2F63A 2PFFB 2GZOA 2DITA 3OTEA 2U1AA 1K44A 2DGOA 3C6TB 1BUXA 1RHJB 1R7IA 2DYAA 3MUMP 4JV5J 4EO6A 2KHDA 1HHSA 2AGPA 3G8SA 4HHJA 5C2CA 2YWHA 2RDDA 3KLEB 3KLFB 2CWXA 4K7QA 4LJMA 4ID8A 2J8AA 3MAAB 2AJFE 3IRXB 1QUVA 4XDDA 1CBKA 1HQUA 2OSQA 2DNRA 1MU2B 1Y4ZB 2CADA 4B3SJ 4JI3J 4KHPJ 3LANA 5K20B 2VASA 2OPQB 2ZH5A 1M90T 1PJ6A 3I32A 3Q8YA 1JLQB 2DHSA 3HHKA 2FDNA 3EXCX 5IV3A 2M8DB 4I2QA 3FFIB 4KH0B 3VAGA 2B5JB 4RNOA 2QA1A 4JI0F 3KKFA 4AL7A 2FY1A 4KGKA 2K1RB 4TQRA 4DMZA 2XS5A 4YUDA 4C0BA 3R2DJ 3N5BA 1VBKA 4A8MP 5D15A 2RRNA 1S6QB 3B4DA 4ZPWR 4DR7F 3M8PB 1DBDA 5CYQA 2MQNA 2LECA 2DRDA 1R6YA 2WONA 2OHDA 2VFUA 2CVIA 3GZ7A 1HA1A 1YIJS 4C2MA 2ZVSA 3L7OA 2ZZTA 3OFHA 4C8LA 2VKZG 3VV2B 3Q2SC 3THTA 3HSJA 2UV8G 5L46A 3QWUA 4G65A 3V6KA 4F0KA 4F67A 4KPYA 4LSLB 2DR5A 4F4KA 2ZE2A 3OFFA 3JYTB 5IT9U 4AD6A 3M4XA 4ZLLA 1F6TA 3E2EA 3DM2B 2GMJA 1S6UA 1EQ0A 3QAEA 4JI7J 3K5MA 1LWFA 4FXWA 1OYEA 1IBKF 4X64J 4B3TF 5AXLA 2H65B 2ZUAA 5ADZA 4XPEA 3HHLB 4A8KA 2QSFA 2GQQA 5F8NA 4DSKA 1KN6A 4WU2A 3QFWA 2C2MB 2WOMB 3J80U 1HHQA 4GVLA 2Z2ZA 1SCJB 1C4CA 5KFFA 2BE2A 3MECB 4HVZA 3M8QB 1SKWA 1WHVA 1QAXA 2PA3A 5KT6A 2MY7A 3GJSB 3RTVA 2IM3A 1FDNA 5CCLA 1KD1T 3T19A 1YBTA 2N7CA 3ENWA 2YNIA 3DMJB 1KFSA 3BN4A 2WTFA 1FRKA 4ENOA 2PSZA 4CIOA 3AJ1A 3QWPA 5A6PA 4YB1P 2OFGX 3U1NA 1Q53A 2IVMA 2EBEA 2LQBA 2GVZB 1NPKA 3A4TA 3UD5A 4I2PB 1QY7A 2OFHX 3KYLA 4H4OB 2R2RA 4ZLNA 1BQNB 1UJ4A 4EK2A 4ZVSB 1UW9A 3V4IB 1FO1A 4LVNP 2D74B 1CPZA 4JV2A 2KT3A 4B9TA 2ZOGA 5LMUJ 4DPOA 3CC7S 3CD0A 2EFVA 4ID5A 2AHOB 2QMUB 1PCAA 4I6YA 4LRBA 2OD4A 1FJGF 1SKRA 2R8GA 1GNKA 3GE9A 4CO2A 1RTDA 3CCLS 2JZ5A 1S9EA 5KTQA 2QYCA 4X66J 1K73T 4J9LA 2DHAA 1PIEA 1Q86T 5KAKA 2K8GA 2HMIB 1HBMA 3FK4A 3LF0A 4UUXA 4O0NA 1IBMJ 1Q8LA 4P74A 5B0FA 4DQSA 1RABB 3G6VA 2V6AA 4ED6A 1G1XA 1XN9A 1BMQB 1IBCB 1FJCA 3L7PA 4L76A 2ZFHA 4EO8A 3BGRB 1SUQB 1JKHB 1CULB 1U2FA 3NGTA 4OYZA 2HGMA 1DAXA 2LP4A 3NWGA 2B6AA 1J5EJ 5KFGA 2VBZA 3GIRA 4OZJA 1CLFA 4S0MA 4JI6F 4LBPA 1GXTA 1CJVB 4OYBA 3KLGA 4XDCA 5E41A 4R8UB 3I87A 2HHHJ 3MMAA 3S01A 2CPXA 2QV6A 2M70A 3NBPB 3RB6A 5JJBA 1S12A 1FRHA 3DDIA 2WHOA 2RKIA 5DQHA 3GONA 1VRUA 4V19X 3T41A 5CD4A 4LRDA 1R0BG 1W2BR 3PACA 4Y34A 1WWHA 5KG4A 3PEJA 1NXIA 1DZ5A 1NU4A 4P2XA 2RQMA 4ZVFA 4FF2A 2NZCA 2BJ1A 3IBCB 3F0NA 1KLMA 3OR1A 4PR6A 4USJC 2OELA 2CXEA 1FA0A 1YLXA 4F4XA 1ZAWA 2G0IA 2AMCB 3M05A 3HHEA 2BMBA 4BC7A 1QE1A 4JV0A 1U1RA 3CIZA 4TYAA 3A8KA 4YS2A 2R2TA 3PFEA 2A1BA 2HGLA 3AD8C 1FCAA 1LW0B 1EARA 2BJEA 1X60A 3GPAA 3EGWB 4LRAA 2F5GA 3BM7A 3BGFA 5L1LA 4USUA 2WB1D 5F8MA 5LXRA 4WK1A 3MEGA 4Q0BB 3MM6B 3BB5A 2RE1A 3DLKB 2CQPA 5HK4A 1YZ6A 4OI0A 1OPIA 2XS7A 2B9XA 4HTJA 4KFBA 3MPUB 3MTKA 5HO4A 2E9ZA 1ZBTA 4CDIA 2DXDA 3SYZA 2YNFA 5ETMA 1EKSA 2B9YA 2DRBA 4URQU 5A76A 3GFHA 3QSIA 4I0WA 4P52A 3CCQS 1RT4A 1IQTA 2V8DA 1RWKB 4OHVA 2ZH4A 3OFGA 4F4AA 3L3CA 1U09A 2GX8A 4OI3A 5KFWA 4O3RA 2LQ5A 1B70B 1GEHA 2BA9A 2BABA 3C15B 4K8RA 2G4BA 5I42A 1JMTA 1U8SA 3AD7C 2FLPA 5HJYA 2MGZA 3M2RA 2VIHA 2W24A 2P2CB 4NYOA 2X1GA 2HGNA 2I38A 1A6LA 1HQUB 2EW9A 3UCUP 1RT1A 1Q8IA 4ED5A 2FHJD 3SCJE 3ULHA 1ZAVA 1RAEB 3H42A 2XM3A 1KKHA 2F9JA 2E66A 3PZPA 2RU9A 5GADU 5KOWA 4I2QB 5CABA 3BSOA 1O0PA 4ZLPA 2XMWA 2VF3A 1RWNB 4USKA 3BO4A 2HK2A 4DDFA 1FTCA 3ILIA 4DPWA 2PGCA 3BREA 3O8WA 5BXIA 1ZTWA 2JRSA 3KJQB 3G6XA 1U25A 4TVAB 2X3GA 5B0DA 5CYQB 5KFYA 3B54A 1MWZA 3ZZTA 1UFLA 2GCFA 2WONB 4PG5A 4OYIA 2ALYB 4BHQA 3TX8A 4CLZA 3H2UB 1KSPA 1PILA 2HLUA 3CNQP 3RBDA 2EFGA 1M1HA 1KQGB 1ZZFA 2K06A 3KXDA 4A8WA 5ETLA 4E2FB 4RNMA 5C42A 2KFNA 1EJ7L 2KVIA 3TUJC 3RB3A 1NK7A 2ZE2B 3OSNA 3DOMA 2AZ3A 1Y00A 2OIHA 4UY85 1OY6A 3GYXB 2DHHA 1RT5A 2CQ3A 2O66A 3IG1B 5E3QA 3AODA 2ALZA 3W5YA 2MPUA 2RH3A 3BQ2A 2ZHOA 3NAHA 1TUWA 4JI8F 2HQDA 4OI4A 4M5DA 1X4BA 2UVWA 1WTBA 4DU8A 2J9EA 2E29A 2WVDA 1R89A 3DC2A 1RT2A 1NSQA 2VPYB 1MMLA 1N54B 3DOLA 2BDPA 3VCDA 3OTBA 2MKKA 1C4AA 2ZBIA 2LYVA 1PBAA 2IA6A 3QJPA 1HNIA 2WK4A 2UUAJ 3NS5A 3QATA 2QGFB 3MR2A 5GAHU 3UDVA 2GVDA 8RUCA 1S97A 4MKYA 3R8YA 1H38A 4CWBA 4J9VA 2NR0A 1CVJA 4UUWA 3W8PA 4JI5F 5E3PA 2MKIA 2ZWPA 1TUVA 3IWXA 4LFAF 4CLWA 4CI0B 4LVOP 1WHXA 1HQ2A 2RF2B 4H4MA 3EJMA 1V9OA 4FYXB 3PX4A 4ELTA 1S59A 2XMUA 2HQIA 3K89A 4OHZA 2GIRA 3DLGA 4LF7F 1YBUA 3OV7A 3K2YA 1FWLA 3LH2S 3EYZA 1RTDB 4DPTA 3LW5C 3D6MB 2MZSA 3VAJA 2CQ2A 3PNIA 1HLWA 3R9LA 4DV1J 1S9GA 4C8KA 1XMQJ 2I8EA 3UNGC 1N5QA 1LFPA 3FBCA 3NGRA 4B3RJ 4M1KA 4WYLA 5LMNJ 2V67A 2Y8WA 8ATCB 4OV6A 2E5LF 4KKOA 1HI0P 4KSEB 1YBAA 4LR9A 5GAEI 2W8KA 1C0UB 2ZEJA 3QIPA 3VGTA 2KRBA 2ZKUA 2VL1A 1RCXB 3C66A 4WP9A 2B6AB 2RHQB 4FPRA 3DRPA 2EK6A 1U1QA 3VZHA 4DV0F 3FC9A 1FFSB 3KLGB 1PYSB 5G0RA 1NK8A 4NLGA 1SJRA 5KFUA 1AXQA 2FVCA 3I0RB 2NQPA 3BGLA 4YR2A 2V34A 2VBXA 1LXNA 2KFYA 3MMJA 4Z7CA 4DHVA 1WKLA 2NXJA 4DV3F 3FSXA 3OTOJ 1TKXA 1F2GA 3MR6A 4DFJA 2DCLA 1AUDA 2YKOA 4I69A 4I64A 5EX0A 4J9QA 2RJZA 4KPCA 4YB5A 3THPA 2HVDA 2NPFA 4ANDA 3OT9A 2YQ1A 4QR0A 2PIIA 3IGNA 3VGVA 3R1HA 2XG8A 2BOAA 2KJVA 3W2WA 5HSPA 1QE1B 2R8JA 4AE5A 2OP5A 1DRZA 2GGPA 3RBZA 2HRYA 4DFMA 3NRBA 4U6PA 4KHRA 5MLCV 4EWTA 2W4DA 4YY3F 2UUBF 1T9TA 1TK5A 1S1UA 1RLDA 4C0HA 4KJIA 4YHHF 2GAHC 4UZBA 3UN3A 2CDQA 9RUBA 5HLFB 3FGVA 1J27A 4PCQA 4LFCF 4KGMA 1ZPVA 3MM7A 2V4JA 3H2VE 5K8MA 2YNHB 2FPHX 1P6TA 4DEZA 3C14B 1REVA 4GKKF 1UETA 2M2BA 2CZ9A 4N47A 1S1WA 2KM8B 2ZDOA 2ILZA 3FMWA 1T9YA 1S99A 4DR2J 3BH6B 1N33J 4ZVEA 2CAJA 1NBEB 2D3UA 4LF4J 2OGUA 1M5OC 5DS7A 3KNGA 3ITHA 2QLXA 2QTWA 4OHYA 2MB0B 3PRBA 1N5VA 2IIHA 3VAHA 1BE4A 5KG0A 3CDUA 3GIMA 3GSIA 2HWHA 4PUOA 3QGPA 1NJZA 2LEPA 5ETSA 5B09A 3PYDA 5K14A 2OEJA 3CB4A 1JLCA 2UU9J 1RT4B 2W2PP 4WFNQ 3U02A 3IS9A 1HYSB 1S6OA 2K2PA 2M3DA 1FWKA 1FT8A 2BE9B 4E8UA 3KFWX 1S9FA 1S1VA 4FDFA 2BJDA 3PRVA 2VU5A 3E3XA 2J6UA 1KWMA 2ERRA 4P72A 3C16A 5KG3A 4R5PA 2PA8D 2GC8A 1R6VA 2AX0A 3GSDA 1UVNA 2BW7A 1OSDA 3QZ8A 1WSRA 2HQCA 1RAGB 4C7QA 1YRXA 1B3TA 1RJJA 2XSFA 2MSSA 3WC2A 3EWGA 1HFEL 1N5YA 3AOBA 4B9LA 4LQ3A 1RHQB 3D9BA 5IOLA 4ICLA 1F5AA 6AT1B 3GQCA 4XIUA 1HKAA 3B6BA 1X4CA 3JQKA 4DR1F 1WACA 2CQHA 2IHR1 2ZC4A 3CCES 2IM2A 4TYBA 4U7UD 2UUCF 2VQEF 1ITPA 1T11A 1H2TZ 3D67A 2LQJA 2JOQA 4UQGA 1SQFA 2VFSA 2CQ1A 1T03B 2YH0A 3PO4A 3E01A 1RLCL 2IJNA 2OJ3A 3HK2A 3DU6A 4X4OA 4URGA 5DETA 4DUYF 2VONA 1FFWB 3HHDA 1JX4A 3SIPB 4M5GA 1S6PB 4A4JA 3CULA 3ENAA 4NYZA 3GU0A 4B9MA 2AJ1A 3AJDA 4NA3A 1SH2A 4ELUA 1VQMS 2RHSB 4Z7YA 1ZA1B 4DUZF 4IG3A 3QJLA 4KO0A 1WI6A 4FF1A 2HWIA 1AB8A 5D0GA 2R3VA 3JQMA 1LWEA 5B0EA 3HFVA 2HHUA 4R0EA 3UDCA 3HFKA 4CP5A 2VKRA 1SJ4P 4R0JA 4J9MA 1N0VC 3CCMS 2BANA 3HCXA 1RT5B 2UXCJ 3KK2B 3CCVS 1NDPA 1WG5A 5D0RA 4A47A 3CCRS 1UFWA 2ZD1A 5BYQA 2JFDA 2B7BB 2GV1A 1VLYA 3J81Y 2D3O1 3P5BP 1SI9A 1NK6A 3FRZA 4TN2A 3ENQA 1TFYA 1GK8A 3R5BA 1ICEB 4HT5A 4JYAJ 4B02A 5LJ5Y 1VFJA 5KFOA 4LF7J 4DQRA 1PG5B 4ZVOB 2YQ0A 3TZZA 2UXDJ 1N0UA 2LQ9A 3KWMA 2YQ3A 2FY8A 1CJTB 3BEGB 2V8GA 4KYZA 4DV2J 2JEIA 3G82A 3GG1A 4FN5A 4B3MF 3HMJG 2GHVC 4K4XA 4PYAA 1HNIB 3OFEA 4M63A 2F4VJ 4RW4B 3WHIA 5D0EA 1HPZA 1HNXJ 1PBUA 2W25A 2HAFA 2BXJA 4PXEA 3QQCD 3D0IE 2E5LJ 3RW7A 2H5JB 4C6AA 5A8RA 5J2QA 1GX6A 2QG9B 4ES2A 5C25A 4DF8A 1S7IA 2ZVIA 1FXDA 4M5JA 2JEGA 4DFPA 3T5LA 4GVBA 4H4MB 3NY0A 2ASYA 1NKEA 2F8EX 1RAJA 3RGIA 2R7TA 1YJ9S 1WI8A 1Q7YT 4UOFA 1NSPA 2W4CA 4TXSA 1K9MT 1H74A 4I1TA 4PWDB 1QAJA 4A8QA 3RAMA 3N4WA 1UVLA 3BN7A 1YGYA 3LQVA 1CQMA 3EGZA 2CZVC 5EGYA 1BY9A 2AIRB 1CC7A 4EYHB 4DX5A 3EM1A 4G1PA 1S9GB 2B8PA 3W7BA 3BR9A 4W98A 2QE5A 4DN9A 1SV5A 3HPOA 4J9OA 3GG0A 4Z37A 2B4PA 1L3KA 1MNEA 2EG2A 2ZBQA 5B0AA 1AFIA 4JI1F 3SDEA 4C4WA 1KEKA 1CEZA 1ULRA 4KKOB 2L9NA 2R7VA 4LF9F 2ZH9A 3QIPB 2HNDB 5D8HB 3D3BJ 3QBCA 1R3NA 1OIAA 2YKMA 2R7OA 3UR0A 1KLNA 1NAQA 4IH5A 1FTRA 1UZDA 2ZWOA 4WKRA 3KK1A 4ZIWA 3TUIC 5DGBA 4J9NA 5AXKA 3QGIA 3TYTA 2N4DA 5G0RB 2VQFF 3WQPA 4BWJA 1O5JA 2H4WB 3W2VA 1S72S 2MQLA 2RNEA 1VC6A 4LREA 2B56A 1X31C 3U27A 5GMKa 4RW8A 2QJ3A 1RBAA 2G2OA 3TAQA 4OZ2A 1T7PA 2KHCA 4O3NA 2YX4A 4B9SA 4NEZA 4ILLA 2RU3A 2NYIA 5E2QA 3U1LA 5B0GA 2G13A 1TKXB 1FKOB 4ECQA 5IFMA 1E6VA 5ETOA 2HHQA 1RWWB 3N9UC 2UUWA 1QSLA 2DHXA 1RT7A 2ZBRA 4DV7F 5HATA 1SC6A 3L4BC 1RQ0A 3H5SA 4Q8FA 2BKPA 3KG1A 4ZHRA 2C2NA 5DG8A 4LUBA 1EETB 1NNDA 3QLHA 1B0TA 2V9WA 3F44A 2Y9HA 1TL4A 3HHLD 3R5GA 2DJWA 3X3UA 1S1TB 1SQEA 1IKWB 3AJ2A 1CJKB 1S1UB 1NUEA 5DM6Q 4FVMA 1C0TB 4P2MA 3ZTPA 2V63A 2EKYA 5DZ7A 2DGWA 4LSZB 2ZH6A 4PEOA 2V4JB 1WDTA 2HZCA 1D8ZA 5CXTA 1REVB 2O5DA 3A1YG 3ZNUA 4NXMF 4CM0A 5KOXA 4OYXA 2I5JA 1S1WB 2W9AA 1JLGA 2NYHA 3G8QA 1YITS 2HS4A 2PE8A 2PC6A 2W4PA 1V3SA 1HW8A 1PJ5A 3M9NB 2HRUA 3ITHB 2GJ2A 2MQ8A 4QWDA 2F40A 1BD6A 2JLEA 4RO0A 2KXFA 3D6FB 1U49A 2W01A 2XMVA 3DYAA 1GFWB 4PUOB 1XEZA 5KFQA 1VBZA 1RU1A 3SQGB 5FLXY 2VG5A 1RE1B 1YZ7A 1JLCB 2R2UA 1X5PA 2CKWA 4QPXA 3PDNA 1R0AB 4ZCMA 2V4QA 4RX6A 2OPPB 3JSYA 1MROA 1Y10A 3H40A 1SVDA 2VA2A 4DSIA 4Q43A 3C16B 4R5PB 1I6JA 1V5VA 2QZ8A 3OL8A 4P2SA 1FE0A 2YX1A 3HZEA 1NZAA 1WC5A 3MCOA 2HHSA 1SJ3P 1RT3A 3R6LB 1HW9A 4QJVA 2VG7A 2IY5B 3L9ZA 1RHKB 5BR8F 1N5YB 1NB2A 2J9CA 3WIVA 1VYAA 1TV6A 4ICLB 2RVJA 1WF0A 4YOEA 1UVIA 5F8JA 2I0XA 2Z58B 4HH0A 1TQLA 2MLZA 3DRSB 1KP6A 1HBNA 3V81A 3PCOB 1U26A 1C2PA 2BZ2A 1RHRB 2Z2YB 1RYRA 2YPZA 3QYYA 4YP3A 4HACB 2ZZNA 2VOOA 4CLKA 2KT2A 4F4WA 4LF8F 2HNYA 3AA9A 1TR0A 3E01B 3QO9A 4IDKA 4QIGA 4M5IA 2R7SA 1NM2A 1HBOA 4URSA 4OL8A 4IFYA 1WDDA 2YH1A 1IKXB 1JQGA 2VOPA 2V5HG 5CD4H 3FBFA 1Y7PA 3DLJA 4C3MA 2Y0SD 1YVFA 2EWHA 3BGOP 4X4UA 3FEXB 3HI9A 3RB0A 1HNVA 1LKZA 4O3QA 2BKOA 4JI2J 4UZCA 2XGQA 4WWSA 4IG3B 4U95A 3KOAA 1NPPA 1SC3B 4EZ6A 3RYLA 2DR6A 4NLOA 3M1VB 3CJSA 1BQMA 4AQYF 2KH9A 4IG0B 3VHQA 1LWEB 4K4TA 2CQBA 3C6UA 1XC9A 4K59A 2EK1A 1PJ7A 3EPGA 3EGNA 1PGZA 3LP1A 3LOUA 2Y1RI 1DARA 1T9WA 2XNQA 3HD2A 4GKJF 4OX9J 5F9NA 2BANB 1JJCB 2K7KA 2KN4A 3PKMA 2VDHA 4F8RA 3CC2S 2IAJA 3KG4A 3LP2B 3K59A 2CRLA 4B08A 2GJIA 3H0PA 1T3NA 3C19A 4LF5J 4TU7A 4A8SA 1CS4A 4LFBJ 1WHWA 3FCHA 4GC6A 2DT9A 2XGPA 3SI8A 2HQFA 1Q95G 5ETTA 3MZIA 3K5NA 3GFZA 3MEDA 3CMAS 4C8OA 1QSSA 2JLFA 1MN9A 2JJ4D 3G82B 3A13A 1O6XA 1S1XA 2FUG9 2PI4A 1H72C 3ICLA 1NMEB 2E1PA 3GFXA 1HPZB 2QLBB 3MPDA 1YSJA 4P9SA 5HI7A 4RW7A 3HJVA 2WVBA 2ROEA 4ETZA 5CHCB 3IR5B 1GMVA 2WCXA 5A8RB 1KR4A 3KHHA 5J2QB 3CCTA 5D3GA 5C25B 3CDWA 1K8AT 1X5SA 4LF9J 2QEXS 1XMOJ 4EBEA 2DNNA 2CQIA 1IKYA 4NLSA 4X65J 2UVRA 1KVKA 3SFUA 2JVOA 3IR7B 5DDPC 4WPAA 5CH7B 3CCZA 3IN5A 2R7QA 2MZ1A 4QWCA 4U96A 4WTYA 2AX1A 4RNHA 3I9ZA 1WF2A 2O1PA 2PMHA 2J0WA 1UWBB 4LR7A 2ZJQQ 5DDOC 3MDFA 2Y1JA 5IZHA 1TL3A 3MPYA 1VQKS 4NASA 3BSAA 1SV5B 3GFYA 2R4FA 1WORA 2YVSA 3SBMA 3FZBA 3DRXA 2L9WA 1A7GE 2K3KA 3SDEB 2R8HA 3S6EA 4JV5F 3EDRB 2RRAA 3CD7A 5IQQA 2IRXA 4WE1A 1H2UX 2A6OA 4DSJA 2BM0A 1ZM2A 3LO3A 4ANEA 1TZ0A 2Z57B 3M8RA 2YKMB 5LT5A 4OYOA 1QUPA 1L3SA 4B3SF 4JI3F 4IFVB 4O4GA 1TAQA 3PFOA 3VVTA 5HJXA 3KK1B 5J1EA 1FEHA 4QW9A 4X4NA 1VJQA 3N6NA 2YNGA 4K0KJ 3RG6A 5DO2A 2FVRA 2AP6A 2CQCA 2FHMA 1NSKL 3VQSA 1T9XA 3ADAC 5GAGI 4ZPBA 3MM9A 1TKDA 3HJFA 2ZHBA 3GV8B 2BQ3A 5LM7E 2CJBA 3CD6S 3MGJA 3GWCA 3AY0A 3VAMA 1ZA2B 3C8YA 4NXMJ 1RA6A 1E6VB 2HFNA 4ZA1A 2DB1A 2XSJA 3QZ7A 3PO5A 2ZNYA 1RT7B 2MKJA 4KHMA 3Q2TC 1EX8A 2J0XA 4IOCQ 4CH7A 2YKNA 3ZFVA 1K0TA 1U7LA 4AXJA 3T1YJ 1AW0A 3NAIA 1JNZB 1HL6A 2GW8A 1RWOB 5B0CA 4DV4J 1VQPS 1DTQA 1M0SA 2ROGA 4DG1B 3PTWA 3QLHB 4O3SA 3KJVA 5A6WA 3HT0A 2V8PA 2C3YA 1ZAXA 3CCSS 3FSIA 3QJJA 2Z30B 3NNCA 2CVEA 4LT6A 3HVAA 4LF6J 4HHUA 3G87A 4RW6B 4MTPA 4J37A 4JI7F 4IOAQ 1DURA 3CDAA 4OZ5A 4UY8T 1WEXA 3OTCA 4JB8B 2XMMA 3MEEB 1N56A 1UPPA 3C3LA 5IT0A 1RTHA 5KG5A 1RAAB 1VBYA 2I5JB 2CIMA 2V50A 3CJ5A 1SH0A 2XI2A 5THWA 1XBWA 1KONA 2BW2A 2DO4A 4Y3CA 4QWAA 3T6BA 1GMWA 4HYKA 2CWKA 5AE1A 3U7JA 2BJ3A 5BR8J 3PX6A 1Q4RA 2HHTA 2KKHA 3DOKA 4KGXB 4IO9Q 1QJHA 3DYAB 2C28A 2C2KB 5F9LA 2VG5B 3CO9A 1FD8A 2CQ4A 2CYYA 3NGDA 2Q79A 3ELHA 5T7LA 4G1QA 4CRJA 1OQ6A 3UN5A 2A2CA 1HBUA 3I0SB 1Z2ZA 2YXLA 1RWUA 3MAQA 3TNVA 1MROB 3SQOP 3JTOA 1UZHA 1HQEA 3D1OA 2I2YA 5LMUF 3MUTP 3UW1A 3BBBA 4OLPA 2XMTA 3TA2A 4KQZA 3UVJB 2BUNA 5J2NA 4IRKA 2Q43A 2J6SA 1RTJA 1S0OA 4J9KA 2HKEA 1TTHB 2VG7B 5B08A 4OYAA 1RTIA 4PAAA 4DZ6A 2CNOB 1GAOA 3TX0A 2XHCA 2ZNZA 3MFHA 1Q16B 2VB6A 2ZOFA 5CZVA 1WG4A 4X66F 4F3QA 2ILYA 3PJXA 4KY3A 5D4LA 2AF6A 4IKAA 1E6YB 3V81B 2OTJS 1RAOA 4OYWA 2F3JA 2H3EB 2KVQE 2KYZA 3VF0B 3O3LA 1IBMF 1TVRA 5CZXA 1EP4B 4ILMA 3CMQA 1P27B 1P1TA 5BYRA 5HQ8A 1LFWA 3QO9B 3WZ0A 4IDKB 2LA6A 3N79A 4EYIB 3DRYA 3J7ZT 3Q23A 2OUGA 3BO2A 1UMJA 4IFYB 2MY8A 1J5EF 1HNWJ 1ZPWX 3WDOA 4Z2XA 3MXHP 4QU7A 1X4AA 5DG9A 5HAOA 3CJKB 1N36J 2HHHF 1TL7A 1I94J 1UVKA 1HNVB 3EDQB 2DNQA 1AZSA 3VGUA 2HHXA 3TA0A 2FHOB 1KFDA 2RS8A 5A0YA 3BYRA 4IR1A 5C2GA 2MHNA 3GILA 4MIAA 4ZPAA 5F8LA 2M5YA 1BQMB 1WHYA 1S5ZA 3C6UB 4DQIA 4NMLA 3LP1B 1VHFA 1X9MA 2AJQA 3M9OB 3ETOA 2Y3YA 1FRLA 2JHEA 2L48A 3H7HB 2IAJB 1G2EA 4A8FA 2R2SA 5KT2A 5MAOA 1JWWA 1CS4B 4K4ZA 3ZTSA 2XI3A 2WVEA 2HS0A 2XY5A 4ZVQB 3OD2A 2EG1A 2RQCA 4TU9A 3AB4B 2HZVA 4OX7A 2FYXA 3CCWA 2HWTA 3MEDB 4QYRA 4XO0A 4NA2A 5J2PA 2XYHB 1N4LA 1HIYA 3KLHB 5J2MA 1HR0J 1IJFB 1JJ2R 2AYEA 5I3UB 2OAUA 1S1XB 3IP0A 2CFXA 2UP1A 4MIBA 2A0FB 1WNEA 2YWKA 4DCOB 2DISA 2KL8A 5C7PA 3GYGA 1S4FA 4C8ZA 3V6DA 2V2QA 5EX3A 5I3PA 1YJWS 3A3NB 2ROPA 3TJAA 3MM5A 3N6MA 4ZOSA 2XLJA 4X4VA 4FS1A 2MZQA 2FZCB 2PFDA 1FJEB 2LFVA 1J5OB 2PN6A 3LWLA 4CYUB 2MKSA 3KLIA 1JLFB 1RT6A 1IR2A 3GCWP 1Q82T 2IM1A 3A12A 4NLRA 2E5IA 2APOA 3R7BB 1MG7A 1N52B 3D7SB 4Y6IA 2LQ8A 2H5EA 4C3KA 3WX8A 3CDBA 5HL7Q 1Q81T 2IDEA 5KFXA 3MCNA 2AGOA 2MHEA 2R9LA 5IWAJ 2N4CA 4J9RA 4MKBA 4CNYA 3PVXA 1PYOB 2FJVA 4X4QA 2IRYA 3FBBA 1NHVA 5IT4A 2DCUB 1KHVA 3N01A
chains in the Genus database with same CATH topology
2Y8WA 4U7UD 1WJ9A 5CD4A 3QRPA 4QYZK 2Y9HA 5H9FK 3QRQA 5H9EK 3QRRA 2Y8YA 4DZDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y8W A;  4U7U D;  1WJ9 A;  5CD4 A;  3QRP A;  4QYZ K;  2Y9H A;  5H9F K;  3QRQ A;  5H9E K;  3QRR A;  2Y8Y A;  4DZD A; 
#chains in the Genus database with same CATH topology
 4W90 B;  2ZHA A;  4HH1 A;  2IC3 A;  2G0C A;  2KRR A;  3LP0 B;  4DSE A;  1YDL A;  2D3O R;  4Y0F A;  2RRB A;  3V2U C;  4PQU B;  4O4G B;  5D4O A;  2Q6B A;  5KFE A;  1KBR A;  1UKU A;  3IWN C;  1JB0 C;  1PAU B;  1H98 A;  1JLA A;  3AAW B;  3V6J A;  3CE8 A;  3P49 B;  4N7T A;  1NRK A;  2RDJ A;  2DKO B;  1Q7L B;  5IXU A;  5LJ3 Y;  2WW8 A;  5DG7 A;  3I5C A;  2XB2 D;  4A46 A;  3CCU S;  3T5K A;  3MM9 B;  4AL6 A;  2NZ4 A;  3D66 A;  3IWL A;  4Q7A A;  1TFW A;  3H2L A;  1DTT A;  5HVG A;  3QRP A;  2LKZ A;  1U4B A;  1OMS A;  4KV8 A;  5F8G A;  3IA0 A;  2BAC A;  2PEH A;  2XSJ B;  3KHL A;  4OI1 A;  4M5N A;  2AYM A;  5DRK A;  2HAI A;  6FDR A;  3WX4 A;  3NOG A;  4P7V A;  2B9W A;  4F25 A;  2GQ2 A;  5DZ6 A;  1GXL A;  1UEV A;  4J90 A;  3EPI A;  2PT0 A;  3DKD A;  3KJV B;  4O44 B;  4KGZ B;  1N5T A;  2Z2M A;  4P71 A;  3W5Z A;  5GME A;  5KFJ A;  1B99 A;  3R5J B;  2VJV A;  3OPK A;  1JLE B;  1FK9 A;  4F36 A;  3NGS A;  4J91 A;  3TWZ A;  4ZVP B;  5A2Q Y;  4QOT A;  4Y2A A;  5B7W A;  3R27 A;  1TAU A;  3I6P A;  1IKV A;  3MI7 X;  5C5J A;  2DNZ A;  3W66 A;  1F3F A;  4DLG A;  2HVH A;  1Y9O A;  4DR4 J;  2KYX A;  1RTH B;  4FPI A;  1NH7 A;  4TNO A;  1RKJ A;  4B17 A;  4ZVT B;  4FBT A;  2JH3 A;  3BO3 A;  1D1U A;  2JVR A;  4NZ6 A;  3KHG A;  5AJ3 J;  3QSY B;  1XNQ J;  4PG4 A;  5A8W B;  5HQL A;  2FVS A;  1TL5 A;  3DOK B;  3DGP A;  1GX5 A;  4CO5 A;  3HO1 A;  4NL5 A;  2QT7 A;  3ZC4 A;  4DCJ B;  4O4R A;  2DGX A;  3RZA A;  2JL9 A;  2UUA F;  4WFY A;  1XNR F;  5T7L B;  2H54 B;  3D1Q A;  2YWG A;  3SXL A;  1HBU B;  4JP8 A;  2LA4 A;  2MQQ A;  2MQM A;  2HFV A;  3NCQ A;  1YK9 A;  3CWJ A;  4NLU A;  2IYG A;  5D6G A;  5GAE U;  1WEZ A;  5J1P A;  4RNN A;  1NJX A;  1HQE B;  3PG9 A;  5AXM A;  1D09 B;  1WC0 A;  3GIJ A;  2MKC A;  1FVS A;  2WBM A;  4OZ3 A;  4U67 Q;  2HYI B;  3NGK A;  2VC0 A;  4MK9 A;  4BBY A;  3PIO Q;  3FSY A;  3F56 A;  1RTJ B;  4WU3 A;  2LDI A;  2GIQ A;  4NLV A;  1H6K X;  5CA5 A;  2QSW A;  2FJW A;  2M88 A;  4DOZ A;  1U0H B;  1DQ8 A;  5L9N A;  3Q8U A;  2VDI A;  1KQS R;  2HS3 A;  2BEF A;  4DV1 F;  3CJ2 A;  2DNK A;  1FXL A;  3HUL A;  2HSE B;  1XMQ F;  3NG8 A;  4ES1 A;  4B3R F;  3HVW A;  1TVR B;  5LMN F;  3ET6 B;  1U1P A;  2BX6 A;  1A0O B;  2IMO A;  3OUY B;  2NSC A;  3C6T A;  4O23 A;  4RU9 A;  1YQH A;  2DD8 S;  2HQG A;  1S0M A;  1WSV A;  3OL7 A;  3MUR P;  5L39 A;  1Y11 A;  5HRO B;  3MD3 A;  4N5S A;  1CJU A;  2BRK A;  2M9K A;  1L3U A;  2KO1 A;  3S1T A;  4C9D A;  3EX7 B;  3KLF A;  2H48 B;  1LQ9 A;  1FX4 A;  3DI6 A;  1SL1 A;  2MZT A;  3IRX A;  2B8Q A;  1MU2 A;  3TQ1 A;  3P3D A;  2DO0 A;  3CPW R;  2NPI A;  2PDA A;  2OD6 A;  4RLE A;  4BLG A;  2R8K A;  1FD2 A;  2CPJ A;  5A0Y B;  1VQY A;  1M1K T;  2IBO A;  1QVF R;  3KDN A;  3HF5 A;  2W7O A;  4CLU A;  3TVZ A;  1ELO A;  2XZW A;  1R31 A;  3OTO F;  2HFS A;  1IVZ A;  4OI2 A;  3HDS A;  2K1R A;  3OL9 A;  2VHG A;  1UTA A;  1D9F A;  3CF5 Q;  3KUH A;  2OPS A;  1RZM A;  2XZD B;  4BS2 A;  2J76 E;  2RAQ A;  2C3U A;  2C2Z B;  4WF9 Q;  3CIM A;  3M8P A;  1SL0 A;  3RRH A;  3AA8 A;  3PW2 A;  1X5O A;  3OQ2 A;  4NYP A;  4ES3 A;  3Q22 A;  5FDL B;  4IH6 A;  3I82 A;  1T02 A;  1FER A;  4DPX A;  4N41 A;  3JAM Y;  2HNZ B;  3VTI A;  3ZTO A;  4ZPV R;  1NHU A;  5HP1 B;  2EBG A;  2V2V A;  3FKB A;  2CPE A;  5KT4 A;  2DGV A;  3IGV A;  5J2P B;  1FVQ A;  4H4K C;  1NSA A;  5J2M B;  1SPB P;  1BQX A;  3OBI A;  3GP9 A;  2AEJ A;  3IBF B;  2GNK A;  5H1S V;  3NKY A;  2B9E A;  4ED0 A;  4ZS6 A;  4LSL A;  3H98 A;  3TW0 A;  3JYT A;  4RWX A;  5HBM A;  1WC4 A;  3L09 A;  3HT3 A;  2OLW A;  1RKI A;  3RJM B;  5RUB A;  2NXN A;  3V6D B;  1AYE A;  3MM8 A;  4NCG A;  2XZT B;  4U7C A;  2CPY A;  1VQO S;  3AH6 A;  4BCA A;  3MM5 B;  2FLL A;  3W65 A;  4PQA A;  1VI7 A;  3GR1 A;  1IWG A;  3HHL A;  4F7V A;  2KG0 A;  4DR2 F;  1N33 F;  3PY8 A;  4LF4 F;  2M8H A;  2KI2 A;  2WOM A;  3W9I A;  4Y2C A;  4WIQ A;  1U6F A;  2WBR A;  1PYT A;  1RSC A;  4DS5 A;  1L3T A;  2VG6 A;  4PZV A;  1RT6 B;  2HG4 A;  3M8Q A;  2FIU A;  4LSN A;  3DLE A;  1OYD A;  4MKV A;  3KJN B;  4MMO A;  1T95 A;  5I4M A;  1S79 A;  3JSB A;  2UU9 F;  5JXS A;  3ZO7 A;  3IAM 9;  3MMC A;  4FYY B;  4NXN J;  3FZ2 A;  4AFF A;  1XR6 A;  1L5U A;  4JI4 J;  4ED8 A;  2AGQ A;  2XYP B;  4Q8E A;  2JEJ A;  3K5P A;  4I2P A;  1QSY A;  4H4O A;  1NEE A;  1VIS A;  2V8H A;  3MMB A;  3ISN D;  4GRS A;  1BQN A;  1OQ3 A;  3G71 S;  4LQ9 A;  3QT5 A;  4HR2 A;  2C42 A;  3M8Z A;  4JOU A;  4PYD A;  2YWW A;  4F3M A;  1NHK L;  2JDJ A;  3NL0 A;  2OEM A;  1QDU B;  3HKW A;  2FJE B;  2HPU A;  1Y5L B;  5I3Q A;  1KNZ A;  1YKW A;  3B82 A;  2NS1 B;  5JVH Q;  3BQ0 A;  1XR5 A;  4OZ0 A;  3HHL C;  1SQG A;  1TMM A;  2B51 A;  3C2P A;  2RUS A;  2C2O B;  3JSR A;  4ZVU B;  3HLU A;  5M2U A;  3AHP A;  4WFZ A;  4NZ0 A;  4YN3 B;  4I68 A;  4QR1 A;  5CYJ A;  1LWF B;  4NLT A;  3TEG A;  2DNY A;  2HMI A;  3SV4 A;  4OI6 A;  3E8O A;  2C2R A;  4KV8 B;  2R42 A;  1X4E A;  2F8M A;  2RT3 A;  3BKU A;  5L1K A;  4ECV A;  1YJR A;  3FQK A;  3R7N B;  4UST A;  3TOQ A;  3FEY B;  2BE2 B;  1H7X A;  1SUQ A;  2CJ9 A;  2ADC A;  1JKH A;  3ZZO A;  3R2C J;  2P9G A;  4ED2 A;  1WD6 A;  1NDL A;  4J9S A;  2F1F A;  2DXE A;  4DL2 A;  4EEY A;  3H5Y A;  1CJV A;  2YNI B;  1G4C A;  4X4T A;  3NNA A;  2R7X A;  4OFZ A;  3G9C A;  3R6G B;  3NBP A;  4Y00 A;  2O67 A;  3GV5 B;  2Z0G A;  3POT A;  2CJY B;  1QD1 A;  4KIA A;  2F65 A;  1XNR J;  1FK9 B;  3SSR A;  2ASL A;  3ZZP A;  1RXO B;  2VJU A;  1MW7 A;  1RYS A;  3K8W A;  1AFJ A;  1O51 A;  2AU0 A;  4W4M A;  1VQ6 S;  5D0H A;  2UXC F;  5BYS A;  5H9F J;  1IKV B;  3K5L A;  3H5U A;  4DV6 J;  3A8J A;  2QFI A;  2RQK A;  1UCN A;  3HHN B;  1YHQ S;  2P9C A;  1V3R A;  5F8H A;  1NZ8 A;  4ID5 B;  4WTO B;  5GVQ A;  1TKZ A;  1R8P A;  1B7Y B;  3KDO A;  4JYA F;  2VBY A;  2XMA A;  3MD1 A;  2UXD F;  3M7V A;  2J9D A;  4DR5 J;  4HEA 9;  4LIW A;  4FP9 A;  3MOJ B;  1S9E B;  3RBX A;  3DGP B;  4F2R A;  1G3O A;  4EGL A;  1S57 A;  2DNL A;  1FKA F;  4DV2 F;  3AXM A;  3T9N A;  3BV8 A;  3FDS A;  1RWP B;  2FC9 A;  3KLV A;  4C97 A;  2DGS A;  3IM8 A;  4J7C A;  4TQS A;  1LW0 A;  2F4V F;  1IM6 A;  1WOS A;  1HBM B;  1HNX F;  3G2X A;  4TKT A;  5DQI A;  2QLW A;  3W9H A;  4F0H A;  2OO4 A;  1WF1 A;  5DLG A;  4C8Y A;  1Q5Y A;  1R0C B;  1WOO A;  2MYF A;  4C8M A;  2DHG A;  3CED A;  3J7Z 5;  3D6T B;  1HMV A;  3R5A A;  4N76 A;  2F9D A;  4TY8 A;  3DLK A;  3ZTR A;  1HWI A;  2DGT A;  3E51 A;  2C2E A;  4I6A A;  3FCV A;  2VV5 A;  4RBT A;  1VC5 A;  2MMY A;  1LOU A;  2IJF A;  1SH3 A;  2VC1 A;  3J81 U;  1F1B B;  2H51 B;  3MR7 A;  2C2D A;  3BGU A;  3MMA B;  3JQJ A;  4O0I A;  3OHA A;  3OLA A;  2VPZ B;  4ED1 A;  1FDA A;  4ZCL A;  3Q8S B;  4DR3 J;  5M2R A;  2RKI B;  4ZJO A;  1F5C A;  1VRU B;  3VQT A;  5F3T A;  1N8R T;  5FD1 A;  3W60 A;  3VWS A;  3DLB A;  5HMX A;  2ZM6 J;  2QC3 A;  3BSN A;  1SJF A;  2E1A A;  2DNP A;  3FRY A;  3T5H A;  3D3C J;  1XK8 A;  4FF4 A;  1KLM B;  1LNQ A;  2HVI A;  1JJH A;  1PC5 A;  3OR1 B;  1VQS A;  3PKY A;  4Y65 A;  3C15 A;  4KGV B;  4ECW A;  3I9V 9;  3TJ8 A;  1CJU B;  2W9C A;  3EZU A;  4P73 A;  4ELV A;  3UFC X;  4FBU A;  3T1H J;  2W7P A;  3IC1 A;  5ETR A;  5H9F K;  1RWV B;  3KUE A;  3NS7 B;  2QA4 S;  3DI6 B;  2COL A;  3NCR A;  1S77 D;  3CW2 C;  1C1B A;  4OV1 A;  3OVS A;  1F0X A;  1U1N A;  2HBQ B;  4IYQ A;  2QFJ A;  2D9P A;  2NCK L;  2G2Y A;  5IV4 A;  3NWR A;  2X7I A;  3H5X A;  5HAN A;  3TUZ C;  3PJW A;  2FB0 A;  2ZH1 A;  4U8Y A;  3A3P B;  1IUJ A;  3BBC A;  3MEG B;  4DLE A;  4ILR A;  3M6X A;  4P2F A;  3DDK A;  5CYM A;  2L9D A;  3QRR A;  1RAC B;  3KNA A;  2DR7 A;  1YRU A;  4CO3 A;  1PC4 A;  1NK5 A;  2OPS B;  8AT1 B;  3T5J A;  3MTJ A;  5HVH A;  3Q24 A;  2HFZ A;  1RHM B;  4KFB B;  4PG7 A;  3D0H E;  1FNX H;  2YBV A;  1RK8 A;  1FNM A;  2YNF B;  2NSB A;  1RAI B;  1VMB A;  4C11 A;  2EXU A;  3W62 A;  4NRT A;  1S7H A;  1Y0H A;  4ALZ A;  2F4F A;  3DLL Q;  2DGQ A;  2P9E A;  4NLQ A;  4HDG A;  3OXG A;  1OWX A;  5EDW A;  4ZJQ A;  1IBL F;  3N5F A;  4IR9 A;  1ZS6 A;  2XBP A;  4OJ3 A;  1RWX B;  4GO5 X;  3PW5 A;  5ETN A;  2MLX A;  5HBM B;  1WC6 A;  2B7C B;  1D0E A;  4I7F A;  3D2W A;  1UWA A;  4ECR A;  4FYV B;  1T8E A;  4JUZ A;  3BKT A;  4NCG B;  3MM8 B;  1WEL A;  5I42 B;  3IG1 A;  2MGZ B;  3DDN A;  3M2R B;  5D78 A;  4X62 J;  4EMD A;  3HSD A;  1KTV A;  1IQZ A;  3VAF A;  2QIF A;  1D9D A;  4X4S A;  2HLT A;  2KXN B;  3VAK A;  3US5 A;  2DNH A;  3NXZ A;  3M6V A;  3DN9 A;  4K2X A;  1RT1 B;  3BDP A;  1A9N B;  2ACY A;  1FKP A;  2GAG C;  1HHT P;  2VG6 B;  4KRW A;  2Z56 B;  3RRG A;  4LSN B;  3I5B A;  4V19 J;  3DLE B;  1X0F A;  1ACM B;  2LDY A;  2A10 A;  2AYB A;  2M52 A;  2KU7 A;  3H8Y A;  3ETM A;  4I6W A;  4ZP6 A;  3MMC B;  3D4J A;  2BQU A;  3SCK E;  3CDE A;  4P6Q A;  2FJD B;  1VC0 A;  1T3O A;  1YRT A;  2G1D A;  1X0P A;  2AEF A;  2E9R X;  2JC1 A;  2V2Z A;  5F8I A;  2FVQ A;  1M5V C;  2XYG B;  2J7K A;  2HFU A;  3MMB B;  2ZUG A;  4ED3 A;  1CC8 A;  1P1L A;  3TI0 A;  2XMK A;  4TU8 A;  2IDL A;  1SC1 B;  4G1I A;  3Q0A A;  3P4U B;  1XQI A;  2RF2 A;  2R8I A;  1K1Q A;  3UN2 A;  1M5S A;  4RPF A;  3MR3 A;  4R25 A;  1TL1 A;  2UXB J;  3JS9 A;  2W7A A;  2P5V A;  2AEM A;  1QLN A;  1P9Q C;  1HWL A;  1JXV A;  1VRT A;  5KFT A;  1LV5 A;  5C42 B;  3MCS A;  4LR8 A;  2R7U A;  2RD5 C;  4ZP7 A;  1YJ7 A;  4WZQ A;  3HZG A;  1RWM B;  3TP2 A;  3U1M A;  3DOM B;  2F7V A;  4K4V A;  4ZJL A;  4IQM A;  4K5R A;  4WFX A;  2MST A;  1RUS A;  5FLX U;  2QX0 A;  2J0S D;  3CJ8 A;  1U48 A;  3KTQ A;  4KR0 B;  5AE2 A;  1VQ8 S;  3HP6 A;  1YJN S;  5DGA A;  4NEY A;  2RQ4 A;  2QL9 B;  1MSW D;  2BJ9 A;  3UQS A;  4ZIV A;  4M5L A;  4F0M A;  2QL5 B;  4MIW A;  3CC4 S;  4NCB A;  5DQG A;  4N8O A;  3ISZ A;  4JBC A;  5A8K A;  4DL7 A;  3MFI A;  1N34 F;  1C0U A;  4M5D B;  2MTL A;  3L7U A;  3VAL A;  2VH7 A;  1EZZ B;  4CT9 A;  3W64 A;  3EVW A;  3FMB A;  3GR0 A;  4E0D A;  2CG4 A;  2CJX B;  3I5A A;  3EZO A;  1RT2 B;  2AZ1 A;  4A8Y A;  3AD9 C;  3JXO A;  2CQD A;  1KOO A;  2E44 A;  3DOL B;  3M8S A;  2B43 A;  4JI2 F;  2FHK A;  1T9V A;  1NDK A;  3DLH A;  3I0R A;  1WC1 A;  2IFX A;  1VQL S;  3POT B;  1FX2 A;  4WK3 A;  3J7Y U;  1IR1 A;  4USV A;  4UT4 A;  2GVD B;  2VFT A;  2OML A;  4NLX A;  3MPW A;  4OX9 F;  2ASJ A;  2Q3P A;  2G0J A;  2G9O A;  4RBV A;  2FJX A;  1B4S A;  2DNG A;  4AYB D;  2AW0 A;  3CME S;  1B0P A;  1UEU A;  2HFO A;  1VIX A;  3BR8 A;  3UDL A;  1IJE B;  5KFD A;  4LF5 F;  1I3O B;  2LVW A;  3R1L A;  4GO7 X;  3PRD A;  4LFB F;  3BS9 A;  3D28 A;  1TKZ B;  2DRA A;  1OSC A;  1SKU B;  3DLG B;  4KH1 B;  4YME A;  5KFN A;  1EB0 A;  2WSE C;  4MKA A;  2PD1 A;  5AXN A;  2N82 B;  1UP1 A;  4KC5 A;  4A8O A;  1K0V A;  3S7R A;  5HMZ A;  1N32 J;  2MKY A;  3O44 A;  4IQX A;  5KFB A;  4NLW A;  1Z1Z A;  1RA7 A;  1KHW A;  1XR7 A;  1NH8 A;  3ZNJ 1;  4EFA C;  2YKP A;  2LMI A;  4RUC A;  1FRJ A;  3K8V A;  2CJK A;  3BYP A;  3D68 A;  5HLF A;  4WP3 A;  4W92 B;  2OEK A;  1TKT A;  1FES A;  2WB4 A;  1HMV B;  2OMO A;  4MYU A;  2BQR A;  2YNH A;  4QWB A;  4TY8 B;  4MAK A;  4XPC A;  3C14 A;  2ZJP Q;  4DPU A;  3PM9 A;  1XMO F;  4DSL A;  1NKC A;  4IUF A;  4X65 F;  1UJ6 A;  4RW9 A;  1VR6 A;  4NZ7 A;  1GH8 A;  3DRP B;  2X1F A;  4IRD A;  5FJ4 A;  4ERD A;  2ZDP A;  2ZKT A;  5E33 A;  1GTE A;  5IT9 Y;  4RJV A;  1PSD A;  5GAG U;  3T3F A;  4IH7 A;  1SJ1 A;  5KFL A;  3RAX A;  2EVZ A;  1NJI T;  3TZX A;  2ZH3 A;  2XUL A;  1TK8 A;  4JI0 J;  3NMA A;  1MWQ A;  2ZH7 A;  1HYS A;  3HX9 A;  2DY1 A;  4CO1 A;  2W2O P;  4C0O C;  3J80 Y;  1FXR A;  1LK5 A;  3UCZ P;  2LCW A;  3WIU A;  5C24 A;  2D69 A;  3JTP A;  3N6L A;  4DR7 J;  2CPD A;  5DJB A;  3G96 A;  3ILL A;  2W9C B;  3D0G E;  3LGM A;  2W1B A;  3GTY X;  3W2W B;  3KUG A;  1WOP A;  4F3O A;  4TLR A;  3PYF A;  4WBF A;  2GGP B;  1BHN A;  1S76 D;  2DXF A;  5KG1 A;  3N28 A;  2QN6 B;  2HQ3 A;  4RNF A;  1C1B B;  4ETX A;  2KM8 C;  2ACM A;  2FTR A;  4K0K F;  1Y5N B;  4C3L A;  1IBL J;  1Q1K A;  3BDE A;  3GCX P;  1RIS A;  1UL3 A;  4FYW B;  3RRK A;  4ZIT A;  3LPY A;  3MEK A;  4OYM A;  4OIX A;  1S49 A;  2FGO A;  2V69 A;  1SC4 B;  3MM7 B;  2QL7 B;  4DJB A;  2M4M A;  3LGH A;  1IBK J;  2J5A A;  4WXO A;  4B3T J;  4LIR A;  4FXV A;  5CYM B;  1R43 A;  2UVV A;  3SCI E;  3QID A;  5T41 A;  1IR0 A;  1T03 A;  2VPW B;  3H59 A;  2ATC B;  4PRF A;  1U45 A;  3T1Y F;  3A8I A;  5HQM A;  2XCA A;  1VGY A;  4U9R A;  1S6P A;  1FF2 A;  2DIU A;  4QW8 A;  4YR0 A;  2IVY A;  4QWE A;  4OX8 A;  4L3K A;  4DV4 F;  4C11 B;  4ZMM A;  4HI2 A;  3IXQ A;  1EQM A;  2DNM A;  5K14 B;  4WZM A;  4ZPD A;  2PMZ D;  4OJH A;  5L9X A;  5JMN A;  2E1R A;  3IS9 B;  4LF6 F;  2QLJ B;  4OLO A;  1SBR A;  3EVM A;  4N8N A;  3FCW A;  3NNH A;  2E7V A;  4QU6 A;  1RHU B;  4J5O A;  4ZPC A;  3GMG A;  3LPE A;  1S1V B;  4OZL A;  4I7F B;  2B4O A;  1GMW D;  3TA1 A;  3ONQ A;  5EN1 A;  3P96 A;  3W3S A;  4K50 A;  5FII A;  4MH8 A;  2XLI A;  4EU0 A;  3KK2 A;  3BBF A;  3ENV A;  4FS2 A;  4USI A;  3NEK A;  3LAL A;  1T05 A;  2WVC A;  1VQ9 S;  1F2H A;  3VAI A;  2ZC3 A;  2X51 A;  1UA1 A;  2J0Q D;  4IRC A;  1AA1 B;  2MKH A;  4HTI A;  1FKP B;  3QGG A;  3IR6 B;  1FJG J;  3TAN A;  4L73 A;  3TO8 A;  3OR2 A;  1D8Y A;  2MJN A;  3UI3 A;  2Z2L A;  1CJT A;  1PKU A;  4B9N A;  1LEO A;  4DF4 A;  4QIW D;  2BOP A;  5K8P A;  4ZN1 A;  1IXK A;  1KVI A;  2CZ4 A;  1VHI A;  1F60 B;  1QTN B;  3PHE A;  4RW4 A;  2NXC A;  2KDO A;  4PPD A;  3M8W A;  3IRW P;  2KG1 A;  3W5X A;  4CH1 A;  5E3C A;  1KRP A;  1F9F A;  2J9D E;  4Y28 C;  1N34 J;  3KJF B;  1NPR A;  2X3D A;  5EWG A;  3DHX A;  3TAM A;  3PHT A;  4RKU C;  4OZ1 A;  4CLP A;  2MQP A;  1LWX A;  3ZTQ A;  4ECY A;  1DQ9 A;  2EI5 A;  3GV7 B;  2VUG A;  1KQK A;  1TL1 B;  4UTG A;  5HMY A;  1WUU A;  3KMS A;  3HM9 A;  1EHW A;  1VJW A;  1JK9 B;  4YB6 A;  4JI6 J;  4I67 A;  2FZG B;  2JEF A;  1K47 A;  1VRT B;  5SUH A;  4M5K A;  4PWD A;  4RR5 A;  2Y0B B;  4KO0 B;  4BC9 A;  3MAH A;  3LUY A;  3PEH A;  2H9Z A;  2G2Z A;  3AB2 B;  2V4R A;  4XAK A;  2DR9 A;  3Q89 A;  2HVZ A;  3I4P A;  2CNK B;  3HSG A;  3BH7 B;  3T9Z A;  2GIF A;  1U1K A;  4XTT A;  2CJA A;  2ZD1 B;  3VR1 A;  4EZ9 A;  4DPY A;  3VVU A;  4CM2 A;  3AXK A;  5A8K B;  4FKX A;  4Q45 A;  2GMH A;  5D77 A;  4FNH A;  4Q44 A;  3TUP A;  1HNW F;  4CO4 A;  4UOC A;  4DS4 A;  2DEJ A;  1Q78 A;  2HND A;  4DFK A;  1K1S A;  2O3D A;  4H54 A;  1FDB A;  3PIP Q;  5E3R A;  5KFI A;  4DQP A;  5AE3 A;  4I4B A;  2DNO A;  1N36 F;  3UWT A;  2HRT A;  1I94 F;  1NJW A;  3HKZ D;  1FRI A;  3BF4 A;  3TEH B;  1TEL A;  2FVP A;  3HXM A;  4DBQ A;  2KZZ A;  3K5O A;  3ZXW A;  2HIQ A;  3N0V A;  2OPR A;  1OJ4 A;  3Q8Q B;  1YWX A;  1YI2 S;  2R7R A;  1LW2 A;  4LRF A;  3IM9 A;  4PXD A;  4CO0 A;  3H25 A;  1MMN A;  1RAH B;  1KC8 T;  2VA3 A;  2W9B A;  2BJ8 A;  1FKO A;  1ZM3 A;  4O3P A;  3SMZ A;  5K8O A;  2V94 A;  1T94 A;  4GVB B;  2D3Z A;  1KOH A;  4DX6 A;  1OPZ A;  2EKN A;  1EIY B;  1SJQ A;  1U6B A;  2YTC A;  3HVR A;  3OLB A;  3TAP A;  1S0N A;  4YEA A;  3L95 X;  3TJ9 A;  2C1E B;  2IPO B;  3TVK A;  2D9O A;  3J7A 1;  3FJ2 A;  3LGN A;  2CQG A;  1F9H A;  5L8R C;  2EFP A;  1EET A;  4RBU A;  2FLN A;  1RBL A;  1GTH A;  1HR0 F;  1LXJ A;  1CSJ A;  4ECX A;  1VQ7 S;  3H4B A;  2Z4P A;  3SCL E;  4CZC A;  3O1L A;  1S1T A;  1IKW A;  3PR4 A;  4D3G A;  1HWJ A;  2DH7 A;  4RZR A;  1CJK A;  1QTM A;  4DI6 A;  3F73 A;  5DDQ C;  4ZN3 A;  1C0T A;  4ECT A;  1AUS L;  1LWC A;  2W2M P;  1KTQ A;  3S8S A;  4GC7 A;  2VFR A;  1N88 A;  1RGV A;  2A6M A;  4QIV A;  3NP5 A;  1TKT B;  5M2P A;  1VQN S;  1BC6 A;  1JLB A;  5K8N A;  1EKR A;  3QT7 A;  1MLA A;  3O6Q A;  4RW9 B;  3D6H B;  5G4D A;  2YPY A;  4GMK A;  2BV3 A;  4E98 A;  4KT0 C;  2KFZ A;  1OY8 A;  1PAE X;  1U0S A;  1RDR A;  3UNY A;  4K4S A;  3AQP A;  2E7X A;  4NRU A;  3W2V B;  2JLG A;  4WJB A;  4MJK A;  1ROF A;  1XMB A;  4FXD A;  1Y5I B;  4X4P A;  3CJ0 A;  1N6Q A;  2RIL A;  3SQG A;  2F8H A;  2XY7 A;  4RW8 B;  3I56 S;  4L6V 3;  1MN7 A;  2FZK B;  4B9U A;  5IWA F;  2NUU G;  1V5I B;  3CTR A;  2A2D A;  2C3O A;  3TZW A;  5F0W A;  4YFU A;  2EPI A;  3M2U A;  2XNR A;  2FHJ A;  2ZH8 A;  4F4Y A;  1R0A A;  2R7W A;  2OPP A;  3MOZ A;  3CVK A;  2WSF C;  2LEB A;  3TAR A;  4K2J A;  3RW6 A;  1P9Y A;  1U02 A;  1ZZN A;  5C24 B;  6FD1 A;  3EUN A;  1QM9 A;  5LL6 d;  1I1G A;  3NLC A;  2QA2 A;  3P8B B;  3MCM A;  5KFC A;  1MMD A;  2BR0 A;  5EWF A;  2N3O A;  4PWU A;  4ZHR B;  1IN0 A;  1MWY A;  4LF2 A;  2NRE A;  1GT8 A;  4A8X A;  4DU7 A;  3GIK A;  2RB7 A;  2HVE A;  3EXY A;  3DU5 A;  2DR8 A;  4QZV B;  3W8G A;  3M6W A;  3TZY A;  4CTA A;  5ETQ A;  3JTN A;  4WYW A;  1ZM9 A;  5ITH A;  2IM0 A;  1QVG R;  5GAD I;  3TQE A;  2BJ7 A;  4UOG A;  1APS A;  2GS8 A;  2JFK A;  3DRS A;  3ZZR A;  2J6T A;  4KTQ A;  1R8B A;  4RU2 A;  2FJB B;  1U1M A;  3DNC A;  4ITS A;  3FVY A;  2UVU A;  2CDR B;  4HAC A;  4NOH A;  5AT1 B;  4UQT A;  1VDH A;  4PXC A;  5LSO A;  3GJR B;  2AYG A;  1NK9 A;  3EGV A;  4Q2M A;  1JLG B;  5E0O A;  1BWV A;  3Q86 A;  2Z8Q A;  2VFV A;  2JWN A;  3AOC A;  1FRX A;  4JI8 J;  5KFR A;  5KFZ A;  1BLU A;  2W2Q P;  1M1G A;  3W9J A;  4Q5V A;  4CLF A;  1U2R A;  1IKX A;  2HK3 A;  3V6H A;  1C1C A;  3LAK A;  3RB4 A;  1X4H A;  3HSZ A;  3P6Y C;  3W61 A;  4MK8 A;  5E5N A;  3KG0 A;  4MK7 A;  4B9V A;  3D54 A;  5E7O B;  2IBK A;  4LF1 A;  3M1V A;  4HKQ A;  2W8L A;  4IG0 A;  3CO0 P;  4K4Y A;  1XJW B;  3ISN C;  3NMR A;  3K0J A;  4WCE Q;  4U8V A;  5DM7 Q;  2QA4 G;  2WAQ D;  3D1H A;  2GHP A;  4CCH A;  3GJT B;  3DGV A;  5IQ6 A;  1HD0 A;  2HIY A;  1VK3 A;  3THV A;  3BPD A;  4JI5 J;  2OTL S;  3HVT A;  4DR4 F;  4LFA J;  1T05 B;  1U47 A;  2E1M C;  3LP2 A;  1OY9 A;  1XWL A;  4UW2 A;  4L72 B;  2RML A;  2QRR A;  2KB2 A;  2YKA A;  4V1A k;  2M0G B;  5AJ3 F;  1RT3 B;  5ETP A;  5LOQ A;  1XNQ F;  2XEX A;  1X9W A;  4X84 A;  1FDD A;  1H7W A;  4HI1 A;  1CQN A;  5ETV A;  5KG7 A;  5F3Z A;  1TV6 B;  2YKQ A;  3OR2 B;  1HNZ F;  2GA7 A;  2GJF A;  7AT1 B;  4USM A;  3BZQ A;  4F50 A;  1HBN B;  1T9U A;  3H4D A;  2KJW A;  1VBX A;  1Y3K A;  4CH0 S;  4CLY A;  3HD1 A;  3D5M A;  3Q83 A;  3J7A N;  2Y1I A;  5GAH I;  2MJU A;  2LU1 A;  5KFV A;  5KFK A;  2IVF B;  3W63 A;  1XER A;  2HNY B;  4DL3 A;  4WFA Q;  2RUG A;  5A2Q U;  4HHH A;  4CLS A;  3PYG A;  1HBO B;  3TAM B;  4HT7 A;  1B0V A;  1GXU A;  4M5M A;  4Q2L A;  3CSK A;  3UCG A;  1JXL A;  1W2I A;  2OH2 A;  3PW4 A;  2QYG A;  4DV0 J;  2A18 A;  1DLO A;  3AQO A;  5HN0 A;  4NLP A;  4CNZ A;  9ATC B;  2DVI A;  4B3O A;  1UWB A;  5L38 A;  1Q8B A;  4LRC A;  1QAY A;  4ZCK A;  1FHT A;  3V4M A;  3B78 A;  1DFD A;  1SKS A;  1WC3 A;  1WKK A;  2GO9 A;  3DRR A;  4WII A;  4DV3 J;  3UD3 P;  5GMD A;  4RL1 A;  3OTD A;  4DZD A;  4FZV A;  2D1C A;  1JIH A;  2K3I A;  2VOD A;  3Q8P B;  4P7T A;  1KS2 A;  4PKD B;  2RDI A;  3A8E A;  4NCA A;  4F04 B;  3LTO A;  5JVG Q;  3CJR A;  1VK8 A;  3ZZZ A;  3QRQ A;  1R8H A;  4NLY A;  2B4U A;  4ECU A;  1Q5V A;  4QR2 A;  2CPF A;  1FFG B;  4DCP B;  4C98 A;  4IFV A;  2CNL B;  2FC8 A;  1GQE A;  3LAM A;  2QMX A;  1NJY A;  4YY3 J;  2UUB J;  4YDX A;  1U2C A;  2CNN B;  3QFH A;  4F02 A;  4YHH J;  4X2B A;  2P6S A;  2XWX A;  1D9A A;  3AOA A;  4RW7 B;  1RTZ A;  2OPR B;  3OJU A;  3IMQ J;  5IM0 A;  3DCA A;  3O2I A;  4DV5 F;  4DR6 F;  3GYN A;  1LW2 B;  4LFC J;  5D3G B;  4M94 A;  2AJ2 A;  2WW4 A;  2W9B B;  4ER8 A;  4GKK J;  2I9S A;  3JB9 k;  4HDH A;  1IKY B;  1TMJ A;  3WBZ A;  1Z2L A;  1SIZ A;  1B64 A;  2PO4 A;  4NMX A;  3DHW C;  5LSR A;  2PMW A;  2O01 C;  1VIO A;  2Q6C A;  2HHV A;  2GHW A;  1Z4U A;  2QMW A;  2CUY A;  4DG1 A;  1V3Z A;  3A3O B;  2ASD A;  2YX7 A;  1BXN A;  1TL3 B;  2GQC A;  5JUM A;  3DXB A;  1R8C A;  3T1A A;  2BVZ A;  5EWE A;  3I31 A;  3B4M A;  4PXB A;  3CJ4 A;  3M30 A;  1FI4 A;  2CPZ A;  4RW6 A;  1LWC B;  1HAR A;  1M5K C;  2AD9 A;  4C8N A;  3CT9 A;  4BDP A;  4ZVR B;  2AJ4 A;  2C3M A;  3MEE A;  1YX2 A;  2E9T A;  1YJV A;  1JLB B;  4WE1 B;  7FD1 A;  3JSM A;  2BBE A;  1UVM A;  1U24 A;  2V0N A;  2FD2 A;  3PXG a;  2HUR A;  4ZVH A;  4CLL A;  4DL4 A;  2ADB A;  5J1E B;  3CJ3 A;  4ZVG A;  3G8T A;  4YQW A;  1UEK A;  2FQQ B;  2YNG B;  2OSR A;  2CG8 A;  2YWF A;  3X1L B;  3AFG A;  3JAM U;  2C3P A;  1N6Q B;  4ZP8 A;  2JX2 A;  2ATL A;  4FYD A;  3TVY A;  4DR1 J;  4NXN F;  4YB7 A;  4PWW A;  3SZ2 A;  2V8V A;  4JI4 F;  2V2K A;  2K7J A;  3M9M B;  3QNW B;  3P45 B;  2UUC J;  2VQE J;  3M2U B;  4UOH A;  3R3T A;  3PR5 B;  2Y8Y A;  3MUV P;  1RU2 A;  3CCJ S;  3I0S A;  4OJ1 A;  4MT1 A;  2DK2 A;  4I56 A;  3V5R A;  2E7W A;  2ZZM A;  3G6E S;  3EVO A;  3FNN A;  1UPM B;  2CPH A;  2L41 A;  3W1Y C;  4AUK A;  3K7R A;  3QGH A;  4U7U K;  7FDR A;  2YKN B;  2XC9 A;  2LU2 A;  4DUY J;  4ECZ A;  1EAY C;  1R27 B;  4ZCI A;  4O3O A;  3RR7 A;  3UVJ A;  2DTJ A;  1YJU A;  4EUV A;  2CA9 A;  1DTQ B;  3GLJ A;  2POK A;  4LBH A;  1RP5 A;  1N48 A;  3Q8V A;  4MFB A;  3TR5 A;  4WKY A;  3OXL A;  4KAI A;  1FNO A;  5IC6 B;  3R5D A;  3GII A;  4ECS A;  3C46 A;  4CTA B;  3KK3 A;  2M7S A;  4DUZ J;  2E1C A;  5H9E J;  1SB6 A;  1NDC A;  1HWK A;  1NKB A;  1D3W A;  2D41 A;  1E6Y A;  3DFE A;  2KT5 A;  4NI2 A;  2C22 A;  3CD5 A;  2XS2 A;  2J7U A;  4P10 A;  1OS5 A;  1EP4 A;  2AT1 B;  1UJ5 A;  4X4R A;  3UPF A;  4K4U A;  4Y2I A;  2XWY A;  2NXE A;  3EIC A;  3DXS X;  2DY9 A;  3G6Y A;  2EC0 A;  4L3N A;  1KDN A;  4CLT A;  1URN A;  2RS2 A;  1HNZ J;  2LXF A;  3CJK A;  4G3I A;  1C1C B;  3M2V A;  4DL0 C;  3FBE A;  2BYC A;  3M32 A;  1RAD B;  5KFA A;  1AT1 B;  1VS3 A;  4AL5 A;  4QCL A;  4QBU A;  4B3M J;  4G1Q B;  1FRM A;  2XO7 A;  4N77 A;  2KTQ A;  5CQG A;  1SXL A;  2HHP A;  3I96 A;  4KBI A;  2HHW A;  2MXY A;  4YDD B;  1FWP A;  4OQJ A;  5KFM A;  4EBC A;  3QAU A;  3VGS A;  5L1J A;  1T0T V;  4DV6 F;  2A3J A;  5ETK A;  3HVT B;  2JNJ A;  2XMJ A;  4OX6 A;  2D7S A;  5J2N B;  2ABY A;  1VCT A;  1ZM4 A;  4KB7 A;  3FEZ A;  5U47 A;  1UW4 A;  2B4V A;  1G6B A;  2EEY A;  3GJQ B;  3VZI A;  1WEY A;  1N5S A;  2QLF B;  4DR5 F;  2J8S A;  3BSC A;  5E3A A;  1RTI B;  4DWI A;  2P8I A;  3MHY A;  4DX8 H;  1YTY A;  1TU0 B;  3P5T L;  1VLO A;  3KMQ A;  2KXH A;  1RAF B;  3KLH A;  5B0B A;  4YR3 A;  1G7C B;  1ZOT A;  5I3U A;  3LA0 A;  4K4W A;  2NUH A;  3SV3 A;  3SSQ A;  4RUH A;  4NPO A;  4ZP9 A;  3IBW A;  2XHW A;  3K57 A;  2I1R A;  4NLD A;  3J7Y I;  2HW3 A;  5DLF A;  2DIV A;  4FNI A;  1H2V Z;  4JI1 J;  5H9E K;  1B7F A;  1TP7 A;  3RAQ A;  2HEK A;  2E5J A;  2ZH2 A;  4ANC A;  1X8D A;  3FQL A;  4H4K A;  4Y2K A;  4CQ1 A;  3KLE A;  1HWU A;  1J5O A;  3NOC A;  2DH9 A;  4QQB A;  4Y2M A;  1DJ0 A;  2J7W A;  1FEE A;  3MAA A;  4A48 A;  2BKN A;  2YY3 A;  3O5T B;  4CYU A;  1REG X;  1JLF A;  1JJ4 A;  2OPQ A;  1TL7 B;  3UO0 A;  1UVJ A;  1S10 A;  2I6W A;  1Y3J A;  4OYP A;  4ZLJ A;  1UA0 A;  1JLQ A;  2BM1 A;  1AZS B;  1RB0 A;  2IYI A;  4DSF A;  1DLO B;  4DR3 F;  2VQF J;  2CQ0 A;  3SEO A;  2EC2 A;  5DDR C;  1U6Z A;  3ZZY A;  3FFI A;  1S4E A;  1PO6 A;  4B3O B;  1H3D A;  3BQ1 A;  4L74 A;  2B5J A;  3AT1 B;  2LLZ A;  4DXL A;  2X1B A;  2KZM A;  2ZM6 F;  3CUN A;  4DV5 J;  1NCL A;  3K17 A;  4DR6 J;  2H4Y B;  3DRR B;  4PG6 A;  1M5H A;  4DX7 A;  1WKJ A;  2XY6 A;  1NB7 A;  3FUY A;  3OSP A;  3EZ5 A;  3BJY A;  3QMQ A;  1S6Q A;  1NK0 A;  3OHB A;  4BWM A;  2FGC A;  1GMU A;  1X4F A;  5D4P A;  5HVF A;  3OXF A;  4ZPT R;  3T1H F;  2H1Y A;  4DV7 J;  2XTJ P;  2EFN A;  4RWW A;  2PEB A;  1VQ4 S;  3NCP A;  3LP0 A;  3T6J A;  1BGX T;  4DL5 A;  3UR3 C;  4QIF A;  1I51 B;  4KHP F;  4PQU A;  4QYZ J;  2E5H A;  1ZYQ A;  4D3H A;  1DHM A;  4LMZ A;  4AT1 B;  3QPI A;  2LXI A;  1M5P C;  4WP8 A;  1LK7 A;  4USH A;  2LXU A;  3MWB A;  2Y1L B;  4G6V B;  1R8A A;  1XTZ A;  3DM2 A;  1YJT A;  2LEA A;  2N7Y A;  5D4N A;  2B3T B;  3HFZ B;  3TRG A;  4ZDN A;  3PX0 A;  5IM0 B;  2GO8 A;  4TLQ A;  5LSL A;  3NGU A;  1RI7 A;  3ZZ0 A;  4DL6 A;  2ZBP A;  2VPX B;  2HBY B;  2JC0 A;  3H20 A;  2E5G A;  1L3V A;  3I4H X;  1DQA A;  3NS6 A;  3KLI B;  4C48 A;  1TK0 A;  3OW2 R;  1HI8 A;  3MEC A;  3R97 A;  3BKF A;  1IM4 A;  4TY9 A;  1P8G A;  1Q0N A;  2X1A A;  5KT3 A;  2MQO A;  4WFB Q;  3RBE A;  3DMJ A;  4IO1 A;  2MEW A;  2AJ0 A;  1S0V A;  4O44 A;  2P6T A;  2U2F A;  5KG6 A;  4DUT A;  4DQQ A;  2HZA A;  1CG2 A;  3M8Y A;  2IA0 A;  3PW7 A;  1JLE A;  2GVZ A;  3M30 B;  4JV1 A;  4OJG A;  1VOM A;  2DPJ A;  2UV8 A;  3I55 S;  3EE3 A;  4J9U E;  1U1L A;  4X64 F;  2XLK A;  4NA1 A;  1WG1 A;  4J9P A;  2VBW A;  3V4I A;  5F41 A;  4X62 F;  1BWE A;  3CJQ A;  2WSC C;  2HBZ B;  1F3V A;  2OI2 A;  2WZ1 A;  4FF3 A;  5KFP A;  3CJT A;  2IC3 B;  3JSM B;  5KG2 A;  2NXU A;  2VD3 A;  1Q8K A;  1KQF B;  2ZBC A;  5CCM A;  3LWM A;  2DGU A;  3MR5 A;  2MDA A;  4P75 A;  1W26 A;  1NK4 A;  3Q8R B;  1JLA B;  5A8W A;  4QIE A;  5HMW A;  1ZH5 A;  4F26 A;  2AWZ A;  2QO3 A;  1VQ5 S;  3OVA A;  1X4D A;  4PAB A;  1SIW B;  1HI1 A;  4PPZ A;  1FJ7 A;  4OMF G;  1UAW A;  4OHX A;  2DEI A;  1JNR B;  4DN0 A;  3M6U A;  4AXI A;  1F9E B;  4OHW A;  4QYZ K;  4RUB A;  1U1O A;  2B0G A;  1DTT B;  2XCP A;  2EFQ A;  3CGI A;  4FKY A;  1ZTT A;  1YG0 A;  4ATN A;  1RCO B;  3G86 A;  2YWE A;  2VZ9 A;  5IC4 B;  4M8L A;  3MF5 A;  3UDE A;  4LF8 J;  2L3M A;  2ZOM A;  5EUH A;  4MYT A;  5KFH A;  3BGR A;  2Q1L A;  5LXY A;  2L08 A;  1CUL A;  2UXB F;  1WTF A;  1W7W A;  3PV8 A;  4ED4 A;  3UD4 P;  2V68 A;  1OO0 B;  2ZIT A;  1NLK L;  2OKQ A;  1I5O B;  2V9K A;  1FE4 A;  4R8U A;  2NLW A;  2MZR A;  4MFB B;  2AV5 A;  5KFS A;  4L75 A;  5J1N A;  2UZA A;  3PJ9 A;  5K5M A;  3QT8 A;  1U0H A;  1HD1 A;  3OL6 A;  3KK3 B;  4XK8 C;  2XO6 A;  3RR8 A;  3BPS P;  1XIQ A;  2G1H A;  3OVB A;  4AQY J;  1DY3 A;  4ZKA A;  1F5B A;  4NI2 B;  2IRU A;  4GKJ J;  4IOB A;  4F2S A;  3WC0 A;  1S48 A;  4RUA A;  3R5C A;  1VRQ C;  3UE2 A;  3ET6 A;  3PYE A;  2Q66 A;  3MPV A;  3OUY A;  2N3L A;  4OZN A;  2AKW B;  5EHH A;  5IS2 A;  4F4Z A;  5HRO A;  4M95 A;  3ZZU A;  1URR A;  1X7V A;  1WJ9 A;  3G4S S;  4LBI A;  2MLY A;  1NO8 A;  1X9S A;  5K9F A;  1JXE A;  2WVF A;  3IFE A;  2HBR B;  1Q79 A;  2XQC A;  3CXC R;  1QAI A;  4KE5 A;  2AQ4 A;  4N56 A;  1X5T A;  4HLB A;  3B8H A;  3RU0 A;  3EMT A;  4UF4 A;  4CT8 A;  5SZT A;  1H0H B;  3M2V B;  3M32 B;  2IJR A;  4WXW A;  3J81 j;  3IO1 A;  1H73 A;  1U8W A;  2GML A;  3F41 A;  3SSS A;  2BRL A;  3H90 A;  3PW0 A;  3SFG A;  4ZK7 M;  4PG8 A;  2W2N P;  3ILJ A;  5F0U A;  1KVJ A;  1SL2 A;  4Q0B A;  3MM6 A;  5CAA A;  2UUT A;  2EFO A;  2BE7 D;  3QT6 A;  1V6H A;  2FLO A;  5L1I A;  3RUB L;  3KHR A;  2RIJ A;  1IWA A;  3GB0 A;  2CPI A;  5KT5 A;  1RBO B;  3ILO A;  2DPI A;  2H5I B;  1J2V A;  1W25 A;  2PI5 A;  2IMW P;  4FVC A;  2RSQ A;  4K5S A;  4QPT A;  1TUG B;  4NE9 C;  2FJA B;  2VIC A;  2JSX A;  5BJR A;  5FDL A;  2CJQ A;  4NWB A;  4USW A;  4ED7 A;  2HNZ A;  4EI2 A;  2SXL A;  1X4G A;  4HL9 A;  5HP1 A;  1N32 F;  3IAS 9;  4EBD A;  2ZJR Q;  2WRM A;  2GFF A;  3K58 A;  2DBB A;  2MZJ A;  4NX9 A;  1ARO P;  5T14 A;  5KT7 A;  3OJS A;  1O8B A;  1UFK A;  3R7S B;  2DH8 A;  4M5H A;  1ZET A;  2F63 A;  2PFF B;  2GZO A;  2DIT A;  3OTE A;  2U1A A;  1K44 A;  2DGO A;  3C6T B;  1BUX A;  1RHJ B;  1R7I A;  2DYA A;  3MUM P;  4JV5 J;  4EO6 A;  2KHD A;  1HHS A;  2AGP A;  3G8S A;  4HHJ A;  5C2C A;  2YWH A;  2RDD A;  3KLE B;  3KLF B;  2CWX A;  4K7Q A;  4LJM A;  4ID8 A;  2J8A A;  3MAA B;  2AJF E;  3IRX B;  1QUV A;  4XDD A;  1CBK A;  1HQU A;  2OSQ A;  2DNR A;  1MU2 B;  1Y4Z B;  2CAD A;  4B3S J;  4JI3 J;  4KHP J;  3LAN A;  5K20 B;  2VAS A;  2OPQ B;  2ZH5 A;  1M90 T;  1PJ6 A;  3I32 A;  3Q8Y A;  1JLQ B;  2DHS A;  3HHK A;  2FDN A;  3EXC X;  5IV3 A;  2M8D B;  4I2Q A;  3FFI B;  4KH0 B;  3VAG A;  2B5J B;  4RNO A;  2QA1 A;  4JI0 F;  3KKF A;  4AL7 A;  2FY1 A;  4KGK A;  2K1R B;  4TQR A;  4DMZ A;  2XS5 A;  4YUD A;  4C0B A;  3R2D J;  3N5B A;  1VBK A;  4A8M P;  5D15 A;  2RRN A;  1S6Q B;  3B4D A;  4ZPW R;  4DR7 F;  3M8P B;  1DBD A;  5CYQ A;  2MQN A;  2LEC A;  2DRD A;  1R6Y A;  2WON A;  2OHD A;  2VFU A;  2CVI A;  3GZ7 A;  1HA1 A;  1YIJ S;  4C2M A;  2ZVS A;  3L7O A;  2ZZT A;  3OFH A;  4C8L A;  2VKZ G;  3VV2 B;  3Q2S C;  3THT A;  3HSJ A;  2UV8 G;  5L46 A;  3QWU A;  4G65 A;  3V6K A;  4F0K A;  4F67 A;  4KPY A;  4LSL B;  2DR5 A;  4F4K A;  2ZE2 A;  3OFF A;  3JYT B;  5IT9 U;  4AD6 A;  3M4X A;  4ZLL A;  1F6T A;  3E2E A;  3DM2 B;  2GMJ A;  1S6U A;  1EQ0 A;  3QAE A;  4JI7 J;  3K5M A;  1LWF A;  4FXW A;  1OYE A;  1IBK F;  4X64 J;  4B3T F;  5AXL A;  2H65 B;  2ZUA A;  5ADZ A;  4XPE A;  3HHL B;  4A8K A;  2QSF A;  2GQQ A;  5F8N A;  4DSK A;  1KN6 A;  4WU2 A;  3QFW A;  2C2M B;  2WOM B;  3J80 U;  1HHQ A;  4GVL A;  2Z2Z A;  1SCJ B;  1C4C A;  5KFF A;  2BE2 A;  3MEC B;  4HVZ A;  3M8Q B;  1SKW A;  1WHV A;  1QAX A;  2PA3 A;  5KT6 A;  2MY7 A;  3GJS B;  3RTV A;  2IM3 A;  1FDN A;  5CCL A;  1KD1 T;  3T19 A;  1YBT A;  2N7C A;  3ENW A;  2YNI A;  3DMJ B;  1KFS A;  3BN4 A;  2WTF A;  1FRK A;  4ENO A;  2PSZ A;  4CIO A;  3AJ1 A;  3QWP A;  5A6P A;  4YB1 P;  2OFG X;  3U1N A;  1Q53 A;  2IVM A;  2EBE A;  2LQB A;  2GVZ B;  1NPK A;  3A4T A;  3UD5 A;  4I2P B;  1QY7 A;  2OFH X;  3KYL A;  4H4O B;  2R2R A;  4ZLN A;  1BQN B;  1UJ4 A;  4EK2 A;  4ZVS B;  1UW9 A;  3V4I B;  1FO1 A;  4LVN P;  2D74 B;  1CPZ A;  4JV2 A;  2KT3 A;  4B9T A;  2ZOG A;  5LMU J;  4DPO A;  3CC7 S;  3CD0 A;  2EFV A;  4ID5 A;  2AHO B;  2QMU B;  1PCA A;  4I6Y A;  4LRB A;  2OD4 A;  1FJG F;  1SKR A;  2R8G A;  1GNK A;  3GE9 A;  4CO2 A;  1RTD A;  3CCL S;  2JZ5 A;  1S9E A;  5KTQ A;  2QYC A;  4X66 J;  1K73 T;  4J9L A;  2DHA A;  1PIE A;  1Q86 T;  5KAK A;  2K8G A;  2HMI B;  1HBM A;  3FK4 A;  3LF0 A;  4UUX A;  4O0N A;  1IBM J;  1Q8L A;  4P74 A;  5B0F A;  4DQS A;  1RAB B;  3G6V A;  2V6A A;  4ED6 A;  1G1X A;  1XN9 A;  1BMQ B;  1IBC B;  1FJC A;  3L7P A;  4L76 A;  2ZFH A;  4EO8 A;  3BGR B;  1SUQ B;  1JKH B;  1CUL B;  1U2F A;  3NGT A;  4OYZ A;  2HGM A;  1DAX A;  2LP4 A;  3NWG A;  2B6A A;  1J5E J;  5KFG A;  2VBZ A;  3GIR A;  4OZJ A;  1CLF A;  4S0M A;  4JI6 F;  4LBP A;  1GXT A;  1CJV B;  4OYB A;  3KLG A;  4XDC A;  5E41 A;  4R8U B;  3I87 A;  2HHH J;  3MMA A;  3S01 A;  2CPX A;  2QV6 A;  2M70 A;  3NBP B;  3RB6 A;  5JJB A;  1S12 A;  1FRH A;  3DDI A;  2WHO A;  2RKI A;  5DQH A;  3GON A;  1VRU A;  4V19 X;  3T41 A;  5CD4 A;  4LRD A;  1R0B G;  1W2B R;  3PAC A;  4Y34 A;  1WWH A;  5KG4 A;  3PEJ A;  1NXI A;  1DZ5 A;  1NU4 A;  4P2X A;  2RQM A;  4ZVF A;  4FF2 A;  2NZC A;  2BJ1 A;  3IBC B;  3F0N A;  1KLM A;  3OR1 A;  4PR6 A;  4USJ C;  2OEL A;  2CXE A;  1FA0 A;  1YLX A;  4F4X A;  1ZAW A;  2G0I A;  2AMC B;  3M05 A;  3HHE A;  2BMB A;  4BC7 A;  1QE1 A;  4JV0 A;  1U1R A;  3CIZ A;  4TYA A;  3A8K A;  4YS2 A;  2R2T A;  3PFE A;  2A1B A;  2HGL A;  3AD8 C;  1FCA A;  1LW0 B;  1EAR A;  2BJE A;  1X60 A;  3GPA A;  3EGW B;  4LRA A;  2F5G A;  3BM7 A;  3BGF A;  5L1L A;  4USU A;  2WB1 D;  5F8M A;  5LXR A;  4WK1 A;  3MEG A;  4Q0B B;  3MM6 B;  3BB5 A;  2RE1 A;  3DLK B;  2CQP A;  5HK4 A;  1YZ6 A;  4OI0 A;  1OPI A;  2XS7 A;  2B9X A;  4HTJ A;  4KFB A;  3MPU B;  3MTK A;  5HO4 A;  2E9Z A;  1ZBT A;  4CDI A;  2DXD A;  3SYZ A;  2YNF A;  5ETM A;  1EKS A;  2B9Y A;  2DRB A;  4URQ U;  5A76 A;  3GFH A;  3QSI A;  4I0W A;  4P52 A;  3CCQ S;  1RT4 A;  1IQT A;  2V8D A;  1RWK B;  4OHV A;  2ZH4 A;  3OFG A;  4F4A A;  3L3C A;  1U09 A;  2GX8 A;  4OI3 A;  5KFW A;  4O3R A;  2LQ5 A;  1B70 B;  1GEH A;  2BA9 A;  2BAB A;  3C15 B;  4K8R A;  2G4B A;  5I42 A;  1JMT A;  1U8S A;  3AD7 C;  2FLP A;  5HJY A;  2MGZ A;  3M2R A;  2VIH A;  2W24 A;  2P2C B;  4NYO A;  2X1G A;  2HGN A;  2I38 A;  1A6L A;  1HQU B;  2EW9 A;  3UCU P;  1RT1 A;  1Q8I A;  4ED5 A;  2FHJ D;  3SCJ E;  3ULH A;  1ZAV A;  1RAE B;  3H42 A;  2XM3 A;  1KKH A;  2F9J A;  2E66 A;  3PZP A;  2RU9 A;  5GAD U;  5KOW A;  4I2Q B;  5CAB A;  3BSO A;  1O0P A;  4ZLP A;  2XMW A;  2VF3 A;  1RWN B;  4USK A;  3BO4 A;  2HK2 A;  4DDF A;  1FTC A;  3ILI A;  4DPW A;  2PGC A;  3BRE A;  3O8W A;  5BXI A;  1ZTW A;  2JRS A;  3KJQ B;  3G6X A;  1U25 A;  4TVA B;  2X3G A;  5B0D A;  5CYQ B;  5KFY A;  3B54 A;  1MWZ A;  3ZZT A;  1UFL A;  2GCF A;  2WON B;  4PG5 A;  4OYI A;  2ALY B;  4BHQ A;  3TX8 A;  4CLZ A;  3H2U B;  1KSP A;  1PIL A;  2HLU A;  3CNQ P;  3RBD A;  2EFG A;  1M1H A;  1KQG B;  1ZZF A;  2K06 A;  3KXD A;  4A8W A;  5ETL A;  4E2F B;  4RNM A;  5C42 A;  2KFN A;  1EJ7 L;  2KVI A;  3TUJ C;  3RB3 A;  1NK7 A;  2ZE2 B;  3OSN A;  3DOM A;  2AZ3 A;  1Y00 A;  2OIH A;  4UY8 5;  1OY6 A;  3GYX B;  2DHH A;  1RT5 A;  2CQ3 A;  2O66 A;  3IG1 B;  5E3Q A;  3AOD A;  2ALZ A;  3W5Y A;  2MPU A;  2RH3 A;  3BQ2 A;  2ZHO A;  3NAH A;  1TUW A;  4JI8 F;  2HQD A;  4OI4 A;  4M5D A;  1X4B A;  2UVW A;  1WTB A;  4DU8 A;  2J9E A;  2E29 A;  2WVD A;  1R89 A;  3DC2 A;  1RT2 A;  1NSQ A;  2VPY B;  1MML A;  1N54 B;  3DOL A;  2BDP A;  3VCD A;  3OTB A;  2MKK A;  1C4A A;  2ZBI A;  2LYV A;  1PBA A;  2IA6 A;  3QJP A;  1HNI A;  2WK4 A;  2UUA J;  3NS5 A;  3QAT A;  2QGF B;  3MR2 A;  5GAH U;  3UDV A;  2GVD A;  8RUC A;  1S97 A;  4MKY A;  3R8Y A;  1H38 A;  4CWB A;  4J9V A;  2NR0 A;  1CVJ A;  4UUW A;  3W8P A;  4JI5 F;  5E3P A;  2MKI A;  2ZWP A;  1TUV A;  3IWX A;  4LFA F;  4CLW A;  4CI0 B;  4LVO P;  1WHX A;  1HQ2 A;  2RF2 B;  4H4M A;  3EJM A;  1V9O A;  4FYX B;  3PX4 A;  4ELT A;  1S59 A;  2XMU A;  2HQI A;  3K89 A;  4OHZ A;  2GIR A;  3DLG A;  4LF7 F;  1YBU A;  3OV7 A;  3K2Y A;  1FWL A;  3LH2 S;  3EYZ A;  1RTD B;  4DPT A;  3LW5 C;  3D6M B;  2MZS A;  3VAJ A;  2CQ2 A;  3PNI A;  1HLW A;  3R9L A;  4DV1 J;  1S9G A;  4C8K A;  1XMQ J;  2I8E A;  3UNG C;  1N5Q A;  1LFP A;  3FBC A;  3NGR A;  4B3R J;  4M1K A;  4WYL A;  5LMN J;  2V67 A;  2Y8W A;  8ATC B;  4OV6 A;  2E5L F;  4KKO A;  1HI0 P;  4KSE B;  1YBA A;  4LR9 A;  5GAE I;  2W8K A;  1C0U B;  2ZEJ A;  3QIP A;  3VGT A;  2KRB A;  2ZKU A;  2VL1 A;  1RCX B;  3C66 A;  4WP9 A;  2B6A B;  2RHQ B;  4FPR A;  3DRP A;  2EK6 A;  1U1Q A;  3VZH A;  4DV0 F;  3FC9 A;  1FFS B;  3KLG B;  1PYS B;  5G0R A;  1NK8 A;  4NLG A;  1SJR A;  5KFU A;  1AXQ A;  2FVC A;  3I0R B;  2NQP A;  3BGL A;  4YR2 A;  2V34 A;  2VBX A;  1LXN A;  2KFY A;  3MMJ A;  4Z7C A;  4DHV A;  1WKL A;  2NXJ A;  4DV3 F;  3FSX A;  3OTO J;  1TKX A;  1F2G A;  3MR6 A;  4DFJ A;  2DCL A;  1AUD A;  2YKO A;  4I69 A;  4I64 A;  5EX0 A;  4J9Q A;  2RJZ A;  4KPC A;  4YB5 A;  3THP A;  2HVD A;  2NPF A;  4AND A;  3OT9 A;  2YQ1 A;  4QR0 A;  2PII A;  3IGN A;  3VGV A;  3R1H A;  2XG8 A;  2BOA A;  2KJV A;  3W2W A;  5HSP A;  1QE1 B;  2R8J A;  4AE5 A;  2OP5 A;  1DRZ A;  2GGP A;  3RBZ A;  2HRY A;  4DFM A;  3NRB A;  4U6P A;  4KHR A;  5MLC V;  4EWT A;  2W4D A;  4YY3 F;  2UUB F;  1T9T A;  1TK5 A;  1S1U A;  1RLD A;  4C0H A;  4KJI A;  4YHH F;  2GAH C;  4UZB A;  3UN3 A;  2CDQ A;  9RUB A;  5HLF B;  3FGV A;  1J27 A;  4PCQ A;  4LFC F;  4KGM A;  1ZPV A;  3MM7 A;  2V4J A;  3H2V E;  5K8M A;  2YNH B;  2FPH X;  1P6T A;  4DEZ A;  3C14 B;  1REV A;  4GKK F;  1UET A;  2M2B A;  2CZ9 A;  4N47 A;  1S1W A;  2KM8 B;  2ZDO A;  2ILZ A;  3FMW A;  1T9Y A;  1S99 A;  4DR2 J;  3BH6 B;  1N33 J;  4ZVE A;  2CAJ A;  1NBE B;  2D3U A;  4LF4 J;  2OGU A;  1M5O C;  5DS7 A;  3KNG A;  3ITH A;  2QLX A;  2QTW A;  4OHY A;  2MB0 B;  3PRB A;  1N5V A;  2IIH A;  3VAH A;  1BE4 A;  5KG0 A;  3CDU A;  3GIM A;  3GSI A;  2HWH A;  4PUO A;  3QGP A;  1NJZ A;  2LEP A;  5ETS A;  5B09 A;  3PYD A;  5K14 A;  2OEJ A;  3CB4 A;  1JLC A;  2UU9 J;  1RT4 B;  2W2P P;  4WFN Q;  3U02 A;  3IS9 A;  1HYS B;  1S6O A;  2K2P A;  2M3D A;  1FWK A;  1FT8 A;  2BE9 B;  4E8U A;  3KFW X;  1S9F A;  1S1V A;  4FDF A;  2BJD A;  3PRV A;  2VU5 A;  3E3X A;  2J6U A;  1KWM A;  2ERR A;  4P72 A;  3C16 A;  5KG3 A;  4R5P A;  2PA8 D;  2GC8 A;  1R6V A;  2AX0 A;  3GSD A;  1UVN A;  2BW7 A;  1OSD A;  3QZ8 A;  1WSR A;  2HQC A;  1RAG B;  4C7Q A;  1YRX A;  1B3T A;  1RJJ A;  2XSF A;  2MSS A;  3WC2 A;  3EWG A;  1HFE L;  1N5Y A;  3AOB A;  4B9L A;  4LQ3 A;  1RHQ B;  3D9B A;  5IOL A;  4ICL A;  1F5A A;  6AT1 B;  3GQC A;  4XIU A;  1HKA A;  3B6B A;  1X4C A;  3JQK A;  4DR1 F;  1WAC A;  2CQH A;  2IHR 1;  2ZC4 A;  3CCE S;  2IM2 A;  4TYB A;  4U7U D;  2UUC F;  2VQE F;  1ITP A;  1T11 A;  1H2T Z;  3D67 A;  2LQJ A;  2JOQ A;  4UQG A;  1SQF A;  2VFS A;  2CQ1 A;  1T03 B;  2YH0 A;  3PO4 A;  3E01 A;  1RLC L;  2IJN A;  2OJ3 A;  3HK2 A;  3DU6 A;  4X4O A;  4URG A;  5DET A;  4DUY F;  2VON A;  1FFW B;  3HHD A;  1JX4 A;  3SIP B;  4M5G A;  1S6P B;  4A4J A;  3CUL A;  3ENA A;  4NYZ A;  3GU0 A;  4B9M A;  2AJ1 A;  3AJD A;  4NA3 A;  1SH2 A;  4ELU A;  1VQM S;  2RHS B;  4Z7Y A;  1ZA1 B;  4DUZ F;  4IG3 A;  3QJL A;  4KO0 A;  1WI6 A;  4FF1 A;  2HWI A;  1AB8 A;  5D0G A;  2R3V A;  3JQM A;  1LWE A;  5B0E A;  3HFV A;  2HHU A;  4R0E A;  3UDC A;  3HFK A;  4CP5 A;  2VKR A;  1SJ4 P;  4R0J A;  4J9M A;  1N0V C;  3CCM S;  2BAN A;  3HCX A;  1RT5 B;  2UXC J;  3KK2 B;  3CCV S;  1NDP A;  1WG5 A;  5D0R A;  4A47 A;  3CCR S;  1UFW A;  2ZD1 A;  5BYQ A;  2JFD A;  2B7B B;  2GV1 A;  1VLY A;  3J81 Y;  2D3O 1;  3P5B P;  1SI9 A;  1NK6 A;  3FRZ A;  4TN2 A;  3ENQ A;  1TFY A;  1GK8 A;  3R5B A;  1ICE B;  4HT5 A;  4JYA J;  4B02 A;  5LJ5 Y;  1VFJ A;  5KFO A;  4LF7 J;  4DQR A;  1PG5 B;  4ZVO B;  2YQ0 A;  3TZZ A;  2UXD J;  1N0U A;  2LQ9 A;  3KWM A;  2YQ3 A;  2FY8 A;  1CJT B;  3BEG B;  2V8G A;  4KYZ A;  4DV2 J;  2JEI A;  3G82 A;  3GG1 A;  4FN5 A;  4B3M F;  3HMJ G;  2GHV C;  4K4X A;  4PYA A;  1HNI B;  3OFE A;  4M63 A;  2F4V J;  4RW4 B;  3WHI A;  5D0E A;  1HPZ A;  1HNX J;  1PBU A;  2W25 A;  2HAF A;  2BXJ A;  4PXE A;  3QQC D;  3D0I E;  2E5L J;  3RW7 A;  2H5J B;  4C6A A;  5A8R A;  5J2Q A;  1GX6 A;  2QG9 B;  4ES2 A;  5C25 A;  4DF8 A;  1S7I A;  2ZVI A;  1FXD A;  4M5J A;  2JEG A;  4DFP A;  3T5L A;  4GVB A;  4H4M B;  3NY0 A;  2ASY A;  1NKE A;  2F8E X;  1RAJ A;  3RGI A;  2R7T A;  1YJ9 S;  1WI8 A;  1Q7Y T;  4UOF A;  1NSP A;  2W4C A;  4TXS A;  1K9M T;  1H74 A;  4I1T A;  4PWD B;  1QAJ A;  4A8Q A;  3RAM A;  3N4W A;  1UVL A;  3BN7 A;  1YGY A;  3LQV A;  1CQM A;  3EGZ A;  2CZV C;  5EGY A;  1BY9 A;  2AIR B;  1CC7 A;  4EYH B;  4DX5 A;  3EM1 A;  4G1P A;  1S9G B;  2B8P A;  3W7B A;  3BR9 A;  4W98 A;  2QE5 A;  4DN9 A;  1SV5 A;  3HPO A;  4J9O A;  3GG0 A;  4Z37 A;  2B4P A;  1L3K A;  1MNE A;  2EG2 A;  2ZBQ A;  5B0A A;  1AFI A;  4JI1 F;  3SDE A;  4C4W A;  1KEK A;  1CEZ A;  1ULR A;  4KKO B;  2L9N A;  2R7V A;  4LF9 F;  2ZH9 A;  3QIP B;  2HND B;  5D8H B;  3D3B J;  3QBC A;  1R3N A;  1OIA A;  2YKM A;  2R7O A;  3UR0 A;  1KLN A;  1NAQ A;  4IH5 A;  1FTR A;  1UZD A;  2ZWO A;  4WKR A;  3KK1 A;  4ZIW A;  3TUI C;  5DGB A;  4J9N A;  5AXK A;  3QGI A;  3TYT A;  2N4D A;  5G0R B;  2VQF F;  3WQP A;  4BWJ A;  1O5J A;  2H4W B;  3W2V A;  1S72 S;  2MQL A;  2RNE A;  1VC6 A;  4LRE A;  2B56 A;  1X31 C;  3U27 A;  5GMK a;  4RW8 A;  2QJ3 A;  1RBA A;  2G2O A;  3TAQ A;  4OZ2 A;  1T7P A;  2KHC A;  4O3N A;  2YX4 A;  4B9S A;  4NEZ A;  4ILL A;  2RU3 A;  2NYI A;  5E2Q A;  3U1L A;  5B0G A;  2G13 A;  1TKX B;  1FKO B;  4ECQ A;  5IFM A;  1E6V A;  5ETO A;  2HHQ A;  1RWW B;  3N9U C;  2UUW A;  1QSL A;  2DHX A;  1RT7 A;  2ZBR A;  4DV7 F;  5HAT A;  1SC6 A;  3L4B C;  1RQ0 A;  3H5S A;  4Q8F A;  2BKP A;  3KG1 A;  4ZHR A;  2C2N A;  5DG8 A;  4LUB A;  1EET B;  1NND A;  3QLH A;  1B0T A;  2V9W A;  3F44 A;  2Y9H A;  1TL4 A;  3HHL D;  3R5G A;  2DJW A;  3X3U A;  1S1T B;  1SQE A;  1IKW B;  3AJ2 A;  1CJK B;  1S1U B;  1NUE A;  5DM6 Q;  4FVM A;  1C0T B;  4P2M A;  3ZTP A;  2V63 A;  2EKY A;  5DZ7 A;  2DGW A;  4LSZ B;  2ZH6 A;  4PEO A;  2V4J B;  1WDT A;  2HZC A;  1D8Z A;  5CXT A;  1REV B;  2O5D A;  3A1Y G;  3ZNU A;  4NXM F;  4CM0 A;  5KOX A;  4OYX A;  2I5J A;  1S1W B;  2W9A A;  1JLG A;  2NYH A;  3G8Q A;  1YIT S;  2HS4 A;  2PE8 A;  2PC6 A;  2W4P A;  1V3S A;  1HW8 A;  1PJ5 A;  3M9N B;  2HRU A;  3ITH B;  2GJ2 A;  2MQ8 A;  4QWD A;  2F40 A;  1BD6 A;  2JLE A;  4RO0 A;  2KXF A;  3D6F B;  1U49 A;  2W01 A;  2XMV A;  3DYA A;  1GFW B;  4PUO B;  1XEZ A;  5KFQ A;  1VBZ A;  1RU1 A;  3SQG B;  5FLX Y;  2VG5 A;  1RE1 B;  1YZ7 A;  1JLC B;  2R2U A;  1X5P A;  2CKW A;  4QPX A;  3PDN A;  1R0A B;  4ZCM A;  2V4Q A;  4RX6 A;  2OPP B;  3JSY A;  1MRO A;  1Y10 A;  3H40 A;  1SVD A;  2VA2 A;  4DSI A;  4Q43 A;  3C16 B;  4R5P B;  1I6J A;  1V5V A;  2QZ8 A;  3OL8 A;  4P2S A;  1FE0 A;  2YX1 A;  3HZE A;  1NZA A;  1WC5 A;  3MCO A;  2HHS A;  1SJ3 P;  1RT3 A;  3R6L B;  1HW9 A;  4QJV A;  2VG7 A;  2IY5 B;  3L9Z A;  1RHK B;  5BR8 F;  1N5Y B;  1NB2 A;  2J9C A;  3WIV A;  1VYA A;  1TV6 A;  4ICL B;  2RVJ A;  1WF0 A;  4YOE A;  1UVI A;  5F8J A;  2I0X A;  2Z58 B;  4HH0 A;  1TQL A;  2MLZ A;  3DRS B;  1KP6 A;  1HBN A;  3V81 A;  3PCO B;  1U26 A;  1C2P A;  2BZ2 A;  1RHR B;  2Z2Y B;  1RYR A;  2YPZ A;  3QYY A;  4YP3 A;  4HAC B;  2ZZN A;  2VOO A;  4CLK A;  2KT2 A;  4F4W A;  4LF8 F;  2HNY A;  3AA9 A;  1TR0 A;  3E01 B;  3QO9 A;  4IDK A;  4QIG A;  4M5I A;  2R7S A;  1NM2 A;  1HBO A;  4URS A;  4OL8 A;  4IFY A;  1WDD A;  2YH1 A;  1IKX B;  1JQG A;  2VOP A;  2V5H G;  5CD4 H;  3FBF A;  1Y7P A;  3DLJ A;  4C3M A;  2Y0S D;  1YVF A;  2EWH A;  3BGO P;  4X4U A;  3FEX B;  3HI9 A;  3RB0 A;  1HNV A;  1LKZ A;  4O3Q A;  2BKO A;  4JI2 J;  4UZC A;  2XGQ A;  4WWS A;  4IG3 B;  4U95 A;  3KOA A;  1NPP A;  1SC3 B;  4EZ6 A;  3RYL A;  2DR6 A;  4NLO A;  3M1V B;  3CJS A;  1BQM A;  4AQY F;  2KH9 A;  4IG0 B;  3VHQ A;  1LWE B;  4K4T A;  2CQB A;  3C6U A;  1XC9 A;  4K59 A;  2EK1 A;  1PJ7 A;  3EPG A;  3EGN A;  1PGZ A;  3LP1 A;  3LOU A;  2Y1R I;  1DAR A;  1T9W A;  2XNQ A;  3HD2 A;  4GKJ F;  4OX9 J;  5F9N A;  2BAN B;  1JJC B;  2K7K A;  2KN4 A;  3PKM A;  2VDH A;  4F8R A;  3CC2 S;  2IAJ A;  3KG4 A;  3LP2 B;  3K59 A;  2CRL A;  4B08 A;  2GJI A;  3H0P A;  1T3N A;  3C19 A;  4LF5 J;  4TU7 A;  4A8S A;  1CS4 A;  4LFB J;  1WHW A;  3FCH A;  4GC6 A;  2DT9 A;  2XGP A;  3SI8 A;  2HQF A;  1Q95 G;  5ETT A;  3MZI A;  3K5N A;  3GFZ A;  3MED A;  3CMA S;  4C8O A;  1QSS A;  2JLF A;  1MN9 A;  2JJ4 D;  3G82 B;  3A13 A;  1O6X A;  1S1X A;  2FUG 9;  2PI4 A;  1H72 C;  3ICL A;  1NME B;  2E1P A;  3GFX A;  1HPZ B;  2QLB B;  3MPD A;  1YSJ A;  4P9S A;  5HI7 A;  4RW7 A;  3HJV A;  2WVB A;  2ROE A;  4ETZ A;  5CHC B;  3IR5 B;  1GMV A;  2WCX A;  5A8R B;  1KR4 A;  3KHH A;  5J2Q B;  3CCT A;  5D3G A;  5C25 B;  3CDW A;  1K8A T;  1X5S A;  4LF9 J;  2QEX S;  1XMO J;  4EBE A;  2DNN A;  2CQI A;  1IKY A;  4NLS A;  4X65 J;  2UVR A;  1KVK A;  3SFU A;  2JVO A;  3IR7 B;  5DDP C;  4WPA A;  5CH7 B;  3CCZ A;  3IN5 A;  2R7Q A;  2MZ1 A;  4QWC A;  4U96 A;  4WTY A;  2AX1 A;  4RNH A;  3I9Z A;  1WF2 A;  2O1P A;  2PMH A;  2J0W A;  1UWB B;  4LR7 A;  2ZJQ Q;  5DDO C;  3MDF A;  2Y1J A;  5IZH A;  1TL3 A;  3MPY A;  1VQK S;  4NAS A;  3BSA A;  1SV5 B;  3GFY A;  2R4F A;  1WOR A;  2YVS A;  3SBM A;  3FZB A;  3DRX A;  2L9W A;  1A7G E;  2K3K A;  3SDE B;  2R8H A;  3S6E A;  4JV5 F;  3EDR B;  2RRA A;  3CD7 A;  5IQQ A;  2IRX A;  4WE1 A;  1H2U X;  2A6O A;  4DSJ A;  2BM0 A;  1ZM2 A;  3LO3 A;  4ANE A;  1TZ0 A;  2Z57 B;  3M8R A;  2YKM B;  5LT5 A;  4OYO A;  1QUP A;  1L3S A;  4B3S F;  4JI3 F;  4IFV B;  4O4G A;  1TAQ A;  3PFO A;  3VVT A;  5HJX A;  3KK1 B;  5J1E A;  1FEH A;  4QW9 A;  4X4N A;  1VJQ A;  3N6N A;  2YNG A;  4K0K J;  3RG6 A;  5DO2 A;  2FVR A;  2AP6 A;  2CQC A;  2FHM A;  1NSK L;  3VQS A;  1T9X A;  3ADA C;  5GAG I;  4ZPB A;  3MM9 A;  1TKD A;  3HJF A;  2ZHB A;  3GV8 B;  2BQ3 A;  5LM7 E;  2CJB A;  3CD6 S;  3MGJ A;  3GWC A;  3AY0 A;  3VAM A;  1ZA2 B;  3C8Y A;  4NXM J;  1RA6 A;  1E6V B;  2HFN A;  4ZA1 A;  2DB1 A;  2XSJ A;  3QZ7 A;  3PO5 A;  2ZNY A;  1RT7 B;  2MKJ A;  4KHM A;  3Q2T C;  1EX8 A;  2J0X A;  4IOC Q;  4CH7 A;  2YKN A;  3ZFV A;  1K0T A;  1U7L A;  4AXJ A;  3T1Y J;  1AW0 A;  3NAI A;  1JNZ B;  1HL6 A;  2GW8 A;  1RWO B;  5B0C A;  4DV4 J;  1VQP S;  1DTQ A;  1M0S A;  2ROG A;  4DG1 B;  3PTW A;  3QLH B;  4O3S A;  3KJV A;  5A6W A;  3HT0 A;  2V8P A;  2C3Y A;  1ZAX A;  3CCS S;  3FSI A;  3QJJ A;  2Z30 B;  3NNC A;  2CVE A;  4LT6 A;  3HVA A;  4LF6 J;  4HHU A;  3G87 A;  4RW6 B;  4MTP A;  4J37 A;  4JI7 F;  4IOA Q;  1DUR A;  3CDA A;  4OZ5 A;  4UY8 T;  1WEX A;  3OTC A;  4JB8 B;  2XMM A;  3MEE B;  1N56 A;  1UPP A;  3C3L A;  5IT0 A;  1RTH A;  5KG5 A;  1RAA B;  1VBY A;  2I5J B;  2CIM A;  2V50 A;  3CJ5 A;  1SH0 A;  2XI2 A;  5THW A;  1XBW A;  1KON A;  2BW2 A;  2DO4 A;  4Y3C A;  4QWA A;  3T6B A;  1GMW A;  4HYK A;  2CWK A;  5AE1 A;  3U7J A;  2BJ3 A;  5BR8 J;  3PX6 A;  1Q4R A;  2HHT A;  2KKH A;  3DOK A;  4KGX B;  4IO9 Q;  1QJH A;  3DYA B;  2C28 A;  2C2K B;  5F9L A;  2VG5 B;  3CO9 A;  1FD8 A;  2CQ4 A;  2CYY A;  3NGD A;  2Q79 A;  3ELH A;  5T7L A;  4G1Q A;  4CRJ A;  1OQ6 A;  3UN5 A;  2A2C A;  1HBU A;  3I0S B;  1Z2Z A;  2YXL A;  1RWU A;  3MAQ A;  3TNV A;  1MRO B;  3SQO P;  3JTO A;  1UZH A;  1HQE A;  3D1O A;  2I2Y A;  5LMU F;  3MUT P;  3UW1 A;  3BBB A;  4OLP A;  2XMT A;  3TA2 A;  4KQZ A;  3UVJ B;  2BUN A;  5J2N A;  4IRK A;  2Q43 A;  2J6S A;  1RTJ A;  1S0O A;  4J9K A;  2HKE A;  1TTH B;  2VG7 B;  5B08 A;  4OYA A;  1RTI A;  4PAA A;  4DZ6 A;  2CNO B;  1GAO A;  3TX0 A;  2XHC A;  2ZNZ A;  3MFH A;  1Q16 B;  2VB6 A;  2ZOF A;  5CZV A;  1WG4 A;  4X66 F;  4F3Q A;  2ILY A;  3PJX A;  4KY3 A;  5D4L A;  2AF6 A;  4IKA A;  1E6Y B;  3V81 B;  2OTJ S;  1RAO A;  4OYW A;  2F3J A;  2H3E B;  2KVQ E;  2KYZ A;  3VF0 B;  3O3L A;  1IBM F;  1TVR A;  5CZX A;  1EP4 B;  4ILM A;  3CMQ A;  1P27 B;  1P1T A;  5BYR A;  5HQ8 A;  1LFW A;  3QO9 B;  3WZ0 A;  4IDK B;  2LA6 A;  3N79 A;  4EYI B;  3DRY A;  3J7Z T;  3Q23 A;  2OUG A;  3BO2 A;  1UMJ A;  4IFY B;  2MY8 A;  1J5E F;  1HNW J;  1ZPW X;  3WDO A;  4Z2X A;  3MXH P;  4QU7 A;  1X4A A;  5DG9 A;  5HAO A;  3CJK B;  1N36 J;  2HHH F;  1TL7 A;  1I94 J;  1UVK A;  1HNV B;  3EDQ B;  2DNQ A;  1AZS A;  3VGU A;  2HHX A;  3TA0 A;  2FHO B;  1KFD A;  2RS8 A;  5A0Y A;  3BYR A;  4IR1 A;  5C2G A;  2MHN A;  3GIL A;  4MIA A;  4ZPA A;  5F8L A;  2M5Y A;  1BQM B;  1WHY A;  1S5Z A;  3C6U B;  4DQI A;  4NML A;  3LP1 B;  1VHF A;  1X9M A;  2AJQ A;  3M9O B;  3ETO A;  2Y3Y A;  1FRL A;  2JHE A;  2L48 A;  3H7H B;  2IAJ B;  1G2E A;  4A8F A;  2R2S A;  5KT2 A;  5MAO A;  1JWW A;  1CS4 B;  4K4Z A;  3ZTS A;  2XI3 A;  2WVE A;  2HS0 A;  2XY5 A;  4ZVQ B;  3OD2 A;  2EG1 A;  2RQC A;  4TU9 A;  3AB4 B;  2HZV A;  4OX7 A;  2FYX A;  3CCW A;  2HWT A;  3MED B;  4QYR A;  4XO0 A;  4NA2 A;  5J2P A;  2XYH B;  1N4L A;  1HIY A;  3KLH B;  5J2M A;  1HR0 J;  1IJF B;  1JJ2 R;  2AYE A;  5I3U B;  2OAU A;  1S1X B;  3IP0 A;  2CFX A;  2UP1 A;  4MIB A;  2A0F B;  1WNE A;  2YWK A;  4DCO B;  2DIS A;  2KL8 A;  5C7P A;  3GYG A;  1S4F A;  4C8Z A;  3V6D A;  2V2Q A;  5EX3 A;  5I3P A;  1YJW S;  3A3N B;  2ROP A;  3TJA A;  3MM5 A;  3N6M A;  4ZOS A;  2XLJ A;  4X4V A;  4FS1 A;  2MZQ A;  2FZC B;  2PFD A;  1FJE B;  2LFV A;  1J5O B;  2PN6 A;  3LWL A;  4CYU B;  2MKS A;  3KLI A;  1JLF B;  1RT6 A;  1IR2 A;  3GCW P;  1Q82 T;  2IM1 A;  3A12 A;  4NLR A;  2E5I A;  2APO A;  3R7B B;  1MG7 A;  1N52 B;  3D7S B;  4Y6I A;  2LQ8 A;  2H5E A;  4C3K A;  3WX8 A;  3CDB A;  5HL7 Q;  1Q81 T;  2IDE A;  5KFX A;  3MCN A;  2AGO A;  2MHE A;  2R9L A;  5IWA J;  2N4C A;  4J9R A;  4MKB A;  4CNY A;  3PVX A;  1PYO B;  2FJV A;  4X4Q A;  2IRY A;  3FBB A;  1NHV A;  5IT4 A;  2DCU B;  1KHV A;  3N01 A; 
#chains in the Genus database with same CATH homology
 2Y8W A;  4U7U D;  1WJ9 A;  5CD4 A;  3QRP A;  4QYZ K;  2Y9H A;  5H9F K;  3QRQ A;  5H9E K;  3QRR A;  2Y8Y A;  4DZD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...