3QRRA

Structure of thermus thermophilus cse3 bound to an rna representing a product complex
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
213
structure length
204
Chain Sequence
b'FQMWLTKLVLNPASRAARRDLANPYEMHRTLSKAVSRALEEGRERLLWRLEPARGLEPPVVLVQTLTEPDWSVLDEGYAQVFPPKPFHPALKPGQRLRFRLRANPAKRLAATGKRVALKTPAEKVAWLERRLEEGGFRLLEGERGPWVQILQDTFLEVRRLLQVQAVLFEGRLEVVDPERALATLRRGVGPGKALGLGLLSVAP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein TTHB192
publication title Recognition and maturation of effector RNAs in a CRISPR interference pathway.
pubmed doi rcsb
source organism Thermus thermophilus hb8
molecule tags Rna binding protein/rna
total genus 48
structure length 204
sequence length 213
ec nomenclature
pdb deposition date 2011-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08798 CRISPR_assoc CRISPR associated protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1200 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Crispr-associated protein; domain 1 3qrrA01
3.30.70.1210 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Crispr-associated protein; domain 2 3qrrA02
4QYZK 4U7UD 2Y8WA 3QRQA 1WJ9A 3QRRA 4DZDA 2Y8YA 3QRPA 5H9EK 2Y9HA 5H9FK 5CD4A
chains in the Genus database with same CATH superfamily
1BD6A 1Q7YT 4F3MA 4ZLLA 3DLLQ 3FEXB 4DX8H 1U1QA 1VS3A 4K4XA 3LF0A 3EDQB 1UVKA 3H2VE 2E9ZA 2QMXA 2KDOA 5HSPA 1CQMA 3DLGB 4DUYF 1IN0A 3TEGA 1CJTB 4NYPA 4QYZK 3GCWP 5J2NA 3IBFB 4RW4B 5FDLB 3V5RA 2GVZB 4RW8A 4IDKB 4KPYA 2XI3A 3QRRA 1YJNS 4FPRA 4C3KA 4ZPVR 3TA0A 4WJBA 3IAM9 2UXBJ 3W2WB 4WCEQ 3R7NB 2IIHA 1VRUB 3DHWC 1ZTWA 3MPDA 1REVB 1VQSA 1ZAXA 4UTGA 5JVGQ 2YKNB 5D77A 3NCQA 5DG9A 3JTPA 2B43A 4HYKA 2DHAA 5DQHA 5HBMA 4OZJA 3M6VA 2XMJA 1RAGB 3RAQA 1KFSA 3CJ3A 1KDNA 1RT7B 1VCTA 1XR7A 4IOBA 1GMWA 3V6JA 1U47A 2KN4A 4P10A 2LXUA 3UWTA 1RT6B 2DPIA 2AU0A 3RB4A 4FN5A 1TQLA 3SV3A 4IG0A 4LF2A 3C2PA 1HBNA 2F9JA 3DRSA 2X1BA 1SC1B 1KVJA 3RB6A 2DB1A 2QV6A 4YN3B 3OV7A 3M1VA 3DLJA 3TO8A 1B64A 1S1VB 1PBUA 3VVUA 2WVFA 3PW2A 1VHFA 4GRSA 3SXLA 4B3RF 1A6LA 3X1LB 2BRLA 4C48A 1RU2A 2W7AA 4IOCQ 3HFKA 4OV1A 2PFDA 2ZH6A 3MEEA 4F04B 3SCLE 1FHTA 1X5SA 2EFGA 2HQGA 4FVMA 2J7UA 3D3BJ 5IC4B 3A12A 3HZGA 4YB1P 4LF8J 4QIFA 3UDVA 4O3NA 5CCLA 4CQ1A 4DV2J 1JLEB 3C16A 3SCKE 1LNQA 1ZTTA 3HO1A 2BVZA 1S9EB 2LEBA 2PA8D 3FSXA 1H7WA 2FLNA 2R2RA 5DRKA 1ZM2A 3AQOA 2IPOB 2ZUGA 4KPCA 1U7LA 4A8YA 1LFWA 2LQ5A 4DR7F 3BSNA 3W8GA 2B4UA 1F60B 2GC8A 3OTCA 2OIHA 3D1QA 4K5SA 2FVSA 2GZOA 2B8PA 4OI1A 2U2FA 2QYGA 5KG3A 1HNVA 4YDXA 4OJHA 1RLCL 1XNQJ 1YGYA 4C8OA 3TNVA 3F0NA 1VQMS 1SPBP 3J7ZT 4BWMA 1UWAA 2I5JB 1JQGA 2QLWA 1UVIA 2C3OA 3G6XA 3PJXA 1JLGB 3VAJA 3MEKA 4XK8C 4V1Ak 5GMEA 4RW9B 2KJWA 5D3GA 2CQCA 1GNKA 2LQBA 5DGBA 2M8DB 4MH8A 4LREA 1M5VC 2GMLA 2OI2A 1S49A 4RBUA 1HI0P 2PSZA 2WHOA 2QYCA 5B0CA 1DQ8A 1JNZB 2DD8S 1L3KA 1KQFB 5C42B 4ZN1A 4ANCA 1X4DA 4ID8A 2AYBA 1CC7A 5KG0A 4X4SA 2QIFA 3H2UB 2WSFC 2CKWA 3D68A 4CI0B 4MKVA 4DU7A 1TVRA 3NNHA 4DV6J 4TU9A 1JJCB 4P2MA 1VJWA 1Q86T 3DGPA 5F8MA 3FBCA 3QBCA 4C11B 2N3LA 3U7JA 3POTA 2CXEA 1N54B 5DZ7A 3CC7S 2LQJA 3I4HX 1GTEA 1UWBB 4JBCA 2VQFJ 3DU6A 4CLKA 1NUEA 4KY3A 2JC0A 3HFVA 1U6BA 1HBMB 2LQ8A 3M8RA 3Q8UA 3NMRA 2VICA 4ECSA 3IR5B 4N56A 3MM8B 1RKIA 1VC5A 2XMKA 2P2CB 3EVOA 3RW6A 4ED6A 2O5DA 3GJTB 4F4XA 2IHR1 5IC6B 1D9DA 1NK6A 1IQZA 3NG8A 2J6SA 4LR9A 1V9OA 5HANA 3IP0A 1Y10A 1MNEA 1WC0A 2UXBF 3M05A 5AT1B 4CYUA 3H5XA 2K1RA 4AL6A 5F8NA 1VFJA 2DGOA 3CJ5A 4USJC 3FBBA 2VBYA 3GSIA 1KOOA 1N4LA 1S77D 3VVTA 2HWTA 3PDNA 4NE9C 2CIMA 3MM7A 2X1AA 2XHWA 2IM1A 1WF1A 2B0GA 2CG8A 1W2BR 2DVIA 1LXJA 3P6YC 5KFHA 1KLNA 5KOWA 1YWXA 1C4CA 3KJVB 1Y3KA 4PEOA 4O4GA 3AXMA 5F8IA 2DNPA 3C6UA 3A8KA 1LW0B 4U7CA 2CDRB 3RBDA 4ED0A 1KKHA 3LGMA 3D3CJ 2G0IA 2OD4A 4DR6J 1DQ9A 1JLAA 5KT3A 3CMAS 4MMOA 1NKBA 2X51A 4DX6A 1U1PA 3T1HF 4MJKA 5K14A 3QJJA 3PV8A 1FKPB 5EN1A 2ZH9A 3EX7B 3D2WA 1GX6A 1MWZA 2HNDB 4L75A 3ULHA 3OTOJ 5IM0A 3B8HA 2GO9A 4KRWA 3Q8QB 2AKWB 1JK9B 2I9SA 3DM2A 2FLPA 5I42A 3I0RB 1JKHB 4LFBF 1SQEA 1KP6A 2CPFA 5ITHA 2E7XA 4F50A 1R27B 4CH0S 4NMLA 1YQHA 3UDLA 5KFMA 4IFYB 1FFSB 4NPOA 1YG0A 2YKMA 1IBLJ 4C8KA 4CLPA 1N34J 2EKYA 4QIVA 2HKEA 1QDUB 1U25A 3BS9A 3UFCX 2KRRA 1XNQF 3QFWA 1R8AA 4ECUA 5HP1A 1J27A 1N32F 5DDPC 1TFWA 4ZOSA 2D9OA 3CULA 4UUWA 4FXDA 3IA0A 3J81U 3I96A 2KO1A 1H2VZ 3H42A 1V6HA 2JDJA 5HAOA 3J80U 3BGLA 1VLOA 3KHLA 1L3TA 2KXNB 2BE9B 3MM5A 5D0EA 1WC3A 2VONA 1MMDA 5G0RA 2L9NA 4ZCKA 4PQUA 4K2XA 4CCHA 1P6TA 3VAGA 1PC5A 2EFVA 5L9XA 3E8OA 1TL5A 3BBCA 2XSFA 1X4EA 4PRFA 2NSBA 4DV6F 2FQQB 3GP9A 3LP2B 5DDQC 1TELA 1D8ZA 2WW4A 2EFPA 4N76A 1EP4B 1SJQA 1WG5A 4IKAA 1UPPA 4DCPB 1Q7LB 3ZO7A 4UF4A 3L09A 1EAYC 4GKJJ 4KGMA 4M5DA 1N5SA 5GAEU 3CJSA 3T5KA 2A6MA 2VQFF 4Z37A 3GV7B 4J9LA 4UOCA 5CA5A 3IFEA 4ZCLA 1S9GB 2M9KA 2R2SA 1QSLA 2UUAF 4WZQA 4PUOA 4DCOB 4KO0B 2KG0A 3ITHA 4WTYA 2B4OA 2RHSB 3D7SB 3US5A 1CSJA 4Q8FA 3VAMA 2H1YA 3W61A 2B6AA 2JVOA 3FMBA 3DU5A 1FJCA 4KV8A 4JI8J 4YEAA 1IQTA 2FHJD 1JLCB 5E3AA 3THTA 5B7WA 2J7KA 3KUEA 1F9HA 2RH3A 5A8KB 1KHWA 3BN7A 2R7SA 2BANB 4I2PA 1P27B 1O6XA 2LXFA 3P4UB 3FFIB 4ZMMA 1FVSA 3W5YA 4JYAJ 5KFOA 1TK5A 1IKVB 5D4NA 4EI2A 2AF6A 4GVBB 2QL9B 3RRKA 3OHAA 2BABA 2CAJA 5GAEI 3G86A 3OXGA 3TJ9A 1SL2A 3MPWA 1VC6A 3KHGA 1VQLS 1WOOA 3W2VA 1XIQA 2MTLA 1SH3A 2M88A 1RTIA 3GCXP 5C24A 2IBOA 3VGUA 3EICA 4HH0A 1ZA2B 2XMVA 5HMXA 4A8KA 1HHTP 2DEJA 4HLBA 3G71S 4IFVA 1RACB 3G2XA 5L46A 1FK9A 1IVZA 3GYXB 4UUXA 4ED8A 1N36F 1AT1B 4B3MJ 4CTAB 3EGWB 2Z58B 1TL1A 2RNEA 4OYIA 2KXHA 2YX4A 4KJIA 3D6MB 4MKYA 1LKZA 4TVAB 4DLEA 2QX0A 1XC9A 1NK8A 2RQ4A 4DS5A 4DR6F 2V8DA 2EXUA 2VQEJ 1JX4A 2YKAA 2Q66A 3KJFB 4MTPA 1RT1A 1AA1B 1LWEA 5F0UA 4AQYJ 3DDIA 1RHKB 5A2QU 2UU9J 3B82A 3F56A 4QIEA 3PO5A 1TAUA 3K5MA 4YR0A 1SC3B 2B56A 4ZPTR 1RTJA 3BDPA 4A8OA 1HBUA 2DRAA 3FBEA 3DXSX 4N77A 1N5TA 1YBTA 3BGFA 2NYHA 2DNQA 4ZLNA 4AT1B 1RK8A 3GIKA 1RTDB 1TKZA 3KLIA 3D6FB 2MQNA 1GH8A 4Y2MA 3FBFA 2W9BB 5K8NA 1NRKA 2G0CA 1CULA 2OD6A 3PCOB 3CIMA 8RUCA 3FGVA 4H4KC 1SB6A 2OPSA 2BE2B 2MSSA 2NZCA 2DISA 4ELUA 3ZFVA 4URSA 1XWLA 4DR2F 1FI4A 2EBGA 4I6AA 3K59A 4NLUA 1RKJA 2H51B 4IO1A 1LFPA 4YDDB 2XCPA 2BDPA 1Y7PA 2VODA 1KN6A 1SKSA 4CO3A 4USVA 1MLAA 1ITPA 2V2VA 2WOMB 3CD5A 4TKTA 1K0TA 3KLFA 2CPEA 1YJRA 2M0GB 3PFEA 2EG1A 3FEZA 3TUPA 4JI0J 1U1MA 2BM1A 3A8IA 4NZ6A 3ENQA 3UI3A 1ZPWX 1GXUA 2ZDOA 1HARA 1VK3A 1BWEA 3V4IB 3DLBA 4GKKJ 5C25A 2LECA 2HNYB 4LRCA 2CA9A 1IKYB 4ECQA 1UL3A 3VGVA 2ZD1B 3OJUA 1LWXA 2VFSA 1UVLA 3PYDA 4DI6A 2DR5A 3V6HA 3DMJB 4DXLA 4K50A 2PIIA 3M4XA 4M5IA 3LANA 3MURP 2HHQA 1XMOJ 5I3UB 4A8FA 3L95X 2V69A 5D0HA 1DLOB 3EGVA 2D41A 2KVQE 2CJYB 3AODA 4ZDNA 3IS9B 3PRVA 3Q8YA 2HG4A 4NCAA 4LIWA 4LR8A 1RBOB 3SZ2A 2ZUAA 3RR8A 4GKJF 2G2OA 2ZE2B 5ETMA 3C14B 2PMHA 3ZZUA 2AT1B 3JXOA 2BUNA 3K5PA 3ZNUA 2RF2B 3ISZA 4F8RA 2AZ3A 5HJXA 5U47A 3TUIC 1GT8A 2DGUA 3EM1A 3LP1A 1DZ5A 4DX7A 1NDKA 1WSRA 4ZLPA 2FHOB 5T41A 2GHVC 2RJZA 2R7OA 1JIHA 1V5VA 3MM6A 3IG1B 3N6NA 4ECVA 4BC9A 3MCMA 4CT9A 3R6LB 1SBRA 3A3NB 4G1QA 1IBMF 2JRSA 4OX8A 5BYRA 3TAMB 1NPPA 3H5SA 2H48B 1Y3JA 2MQ8A 3OHBA 4O3PA 2RT3A 4LF6J 3BPSP 1MMNA 1NB2A 4OX9J 4ZHRA 3DC2A 4RWXA 4JYAF 2ZHBA 2R7WA 2HS0A 3IGNA 3VQSA 3GG0A 1I1GA 5AXNA 4QBUA 2VU5A 4UZCA 4KBIA 3MR6A 4FYVB 5J2NB 3KG1A 3D0IE 3GR1A 3BQ2A 2R42A 4DFKA 2DGQA 4RW8B 2R7UA 1FRJA 1WHXA 3NL0A 2ABYA 3H98A 4FS2A 3ILIA 1YJUA 5E5NA 4C0BA 3Q8VA 4OV6A 3SQOP 4JI7J 4BDPA 2QTWA 5DO2A 1FRXA 2HNZA 4CLFA 1QM9A 4OMFG 1ZOTA 4CO0A 2D69A 2PEBA 3QWPA 1RAIB 1UVMA 1S7HA 2WVEA 2NXEA 2OGUA 2H4WB 5HBMB 3D0HE 1FJGJ 2PDAA 3NWGA 1TTHB 2Y1IA 2XLKA 2VUGA 4JB8B 1K0VA 2YWGA 5BR8J 3LGHA 3I9ZA 3I5AA 3VAKA 4IG0B 4O0IA 5HVGA 1HBNB 1B0VA 3DRSB 4QCLA 3DFEA 1HHQA 2F1FA 2ILZA 1K8AT 3D1OA 2XC9A 1QSYA 3M1VB 2E7WA 1S6UA 4K8RA 4F02A 2E5IA 5FJ4A 4PWDA 3C46A 1XNRJ 1U8WA 2DO4A 5DQIA 4KTQA 2QZ8A 3MEEB 2MKIA 1FXRA 2ZC3A 3QNWB 4B3OA 3QRPA 2A18A 2F8EX 2VFRA 2HQCA 2GVDA 1QUPA 1VDHA 1JJ4A 1DFDA 3ZZOA 3C16B 3CO9A 3N9UC 2ZHOA 3NLCA 2Z0GA 2GX8A 5E3CA 4RUAA 2PI5A 4M5LA 3K8VA 3MAAA 4CO2A 3JYTA 2HFOA 5M2RA 1Q8IA 3OTBA 3K5OA 4XPCA 4N8NA 2WSCC 2JFDA 4LF7J 2XNQA 4TLQA 2W4CA 2HHPA 1KNZA 3CB4A 4KYZA 3OQ2A 4WPAA 1DHMA 1S6PA 4GO5X 2GIFA 3QIPA 1HNVB 4J9PA 1A0OB 2M2BA 2CPDA 4X66J 4W4MA 5IXUA 3D66A 2HHXA 2ZNZA 1UEUA 4QIGA 4NL5A 4DV5J 3D9BA 4NLTA 1G4CA 5B0AA 1S72S 5D3GB 1QSSA 1KR4A 5ETKA 2W9AA 5KFLA 2HFSA 2V8PA 1T7PA 6AT1B 1SH2A 2UVWA 1IR2A 3Q2SC 4HEA9 2CPYA 4C8MA 4DQRA 4DFJA 4LSLA 5DGAA 2XCAA 1FX2A 1NKEA 3C3LA 1TVRB 4NMXA 4AL5A 2HK3A 1HNIA 1OSDA 3MMBA 2VC0A 3DGPB 4DEZA 3Q8PB 3D0GE 1T9UA 3POTB 3OPKA 1UW9A 4F3QA 2UUCJ 4DR1J 2FTRA 1NCLA 3M32A 3AJDA 4OX9F 1KBRA 3LWLA 4K4ZA 1HW9A 2ZBCA 5G4DA 3CNQP 1GMUA 1IR1A 1SL1A 1F5CA 3AJ2A 4BS2A 4Y3CA 1ZZFA 3MUMP 2E5GA 2CADA 3AQPA 3LAKA 2FJWA 1VJQA 4Q43A 2I6WA 2IY5B 2QLXA 1JXLA 3GJQB 2GQ2A 4CYUB 4PG6A 2K1RB 1S0MA 4RBTA 1VQ5S 3QAEA 2CWXA 1Z1ZA 5KFKA 1WHYA 3O44A 1QY7A 3LPEA 3P5TL 1KQGB 4C3MA 3JS9A 2ASYA 1X9SA 5LMUJ 4V19J 1DAXA 3CDAA 3GSDA 1T05A 4G1IA 3G8SA 2HHHJ 1CEZA 3KG4A 1D09B 3MM7B 2FJAB 3QT7A 5DM6Q 4WKRA 5KFAA 1VRQC 4LMZA 3MECA 4DQIA 1RBLA 1RCOB 3GZ7A 3CCWA 1UA1A 2BOAA 3Q0AA 2MKSA 3BM7A 2KI2A 4AFFA 4O4GB 3C6UB 5JXSA 1VLYA 3BO4A 1SH0A 5KG4A 2HGLA 2NS1B 1WF0A 2NPFA 5B0GA 4YFUA 3IAS9 3OTDA 3L4BC 3UD5A 1XNRF 1JLAB 2XGPA 2G0JA 1FEEA 4XO0A 3CMES 3M8QA 5K14B 2CQGA 5ETTA 3TZXA 1XMQF 2A2DA 3PXGa 3PR4A 2VBWA 2HAIA 5I3PA 5IM0B 1U4BA 1YZ6A 4DDFA 2VDHA 3DM2B 2ZNYA 5I42B 3HD2A 4KAIA 3W9HA 3IR7B 2HSEB 1VI7A 3KFWX 2YNHA 1REVA 3QGPA 4HHJA 4OX7A 4OHXA 4Y6IA 3QFHA 2DTJA 1JMTA 3FC9A 1SJ1A 3JSYA 4LF7F 1PCAA 2P6SA 2IDEA 2OKQA 2AGPA 5C2GA 4X4VA 2YKMB 3NKYA 3G96A 2NZ4A 4RNFA 3I82A 1VQYA 4NLGA 3A13A 3PW4A 3T3FA 4RU9A 4O44A 2QA4G 4ZK7M 5HP1B 3OFGA 4P9SA 1A9NB 1VYAA 2IA0A 4IQXA 1Y5NB 3OL8A 1NK9A 3AJ1A 1YLXA 4LVNP 2QJ3A 2IBKA 2J0QD 2ZWOA 3SQGA 4JI2J 3EZOA 3CMQA 3TOQA 3JSRA 4ITSA 2VC1A 3I9V9 2ASLA 3MM5B 1F1BB 2RQCA 1HWKA 2J9DA 2AGQA 5G0RB 1NK5A 4F2SA 4PQUB 1NPRA 1UZDA 4MK9A 9ATCB 2XMWA 3ZZYA 2O66A 4U95A 4USTA 3CJRA 3TUJC 2YWHA 4XAKA 1C2PA 1ZS6A 3HHKA 4OL8A 3PEHA 1GFWB 4XTTA 1TR0A 2VFTA 4DL3A 1WWHA 4RX6A 3HHLA 5SZTA 5KG1A 2FVPA 3EPGA 2DRBA 1T11A 2X1FA 1KQSR 4M5DB 2V8VA 3MTJA 1UFLA 3BJYA 2HQ3A 2YNIA 4NYOA 2YWFA 3SI8A 4ERDA 5IOLA 5LXYA 2WBMA 4I0WA 1M0SA 2XGQA 1YKWA 2IAJA 1RT3A 2CQDA 4PUOB 2YKOA 1NLKL 2BQRA 1RDRA 1X60A 3ITHB 2VHGA 3U1LA 2GGPA 2MB0B 3HLUA 3WX4A 2B6AB 2P9CA 1ICEB 3M30A 2DR9A 1S1XA 1RHUB 4KV8B 2FLLA 4DL5A 4HKQA 2JSXA 3MCOA 4B3SJ 3U02A 4DFPA 3G82A 1UKUA 5GADU 3N5BA 5LXRA 2LEAA 2JEIA 4DQSA 2MJUA 4I2PB 1QJHA 3BKFA 4PYAA 4YS2A 2A3JA 3RZAA 2JH3A 3BSAA 2E9RX 4J9UE 2COLA 4WFYA 4U67Q 4EYIB 1FF2A 1K9MT 4DFMA 4F4KA 4EGLA 2DGWA 5LMUF 2MZQA 4RLEA 3VCDA 3HT3A 1RUSA 1Q8LA 5ETLA 3QWUA 1RADB 1KD1T 3M8PA 4RJVA 3TAQA 4CH1A 1RTIB 2BOPA 5C24B 3JAMU 1N0UA 1J5OA 3HM9A 3IRXA 4FF4A 4QYRA 2R4FA 4JI3F 1Q79A 2ZH7A 4C8NA 3GJSB 4IFVB 2CZ9A 3PNIA 1PIEA 2VJUA 5IQ6A 4PPZA 1FK9B 5C7PA 4TXSA 2BW7A 4OI4A 5HROA 2FGCA 4NLXA 2ACYA 4JV1A 1CJUA 3DLKA 1TL1B 2FDNA 5GADI 4QU6A 2HMIA 5DETA 2BJDA 2XBPA 1HWIA 2NXNA 3C66A 3JTNA 3R5DA 2MZ1A 3UD3P 3KXDA 4N41A 4KQZA 1M5SA 1N88A 1HHSA 2F65A 2CQ2A 4PQAA 2B9YA 2VKZG 3TQEA 3BSCA 4S0MA 1RT1B 1P1TA 1LWEB 4DQQA 3CCTA 2FHKA 2JVRA 4XDDA 2ADBA 4ZLJA 1X4GA 4J7CA 4JV0A 1RAOA 1RLDA 1TMJA 2CNNB 1MWYA 4DF4A 3DRPA 1RTJB 2ZWPA 3V6DA 2DR6A 2WVBA 4KSEB 1HBUB 5IWAJ 2EFOA 3ZC4A 4NA2A 2OAUA 4YHHJ 4P6QA 1K73T 1TKZB 3KLIB 2HRUA 4OYXA 2F4FA 3PR5B 4DOZA 1CULB 3RW7A 4DR5F 1PILA 2OPSB 2V2QA 4QWBA 1Q95G 1IKXA 4P52A 3UCZP 4H54A 2VKRA 4WIQA 2FIUA 4X4NA 2MHEA 2W1BA 1UVNA 2B7CB 2HZAA 2HYIB 4NLWA 3AD7C 3ELHA 1PJ5A 3HSDA 5H9FJ 2R8HA 1VQNS 4J9SA 4P2FA 5AXKA 1EARA 3HKWA 1I94J 1RWKB 5JUMA 1HI8A 4Y2AA 3CPWR 3KLFB 2MJNA 5DDOC 3IM9A 4JI2F 3FQLA 3TVYA 3F41A 2ZJPQ 3CE8A 2MQMA 3VAFA 1F3FA 5C25B 1R8PA 3FZBA 4Q44A 4DCJB 4PXCA 5LMNJ 4NXNJ 4Q45A 2GMHA 4J90A 1WNEA 3KK1A 2EFNA 3EXCX 4IG3A 2CZVC 2RE1A 1XTZA 3RBEA 3LA0A 2XS7A 1RAHB 2R2UA 4YR3A 2HEKA 1LOUA 3QMQA 4ZPCA 3B4DA 4I1TA 3I4PA 1HD1A 3SSRA 1CQNA 2IYGA 1T9VA 1YHQS 4B3TJ 4HVZA 2R3VA 4LRDA 3GV8B 3HD1A 2VJVA 3QO9A 4J9VA 1Q0NA 1NSQA 3LP1B 4HT5A 3OL6A 3OFFA 2J9EA 1WDDA 4F7VA 3NXZA 2KFNA 3KYLA 2RS8A 3MM6B 5AJ3J 2ASDA 4B3SF 1F9EB 2JX2A 3CT9A 4G1QB 1X9WA 4QWAA 4OYBA 2MGZA 2ROPA 3LWMA 2MLZA 1RBAA 1MN9A 1N33F 1HNWJ 4DV3J 2AGOA 4ZHRB 3CXCR 2HBRB 2H4YB 5F0WA 1KSPA 4FS1A 1EETA 4G6VB 3ZZPA 2KM8C 3GYGA 5L1JA 2JZ5A 2BACA 2P9GA 1CLFA 2HZCA 4MIAA 3DOLA 2M5YA 2HQDA 4MIBA 2ZM6J 3KLEA 4DL6A 4FPIA 3OVBA 4URGA 4A8SA 3K5NA 2XMAA 6FDRA 4I56A 1WHWA 1RQ0A 1KTQA 3UCGA 3J81Y 4KH1B 1RHRB 3EGZA 3CCMS 4ETZA 5A0YA 1FE4A 1FXLA 2E66A 2B3TB 3J80Y 4P7TA 3DRRA 4A48A 2HNZB 4OZ2A 1WF2A 2MQLA 4JV5F 2C2ZB 4O3SA 3FNNA 1GX5A 3MMCA 4CT8A 3IO1A 2BMBA 3P45B 2CNKB 4ER8A 1TK0A 3GILA 1M5HA 2AHOB 3ETMA 4FYWB 4NZ0A 3R5JB 3TVZA 4F67A 4F36A 3EUNA 4ELVA 1GXLA 1MW7A 3IBWA 2GW8A 1FFGB 3D4JA 3W64A 4N5SA 5LSLA 1XMBA 4P73A 3O3LA 4DSJA 1ZZNA 2J9CA 3QT6A 2E44A 1EX8A 5CH7B 4Y0FA 2JEFA 4E98A 1Q8KA 4DSFA 4O3RA 2JEJA 2XMUA 1Q78A 4PWDB 1XR6A 4OLPA 3PYEA 2MKJA 2G1DA 1Y11A 2QSFA 4DUYJ 1TFYA 3Q22A 2OTLS 1NXIA 3WC2A 2OTJS 1NK4A 2L9WA 5AXMA 1OQ3A 3M6WA 4B3OB 3TAPA 3R9LA 2X3DA 4ZJQA 2GVDB 4CP5A 2JHEA 1DARA 3M8SA 5DLFA 5LT5A 1B3TA 3GV5B 3VWSA 1JB0C 2D3ZA 3J7YU 1H98A 5MLCV 2UP1A 4ATNA 2RUGA 2DNKA 4DL0C 1URRA 1D8YA 3ZTPA 5LSOA 2ZBPA 5GMDA 3MAAB 3UN3A 1RYRA 1I94F 4ECTA 3JYTB 3OR2A 3OSNA 4K4TA 3R7SB 5LJ3Y 1L3SA 2KRBA 1RYSA 2HFVA 3JB9k 3PKYA 1S6PB 4WP8A 3QIPB 4C4WA 1XERA 4DBQA 4D3GA 3QLHA 5D4OA 2QFIA 4NXNF 2FD2A 1QTMA 4K4UA 1T9XA 2CQBA 4NEYA 2IJFA 1X8DA 4DR4F 4YB7A 2W9CA 4DV7J 4P2SA 1X5OA 4L74A 2OPPA 3A4TA 1R6YA 5F3ZA 3KJQB 4NX9A 5LJ5Y 2YPYA 1S1WA 3H4DA 4PWWA 4C0HA 1N5QA 3K5LA 4N8OA 3MPVA 1VBZA 3B4MA 4CLSA 3LTOA 4LSLB 4IR9A 1ULRA 4WKYA 3MXHP 3MPYA 2J6UA 3CC4S 3DLEA 1HNIB 3WQPA 3MMBB 3RGIA 3X3UA 1RWVB 1OO0B 1U6FA 4DSEA 1OMSA 3E51A 2UV8G 1WC6A 2C28A 3G6YA 1HNWF 4RKUC 3M32B 2C3UA 2F40A 4DV3F 2RRNA 1RT5A 2H9ZA 2XTJP 1FO1A 2ROGA 2CJAA 4ELTA 1T02A 2EVZA 4BHQA 1M5KC 1HYSA 2UVVA 2GS8A 4LFAF 2Q6BA 4WFAQ 3H0PA 2VIHA 1C1BA 3UN5A 2DPJA 4J91A 1KTVA 3EMTA 1Y5IB 4UQGA 4ILLA 1URNA 2J7WA 4MIWA 2KJVA 3W7BA 4KHRA 4BBYA 4AXIA 4KB7A 4HDGA 3NMAA 4NLQA 4B9UA 4NLOA 5IFMA 2AMCB 3DGVA 4EK2A 1WACA 3S01A 1T05B 1AFIA 3KMSA 2B9XA 3I6PA 2CVIA 4LUBA 1NZ8A 4O4RA 1AW0A 4Q2MA 4KGXB 1YITS 2NR0A 1GTHA 1SUQA 4ED2A 3A3PB 5K9FA 2DNYA 2W2MP 4PPDA 3MECB 2V4QA 4IH7A 2QLFB 3CDBA 5CZVA 2VFUA 4OYAA 4DV0J 3CEDA 4WK1A 3P3DA 1C0UA 3CJ2A 1L3VA 1L3UA 3J7Z5 5LL6d 2HLTA 4RW6A 5GVQA 4AE5A 4F0MA 1K1QA 2KL8A 3E01A 1MROA 1S7IA 4P74A 5A76A 1J5EF 4DV1F 1DTQA 3PRBA 2KU7A 4PKDB 3WDOA 3M8QB 1D9FA 4ES3A 3MDFA 4DQPA 4Q7AA 3RBZA 5F8HA 5D0GA 2N4DA 1WI6A 3KWMA 5M2PA 2AJ1A 3TARA 3DDKA 1HQ2A 4WXWA 4DL7A 1WHVA 3JQKA 1OIAA 1RI7A 2YNHB 1VQ4S 1IWGA 3LOUA 2Z2YB 4B9VA 5F8JA 5BYSA 3FUYA 1FNOA 2HVEA 3PM9A 1Q81T 2N4CA 4EO6A 1ZH5A 2PD1A 1RB0A 3OSPA 2EC2A 1WC1A 3MCSA 2Q6CA 5J2QA 5HMYA 2XO7A 2IA6A 2FHMA 4O44B 2J8AA 4DS4A 3DRYA 3HX9A 2C2KB 3FK4A 4DZ6A 2NXJA 4USIA 2I8EA 1VOMA 2YH1A 1C4AA 3MAHA 4O23A 3BR9A 1LV5A 4DV7F 1O8BA 2MKCA 4OZ3A 3S8SA 2YWKA 2XSJA 1ZPVA 1Q16B 1YRUA 3VZIA 3SQGB 2MY7A 2CPXA 1AROP 2V67A 2F9DA 4J37A 2EFQA 2DY9A 2HVZA 2C2MB 5KT2A 3PJWA 1A7GE 3T1HJ 5DG7A 3H25A 3K57A 3PZPA 1VQ7S 1FJ7A 5ETNA 4Y34A 3Q24A 4Z2XA 5D4PA 2XYPB 5DS7A 4ZA1A 4OYOA 1X0PA 5H9EJ 4LFBJ 3HHLB 4DUZJ 3AB2B 4UQTA 2YNIB 3CJKB 2ZJRQ 1FDAA 4XIUA 4K7QA 4U8VA 2IAJB 2C42A 1RT3B 3VGTA 1U45A 4CLYA 1NJYA 2GGPB 1LWFA 2OELA 1N32J 2UXCJ 2X3GA 3AHPA 1XN9A 3M30B 1S1XB 2HBZB 2ZOMA 3GIRA 5DQGA 3K89A 4LBIA 3HFZB 3G82B 5HMWA 4J9MA 2V8GA 2BV3A 3QQCD 4CIOA 1FD8A 2GO8A 2CNOB 2AIRB 2H5IB 2EI5A 4B9SA 4L73A 1U2RA 3NGKA 4ZJOA 3CO0P 4F2RA 3GIMA 4WU3A 2UVUA 3M9MB 2E29A 3L7OA 3IMQJ 4M8LA 1KLMA 2FHJA 5EWFA 5KFYA 3GIJA 1WOPA 5ETRA 3NCPA 1CS4A 3T6BA 4RZRA 2OEKA 4WZMA 5HK4A 4I4BA 4HHUA 3OD2A 1N52B 3M8PB 2D74B 4R0JA 4B9NA 1FWLA 1X5PA 1P9YA 2OP5A 5KFEA 2KVIA 2C2DA 4QU7A 2E9TA 1J5OB 4JI4J 2WW8A 2R8GA 3JQJA 5A8WA 3IRXB 2JC1A 3DXBA 4DPYA 3CSKA 3W66A 4OX6A 3BR8A 4DG1A 2W4PA 4DV0F 3R5AA 5HROB 1CJUB 3DLKB 2UUAJ 2HMIB 3HP6A 1OYEA 2QA2A 4WWSA 3PW5A 2HVIA 1ZAVA 3G9CA 1H72C 4P72A 1BQMA 2W8KA 4FXVA 1GXTA 1HLWA 3K2YA 3WHIA 3I56S 3PACA 2J76E 1RTZA 2H65B 2JOQA 4I64A 2YTCA 4QW8A 3OL9A 1X4AA 2ZZMA 4U8YA 4J9NA 3AB4B 4ZJLA 1R3NA 3DRPB 3TX0A 2OPRA 4ZS6A 1JWWA 5B0FA 3V6DB 2ZZTA 4CO1A 3P49B 1LWCA 2PA3A 3OR1A 1IBCB 3AOAA 4IO9Q 2YX7A 1HWJA 4OHWA 2DYAA 1ZBTA 4C7QA 2VPZB 3P8BB 5AE2A 1AUDA 4ZITA 3I5CA 4EO8A 2XO6A 1UJ6A 1IKXB 1ZM4A 2OLWA 1RHQB 3R97A 4FF3A 3SSSA 2OMOA 1OQ6A 3KMQA 3R7BB 3ET6A 2BA9A 2V94A 2UUWA 1X0FA 5A8RA 4ECXA 2UVRA 5IT0A 2QA1A 3D1HA 2J9DE 4OI2A 1N36J 2IRXA 3KNGA 1JJHA 2F3JA 3DYAA 3T19A 1SC6A 3ZXWA 3NNCA 1RT4A 1Q53A 3R5GA 4HI1A 3RBXA 3AA9A 1U1KA 1RISA 2HHWA 4FNHA 4ECRA 5KT5A 3AOBA 1R8CA 1X7VA 3T9NA 1WTBA 4DL4A 3T5LA 3NCRA 5DDRC 4Y28C 5CAAA 4ETXA 1TMMA 3QSYB 3FQKA 3KTQA 2YXLA 3KK1B 4EEYA 2DNNA 1X4FA 1FXDA 4IRKA 2GMJA 3MGJA 2DCUB 4IG3B 1Y4ZB 1NH8A 4WFNQ 1EKSA 3MR5A 4DUZF 4KC5A 2BE7D 1EHWA 2VPYB 1APSA 4TQRA 1TL3A 2VL1A 4ZPWR 4P7VA 1BWVA 1IBKJ 5A6WA 2AZ1A 4KFBA 1FRKA 1Z2ZA 2XZTB 2OUGA 1RWNB 3QO9B 1RHMB 1U6ZA 2XMTA 4DR2J 2N7CA 1WOSA 4L76A 3Q86A 2LEPA 2VV5A 4OZLA 3EVWA 2UXCF 1FVQA 3HHLD 1FTRA 4FF2A 2JLEA 2GIRA 4F25A 3QT5A 3O5TB 1RHJB 3BGOP 4LRFA 2FJBB 4KGVB 4R8UA 2MGZB 1WDTA 2NYIA 1ZETA 2Q79A 3SFGA 3EJMA 1E6VA 3KLGA 1PYTA 2IM0A 2RSQA 1O5JA 2HBYB 2E1MC 5ETPA 4X4QA 1BLUA 1HBOA 1IWAA 2AYEA 4L3KA 1EETB 2ZDPA 1Q5VA 3V6KA 3ZTRA 3R27A 3T6JA 3HSGA 4DPTA 1V3ZA 2HWHA 2CQ0A 3E2EA 2F8MA 3DOLB 2K3KA 4I6YA 4FKYA 2J0SD 4GC6A 3RB3A 4IUFA 1X31C 1PJ6A 3KLEB 2EWHA 3BQ0A 3NBPB 4OIXA 1WORA 2QLBB 4JI4F 2HFZA 5IS2A 4ZP8A 1U26A 1MSWD 5K20B 1HQEA 3FZ2A 5HN0A 4PXBA 1NBEB 2UUBF 5A0YB 4NLDA 3BYPA 2D7SA 1SCJB 1T94A 3I87A 3DRRB 7FDRA 3UPFA 2EK6A 3B54A 3U27A 4LF1A 2JLGA 4KHPF 1S97A 4NLVA 4USWA 3MMCB 2EKNA 4WP9A 2QA4S 3NRBA 1S1UA 2ZBQA 2RHQB 1CVJA 2F7VA 4QR1A 1U24A 4O3OA 4ZVOB 1BQNA 1UTAA 5L1KA 4X4UA 1VQOS 2XLIA 1XBWA 3I32A 4MKAA 1IBMJ 3KK3A 1YJVA 2DJWA 3ZTQA 1OPZA 2WCXA 3OJSA 2K3IA 3C19A 2Q1LA 3EWGA 1VR6A 4ZVPB 4NEZA 2Z2LA 1BE4A 4MFBA 2JLFA 1RAJA 1VGYA 2KM8B 1UZHA 3R1LA 3P96A 3PY8A 3L7UA 4EZ6A 1Q8BA 1U2FA 2K2PA 2G9OA 2ZH5A 2V2ZA 2DCLA 2HLUA 4FYXB 5CD4H 2B5JA 4P75A 3W1YC 2FJVA 4RNMA 2Y1JA 5KAKA 4PG5A 5K8PA 5KT7A 2LA4A 3FKBA 3EPIA 3GPAA 5T14A 2FC8A 2MQQA 3I0SA 4Q5VA 1F6TA 4H4MA 4UY85 2RAQA 4KE5A 1R8BA 2W7PA 1CC8A 1UMJA 3OR2B 2DGTA 4EYHB 1WI8A 4F0KA 4QWCA 1T03A 1FRHA 1FDDA 4WBFA 3W60A 2ZBRA 5I4MA 1U0SA 3ZNJ1 3NOGA 3VQTA 3MR3A 3UR0A 1FESA 3QLHB 4CLZA 2JJ4D 2V9WA 2I0XA 4FYDA 4ZP9A 3JAMY 3MEGA 1HA1A 3W63A 1H38A 2YNGA 2C22A 4RL1A 2ZOFA 3MCNA 2W9CB 1QAYA 1VQ8S 4DSKA 5JVHQ 5KG6A 1KS2A 2OPPB 2BYCA 4M5NA 4KKOA 1NM2A 1S1WB 2BX6A 4Y00A 3ISNC 4A4JA 1GEHA 3VZHA 3Q2TC 3EXYA 1IBKF 3CIZA 5RUBA 2APOA 2YQ0A 2MZRA 3KHHA 2VF3A 2XS5A 4L72B 5HLFA 4QYZJ 3LP0A 3BZQA 4TNOA 3GFHA 4USUA 1TUWA 2W2NP 3DLEB 4X62J 4JI5J 1UEVA 2Y8WA 2HIQA 4F26A 1C1CA 1M90T 4CM2A 2H5EA 3PW7A 2BJ3A 2J0XA 1YIJS 1DY3A 1FWKA 1S1TA 2DNZA 1UCNA 2AP6A 3EVMA 1OY6A 4TYAA 4BWJA 4OZ5A 3NS5A 2ZHAA 1WELA 1UFWA 3AOCA 2DH7A 1M5OC 1OPIA 2WONA 5D15A 3BGUA 4OYPA 1RT5B 1S59A 2HW3A 3O6QA 1UA0A 2FC9A 4FDFA 2P9EA 3PX4A 5K5MA 1FT8A 5J1EA 3WC0A 4RNHA 1FJEB 4RUBA 1HYSB 5CHCB 1N48A 4ZVSB 3EZUA 3M2UA 2IC3A 3VGSA 3A3OB 4FBUA 4MT1A 3NGTA 2DIVA 4NLYA 1UEKA 5KG7A 1C1BB 2YBVA 4DPOA 2KHCA 4NI2A 3DOKA 2FUG9 3HPOA 1VK8A 3T1YJ 3BDEA 2VH7A 2MMYA 4HTIA 2V6AA 3PO4A 1H2TZ 4C98A 4H4KA 3NAHA 4UY8T 5KOXA 3ZZ0A 3V2UC 2G13A 2NLWA 2H5JB 2NPIA 3BKUA 1BMQB 3A8JA 1OS5A 2BKPA 3QIDA 3HXMA 3RU0A 1SUQB 3QSIA 3LALA 4HT7A 1WJ9A 1HPZA 1LK7A 2C1EB 3EE3A 1C0UB 4FP9A 1KONA 5KT4A 3S1TA 3BPDA 1YK9A 4DHVA 2V34A 3CDUA 4A8QA 4NLSA 2I1RA 4RW6B 5F3TA 2AD9A 1CBKA 3NGSA 5F9NA 5ETOA 5F9LA 3BREA 3E01B 4A47A 1MROB 4ZVUB 5CCMA 3DI6A 4W90B 3H2LA 1DTQB 1TUGB 4I2QA 2YQ3A 2RKIA 1SV5A 3EGNA 4RUCA 5DM7Q 1NU4A 1HI1A 1C0TA 2UUTA 5F8LA 3KKFA 2V4RA 1FNMA 4GMKA 1BQXA 2MLYA 2J6TA 2BW2A 1YX2A 4JUZA 4RW7A 2AJ0A 3PX6A 4M5KA 2ZVIA 4IYQA 5D78A 4LJMA 5KFWA 2HS3A 1MMLA 1KHVA 5HVFA 1KVKA 4NLRA 4G65A 1MU2A 5J2QB 3MWBA 4HH1A 4TU7A 2ZFHA 4J9RA 2B8QA 1I6JA 3OXLA 4ENOA 4FZVA 4NCGA 2FLOA 1NZAA 3CCSS 4LF5J 4ED1A 1TKDA 5E3QA 2W8LA 2HZVA 3BH7B 5KFBA 2XSJB 4QWDA 3QPIA 3MMJA 1WTFA 5EX3A 3FSYA 1BGXT 5E3RA 4X64J 3TZWA 2GQQA 2KFYA 3MFHA 4HI2A 1YSJA 1T9WA 3VALA 1RAFB 2EEYA 4C8LA 5K8MA 4WFBQ 4I7FA 1X9MA 2KT3A 4TY8A 2GQCA 4NWBA 1UJ5A 3KLHA 3NGUA 4KH0B 1XMQJ 1NEEA 1N5YA 4QOTA 4X62F 3L7PA 2E7VA 2IVFB 5E41A 4JI5F 3OL7A 3UDEA 1TU0B 4YY3J 3CCJS 4ZPAA 1X5TA 4U7UK 1N8RT 3R3TA 4N7TA 1H6KX 4DMZA 1LEOA 1Q5YA 3LUYA 2P6TA 4R5PA 2HVHA 2R9LA 1WC5A 1I5OB 2VZ9A 4WYWA 2SXLA 3LPYA 1GMVA 1DTTA 1NO8A 3AFGA 2CG4A 1LK5A 4ILRA 4Q0BA 1U1RA 2LU2A 3AA8A 2FVQA 2WZ1A 3GG1A 2L9DA 2PGCA 3QJPA 1LWFB 1RWXB 4PG4A 3DN9A 2H3EB 2IVYA 5T7LA 2K8GA 1JLBA 2FPHX 4O3QA 4DF8A 4JOUA 2OMLA 3V4MA 2OEMA 3JSMA 1HWLA 3TP2A 5IT4A 2ALZA 2E5JA 2KTQA 2PI4A 2GAGC 3T1YF 5HQMA 5E2QA 1KLMB 2DR8A 4DR3F 3CD6S 4MAKA 4LRBA 1NK0A 1FFWB 1CS4B 2EPIA 3FJ2A 3TEHB 2AJ2A 2N7YA 2DHXA 2V5HG 2CDQA 4K4SA 2BZ2A 4F4AA 5A8WB 3M2RA 3GTYX 2LDYA 2A2CA 4ZVEA 2WVDA 4IRCA 3QGIA 4DG1B 2UZAA 4C0OC 3HKZD 5CQGA 2CVEA 2DNGA 2KYZA 4EBCA 4WE1A 2OPQA 5KFVA 4IRDA 4Q8EA 5L1IA 2XNRA 3M9NB 3OFEA 4DJBA 1R89A 1WKJA 3HCXA 5BYQA 2L08A 5DLGA 4W92B 1EQ0A 2NXUA 3F44A 3K58A 2M8HA 1BQMB 3ONQA 3ISND 2ROEA 1H7XA 1S76D 3H7HB 4F4WA 7AT1B 3MHYA 1JLFA 1U09A 2QT7A 4DUTA 3NOCA 2M52A 2VBZA 2JL9A 2DGSA 3C8YA 3GR0A 3W5ZA 1FA0A 2OPRB 1HIYA 1FDBA 5IV3A 2MYFA 2PMWA 2D9PA 1U1OA 1UFKA 1U8SA 1LWCB 3NAIA 1Y0HA 2BKOA 2BR0A 3OR1B 2QMWA 2WB4A 1FD2A 3KG0A 1BHNA 1VBYA 1JLQA 1OSCA 1RCXB 1AZSA 3D67A 1PAUB 4F4ZA 1EJ7L 1ROFA 2R7QA 1YJWS 4EWTA 5FLXU 3ZTOA 2J5AA 4O0NA 1WC4A 4QW9A 1CJKA 2B7BB 2DGVA 4M5HA 3ET6B 3D54A 4ZVRB 1DRZA 5KFQA 4JI3J 1H74A 1QVGR 1WEXA 1RGVA 2FY8A 5A8RB 3P5BP 3ZZTA 4OYMA 1RXOB 3G8TA 3CCLS 5KFPA 5GMKa 1AXQA 4LF8F 4ECWA 1S99A 1NDLA 4LF5F 4E8UA 4I68A 1NJXA 1UAWA 1HL6A 2OHDA 4WP3A 2BXJA 4DV2F 3DYAB 1M1GA 1RJJA 2VPXB 2EK1A 5L38A 2XZDB 1RT4B 1W2IA 4X64F 3RAXA 3IWNC 2DR7A 4M63A 2PT0A 3AT1B 2JWNA 1YBAA 1GMWD 1GAOA 4WFZA 1PO6A 3IC1A 4ZN3A 3GMGA 2IRUA 3TJAA 3GQCA 1SJFA 3OFHA 3MEDA 4AD6A 1I51B 1Q4RA 2R7VA 3WX8A 2OH2A 2MZSA 3NGDA 8ATCB 4MYUA 1TL7A 1NHUA 3LAMA 3R1HA 1B0TA 3QRQA 2GJ2A 2LU1A 1NMEB 1VISA 1NHVA 4YY3F 3RUBL 3BQ1A 1EZZB 3VAIA 2R2TA 3N5FA 1EKRA 2XLJA 3PRDA 1TL3B 2F8HA 4M1KA 2G4BA 4ID5A 4DR5J 1QLNA 1Q1KA 4KFBB 1PC4A 1UW4A 2OEJA 3A8EA 3R2DJ 2EG2A 2DRDA 4MK8A 2XHCA 2G1HA 1F0XA 3CC2S 3GIIA 2YKPA 3K0JA 1U2CA 5K8OA 1YJ9S 4RPFA 1NPKA 2B9EA 2Y0BB 3ADAC 3UVJA 4A8XA 2ACMA 2K06A 4ZPBA 2BM0A 4RUHA 4R8UB 5DG8A 2XMMA 2X7IA 1E6VB 3KLGB 1YBUA 1U49A 5EUHA 3DLHA 1LW2A 5B09A 1MWQA 2YQ1A 3AY0A 1SIZA 1VIXA 3BGRA 1HR0J 1HBOB 3KK2A 1JNRB 2QSWA 4C97A 3CCUS 1GK8A 2BJ8A 3SDEA 3G6VA 3VHQA 4FBTA 5B0DA 1W7WA 4ALZA 3WIUA 1YRTA 3MMAA 2XZWA 3I5BA 2W2OP 3OLAA 2Z2ZA 3AAWB 4JV2A 5KFSA 2CPIA 4RU2A 2ZBIA 3KLVA 4I6WA 4ZCIA 1HQEB 2WK4A 1HNZJ 1WKLA 3HJFA 2DXFA 2F63A 3F73A 2Q43A 4G1PA 3D5MA 3CJKA 2FJXA 4ECYA 2A0FB 2NXCA 2ZITA 2C3YA 1W25A 1S1UB 4NYZA 1FE0A 4OLOA 3I55S 3EDRB 2DEIA 1BQNB 1RU1A 3ENAA 4K4WA 4YOEA 2MY8A 4AL7A 4PYDA 4DL2A 4CNZA 4J5OA 3DKDA 3MR2A 3MTKA 1SXLA 3KK3B 2OO4A 2FY1A 2B9WA 2JEGA 3H20A 2HWIA 3T1AA 1SJ3P 1N33J 3TANA 2RU9A 1EIYB 2IRYA 2DNHA 3FDSA 1NSKL 2AYMA 4MFBB 1WEYA 4LSNA 2U1AA 4YP3A 2K7KA 3T9ZA 1IR0A 2VD3A 4DPXA 1TZ0A 2ASJA 4NA1A 2B5JB 2CFXA 5KFRA 4M5MA 1K1SA 4OHVA 4QWEA 2HFUA 3I0SB 3GLJA 4LF4J 1QUVA 5LOQA 4H4MB 4NLPA 4CZCA 2MLXA 2Y1LB 2CQHA 3H40A 1QAXA 4HTJA 3BKTA 4TLRA 4FXWA 4JV5J 3PHTA 2F4VJ 3O1LA 4XPEA 3OTOF 1R7IA 1T03B 2ZOGA 1N56A 2ZH8A 1N6QA 2R8JA 3KOAA 1YDLA 4NASA 1TKTA 3QZ8A 1CJVA 3G8QA 1R31A 4ES2A 5CYMA 3MEGB 4NZ7A 2WTFA 2YNGB 1IBLF 3W65A 1ZAWA 3HMJG 1TV6A 1N34F 3R5BA 3RAMA 5IT9U 5EDWA 2BEFA 2PMZD 2YX1A 3PKMA 2YNFA 2DY1A 4ZVHA 4DSIA 4KKOB 5KFXA 2YWEA 3V81A 5HATA 2V4JA 4E0DA 5GAHU 2PE8A 2GA7A 1R6VA 1WG4A 4DV4J 1UETA 4LRAA 2QC3A 1KOHA 3BEGB 1SQGA 1PJ7A 3L3CA 4U96A 4ZP6A 1S0OA 4PXEA 3FCVA 1MN7A 3WZ0A 5HLFB 3RG6A 3LP0B 1IXKA 3MUVP 2DNRA 3ZTSA 2D1CA 2OSRA 2IM2A 3HDSA 3EZ5A 4GVLA 3O8WA 1C1CB 2R8IA 2QFJA 1S1TB 1NKCA 4K0KJ 4WXOA 4C9DA 3ETOA 3T5JA 1G6BA 4WK3A 2EBEA 1R0AA 1N0VC 3OUYA 3NGRA 4OFZA 2WONB 5D4LA 3HSZA 4BCAA 4CDIA 5LSRA 3M6UA 3PW0A 3HSJA 2RDIA 1HR0F 2I2YA 4F3OA 5GAHI 1VQKS 3LGNA 1E6YA 1PG5B 5J1NA 5J1EB 2PFFB 1IKWA 3AXKA 2AYGA 3VR1A 1FWPA 3DOMA 2O1PA 4DR4J 1HMVA 1VRTA 2WRMA 3M2UB 4N47A 2HQFA 3IWXA 2IC3B 2DH8A 3KNAA 3ILOA 2IFXA 2GAHC 4DU8A 4CRJA 1H2UX 4PAAA 4NI2B 1HNZF 3DOKB 4IOAQ 1PYSB 2B51A 1ELOA 4C6AA 4JI8F 3KDNA 5MAOA 2GV1A 4W98A 4WFXA 1RT2A 2QN6B 4BC7A 1D9AA 4X65J 3MR7A 4ANDA 4D3HA 4QPTA 2KZMA 1V5IB 2DXEA 3UN2A 3OLBA 3HHEA 3SYZA 4G3IA 1FERA 2LFVA 1UVJA 4F4YA 2VG6A 1M5PC 1YRXA 2LP4A 2JNJA 1HPZB 4OZNA 5H9FK 1FRLA 4CLTA 1G7CB 4NXMJ 2QL7B 2QG9B 4OYWA 1OWXA 2VDIA 2ZH1A 4QR2A 3IBCB 2LLZA 2BJ1A 5HQ8A 3N01A 1VQ6S 2ZZNA 2KG1A 2CJKA 1X4HA 5HL7Q 4K5RA 3DI6B 4B3MF 1U02A 1Y9OA 4I2QB 4WIIA 4AXJA 2DHHA 2MXYA 2IM3A 2RKIB 4PR6A 1SV5B 4LFAJ 3HI9A 3NBPA 1S79A 2HPUA 2AQ4A 2HHSA 2R7TA 1R0CB 2HURA 3RR7A 3RRGA 1C0TB 4TY9A 4LF4F 3ILJA 2VQEF 2RDDA 5I3QA 2HHTA 4ICLA 2YH0A 5KT6A 5KFUA 2Z2MA 4AQYF 3TI0A 1G2EA 1AB8A 3D6HB 2UU9F 4RW7B 2M3DA 3TWZA 2DH9A 2F4VF 2BJ7A 3T5HA 2GIQA 4X84A 4LVOP 2AW0A 4KGZB 4ZVFA 1BY9A 2RVJA 3CCES 3UDCA 4DPWA 3DHXA 4XDCA 2M7SA 1B7YB 4NOHA 1MU2B 4TU8A 3W9IA 3GU0A 2Y0SD 2V0NA 2E1RA 2C2RA 1S6OA 2W2PP 2PEHA 1UPMB 1T3OA 2E5HA 1RWUA 3M9OB 1DBDA 2CQPA 2J8SA 1ACMB 1B0PA 4NCGB 2A10A 3ICLA 3SEOA 4OQJA 3FMWA 2ZKTA 9RUBA 5LM7E 5L1LA 1RWMB 3TR5A 2DHGA 1H3DA 1XEZA 2E1PA 5J2PA 1XR5A 1PYOB 1YJ7A 2C2OB 1BUXA 1O0PA 2FVRA 4DV4F 1Q82T 3Q23A 2AX1A 4DV1J 1J5EJ 2FJDB 1YZ7A 5EX0A 4I7FB 5KFZA 4TY8B 3KLHB 3H90A 2CQIA 4JI0F 2GCFA 3UD4P 2L41A 3UR3C 2P5VA 3UNYA 1N5YB 2VG5A 1PGZA 4GKKF 3NY0A 2MEWA 4OI0A 2Y8YA 2DKOB 3J7A1 3J7AN 4OZ1A 4ZP7A 2RB7A 2QE5A 3CTRA 4A8MP 2NSCA 5L39A 1DJ0A 2QEXS 4K0KF 1XMOF 3MD3A 4R5PB 3HVRA 4HHHA 1J2VA 1W26A 4HACA 1RWWB 3B6BA 3DCAA 5HQLA 3R2CJ 1DTTB 2CQ3A 3GFYA 2CJBA 2RUSA 2B4VA 2HGNA 3CDEA 3HVTA 4Q0BB 3ZZRA 3S7RA 3QT8A 1T0TV 4ED4A 2HS4A 2FGOA 1U0HA 2ZVSA 1FKOA 1D1UA 1RTHA 1CPZA 2VG7A 2LMIA 2IVMA 3MM9A 3C6TA 5BXIA 2LDIA 5T7LB 1SQFA 3IXQA 2RDJA 1JLBB 3TA2A 1SL0A 4OYZA 3QATA 1GQEA 4CLLA 3J7YI 1NNDA 5B08A 2K7JA 3JSMB 4IH6A 1FNXH 1X4CA 2F5GA 2XB2D 4UOHA 3N0VA 4U6PA 3TQ1A 4P2XA 2QO3A 3M7VA 2ADCA 4ES1A 3CCRS 4LQ9A 4ILMA 3EYZA 5J1PA 5ADZA 2VA3A 1S48A 4ANEA 4X65F 4LF6F 5ETVA 3PG9A 2N3OA 2XWXA 2HFNA 1F2GA 4YB6A 1YJTA 2Z8QA 5A2QY 1RE1B 5J2MA 3HULA 3CUNA 1PAEX 2NUHA 3M2RB 2IMOA 1IM4A 1HQUA 2E1CA 3M8YA 4KIAA 4ECZA 2RRAA 2E5LJ 1RSCA 2X1GA 2W4DA 3C15A 2KXFA 4DPUA 4NCBA 4WE1B 4GO7X 2OPQB 5D8HB 2W25A 2L3MA 3GWCA 2M70A 4NXMF 1D3WA 3N6MA 6FD1A 1S4FA 4LR7A 3FCWA 1M1KT 1VBKA 1WG1A 1U1LA 2IYIA 2ATLA 1TP7A 4LSZB 4JI7F 3Q8SB 2V50A 2O67A 3G4SS 3CCVS 3KUHA 3TA1A 2KT2A 1TKXA 4L6V3 2XG8A 4H4OA 3UCUP 4B9LA 4K59A 1F9FA 3OTEA 4DSLA 2VPWB 3SFUA 4YQWA 4YB5A 1JLFB 4NRTA 1K44A 1S12A 4B9TA 1FJGF 4K4YA 2DO0A 1SKRA 3K8WA 1S6QA 2FB0A 1V3RA 3TRGA 2AV5A 2PN6A 3R5CA 2WAQD 3NS6A 2DNMA 4OI6A 5BR8F 4DWIA 2RRBA 2HHVA 2DIUA 4HR2A 3M2VA 5CYQA 4YMEA 1JLQB 1QE1A 1AZSB 3QAUA 4FKXA 4ZIVA 3MI7X 5CD4A 5HI7A 1RA7A 5AE3A 1QD1A 3UNGC 2DGXA 2OFGX 1CJKB 4Q2LA 4Z7YA 2R8KA 3PIPQ 1G3OA 3MZIA 2O01C 3DLGA 4FF1A 1CJTA 2OFHX 4ZVGA 1ZM3A 5HMZA 4BLGA 4RW4A 5FDLA 3KHRA 2GVZA 5JMNA 5H1SV 2XS2A 2O3DA 2VOPA 4IDKA 3IWLA 3CJTA 4IQMA 1NSAA 4TQSA 3PIOQ 3MOJB 4J9OA 3WBZA 1IJEB 3PX0A 3AD8C 1FX4A 2ZC4A 1B99A 3W2WA 3HHLC 1OY8A 2V2KA 4FYYB 1VRUA 1PBAA 2ZH4A 4CO4A 2GNKA 2MKKA 1SI9A 2GFFA 2YKNA 4PWUA 1FRIA 2W2QP 4UOGA 4LT6A 2DT9A 2MDAA 3BBFA 1IM6A 2CJ9A 3MEDB 1ZM9A 1NK7A 2BRKA 1JJ2R 1OYDA 1RT7A 1TL7B 1KRPA 1VIOA 5KFCA 4QPXA 4X66F 5AXLA 1OY9A 1RT6A 5L9NA 2RU3A 2AX0A 4QQBA 2B4PA 4ED7A 3NEKA 4DV5F 1DURA 1S5ZA 4ID5B 3N6LA 3CW2C 1AUSL 2MQPA 1S1VA 1UP1A 2CJXB 1NDCA 2Y3YA 4OJGA 3CF5Q 2LVWA 3CJ4A 2Z57B 1B7FA 1AFJA 4ZKAA 3GJRB 3SIPB 4QZVB 1S10A 1KEKA 4YUDA 3OXFA 2HBQB 2XM3A 1NSPA 3NNAA 4X2BA 3OT9A 3UVJB 1F3VA 2WB1D 4EZ9A 1JLEA 4PCQA 4UT4A 2KKHA 2QRRA 1S0NA 3DRXA 3CDWA 4WU2A 4X4RA 1IUJA 1S9EA 1LW2B 3UQSA 2BBEA 1OJ4A 4J9QA 3W62A 4CLWA 1NJIT 2DK2A 3BGRB 3KK2B 2DITA 2GHPA 4ZPDA 4C3LA 1RA6A 2UUCF 5HJYA 4DR1F 4LF9J 2Z30B 3PJ9A 3SDEB 5EHHA 2OJ3A 2KB2A 4Y2IA 4JP8A 2DXDA 4E2FB 2MKHA 4U7UD 3MMAB 5A6PA 5JJBA 2AEMA 2V63A 1Y5LB 4U9RA 1KFDA 1S57A 2R7XA 2LCWA 1S4EA 3OW2R 3MAQA 3CGIA 2IJNA 3MF5A 2L48A 1FTCA 2FZGB 2I5JA 1SJ4P 1SJRA 2N82B 4PG8A 1ZYQA 1JLGA 2YWWA 2E5LF 3LW5C 5KFGA 4B08A 3TW0A 4RW9A 4MKBA 5EGYA 2RQKA 3THPA 2UXDJ 3BYRA 2HIYA 5B0EA 4M5JA 3IRWP 2LYVA 4LIRA 3UO0A 3FRZA 4IH5A 3PYGA 4JI6J 3FRYA 2EW9A 5C42A 5EWGA 2CZ4A 5M2UA 5HVHA 3SCIE 2MSTA 3JQMA 1NDPA 4JI1J 4B17A 4PXDA 2CYYA 2YVSA 3W2VB 3TZYA 2UV8A 2CPHA 4TN2A 2HHHF 2C2EA 5SUHA 4USKA 4C11A 2HK2A 4WYLA 1QAIA 1V3SA 2XULA 4LQ3A 4Y65A 4RWWA 2EC0A 4LSNB 4RO0A 3KUGA 2Z56B 3MUTP 3TX8A 1UWBA 3W5XA 4LBPA 3HJVA 2V9KA 1UJ4A 3S6EA 1S9FA 1Z2LA 4F0HA 1HBMA 4UW2A 3FVYA 1WEZA 3TYTA 2KH9A 1KQKA 3IR6B 2AEFA 3IM8A 5ETQA 3RYLA 3MM8A 3SBMA 2J0WA 2D3O1 3GONA 4PZVA 2UUBJ 1NJZA 4K2JA 4LFCJ 4CM0A 5H9EK 4B02A 4KHPJ 3BBBA 3PFOA 1MG7A 2PO4A 5HO4A 2CRLA 4M5GA 2QLJB 4FVCA 4PG7A 4DLGA 4LBHA 1N6QB 4YR2A 2ZJQQ 3O2IA 2HVDA 2GHWA 2RMLA 2XY5A 3QJLA 1TKTB 1CJVB 3ZZZA 1T9YA 5CYMB 2NREA 3OVAA 5DJBA 1Y00A 3HHNB 1N5VA 2XYHB 3BO2A 3U1NA 4J9KA 4EMDA 5BJRA 4OHYA 1SIWB 4EFAC 1TV6B 3SCJE 2QL5B 4A8WA 3SMZA 1VC0A 2C2NA 2YNFB 3RJMB 3RTVA 1JXEA 3M6XA 4HL9A 1XJWB 3V81B 2V4JB 3GE9A 3D28A 1WKKA 4DN0A 4RNNA 2MPUA 4IR1A 3CJ8A 3CD0A 5E3PA 3KJVA 4EBDA 5IQQA 5KFFA 1LQ9A 3FEYB 1LW0A 2AJFE 7FD1A 5ETSA 3TJ8A 5E33A 4DN9A 2DNOA 1X4BA 2FZKB 4USHA 2RIJA 3W9JA 2G2ZA 4AYBD 3CWJA 3IGVA 1BXNA 3LQVA 2RD5C 4ZIWA 5C5JA 1FKPA 1K47A 3N4WA 4ZCMA 2HNDA 3QGHA 1NJWA 5IV4A 3MOZA 3THVA 1I3OB 1SKWA 2HRTA 3I0RA 5FD1A 2MQOA 1R0AB 3OUYB 1NB7A 1JKHA 2XI2A 3D6TB 3CCZA 3PVXA 1BC6A 3GFZA 2WSEC 1PSDA 1XK8A 2D3OR 3CVKA 3HK2A 4KHMA 5FLXY 2IMWP 2GJFA 4IFYA 4LF9F 1U48A 1E6YB 5D0RA 2V68A 1IKWB 3N28A 1JXVA 3DDNA 3VF0B 2V8HA 2CPZA 3DOMB 4WTOB 1HMVB 1VRTB 3JSBA 1HKAA 2AJ4A 2ZH2A 2RQMA 3M8WA 3GFXA 3K7RA 3PTWA 5L8RC 3VTIA 1HNXJ 4KGKA 3L9ZA 1Z4UA 2WVCA 2HRYA 1HD0A 2VASA 1RT2B 2XQCA 1S0VA 2VA2A 2ATCB 4CWBA 2UXDF 3HZEA 4EUVA 5KFIA 1R43A 4DZDA 2YPZA 2DHSA 3E3XA 5GAGU 1R8HA 5B0BA 4DX5A 4JI6F 3PEJA 1T8EA 3MD1A 2AWZA 2AJQA 1TL4A 4OHZA 5KFTA 1KVIA 4RR5A 2MZTA 5E7OB 2MKYA 4TYBA 3PHEA 2VG6B 2ZEJA 4C8ZA 4JI1F 2FZCB 2C3MA 3HT0A 3LP2A 5DZ6A 5CABA 4X4OA 2NUUG 3CCQS 1EP4A 2CNLB 2JFKA 3OVSA 4Z7CA 4GC7A 3K17A 3UW1A 4MK7A 4OZ0A 4M94A 8AT1B 5F8GA 2GJIA 3G87A 4P71A 4R0EA 1S9GA 5CZXA 1NH7A 1FRMA 1FEHA 3B78A 1B4SA 4X4TA 2ILYA 1WSVA 4ED5A 2IJRA 1F5AA 4KO0A 1H0HB 1EQMA 2YY3A 5KFJA 2Z4PA 5GAGI 3CJQA 2MHNA 4KR0B 3R8YA 3LO3A 1WD6A 1KWMA 4ICLB 3VV2B 1G1XA 2HHUA 4K4VA 1JLCA 5EWEA 1DQAA 1ZA1B 2VB6A 5KFDA 4LFCF 3WIVA 4NA3A 5A8KA 2LXIA 4UZBA 2BANA 3UE2A 5KTQA 5KFNA 2ZKUA 3HF5A 4QR0A 4USMA 5KG2A 3FFIA 2W7OA 3HVWA 4OJ3A 3BV8A 1P1LA 2LKZA 5IWAF 1QVFR 2Q3PA 1IKVA 1LXNA 4FNIA 3BF4A 4GVBA 4YHHF 3DNCA 3NS7B 3AH6A 1SVDA 3SSQA 2KHDA 4HDHA 1QTNB 2HQIA 2Y1RI 1RWOB 3TUZC 1SKUB 2WBRA 4CNYA 2P8IA 2CWKA 1FDNA 2CJQA 2RS2A 3H8YA 1TK8A 2W24A 1YTYA 3Q89A 4MYTA 5CXTA 5THWA 5E0OA 3H5YA 1VQ9S 3A1YG 1VBXA 4I69A 4R25A 4X4PA 3MFIA 2R7RA 1QAJA 4RBVA 4QJVA 1RABB 4ZVTB 2HGMA 4NRUA 3R6GB 1L5UA 5J2PB 2A6OA 3RRHA 1WUUA 4WF9Q 2OSQA 2VBXA 4CTAA 3BSOA 3U1MA 4RNOA 5D6GA 3BN4A 2AEJA 4AUKA 3SV4A 2LQ9A 4Y2CA 2BQUA 3H59A 2VG5B 4KT0C 3H5UA 1TUVA 2NCKL 2XYGB 1VHIA 3AD9C 4UOFA 2VOOA 5LMNF 3H4BA 1FCAA 4B9MA 1HFEL 1FKAF 2YKQA 1AYEA 4CLUA 5C2CA 2QMUB 3QYYA 2CQ1A 4HACB 3MPUB 1VMBA 3QGGA 3QZ7A 1F2HA 2KYXA 4B3RJ 2C3PA 1VQPS 3HVTB 1RTDA 4M95A 4C8YA 3J81j 1SC4B 5AE1A 2IDLA 2FYXA 2W9BA 3TVKA 1U0HB 2I38A 1FKOB 2PC6A 4Y2KA 1RTHB 2VG7B 5FIIA 1P9QC 4A46A 3MM9B 2CPJA 2BE2A 3OBIA 3C6TB 4B3TF 5CYJA 2BJ9A 1RAEB 2RILA 1RZMA 3KDOA 1O51A 1F5BA 3GB0A 1RAAB 4OI3A 1HW8A 2NQPA 2BKNA 2ALYB 2XWYA 3N79A 5AJ3F 2D3UA 3LH2S 1T3NA 1HNXF 3NP5A 3Q83A 2WOMA 2LA6A 2KT5A 2FJEB 3ILLA 4DR7J 3BO3A 4C2MA 5IZHA 2XY6A 3ENVA 3FSIA 3W3SA 1NHKL 4ED3A 1M1HA 3M8ZA 2H54B 3CD7A 3V4IA 1RWPB 3BB5A 1PKUA 3VAHA 2CUYA 2HNYA 2POKA 2W01A 5KG5A 1IKYA 1T9TA 5J2MB 1H73A 2BJEA 3I31A 2G2YA 4CO5A 3KJNB 3JTOA 1U1NA 4ZVQB 1REGX 2ZD1A 5IT9Y 2MZJA 1P8GA 2FVCA 1HQUB 3DMJA 2KZZA 3BH6B 5I3UA 3C15B 1DLOA 3TZZA 2ZM6F 2M4MA 3IN5A 2E1AA 3IS9A 3Q8RB 4EU0A 2KFZA 2ZH3A 4EBEA 2DBBA 2XY7A 1XQIA 4V19X 2XEXA 2ZE2A 3G6ES 2A1BA 3C14A 2BQ3A 1IJFB 3HHDA 1TKXB 1D0EA 1R0BG 4H4OB 1CG2A 3PYFA 2RF2A 3ENWA 2ERRA 4OJ1A 1KC8T 3CJ0A 3FCHA 1B70B 1YVFA 4L3NA 3RB0A 1NAQA 4CH7A 1T95A 1HWUA 5F41A 2DNLA 1S6QB 3IG1A 4QIWD 1YI2S 3GYNA 4URQU 2CQ4A 1EB0A 3NWRA 3TAMA 3W8PA 2Y9HA 2QGFB 3HVAA 2HAFA 4DR3J 1TAQA 3T41A 4I67A 2VFVA 3M2VB 1RP5A 5CYQB 1QE1B 4PABA
chains in the Genus database with same CATH topology
4QYZK 4U7UD 2Y8WA 3QRQA 1WJ9A 3QRRA 4DZDA 2Y8YA 3QRPA 5H9EK 2Y9HA 5H9FK 5CD4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QYZ K;  4U7U D;  2Y8W A;  3QRQ A;  1WJ9 A;  3QRR A;  4DZD A;  2Y8Y A;  3QRP A;  5H9E K;  2Y9H A;  5H9F K;  5CD4 A; 
#chains in the Genus database with same CATH topology
 1BD6 A;  1Q7Y T;  4F3M A;  4ZLL A;  3DLL Q;  3FEX B;  4DX8 H;  1U1Q A;  1VS3 A;  4K4X A;  3LF0 A;  3EDQ B;  1UVK A;  3H2V E;  2E9Z A;  2QMX A;  2KDO A;  5HSP A;  1CQM A;  3DLG B;  4DUY F;  1IN0 A;  3TEG A;  1CJT B;  4NYP A;  4QYZ K;  3GCW P;  5J2N A;  3IBF B;  4RW4 B;  5FDL B;  3V5R A;  2GVZ B;  4RW8 A;  4IDK B;  4KPY A;  2XI3 A;  3QRR A;  1YJN S;  4FPR A;  4C3K A;  4ZPV R;  3TA0 A;  4WJB A;  3IAM 9;  2UXB J;  3W2W B;  4WCE Q;  3R7N B;  2IIH A;  1VRU B;  3DHW C;  1ZTW A;  3MPD A;  1REV B;  1VQS A;  1ZAX A;  4UTG A;  5JVG Q;  2YKN B;  5D77 A;  3NCQ A;  5DG9 A;  3JTP A;  2B43 A;  4HYK A;  2DHA A;  5DQH A;  5HBM A;  4OZJ A;  3M6V A;  2XMJ A;  1RAG B;  3RAQ A;  1KFS A;  3CJ3 A;  1KDN A;  1RT7 B;  1VCT A;  1XR7 A;  4IOB A;  1GMW A;  3V6J A;  1U47 A;  2KN4 A;  4P10 A;  2LXU A;  3UWT A;  1RT6 B;  2DPI A;  2AU0 A;  3RB4 A;  4FN5 A;  1TQL A;  3SV3 A;  4IG0 A;  4LF2 A;  3C2P A;  1HBN A;  2F9J A;  3DRS A;  2X1B A;  1SC1 B;  1KVJ A;  3RB6 A;  2DB1 A;  2QV6 A;  4YN3 B;  3OV7 A;  3M1V A;  3DLJ A;  3TO8 A;  1B64 A;  1S1V B;  1PBU A;  3VVU A;  2WVF A;  3PW2 A;  1VHF A;  4GRS A;  3SXL A;  4B3R F;  1A6L A;  3X1L B;  2BRL A;  4C48 A;  1RU2 A;  2W7A A;  4IOC Q;  3HFK A;  4OV1 A;  2PFD A;  2ZH6 A;  3MEE A;  4F04 B;  3SCL E;  1FHT A;  1X5S A;  2EFG A;  2HQG A;  4FVM A;  2J7U A;  3D3B J;  5IC4 B;  3A12 A;  3HZG A;  4YB1 P;  4LF8 J;  4QIF A;  3UDV A;  4O3N A;  5CCL A;  4CQ1 A;  4DV2 J;  1JLE B;  3C16 A;  3SCK E;  1LNQ A;  1ZTT A;  3HO1 A;  2BVZ A;  1S9E B;  2LEB A;  2PA8 D;  3FSX A;  1H7W A;  2FLN A;  2R2R A;  5DRK A;  1ZM2 A;  3AQO A;  2IPO B;  2ZUG A;  4KPC A;  1U7L A;  4A8Y A;  1LFW A;  2LQ5 A;  4DR7 F;  3BSN A;  3W8G A;  2B4U A;  1F60 B;  2GC8 A;  3OTC A;  2OIH A;  3D1Q A;  4K5S A;  2FVS A;  2GZO A;  2B8P A;  4OI1 A;  2U2F A;  2QYG A;  5KG3 A;  1HNV A;  4YDX A;  4OJH A;  1RLC L;  1XNQ J;  1YGY A;  4C8O A;  3TNV A;  3F0N A;  1VQM S;  1SPB P;  3J7Z T;  4BWM A;  1UWA A;  2I5J B;  1JQG A;  2QLW A;  1UVI A;  2C3O A;  3G6X A;  3PJX A;  1JLG B;  3VAJ A;  3MEK A;  4XK8 C;  4V1A k;  5GME A;  4RW9 B;  2KJW A;  5D3G A;  2CQC A;  1GNK A;  2LQB A;  5DGB A;  2M8D B;  4MH8 A;  4LRE A;  1M5V C;  2GML A;  2OI2 A;  1S49 A;  4RBU A;  1HI0 P;  2PSZ A;  2WHO A;  2QYC A;  5B0C A;  1DQ8 A;  1JNZ B;  2DD8 S;  1L3K A;  1KQF B;  5C42 B;  4ZN1 A;  4ANC A;  1X4D A;  4ID8 A;  2AYB A;  1CC7 A;  5KG0 A;  4X4S A;  2QIF A;  3H2U B;  2WSF C;  2CKW A;  3D68 A;  4CI0 B;  4MKV A;  4DU7 A;  1TVR A;  3NNH A;  4DV6 J;  4TU9 A;  1JJC B;  4P2M A;  1VJW A;  1Q86 T;  3DGP A;  5F8M A;  3FBC A;  3QBC A;  4C11 B;  2N3L A;  3U7J A;  3POT A;  2CXE A;  1N54 B;  5DZ7 A;  3CC7 S;  2LQJ A;  3I4H X;  1GTE A;  1UWB B;  4JBC A;  2VQF J;  3DU6 A;  4CLK A;  1NUE A;  4KY3 A;  2JC0 A;  3HFV A;  1U6B A;  1HBM B;  2LQ8 A;  3M8R A;  3Q8U A;  3NMR A;  2VIC A;  4ECS A;  3IR5 B;  4N56 A;  3MM8 B;  1RKI A;  1VC5 A;  2XMK A;  2P2C B;  3EVO A;  3RW6 A;  4ED6 A;  2O5D A;  3GJT B;  4F4X A;  2IHR 1;  5IC6 B;  1D9D A;  1NK6 A;  1IQZ A;  3NG8 A;  2J6S A;  4LR9 A;  1V9O A;  5HAN A;  3IP0 A;  1Y10 A;  1MNE A;  1WC0 A;  2UXB F;  3M05 A;  5AT1 B;  4CYU A;  3H5X A;  2K1R A;  4AL6 A;  5F8N A;  1VFJ A;  2DGO A;  3CJ5 A;  4USJ C;  3FBB A;  2VBY A;  3GSI A;  1KOO A;  1N4L A;  1S77 D;  3VVT A;  2HWT A;  3PDN A;  4NE9 C;  2CIM A;  3MM7 A;  2X1A A;  2XHW A;  2IM1 A;  1WF1 A;  2B0G A;  2CG8 A;  1W2B R;  2DVI A;  1LXJ A;  3P6Y C;  5KFH A;  1KLN A;  5KOW A;  1YWX A;  1C4C A;  3KJV B;  1Y3K A;  4PEO A;  4O4G A;  3AXM A;  5F8I A;  2DNP A;  3C6U A;  3A8K A;  1LW0 B;  4U7C A;  2CDR B;  3RBD A;  4ED0 A;  1KKH A;  3LGM A;  3D3C J;  2G0I A;  2OD4 A;  4DR6 J;  1DQ9 A;  1JLA A;  5KT3 A;  3CMA S;  4MMO A;  1NKB A;  2X51 A;  4DX6 A;  1U1P A;  3T1H F;  4MJK A;  5K14 A;  3QJJ A;  3PV8 A;  1FKP B;  5EN1 A;  2ZH9 A;  3EX7 B;  3D2W A;  1GX6 A;  1MWZ A;  2HND B;  4L75 A;  3ULH A;  3OTO J;  5IM0 A;  3B8H A;  2GO9 A;  4KRW A;  3Q8Q B;  2AKW B;  1JK9 B;  2I9S A;  3DM2 A;  2FLP A;  5I42 A;  3I0R B;  1JKH B;  4LFB F;  1SQE A;  1KP6 A;  2CPF A;  5ITH A;  2E7X A;  4F50 A;  1R27 B;  4CH0 S;  4NML A;  1YQH A;  3UDL A;  5KFM A;  4IFY B;  1FFS B;  4NPO A;  1YG0 A;  2YKM A;  1IBL J;  4C8K A;  4CLP A;  1N34 J;  2EKY A;  4QIV A;  2HKE A;  1QDU B;  1U25 A;  3BS9 A;  3UFC X;  2KRR A;  1XNQ F;  3QFW A;  1R8A A;  4ECU A;  5HP1 A;  1J27 A;  1N32 F;  5DDP C;  1TFW A;  4ZOS A;  2D9O A;  3CUL A;  4UUW A;  4FXD A;  3IA0 A;  3J81 U;  3I96 A;  2KO1 A;  1H2V Z;  3H42 A;  1V6H A;  2JDJ A;  5HAO A;  3J80 U;  3BGL A;  1VLO A;  3KHL A;  1L3T A;  2KXN B;  2BE9 B;  3MM5 A;  5D0E A;  1WC3 A;  2VON A;  1MMD A;  5G0R A;  2L9N A;  4ZCK A;  4PQU A;  4K2X A;  4CCH A;  1P6T A;  3VAG A;  1PC5 A;  2EFV A;  5L9X A;  3E8O A;  1TL5 A;  3BBC A;  2XSF A;  1X4E A;  4PRF A;  2NSB A;  4DV6 F;  2FQQ B;  3GP9 A;  3LP2 B;  5DDQ C;  1TEL A;  1D8Z A;  2WW4 A;  2EFP A;  4N76 A;  1EP4 B;  1SJQ A;  1WG5 A;  4IKA A;  1UPP A;  4DCP B;  1Q7L B;  3ZO7 A;  4UF4 A;  3L09 A;  1EAY C;  4GKJ J;  4KGM A;  4M5D A;  1N5S A;  5GAE U;  3CJS A;  3T5K A;  2A6M A;  2VQF F;  4Z37 A;  3GV7 B;  4J9L A;  4UOC A;  5CA5 A;  3IFE A;  4ZCL A;  1S9G B;  2M9K A;  2R2S A;  1QSL A;  2UUA F;  4WZQ A;  4PUO A;  4DCO B;  4KO0 B;  2KG0 A;  3ITH A;  4WTY A;  2B4O A;  2RHS B;  3D7S B;  3US5 A;  1CSJ A;  4Q8F A;  3VAM A;  2H1Y A;  3W61 A;  2B6A A;  2JVO A;  3FMB A;  3DU5 A;  1FJC A;  4KV8 A;  4JI8 J;  4YEA A;  1IQT A;  2FHJ D;  1JLC B;  5E3A A;  3THT A;  5B7W A;  2J7K A;  3KUE A;  1F9H A;  2RH3 A;  5A8K B;  1KHW A;  3BN7 A;  2R7S A;  2BAN B;  4I2P A;  1P27 B;  1O6X A;  2LXF A;  3P4U B;  3FFI B;  4ZMM A;  1FVS A;  3W5Y A;  4JYA J;  5KFO A;  1TK5 A;  1IKV B;  5D4N A;  4EI2 A;  2AF6 A;  4GVB B;  2QL9 B;  3RRK A;  3OHA A;  2BAB A;  2CAJ A;  5GAE I;  3G86 A;  3OXG A;  3TJ9 A;  1SL2 A;  3MPW A;  1VC6 A;  3KHG A;  1VQL S;  1WOO A;  3W2V A;  1XIQ A;  2MTL A;  1SH3 A;  2M88 A;  1RTI A;  3GCX P;  5C24 A;  2IBO A;  3VGU A;  3EIC A;  4HH0 A;  1ZA2 B;  2XMV A;  5HMX A;  4A8K A;  1HHT P;  2DEJ A;  4HLB A;  3G71 S;  4IFV A;  1RAC B;  3G2X A;  5L46 A;  1FK9 A;  1IVZ A;  3GYX B;  4UUX A;  4ED8 A;  1N36 F;  1AT1 B;  4B3M J;  4CTA B;  3EGW B;  2Z58 B;  1TL1 A;  2RNE A;  4OYI A;  2KXH A;  2YX4 A;  4KJI A;  3D6M B;  4MKY A;  1LKZ A;  4TVA B;  4DLE A;  2QX0 A;  1XC9 A;  1NK8 A;  2RQ4 A;  4DS5 A;  4DR6 F;  2V8D A;  2EXU A;  2VQE J;  1JX4 A;  2YKA A;  2Q66 A;  3KJF B;  4MTP A;  1RT1 A;  1AA1 B;  1LWE A;  5F0U A;  4AQY J;  3DDI A;  1RHK B;  5A2Q U;  2UU9 J;  3B82 A;  3F56 A;  4QIE A;  3PO5 A;  1TAU A;  3K5M A;  4YR0 A;  1SC3 B;  2B56 A;  4ZPT R;  1RTJ A;  3BDP A;  4A8O A;  1HBU A;  2DRA A;  3FBE A;  3DXS X;  4N77 A;  1N5T A;  1YBT A;  3BGF A;  2NYH A;  2DNQ A;  4ZLN A;  4AT1 B;  1RK8 A;  3GIK A;  1RTD B;  1TKZ A;  3KLI A;  3D6F B;  2MQN A;  1GH8 A;  4Y2M A;  3FBF A;  2W9B B;  5K8N A;  1NRK A;  2G0C A;  1CUL A;  2OD6 A;  3PCO B;  3CIM A;  8RUC A;  3FGV A;  4H4K C;  1SB6 A;  2OPS A;  2BE2 B;  2MSS A;  2NZC A;  2DIS A;  4ELU A;  3ZFV A;  4URS A;  1XWL A;  4DR2 F;  1FI4 A;  2EBG A;  4I6A A;  3K59 A;  4NLU A;  1RKJ A;  2H51 B;  4IO1 A;  1LFP A;  4YDD B;  2XCP A;  2BDP A;  1Y7P A;  2VOD A;  1KN6 A;  1SKS A;  4CO3 A;  4USV A;  1MLA A;  1ITP A;  2V2V A;  2WOM B;  3CD5 A;  4TKT A;  1K0T A;  3KLF A;  2CPE A;  1YJR A;  2M0G B;  3PFE A;  2EG1 A;  3FEZ A;  3TUP A;  4JI0 J;  1U1M A;  2BM1 A;  3A8I A;  4NZ6 A;  3ENQ A;  3UI3 A;  1ZPW X;  1GXU A;  2ZDO A;  1HAR A;  1VK3 A;  1BWE A;  3V4I B;  3DLB A;  4GKK J;  5C25 A;  2LEC A;  2HNY B;  4LRC A;  2CA9 A;  1IKY B;  4ECQ A;  1UL3 A;  3VGV A;  2ZD1 B;  3OJU A;  1LWX A;  2VFS A;  1UVL A;  3PYD A;  4DI6 A;  2DR5 A;  3V6H A;  3DMJ B;  4DXL A;  4K50 A;  2PII A;  3M4X A;  4M5I A;  3LAN A;  3MUR P;  2HHQ A;  1XMO J;  5I3U B;  4A8F A;  3L95 X;  2V69 A;  5D0H A;  1DLO B;  3EGV A;  2D41 A;  2KVQ E;  2CJY B;  3AOD A;  4ZDN A;  3IS9 B;  3PRV A;  3Q8Y A;  2HG4 A;  4NCA A;  4LIW A;  4LR8 A;  1RBO B;  3SZ2 A;  2ZUA A;  3RR8 A;  4GKJ F;  2G2O A;  2ZE2 B;  5ETM A;  3C14 B;  2PMH A;  3ZZU A;  2AT1 B;  3JXO A;  2BUN A;  3K5P A;  3ZNU A;  2RF2 B;  3ISZ A;  4F8R A;  2AZ3 A;  5HJX A;  5U47 A;  3TUI C;  1GT8 A;  2DGU A;  3EM1 A;  3LP1 A;  1DZ5 A;  4DX7 A;  1NDK A;  1WSR A;  4ZLP A;  2FHO B;  5T41 A;  2GHV C;  2RJZ A;  2R7O A;  1JIH A;  1V5V A;  3MM6 A;  3IG1 B;  3N6N A;  4ECV A;  4BC9 A;  3MCM A;  4CT9 A;  3R6L B;  1SBR A;  3A3N B;  4G1Q A;  1IBM F;  2JRS A;  4OX8 A;  5BYR A;  3TAM B;  1NPP A;  3H5S A;  2H48 B;  1Y3J A;  2MQ8 A;  3OHB A;  4O3P A;  2RT3 A;  4LF6 J;  3BPS P;  1MMN A;  1NB2 A;  4OX9 J;  4ZHR A;  3DC2 A;  4RWX A;  4JYA F;  2ZHB A;  2R7W A;  2HS0 A;  3IGN A;  3VQS A;  3GG0 A;  1I1G A;  5AXN A;  4QBU A;  2VU5 A;  4UZC A;  4KBI A;  3MR6 A;  4FYV B;  5J2N B;  3KG1 A;  3D0I E;  3GR1 A;  3BQ2 A;  2R42 A;  4DFK A;  2DGQ A;  4RW8 B;  2R7U A;  1FRJ A;  1WHX A;  3NL0 A;  2ABY A;  3H98 A;  4FS2 A;  3ILI A;  1YJU A;  5E5N A;  4C0B A;  3Q8V A;  4OV6 A;  3SQO P;  4JI7 J;  4BDP A;  2QTW A;  5DO2 A;  1FRX A;  2HNZ A;  4CLF A;  1QM9 A;  4OMF G;  1ZOT A;  4CO0 A;  2D69 A;  2PEB A;  3QWP A;  1RAI B;  1UVM A;  1S7H A;  2WVE A;  2NXE A;  2OGU A;  2H4W B;  5HBM B;  3D0H E;  1FJG J;  2PDA A;  3NWG A;  1TTH B;  2Y1I A;  2XLK A;  2VUG A;  4JB8 B;  1K0V A;  2YWG A;  5BR8 J;  3LGH A;  3I9Z A;  3I5A A;  3VAK A;  4IG0 B;  4O0I A;  5HVG A;  1HBN B;  1B0V A;  3DRS B;  4QCL A;  3DFE A;  1HHQ A;  2F1F A;  2ILZ A;  1K8A T;  3D1O A;  2XC9 A;  1QSY A;  3M1V B;  2E7W A;  1S6U A;  4K8R A;  4F02 A;  2E5I A;  5FJ4 A;  4PWD A;  3C46 A;  1XNR J;  1U8W A;  2DO4 A;  5DQI A;  4KTQ A;  2QZ8 A;  3MEE B;  2MKI A;  1FXR A;  2ZC3 A;  3QNW B;  4B3O A;  3QRP A;  2A18 A;  2F8E X;  2VFR A;  2HQC A;  2GVD A;  1QUP A;  1VDH A;  1JJ4 A;  1DFD A;  3ZZO A;  3C16 B;  3CO9 A;  3N9U C;  2ZHO A;  3NLC A;  2Z0G A;  2GX8 A;  5E3C A;  4RUA A;  2PI5 A;  4M5L A;  3K8V A;  3MAA A;  4CO2 A;  3JYT A;  2HFO A;  5M2R A;  1Q8I A;  3OTB A;  3K5O A;  4XPC A;  4N8N A;  2WSC C;  2JFD A;  4LF7 J;  2XNQ A;  4TLQ A;  2W4C A;  2HHP A;  1KNZ A;  3CB4 A;  4KYZ A;  3OQ2 A;  4WPA A;  1DHM A;  1S6P A;  4GO5 X;  2GIF A;  3QIP A;  1HNV B;  4J9P A;  1A0O B;  2M2B A;  2CPD A;  4X66 J;  4W4M A;  5IXU A;  3D66 A;  2HHX A;  2ZNZ A;  1UEU A;  4QIG A;  4NL5 A;  4DV5 J;  3D9B A;  4NLT A;  1G4C A;  5B0A A;  1S72 S;  5D3G B;  1QSS A;  1KR4 A;  5ETK A;  2W9A A;  5KFL A;  2HFS A;  2V8P A;  1T7P A;  6AT1 B;  1SH2 A;  2UVW A;  1IR2 A;  3Q2S C;  4HEA 9;  2CPY A;  4C8M A;  4DQR A;  4DFJ A;  4LSL A;  5DGA A;  2XCA A;  1FX2 A;  1NKE A;  3C3L A;  1TVR B;  4NMX A;  4AL5 A;  2HK3 A;  1HNI A;  1OSD A;  3MMB A;  2VC0 A;  3DGP B;  4DEZ A;  3Q8P B;  3D0G E;  1T9U A;  3POT B;  3OPK A;  1UW9 A;  4F3Q A;  2UUC J;  4DR1 J;  2FTR A;  1NCL A;  3M32 A;  3AJD A;  4OX9 F;  1KBR A;  3LWL A;  4K4Z A;  1HW9 A;  2ZBC A;  5G4D A;  3CNQ P;  1GMU A;  1IR1 A;  1SL1 A;  1F5C A;  3AJ2 A;  4BS2 A;  4Y3C A;  1ZZF A;  3MUM P;  2E5G A;  2CAD A;  3AQP A;  3LAK A;  2FJW A;  1VJQ A;  4Q43 A;  2I6W A;  2IY5 B;  2QLX A;  1JXL A;  3GJQ B;  2GQ2 A;  4CYU B;  4PG6 A;  2K1R B;  1S0M A;  4RBT A;  1VQ5 S;  3QAE A;  2CWX A;  1Z1Z A;  5KFK A;  1WHY A;  3O44 A;  1QY7 A;  3LPE A;  3P5T L;  1KQG B;  4C3M A;  3JS9 A;  2ASY A;  1X9S A;  5LMU J;  4V19 J;  1DAX A;  3CDA A;  3GSD A;  1T05 A;  4G1I A;  3G8S A;  2HHH J;  1CEZ A;  3KG4 A;  1D09 B;  3MM7 B;  2FJA B;  3QT7 A;  5DM6 Q;  4WKR A;  5KFA A;  1VRQ C;  4LMZ A;  3MEC A;  4DQI A;  1RBL A;  1RCO B;  3GZ7 A;  3CCW A;  1UA1 A;  2BOA A;  3Q0A A;  2MKS A;  3BM7 A;  2KI2 A;  4AFF A;  4O4G B;  3C6U B;  5JXS A;  1VLY A;  3BO4 A;  1SH0 A;  5KG4 A;  2HGL A;  2NS1 B;  1WF0 A;  2NPF A;  5B0G A;  4YFU A;  3IAS 9;  3OTD A;  3L4B C;  3UD5 A;  1XNR F;  1JLA B;  2XGP A;  2G0J A;  1FEE A;  4XO0 A;  3CME S;  3M8Q A;  5K14 B;  2CQG A;  5ETT A;  3TZX A;  1XMQ F;  2A2D A;  3PXG a;  3PR4 A;  2VBW A;  2HAI A;  5I3P A;  5IM0 B;  1U4B A;  1YZ6 A;  4DDF A;  2VDH A;  3DM2 B;  2ZNY A;  5I42 B;  3HD2 A;  4KAI A;  3W9H A;  3IR7 B;  2HSE B;  1VI7 A;  3KFW X;  2YNH A;  1REV A;  3QGP A;  4HHJ A;  4OX7 A;  4OHX A;  4Y6I A;  3QFH A;  2DTJ A;  1JMT A;  3FC9 A;  1SJ1 A;  3JSY A;  4LF7 F;  1PCA A;  2P6S A;  2IDE A;  2OKQ A;  2AGP A;  5C2G A;  4X4V A;  2YKM B;  3NKY A;  3G96 A;  2NZ4 A;  4RNF A;  3I82 A;  1VQY A;  4NLG A;  3A13 A;  3PW4 A;  3T3F A;  4RU9 A;  4O44 A;  2QA4 G;  4ZK7 M;  5HP1 B;  3OFG A;  4P9S A;  1A9N B;  1VYA A;  2IA0 A;  4IQX A;  1Y5N B;  3OL8 A;  1NK9 A;  3AJ1 A;  1YLX A;  4LVN P;  2QJ3 A;  2IBK A;  2J0Q D;  2ZWO A;  3SQG A;  4JI2 J;  3EZO A;  3CMQ A;  3TOQ A;  3JSR A;  4ITS A;  2VC1 A;  3I9V 9;  2ASL A;  3MM5 B;  1F1B B;  2RQC A;  1HWK A;  2J9D A;  2AGQ A;  5G0R B;  1NK5 A;  4F2S A;  4PQU B;  1NPR A;  1UZD A;  4MK9 A;  9ATC B;  2XMW A;  3ZZY A;  2O66 A;  4U95 A;  4UST A;  3CJR A;  3TUJ C;  2YWH A;  4XAK A;  1C2P A;  1ZS6 A;  3HHK A;  4OL8 A;  3PEH A;  1GFW B;  4XTT A;  1TR0 A;  2VFT A;  4DL3 A;  1WWH A;  4RX6 A;  3HHL A;  5SZT A;  5KG1 A;  2FVP A;  3EPG A;  2DRB A;  1T11 A;  2X1F A;  1KQS R;  4M5D B;  2V8V A;  3MTJ A;  1UFL A;  3BJY A;  2HQ3 A;  2YNI A;  4NYO A;  2YWF A;  3SI8 A;  4ERD A;  5IOL A;  5LXY A;  2WBM A;  4I0W A;  1M0S A;  2XGQ A;  1YKW A;  2IAJ A;  1RT3 A;  2CQD A;  4PUO B;  2YKO A;  1NLK L;  2BQR A;  1RDR A;  1X60 A;  3ITH B;  2VHG A;  3U1L A;  2GGP A;  2MB0 B;  3HLU A;  3WX4 A;  2B6A B;  2P9C A;  1ICE B;  3M30 A;  2DR9 A;  1S1X A;  1RHU B;  4KV8 B;  2FLL A;  4DL5 A;  4HKQ A;  2JSX A;  3MCO A;  4B3S J;  3U02 A;  4DFP A;  3G82 A;  1UKU A;  5GAD U;  3N5B A;  5LXR A;  2LEA A;  2JEI A;  4DQS A;  2MJU A;  4I2P B;  1QJH A;  3BKF A;  4PYA A;  4YS2 A;  2A3J A;  3RZA A;  2JH3 A;  3BSA A;  2E9R X;  4J9U E;  2COL A;  4WFY A;  4U67 Q;  4EYI B;  1FF2 A;  1K9M T;  4DFM A;  4F4K A;  4EGL A;  2DGW A;  5LMU F;  2MZQ A;  4RLE A;  3VCD A;  3HT3 A;  1RUS A;  1Q8L A;  5ETL A;  3QWU A;  1RAD B;  1KD1 T;  3M8P A;  4RJV A;  3TAQ A;  4CH1 A;  1RTI B;  2BOP A;  5C24 B;  3JAM U;  1N0U A;  1J5O A;  3HM9 A;  3IRX A;  4FF4 A;  4QYR A;  2R4F A;  4JI3 F;  1Q79 A;  2ZH7 A;  4C8N A;  3GJS B;  4IFV B;  2CZ9 A;  3PNI A;  1PIE A;  2VJU A;  5IQ6 A;  4PPZ A;  1FK9 B;  5C7P A;  4TXS A;  2BW7 A;  4OI4 A;  5HRO A;  2FGC A;  4NLX A;  2ACY A;  4JV1 A;  1CJU A;  3DLK A;  1TL1 B;  2FDN A;  5GAD I;  4QU6 A;  2HMI A;  5DET A;  2BJD A;  2XBP A;  1HWI A;  2NXN A;  3C66 A;  3JTN A;  3R5D A;  2MZ1 A;  3UD3 P;  3KXD A;  4N41 A;  4KQZ A;  1M5S A;  1N88 A;  1HHS A;  2F65 A;  2CQ2 A;  4PQA A;  2B9Y A;  2VKZ G;  3TQE A;  3BSC A;  4S0M A;  1RT1 B;  1P1T A;  1LWE B;  4DQQ A;  3CCT A;  2FHK A;  2JVR A;  4XDD A;  2ADB A;  4ZLJ A;  1X4G A;  4J7C A;  4JV0 A;  1RAO A;  1RLD A;  1TMJ A;  2CNN B;  1MWY A;  4DF4 A;  3DRP A;  1RTJ B;  2ZWP A;  3V6D A;  2DR6 A;  2WVB A;  4KSE B;  1HBU B;  5IWA J;  2EFO A;  3ZC4 A;  4NA2 A;  2OAU A;  4YHH J;  4P6Q A;  1K73 T;  1TKZ B;  3KLI B;  2HRU A;  4OYX A;  2F4F A;  3PR5 B;  4DOZ A;  1CUL B;  3RW7 A;  4DR5 F;  1PIL A;  2OPS B;  2V2Q A;  4QWB A;  1Q95 G;  1IKX A;  4P52 A;  3UCZ P;  4H54 A;  2VKR A;  4WIQ A;  2FIU A;  4X4N A;  2MHE A;  2W1B A;  1UVN A;  2B7C B;  2HZA A;  2HYI B;  4NLW A;  3AD7 C;  3ELH A;  1PJ5 A;  3HSD A;  5H9F J;  2R8H A;  1VQN S;  4J9S A;  4P2F A;  5AXK A;  1EAR A;  3HKW A;  1I94 J;  1RWK B;  5JUM A;  1HI8 A;  4Y2A A;  3CPW R;  3KLF B;  2MJN A;  5DDO C;  3IM9 A;  4JI2 F;  3FQL A;  3TVY A;  3F41 A;  2ZJP Q;  3CE8 A;  2MQM A;  3VAF A;  1F3F A;  5C25 B;  1R8P A;  3FZB A;  4Q44 A;  4DCJ B;  4PXC A;  5LMN J;  4NXN J;  4Q45 A;  2GMH A;  4J90 A;  1WNE A;  3KK1 A;  2EFN A;  3EXC X;  4IG3 A;  2CZV C;  2RE1 A;  1XTZ A;  3RBE A;  3LA0 A;  2XS7 A;  1RAH B;  2R2U A;  4YR3 A;  2HEK A;  1LOU A;  3QMQ A;  4ZPC A;  3B4D A;  4I1T A;  3I4P A;  1HD1 A;  3SSR A;  1CQN A;  2IYG A;  1T9V A;  1YHQ S;  4B3T J;  4HVZ A;  2R3V A;  4LRD A;  3GV8 B;  3HD1 A;  2VJV A;  3QO9 A;  4J9V A;  1Q0N A;  1NSQ A;  3LP1 B;  4HT5 A;  3OL6 A;  3OFF A;  2J9E A;  1WDD A;  4F7V A;  3NXZ A;  2KFN A;  3KYL A;  2RS8 A;  3MM6 B;  5AJ3 J;  2ASD A;  4B3S F;  1F9E B;  2JX2 A;  3CT9 A;  4G1Q B;  1X9W A;  4QWA A;  4OYB A;  2MGZ A;  2ROP A;  3LWM A;  2MLZ A;  1RBA A;  1MN9 A;  1N33 F;  1HNW J;  4DV3 J;  2AGO A;  4ZHR B;  3CXC R;  2HBR B;  2H4Y B;  5F0W A;  1KSP A;  4FS1 A;  1EET A;  4G6V B;  3ZZP A;  2KM8 C;  3GYG A;  5L1J A;  2JZ5 A;  2BAC A;  2P9G A;  1CLF A;  2HZC A;  4MIA A;  3DOL A;  2M5Y A;  2HQD A;  4MIB A;  2ZM6 J;  3KLE A;  4DL6 A;  4FPI A;  3OVB A;  4URG A;  4A8S A;  3K5N A;  2XMA A;  6FDR A;  4I56 A;  1WHW A;  1RQ0 A;  1KTQ A;  3UCG A;  3J81 Y;  4KH1 B;  1RHR B;  3EGZ A;  3CCM S;  4ETZ A;  5A0Y A;  1FE4 A;  1FXL A;  2E66 A;  2B3T B;  3J80 Y;  4P7T A;  3DRR A;  4A48 A;  2HNZ B;  4OZ2 A;  1WF2 A;  2MQL A;  4JV5 F;  2C2Z B;  4O3S A;  3FNN A;  1GX5 A;  3MMC A;  4CT8 A;  3IO1 A;  2BMB A;  3P45 B;  2CNK B;  4ER8 A;  1TK0 A;  3GIL A;  1M5H A;  2AHO B;  3ETM A;  4FYW B;  4NZ0 A;  3R5J B;  3TVZ A;  4F67 A;  4F36 A;  3EUN A;  4ELV A;  1GXL A;  1MW7 A;  3IBW A;  2GW8 A;  1FFG B;  3D4J A;  3W64 A;  4N5S A;  5LSL A;  1XMB A;  4P73 A;  3O3L A;  4DSJ A;  1ZZN A;  2J9C A;  3QT6 A;  2E44 A;  1EX8 A;  5CH7 B;  4Y0F A;  2JEF A;  4E98 A;  1Q8K A;  4DSF A;  4O3R A;  2JEJ A;  2XMU A;  1Q78 A;  4PWD B;  1XR6 A;  4OLP A;  3PYE A;  2MKJ A;  2G1D A;  1Y11 A;  2QSF A;  4DUY J;  1TFY A;  3Q22 A;  2OTL S;  1NXI A;  3WC2 A;  2OTJ S;  1NK4 A;  2L9W A;  5AXM A;  1OQ3 A;  3M6W A;  4B3O B;  3TAP A;  3R9L A;  2X3D A;  4ZJQ A;  2GVD B;  4CP5 A;  2JHE A;  1DAR A;  3M8S A;  5DLF A;  5LT5 A;  1B3T A;  3GV5 B;  3VWS A;  1JB0 C;  2D3Z A;  3J7Y U;  1H98 A;  5MLC V;  2UP1 A;  4ATN A;  2RUG A;  2DNK A;  4DL0 C;  1URR A;  1D8Y A;  3ZTP A;  5LSO A;  2ZBP A;  5GMD A;  3MAA B;  3UN3 A;  1RYR A;  1I94 F;  4ECT A;  3JYT B;  3OR2 A;  3OSN A;  4K4T A;  3R7S B;  5LJ3 Y;  1L3S A;  2KRB A;  1RYS A;  2HFV A;  3JB9 k;  3PKY A;  1S6P B;  4WP8 A;  3QIP B;  4C4W A;  1XER A;  4DBQ A;  4D3G A;  3QLH A;  5D4O A;  2QFI A;  4NXN F;  2FD2 A;  1QTM A;  4K4U A;  1T9X A;  2CQB A;  4NEY A;  2IJF A;  1X8D A;  4DR4 F;  4YB7 A;  2W9C A;  4DV7 J;  4P2S A;  1X5O A;  4L74 A;  2OPP A;  3A4T A;  1R6Y A;  5F3Z A;  3KJQ B;  4NX9 A;  5LJ5 Y;  2YPY A;  1S1W A;  3H4D A;  4PWW A;  4C0H A;  1N5Q A;  3K5L A;  4N8O A;  3MPV A;  1VBZ A;  3B4M A;  4CLS A;  3LTO A;  4LSL B;  4IR9 A;  1ULR A;  4WKY A;  3MXH P;  3MPY A;  2J6U A;  3CC4 S;  3DLE A;  1HNI B;  3WQP A;  3MMB B;  3RGI A;  3X3U A;  1RWV B;  1OO0 B;  1U6F A;  4DSE A;  1OMS A;  3E51 A;  2UV8 G;  1WC6 A;  2C28 A;  3G6Y A;  1HNW F;  4RKU C;  3M32 B;  2C3U A;  2F40 A;  4DV3 F;  2RRN A;  1RT5 A;  2H9Z A;  2XTJ P;  1FO1 A;  2ROG A;  2CJA A;  4ELT A;  1T02 A;  2EVZ A;  4BHQ A;  1M5K C;  1HYS A;  2UVV A;  2GS8 A;  4LFA F;  2Q6B A;  4WFA Q;  3H0P A;  2VIH A;  1C1B A;  3UN5 A;  2DPJ A;  4J91 A;  1KTV A;  3EMT A;  1Y5I B;  4UQG A;  4ILL A;  1URN A;  2J7W A;  4MIW A;  2KJV A;  3W7B A;  4KHR A;  4BBY A;  4AXI A;  4KB7 A;  4HDG A;  3NMA A;  4NLQ A;  4B9U A;  4NLO A;  5IFM A;  2AMC B;  3DGV A;  4EK2 A;  1WAC A;  3S01 A;  1T05 B;  1AFI A;  3KMS A;  2B9X A;  3I6P A;  2CVI A;  4LUB A;  1NZ8 A;  4O4R A;  1AW0 A;  4Q2M A;  4KGX B;  1YIT S;  2NR0 A;  1GTH A;  1SUQ A;  4ED2 A;  3A3P B;  5K9F A;  2DNY A;  2W2M P;  4PPD A;  3MEC B;  2V4Q A;  4IH7 A;  2QLF B;  3CDB A;  5CZV A;  2VFU A;  4OYA A;  4DV0 J;  3CED A;  4WK1 A;  3P3D A;  1C0U A;  3CJ2 A;  1L3V A;  1L3U A;  3J7Z 5;  5LL6 d;  2HLT A;  4RW6 A;  5GVQ A;  4AE5 A;  4F0M A;  1K1Q A;  2KL8 A;  3E01 A;  1MRO A;  1S7I A;  4P74 A;  5A76 A;  1J5E F;  4DV1 F;  1DTQ A;  3PRB A;  2KU7 A;  4PKD B;  3WDO A;  3M8Q B;  1D9F A;  4ES3 A;  3MDF A;  4DQP A;  4Q7A A;  3RBZ A;  5F8H A;  5D0G A;  2N4D A;  1WI6 A;  3KWM A;  5M2P A;  2AJ1 A;  3TAR A;  3DDK A;  1HQ2 A;  4WXW A;  4DL7 A;  1WHV A;  3JQK A;  1OIA A;  1RI7 A;  2YNH B;  1VQ4 S;  1IWG A;  3LOU A;  2Z2Y B;  4B9V A;  5F8J A;  5BYS A;  3FUY A;  1FNO A;  2HVE A;  3PM9 A;  1Q81 T;  2N4C A;  4EO6 A;  1ZH5 A;  2PD1 A;  1RB0 A;  3OSP A;  2EC2 A;  1WC1 A;  3MCS A;  2Q6C A;  5J2Q A;  5HMY A;  2XO7 A;  2IA6 A;  2FHM A;  4O44 B;  2J8A A;  4DS4 A;  3DRY A;  3HX9 A;  2C2K B;  3FK4 A;  4DZ6 A;  2NXJ A;  4USI A;  2I8E A;  1VOM A;  2YH1 A;  1C4A A;  3MAH A;  4O23 A;  3BR9 A;  1LV5 A;  4DV7 F;  1O8B A;  2MKC A;  4OZ3 A;  3S8S A;  2YWK A;  2XSJ A;  1ZPV A;  1Q16 B;  1YRU A;  3VZI A;  3SQG B;  2MY7 A;  2CPX A;  1ARO P;  2V67 A;  2F9D A;  4J37 A;  2EFQ A;  2DY9 A;  2HVZ A;  2C2M B;  5KT2 A;  3PJW A;  1A7G E;  3T1H J;  5DG7 A;  3H25 A;  3K57 A;  3PZP A;  1VQ7 S;  1FJ7 A;  5ETN A;  4Y34 A;  3Q24 A;  4Z2X A;  5D4P A;  2XYP B;  5DS7 A;  4ZA1 A;  4OYO A;  1X0P A;  5H9E J;  4LFB J;  3HHL B;  4DUZ J;  3AB2 B;  4UQT A;  2YNI B;  3CJK B;  2ZJR Q;  1FDA A;  4XIU A;  4K7Q A;  4U8V A;  2IAJ B;  2C42 A;  1RT3 B;  3VGT A;  1U45 A;  4CLY A;  1NJY A;  2GGP B;  1LWF A;  2OEL A;  1N32 J;  2UXC J;  2X3G A;  3AHP A;  1XN9 A;  3M30 B;  1S1X B;  2HBZ B;  2ZOM A;  3GIR A;  5DQG A;  3K89 A;  4LBI A;  3HFZ B;  3G82 B;  5HMW A;  4J9M A;  2V8G A;  2BV3 A;  3QQC D;  4CIO A;  1FD8 A;  2GO8 A;  2CNO B;  2AIR B;  2H5I B;  2EI5 A;  4B9S A;  4L73 A;  1U2R A;  3NGK A;  4ZJO A;  3CO0 P;  4F2R A;  3GIM A;  4WU3 A;  2UVU A;  3M9M B;  2E29 A;  3L7O A;  3IMQ J;  4M8L A;  1KLM A;  2FHJ A;  5EWF A;  5KFY A;  3GIJ A;  1WOP A;  5ETR A;  3NCP A;  1CS4 A;  3T6B A;  4RZR A;  2OEK A;  4WZM A;  5HK4 A;  4I4B A;  4HHU A;  3OD2 A;  1N52 B;  3M8P B;  2D74 B;  4R0J A;  4B9N A;  1FWL A;  1X5P A;  1P9Y A;  2OP5 A;  5KFE A;  2KVI A;  2C2D A;  4QU7 A;  2E9T A;  1J5O B;  4JI4 J;  2WW8 A;  2R8G A;  3JQJ A;  5A8W A;  3IRX B;  2JC1 A;  3DXB A;  4DPY A;  3CSK A;  3W66 A;  4OX6 A;  3BR8 A;  4DG1 A;  2W4P A;  4DV0 F;  3R5A A;  5HRO B;  1CJU B;  3DLK B;  2UUA J;  2HMI B;  3HP6 A;  1OYE A;  2QA2 A;  4WWS A;  3PW5 A;  2HVI A;  1ZAV A;  3G9C A;  1H72 C;  4P72 A;  1BQM A;  2W8K A;  4FXV A;  1GXT A;  1HLW A;  3K2Y A;  3WHI A;  3I56 S;  3PAC A;  2J76 E;  1RTZ A;  2H65 B;  2JOQ A;  4I64 A;  2YTC A;  4QW8 A;  3OL9 A;  1X4A A;  2ZZM A;  4U8Y A;  4J9N A;  3AB4 B;  4ZJL A;  1R3N A;  3DRP B;  3TX0 A;  2OPR A;  4ZS6 A;  1JWW A;  5B0F A;  3V6D B;  2ZZT A;  4CO1 A;  3P49 B;  1LWC A;  2PA3 A;  3OR1 A;  1IBC B;  3AOA A;  4IO9 Q;  2YX7 A;  1HWJ A;  4OHW A;  2DYA A;  1ZBT A;  4C7Q A;  2VPZ B;  3P8B B;  5AE2 A;  1AUD A;  4ZIT A;  3I5C A;  4EO8 A;  2XO6 A;  1UJ6 A;  1IKX B;  1ZM4 A;  2OLW A;  1RHQ B;  3R97 A;  4FF3 A;  3SSS A;  2OMO A;  1OQ6 A;  3KMQ A;  3R7B B;  3ET6 A;  2BA9 A;  2V94 A;  2UUW A;  1X0F A;  5A8R A;  4ECX A;  2UVR A;  5IT0 A;  2QA1 A;  3D1H A;  2J9D E;  4OI2 A;  1N36 J;  2IRX A;  3KNG A;  1JJH A;  2F3J A;  3DYA A;  3T19 A;  1SC6 A;  3ZXW A;  3NNC A;  1RT4 A;  1Q53 A;  3R5G A;  4HI1 A;  3RBX A;  3AA9 A;  1U1K A;  1RIS A;  2HHW A;  4FNH A;  4ECR A;  5KT5 A;  3AOB A;  1R8C A;  1X7V A;  3T9N A;  1WTB A;  4DL4 A;  3T5L A;  3NCR A;  5DDR C;  4Y28 C;  5CAA A;  4ETX A;  1TMM A;  3QSY B;  3FQK A;  3KTQ A;  2YXL A;  3KK1 B;  4EEY A;  2DNN A;  1X4F A;  1FXD A;  4IRK A;  2GMJ A;  3MGJ A;  2DCU B;  4IG3 B;  1Y4Z B;  1NH8 A;  4WFN Q;  1EKS A;  3MR5 A;  4DUZ F;  4KC5 A;  2BE7 D;  1EHW A;  2VPY B;  1APS A;  4TQR A;  1TL3 A;  2VL1 A;  4ZPW R;  4P7V A;  1BWV A;  1IBK J;  5A6W A;  2AZ1 A;  4KFB A;  1FRK A;  1Z2Z A;  2XZT B;  2OUG A;  1RWN B;  3QO9 B;  1RHM B;  1U6Z A;  2XMT A;  4DR2 J;  2N7C A;  1WOS A;  4L76 A;  3Q86 A;  2LEP A;  2VV5 A;  4OZL A;  3EVW A;  2UXC F;  1FVQ A;  3HHL D;  1FTR A;  4FF2 A;  2JLE A;  2GIR A;  4F25 A;  3QT5 A;  3O5T B;  1RHJ B;  3BGO P;  4LRF A;  2FJB B;  4KGV B;  4R8U A;  2MGZ B;  1WDT A;  2NYI A;  1ZET A;  2Q79 A;  3SFG A;  3EJM A;  1E6V A;  3KLG A;  1PYT A;  2IM0 A;  2RSQ A;  1O5J A;  2HBY B;  2E1M C;  5ETP A;  4X4Q A;  1BLU A;  1HBO A;  1IWA A;  2AYE A;  4L3K A;  1EET B;  2ZDP A;  1Q5V A;  3V6K A;  3ZTR A;  3R27 A;  3T6J A;  3HSG A;  4DPT A;  1V3Z A;  2HWH A;  2CQ0 A;  3E2E A;  2F8M A;  3DOL B;  2K3K A;  4I6Y A;  4FKY A;  2J0S D;  4GC6 A;  3RB3 A;  4IUF A;  1X31 C;  1PJ6 A;  3KLE B;  2EWH A;  3BQ0 A;  3NBP B;  4OIX A;  1WOR A;  2QLB B;  4JI4 F;  2HFZ A;  5IS2 A;  4ZP8 A;  1U26 A;  1MSW D;  5K20 B;  1HQE A;  3FZ2 A;  5HN0 A;  4PXB A;  1NBE B;  2UUB F;  5A0Y B;  4NLD A;  3BYP A;  2D7S A;  1SCJ B;  1T94 A;  3I87 A;  3DRR B;  7FDR A;  3UPF A;  2EK6 A;  3B54 A;  3U27 A;  4LF1 A;  2JLG A;  4KHP F;  1S97 A;  4NLV A;  4USW A;  3MMC B;  2EKN A;  4WP9 A;  2QA4 S;  3NRB A;  1S1U A;  2ZBQ A;  2RHQ B;  1CVJ A;  2F7V A;  4QR1 A;  1U24 A;  4O3O A;  4ZVO B;  1BQN A;  1UTA A;  5L1K A;  4X4U A;  1VQO S;  2XLI A;  1XBW A;  3I32 A;  4MKA A;  1IBM J;  3KK3 A;  1YJV A;  2DJW A;  3ZTQ A;  1OPZ A;  2WCX A;  3OJS A;  2K3I A;  3C19 A;  2Q1L A;  3EWG A;  1VR6 A;  4ZVP B;  4NEZ A;  2Z2L A;  1BE4 A;  4MFB A;  2JLF A;  1RAJ A;  1VGY A;  2KM8 B;  1UZH A;  3R1L A;  3P96 A;  3PY8 A;  3L7U A;  4EZ6 A;  1Q8B A;  1U2F A;  2K2P A;  2G9O A;  2ZH5 A;  2V2Z A;  2DCL A;  2HLU A;  4FYX B;  5CD4 H;  2B5J A;  4P75 A;  3W1Y C;  2FJV A;  4RNM A;  2Y1J A;  5KAK A;  4PG5 A;  5K8P A;  5KT7 A;  2LA4 A;  3FKB A;  3EPI A;  3GPA A;  5T14 A;  2FC8 A;  2MQQ A;  3I0S A;  4Q5V A;  1F6T A;  4H4M A;  4UY8 5;  2RAQ A;  4KE5 A;  1R8B A;  2W7P A;  1CC8 A;  1UMJ A;  3OR2 B;  2DGT A;  4EYH B;  1WI8 A;  4F0K A;  4QWC A;  1T03 A;  1FRH A;  1FDD A;  4WBF A;  3W60 A;  2ZBR A;  5I4M A;  1U0S A;  3ZNJ 1;  3NOG A;  3VQT A;  3MR3 A;  3UR0 A;  1FES A;  3QLH B;  4CLZ A;  2JJ4 D;  2V9W A;  2I0X A;  4FYD A;  4ZP9 A;  3JAM Y;  3MEG A;  1HA1 A;  3W63 A;  1H38 A;  2YNG A;  2C22 A;  4RL1 A;  2ZOF A;  3MCN A;  2W9C B;  1QAY A;  1VQ8 S;  4DSK A;  5JVH Q;  5KG6 A;  1KS2 A;  2OPP B;  2BYC A;  4M5N A;  4KKO A;  1NM2 A;  1S1W B;  2BX6 A;  4Y00 A;  3ISN C;  4A4J A;  1GEH A;  3VZH A;  3Q2T C;  3EXY A;  1IBK F;  3CIZ A;  5RUB A;  2APO A;  2YQ0 A;  2MZR A;  3KHH A;  2VF3 A;  2XS5 A;  4L72 B;  5HLF A;  4QYZ J;  3LP0 A;  3BZQ A;  4TNO A;  3GFH A;  4USU A;  1TUW A;  2W2N P;  3DLE B;  4X62 J;  4JI5 J;  1UEV A;  2Y8W A;  2HIQ A;  4F26 A;  1C1C A;  1M90 T;  4CM2 A;  2H5E A;  3PW7 A;  2BJ3 A;  2J0X A;  1YIJ S;  1DY3 A;  1FWK A;  1S1T A;  2DNZ A;  1UCN A;  2AP6 A;  3EVM A;  1OY6 A;  4TYA A;  4BWJ A;  4OZ5 A;  3NS5 A;  2ZHA A;  1WEL A;  1UFW A;  3AOC A;  2DH7 A;  1M5O C;  1OPI A;  2WON A;  5D15 A;  3BGU A;  4OYP A;  1RT5 B;  1S59 A;  2HW3 A;  3O6Q A;  1UA0 A;  2FC9 A;  4FDF A;  2P9E A;  3PX4 A;  5K5M A;  1FT8 A;  5J1E A;  3WC0 A;  4RNH A;  1FJE B;  4RUB A;  1HYS B;  5CHC B;  1N48 A;  4ZVS B;  3EZU A;  3M2U A;  2IC3 A;  3VGS A;  3A3O B;  4FBU A;  4MT1 A;  3NGT A;  2DIV A;  4NLY A;  1UEK A;  5KG7 A;  1C1B B;  2YBV A;  4DPO A;  2KHC A;  4NI2 A;  3DOK A;  2FUG 9;  3HPO A;  1VK8 A;  3T1Y J;  3BDE A;  2VH7 A;  2MMY A;  4HTI A;  2V6A A;  3PO4 A;  1H2T Z;  4C98 A;  4H4K A;  3NAH A;  4UY8 T;  5KOX A;  3ZZ0 A;  3V2U C;  2G13 A;  2NLW A;  2H5J B;  2NPI A;  3BKU A;  1BMQ B;  3A8J A;  1OS5 A;  2BKP A;  3QID A;  3HXM A;  3RU0 A;  1SUQ B;  3QSI A;  3LAL A;  4HT7 A;  1WJ9 A;  1HPZ A;  1LK7 A;  2C1E B;  3EE3 A;  1C0U B;  4FP9 A;  1KON A;  5KT4 A;  3S1T A;  3BPD A;  1YK9 A;  4DHV A;  2V34 A;  3CDU A;  4A8Q A;  4NLS A;  2I1R A;  4RW6 B;  5F3T A;  2AD9 A;  1CBK A;  3NGS A;  5F9N A;  5ETO A;  5F9L A;  3BRE A;  3E01 B;  4A47 A;  1MRO B;  4ZVU B;  5CCM A;  3DI6 A;  4W90 B;  3H2L A;  1DTQ B;  1TUG B;  4I2Q A;  2YQ3 A;  2RKI A;  1SV5 A;  3EGN A;  4RUC A;  5DM7 Q;  1NU4 A;  1HI1 A;  1C0T A;  2UUT A;  5F8L A;  3KKF A;  2V4R A;  1FNM A;  4GMK A;  1BQX A;  2MLY A;  2J6T A;  2BW2 A;  1YX2 A;  4JUZ A;  4RW7 A;  2AJ0 A;  3PX6 A;  4M5K A;  2ZVI A;  4IYQ A;  5D78 A;  4LJM A;  5KFW A;  2HS3 A;  1MML A;  1KHV A;  5HVF A;  1KVK A;  4NLR A;  4G65 A;  1MU2 A;  5J2Q B;  3MWB A;  4HH1 A;  4TU7 A;  2ZFH A;  4J9R A;  2B8Q A;  1I6J A;  3OXL A;  4ENO A;  4FZV A;  4NCG A;  2FLO A;  1NZA A;  3CCS S;  4LF5 J;  4ED1 A;  1TKD A;  5E3Q A;  2W8L A;  2HZV A;  3BH7 B;  5KFB A;  2XSJ B;  4QWD A;  3QPI A;  3MMJ A;  1WTF A;  5EX3 A;  3FSY A;  1BGX T;  5E3R A;  4X64 J;  3TZW A;  2GQQ A;  2KFY A;  3MFH A;  4HI2 A;  1YSJ A;  1T9W A;  3VAL A;  1RAF B;  2EEY A;  4C8L A;  5K8M A;  4WFB Q;  4I7F A;  1X9M A;  2KT3 A;  4TY8 A;  2GQC A;  4NWB A;  1UJ5 A;  3KLH A;  3NGU A;  4KH0 B;  1XMQ J;  1NEE A;  1N5Y A;  4QOT A;  4X62 F;  3L7P A;  2E7V A;  2IVF B;  5E41 A;  4JI5 F;  3OL7 A;  3UDE A;  1TU0 B;  4YY3 J;  3CCJ S;  4ZPA A;  1X5T A;  4U7U K;  1N8R T;  3R3T A;  4N7T A;  1H6K X;  4DMZ A;  1LEO A;  1Q5Y A;  3LUY A;  2P6T A;  4R5P A;  2HVH A;  2R9L A;  1WC5 A;  1I5O B;  2VZ9 A;  4WYW A;  2SXL A;  3LPY A;  1GMV A;  1DTT A;  1NO8 A;  3AFG A;  2CG4 A;  1LK5 A;  4ILR A;  4Q0B A;  1U1R A;  2LU2 A;  3AA8 A;  2FVQ A;  2WZ1 A;  3GG1 A;  2L9D A;  2PGC A;  3QJP A;  1LWF B;  1RWX B;  4PG4 A;  3DN9 A;  2H3E B;  2IVY A;  5T7L A;  2K8G A;  1JLB A;  2FPH X;  4O3Q A;  4DF8 A;  4JOU A;  2OML A;  3V4M A;  2OEM A;  3JSM A;  1HWL A;  3TP2 A;  5IT4 A;  2ALZ A;  2E5J A;  2KTQ A;  2PI4 A;  2GAG C;  3T1Y F;  5HQM A;  5E2Q A;  1KLM B;  2DR8 A;  4DR3 F;  3CD6 S;  4MAK A;  4LRB A;  1NK0 A;  1FFW B;  1CS4 B;  2EPI A;  3FJ2 A;  3TEH B;  2AJ2 A;  2N7Y A;  2DHX A;  2V5H G;  2CDQ A;  4K4S A;  2BZ2 A;  4F4A A;  5A8W B;  3M2R A;  3GTY X;  2LDY A;  2A2C A;  4ZVE A;  2WVD A;  4IRC A;  3QGI A;  4DG1 B;  2UZA A;  4C0O C;  3HKZ D;  5CQG A;  2CVE A;  2DNG A;  2KYZ A;  4EBC A;  4WE1 A;  2OPQ A;  5KFV A;  4IRD A;  4Q8E A;  5L1I A;  2XNR A;  3M9N B;  3OFE A;  4DJB A;  1R89 A;  1WKJ A;  3HCX A;  5BYQ A;  2L08 A;  5DLG A;  4W92 B;  1EQ0 A;  2NXU A;  3F44 A;  3K58 A;  2M8H A;  1BQM B;  3ONQ A;  3ISN D;  2ROE A;  1H7X A;  1S76 D;  3H7H B;  4F4W A;  7AT1 B;  3MHY A;  1JLF A;  1U09 A;  2QT7 A;  4DUT A;  3NOC A;  2M52 A;  2VBZ A;  2JL9 A;  2DGS A;  3C8Y A;  3GR0 A;  3W5Z A;  1FA0 A;  2OPR B;  1HIY A;  1FDB A;  5IV3 A;  2MYF A;  2PMW A;  2D9P A;  1U1O A;  1UFK A;  1U8S A;  1LWC B;  3NAI A;  1Y0H A;  2BKO A;  2BR0 A;  3OR1 B;  2QMW A;  2WB4 A;  1FD2 A;  3KG0 A;  1BHN A;  1VBY A;  1JLQ A;  1OSC A;  1RCX B;  1AZS A;  3D67 A;  1PAU B;  4F4Z A;  1EJ7 L;  1ROF A;  2R7Q A;  1YJW S;  4EWT A;  5FLX U;  3ZTO A;  2J5A A;  4O0N A;  1WC4 A;  4QW9 A;  1CJK A;  2B7B B;  2DGV A;  4M5H A;  3ET6 B;  3D54 A;  4ZVR B;  1DRZ A;  5KFQ A;  4JI3 J;  1H74 A;  1QVG R;  1WEX A;  1RGV A;  2FY8 A;  5A8R B;  3P5B P;  3ZZT A;  4OYM A;  1RXO B;  3G8T A;  3CCL S;  5KFP A;  5GMK a;  1AXQ A;  4LF8 F;  4ECW A;  1S99 A;  1NDL A;  4LF5 F;  4E8U A;  4I68 A;  1NJX A;  1UAW A;  1HL6 A;  2OHD A;  4WP3 A;  2BXJ A;  4DV2 F;  3DYA B;  1M1G A;  1RJJ A;  2VPX B;  2EK1 A;  5L38 A;  2XZD B;  1RT4 B;  1W2I A;  4X64 F;  3RAX A;  3IWN C;  2DR7 A;  4M63 A;  2PT0 A;  3AT1 B;  2JWN A;  1YBA A;  1GMW D;  1GAO A;  4WFZ A;  1PO6 A;  3IC1 A;  4ZN3 A;  3GMG A;  2IRU A;  3TJA A;  3GQC A;  1SJF A;  3OFH A;  3MED A;  4AD6 A;  1I51 B;  1Q4R A;  2R7V A;  3WX8 A;  2OH2 A;  2MZS A;  3NGD A;  8ATC B;  4MYU A;  1TL7 A;  1NHU A;  3LAM A;  3R1H A;  1B0T A;  3QRQ A;  2GJ2 A;  2LU1 A;  1NME B;  1VIS A;  1NHV A;  4YY3 F;  3RUB L;  3BQ1 A;  1EZZ B;  3VAI A;  2R2T A;  3N5F A;  1EKR A;  2XLJ A;  3PRD A;  1TL3 B;  2F8H A;  4M1K A;  2G4B A;  4ID5 A;  4DR5 J;  1QLN A;  1Q1K A;  4KFB B;  1PC4 A;  1UW4 A;  2OEJ A;  3A8E A;  3R2D J;  2EG2 A;  2DRD A;  4MK8 A;  2XHC A;  2G1H A;  1F0X A;  3CC2 S;  3GII A;  2YKP A;  3K0J A;  1U2C A;  5K8O A;  1YJ9 S;  4RPF A;  1NPK A;  2B9E A;  2Y0B B;  3ADA C;  3UVJ A;  4A8X A;  2ACM A;  2K06 A;  4ZPB A;  2BM0 A;  4RUH A;  4R8U B;  5DG8 A;  2XMM A;  2X7I A;  1E6V B;  3KLG B;  1YBU A;  1U49 A;  5EUH A;  3DLH A;  1LW2 A;  5B09 A;  1MWQ A;  2YQ1 A;  3AY0 A;  1SIZ A;  1VIX A;  3BGR A;  1HR0 J;  1HBO B;  3KK2 A;  1JNR B;  2QSW A;  4C97 A;  3CCU S;  1GK8 A;  2BJ8 A;  3SDE A;  3G6V A;  3VHQ A;  4FBT A;  5B0D A;  1W7W A;  4ALZ A;  3WIU A;  1YRT A;  3MMA A;  2XZW A;  3I5B A;  2W2O P;  3OLA A;  2Z2Z A;  3AAW B;  4JV2 A;  5KFS A;  2CPI A;  4RU2 A;  2ZBI A;  3KLV A;  4I6W A;  4ZCI A;  1HQE B;  2WK4 A;  1HNZ J;  1WKL A;  3HJF A;  2DXF A;  2F63 A;  3F73 A;  2Q43 A;  4G1P A;  3D5M A;  3CJK A;  2FJX A;  4ECY A;  2A0F B;  2NXC A;  2ZIT A;  2C3Y A;  1W25 A;  1S1U B;  4NYZ A;  1FE0 A;  4OLO A;  3I55 S;  3EDR B;  2DEI A;  1BQN B;  1RU1 A;  3ENA A;  4K4W A;  4YOE A;  2MY8 A;  4AL7 A;  4PYD A;  4DL2 A;  4CNZ A;  4J5O A;  3DKD A;  3MR2 A;  3MTK A;  1SXL A;  3KK3 B;  2OO4 A;  2FY1 A;  2B9W A;  2JEG A;  3H20 A;  2HWI A;  3T1A A;  1SJ3 P;  1N33 J;  3TAN A;  2RU9 A;  1EIY B;  2IRY A;  2DNH A;  3FDS A;  1NSK L;  2AYM A;  4MFB B;  1WEY A;  4LSN A;  2U1A A;  4YP3 A;  2K7K A;  3T9Z A;  1IR0 A;  2VD3 A;  4DPX A;  1TZ0 A;  2ASJ A;  4NA1 A;  2B5J B;  2CFX A;  5KFR A;  4M5M A;  1K1S A;  4OHV A;  4QWE A;  2HFU A;  3I0S B;  3GLJ A;  4LF4 J;  1QUV A;  5LOQ A;  4H4M B;  4NLP A;  4CZC A;  2MLX A;  2Y1L B;  2CQH A;  3H40 A;  1QAX A;  4HTJ A;  3BKT A;  4TLR A;  4FXW A;  4JV5 J;  3PHT A;  2F4V J;  3O1L A;  4XPE A;  3OTO F;  1R7I A;  1T03 B;  2ZOG A;  1N56 A;  2ZH8 A;  1N6Q A;  2R8J A;  3KOA A;  1YDL A;  4NAS A;  1TKT A;  3QZ8 A;  1CJV A;  3G8Q A;  1R31 A;  4ES2 A;  5CYM A;  3MEG B;  4NZ7 A;  2WTF A;  2YNG B;  1IBL F;  3W65 A;  1ZAW A;  3HMJ G;  1TV6 A;  1N34 F;  3R5B A;  3RAM A;  5IT9 U;  5EDW A;  2BEF A;  2PMZ D;  2YX1 A;  3PKM A;  2YNF A;  2DY1 A;  4ZVH A;  4DSI A;  4KKO B;  5KFX A;  2YWE A;  3V81 A;  5HAT A;  2V4J A;  4E0D A;  5GAH U;  2PE8 A;  2GA7 A;  1R6V A;  1WG4 A;  4DV4 J;  1UET A;  4LRA A;  2QC3 A;  1KOH A;  3BEG B;  1SQG A;  1PJ7 A;  3L3C A;  4U96 A;  4ZP6 A;  1S0O A;  4PXE A;  3FCV A;  1MN7 A;  3WZ0 A;  5HLF B;  3RG6 A;  3LP0 B;  1IXK A;  3MUV P;  2DNR A;  3ZTS A;  2D1C A;  2OSR A;  2IM2 A;  3HDS A;  3EZ5 A;  4GVL A;  3O8W A;  1C1C B;  2R8I A;  2QFJ A;  1S1T B;  1NKC A;  4K0K J;  4WXO A;  4C9D A;  3ETO A;  3T5J A;  1G6B A;  4WK3 A;  2EBE A;  1R0A A;  1N0V C;  3OUY A;  3NGR A;  4OFZ A;  2WON B;  5D4L A;  3HSZ A;  4BCA A;  4CDI A;  5LSR A;  3M6U A;  3PW0 A;  3HSJ A;  2RDI A;  1HR0 F;  2I2Y A;  4F3O A;  5GAH I;  1VQK S;  3LGN A;  1E6Y A;  1PG5 B;  5J1N A;  5J1E B;  2PFF B;  1IKW A;  3AXK A;  2AYG A;  3VR1 A;  1FWP A;  3DOM A;  2O1P A;  4DR4 J;  1HMV A;  1VRT A;  2WRM A;  3M2U B;  4N47 A;  2HQF A;  3IWX A;  2IC3 B;  2DH8 A;  3KNA A;  3ILO A;  2IFX A;  2GAH C;  4DU8 A;  4CRJ A;  1H2U X;  4PAA A;  4NI2 B;  1HNZ F;  3DOK B;  4IOA Q;  1PYS B;  2B51 A;  1ELO A;  4C6A A;  4JI8 F;  3KDN A;  5MAO A;  2GV1 A;  4W98 A;  4WFX A;  1RT2 A;  2QN6 B;  4BC7 A;  1D9A A;  4X65 J;  3MR7 A;  4AND A;  4D3H A;  4QPT A;  2KZM A;  1V5I B;  2DXE A;  3UN2 A;  3OLB A;  3HHE A;  3SYZ A;  4G3I A;  1FER A;  2LFV A;  1UVJ A;  4F4Y A;  2VG6 A;  1M5P C;  1YRX A;  2LP4 A;  2JNJ A;  1HPZ B;  4OZN A;  5H9F K;  1FRL A;  4CLT A;  1G7C B;  4NXM J;  2QL7 B;  2QG9 B;  4OYW A;  1OWX A;  2VDI A;  2ZH1 A;  4QR2 A;  3IBC B;  2LLZ A;  2BJ1 A;  5HQ8 A;  3N01 A;  1VQ6 S;  2ZZN A;  2KG1 A;  2CJK A;  1X4H A;  5HL7 Q;  4K5R A;  3DI6 B;  4B3M F;  1U02 A;  1Y9O A;  4I2Q B;  4WII A;  4AXJ A;  2DHH A;  2MXY A;  2IM3 A;  2RKI B;  4PR6 A;  1SV5 B;  4LFA J;  3HI9 A;  3NBP A;  1S79 A;  2HPU A;  2AQ4 A;  2HHS A;  2R7T A;  1R0C B;  2HUR A;  3RR7 A;  3RRG A;  1C0T B;  4TY9 A;  4LF4 F;  3ILJ A;  2VQE F;  2RDD A;  5I3Q A;  2HHT A;  4ICL A;  2YH0 A;  5KT6 A;  5KFU A;  2Z2M A;  4AQY F;  3TI0 A;  1G2E A;  1AB8 A;  3D6H B;  2UU9 F;  4RW7 B;  2M3D A;  3TWZ A;  2DH9 A;  2F4V F;  2BJ7 A;  3T5H A;  2GIQ A;  4X84 A;  4LVO P;  2AW0 A;  4KGZ B;  4ZVF A;  1BY9 A;  2RVJ A;  3CCE S;  3UDC A;  4DPW A;  3DHX A;  4XDC A;  2M7S A;  1B7Y B;  4NOH A;  1MU2 B;  4TU8 A;  3W9I A;  3GU0 A;  2Y0S D;  2V0N A;  2E1R A;  2C2R A;  1S6O A;  2W2P P;  2PEH A;  1UPM B;  1T3O A;  2E5H A;  1RWU A;  3M9O B;  1DBD A;  2CQP A;  2J8S A;  1ACM B;  1B0P A;  4NCG B;  2A10 A;  3ICL A;  3SEO A;  4OQJ A;  3FMW A;  2ZKT A;  9RUB A;  5LM7 E;  5L1L A;  1RWM B;  3TR5 A;  2DHG A;  1H3D A;  1XEZ A;  2E1P A;  5J2P A;  1XR5 A;  1PYO B;  1YJ7 A;  2C2O B;  1BUX A;  1O0P A;  2FVR A;  4DV4 F;  1Q82 T;  3Q23 A;  2AX1 A;  4DV1 J;  1J5E J;  2FJD B;  1YZ7 A;  5EX0 A;  4I7F B;  5KFZ A;  4TY8 B;  3KLH B;  3H90 A;  2CQI A;  4JI0 F;  2GCF A;  3UD4 P;  2L41 A;  3UR3 C;  2P5V A;  3UNY A;  1N5Y B;  2VG5 A;  1PGZ A;  4GKK F;  3NY0 A;  2MEW A;  4OI0 A;  2Y8Y A;  2DKO B;  3J7A 1;  3J7A N;  4OZ1 A;  4ZP7 A;  2RB7 A;  2QE5 A;  3CTR A;  4A8M P;  2NSC A;  5L39 A;  1DJ0 A;  2QEX S;  4K0K F;  1XMO F;  3MD3 A;  4R5P B;  3HVR A;  4HHH A;  1J2V A;  1W26 A;  4HAC A;  1RWW B;  3B6B A;  3DCA A;  5HQL A;  3R2C J;  1DTT B;  2CQ3 A;  3GFY A;  2CJB A;  2RUS A;  2B4V A;  2HGN A;  3CDE A;  3HVT A;  4Q0B B;  3ZZR A;  3S7R A;  3QT8 A;  1T0T V;  4ED4 A;  2HS4 A;  2FGO A;  1U0H A;  2ZVS A;  1FKO A;  1D1U A;  1RTH A;  1CPZ A;  2VG7 A;  2LMI A;  2IVM A;  3MM9 A;  3C6T A;  5BXI A;  2LDI A;  5T7L B;  1SQF A;  3IXQ A;  2RDJ A;  1JLB B;  3TA2 A;  1SL0 A;  4OYZ A;  3QAT A;  1GQE A;  4CLL A;  3J7Y I;  1NND A;  5B08 A;  2K7J A;  3JSM B;  4IH6 A;  1FNX H;  1X4C A;  2F5G A;  2XB2 D;  4UOH A;  3N0V A;  4U6P A;  3TQ1 A;  4P2X A;  2QO3 A;  3M7V A;  2ADC A;  4ES1 A;  3CCR S;  4LQ9 A;  4ILM A;  3EYZ A;  5J1P A;  5ADZ A;  2VA3 A;  1S48 A;  4ANE A;  4X65 F;  4LF6 F;  5ETV A;  3PG9 A;  2N3O A;  2XWX A;  2HFN A;  1F2G A;  4YB6 A;  1YJT A;  2Z8Q A;  5A2Q Y;  1RE1 B;  5J2M A;  3HUL A;  3CUN A;  1PAE X;  2NUH A;  3M2R B;  2IMO A;  1IM4 A;  1HQU A;  2E1C A;  3M8Y A;  4KIA A;  4ECZ A;  2RRA A;  2E5L J;  1RSC A;  2X1G A;  2W4D A;  3C15 A;  2KXF A;  4DPU A;  4NCB A;  4WE1 B;  4GO7 X;  2OPQ B;  5D8H B;  2W25 A;  2L3M A;  3GWC A;  2M70 A;  4NXM F;  1D3W A;  3N6M A;  6FD1 A;  1S4F A;  4LR7 A;  3FCW A;  1M1K T;  1VBK A;  1WG1 A;  1U1L A;  2IYI A;  2ATL A;  1TP7 A;  4LSZ B;  4JI7 F;  3Q8S B;  2V50 A;  2O67 A;  3G4S S;  3CCV S;  3KUH A;  3TA1 A;  2KT2 A;  1TKX A;  4L6V 3;  2XG8 A;  4H4O A;  3UCU P;  4B9L A;  4K59 A;  1F9F A;  3OTE A;  4DSL A;  2VPW B;  3SFU A;  4YQW A;  4YB5 A;  1JLF B;  4NRT A;  1K44 A;  1S12 A;  4B9T A;  1FJG F;  4K4Y A;  2DO0 A;  1SKR A;  3K8W A;  1S6Q A;  2FB0 A;  1V3R A;  3TRG A;  2AV5 A;  2PN6 A;  3R5C A;  2WAQ D;  3NS6 A;  2DNM A;  4OI6 A;  5BR8 F;  4DWI A;  2RRB A;  2HHV A;  2DIU A;  4HR2 A;  3M2V A;  5CYQ A;  4YME A;  1JLQ B;  1QE1 A;  1AZS B;  3QAU A;  4FKX A;  4ZIV A;  3MI7 X;  5CD4 A;  5HI7 A;  1RA7 A;  5AE3 A;  1QD1 A;  3UNG C;  2DGX A;  2OFG X;  1CJK B;  4Q2L A;  4Z7Y A;  2R8K A;  3PIP Q;  1G3O A;  3MZI A;  2O01 C;  3DLG A;  4FF1 A;  1CJT A;  2OFH X;  4ZVG A;  1ZM3 A;  5HMZ A;  4BLG A;  4RW4 A;  5FDL A;  3KHR A;  2GVZ A;  5JMN A;  5H1S V;  2XS2 A;  2O3D A;  2VOP A;  4IDK A;  3IWL A;  3CJT A;  4IQM A;  1NSA A;  4TQS A;  3PIO Q;  3MOJ B;  4J9O A;  3WBZ A;  1IJE B;  3PX0 A;  3AD8 C;  1FX4 A;  2ZC4 A;  1B99 A;  3W2W A;  3HHL C;  1OY8 A;  2V2K A;  4FYY B;  1VRU A;  1PBA A;  2ZH4 A;  4CO4 A;  2GNK A;  2MKK A;  1SI9 A;  2GFF A;  2YKN A;  4PWU A;  1FRI A;  2W2Q P;  4UOG A;  4LT6 A;  2DT9 A;  2MDA A;  3BBF A;  1IM6 A;  2CJ9 A;  3MED B;  1ZM9 A;  1NK7 A;  2BRK A;  1JJ2 R;  1OYD A;  1RT7 A;  1TL7 B;  1KRP A;  1VIO A;  5KFC A;  4QPX A;  4X66 F;  5AXL A;  1OY9 A;  1RT6 A;  5L9N A;  2RU3 A;  2AX0 A;  4QQB A;  2B4P A;  4ED7 A;  3NEK A;  4DV5 F;  1DUR A;  1S5Z A;  4ID5 B;  3N6L A;  3CW2 C;  1AUS L;  2MQP A;  1S1V A;  1UP1 A;  2CJX B;  1NDC A;  2Y3Y A;  4OJG A;  3CF5 Q;  2LVW A;  3CJ4 A;  2Z57 B;  1B7F A;  1AFJ A;  4ZKA A;  3GJR B;  3SIP B;  4QZV B;  1S10 A;  1KEK A;  4YUD A;  3OXF A;  2HBQ B;  2XM3 A;  1NSP A;  3NNA A;  4X2B A;  3OT9 A;  3UVJ B;  1F3V A;  2WB1 D;  4EZ9 A;  1JLE A;  4PCQ A;  4UT4 A;  2KKH A;  2QRR A;  1S0N A;  3DRX A;  3CDW A;  4WU2 A;  4X4R A;  1IUJ A;  1S9E A;  1LW2 B;  3UQS A;  2BBE A;  1OJ4 A;  4J9Q A;  3W62 A;  4CLW A;  1NJI T;  2DK2 A;  3BGR B;  3KK2 B;  2DIT A;  2GHP A;  4ZPD A;  4C3L A;  1RA6 A;  2UUC F;  5HJY A;  4DR1 F;  4LF9 J;  2Z30 B;  3PJ9 A;  3SDE B;  5EHH A;  2OJ3 A;  2KB2 A;  4Y2I A;  4JP8 A;  2DXD A;  4E2F B;  2MKH A;  4U7U D;  3MMA B;  5A6P A;  5JJB A;  2AEM A;  2V63 A;  1Y5L B;  4U9R A;  1KFD A;  1S57 A;  2R7X A;  2LCW A;  1S4E A;  3OW2 R;  3MAQ A;  3CGI A;  2IJN A;  3MF5 A;  2L48 A;  1FTC A;  2FZG B;  2I5J A;  1SJ4 P;  1SJR A;  2N82 B;  4PG8 A;  1ZYQ A;  1JLG A;  2YWW A;  2E5L F;  3LW5 C;  5KFG A;  4B08 A;  3TW0 A;  4RW9 A;  4MKB A;  5EGY A;  2RQK A;  3THP A;  2UXD J;  3BYR A;  2HIY A;  5B0E A;  4M5J A;  3IRW P;  2LYV A;  4LIR A;  3UO0 A;  3FRZ A;  4IH5 A;  3PYG A;  4JI6 J;  3FRY A;  2EW9 A;  5C42 A;  5EWG A;  2CZ4 A;  5M2U A;  5HVH A;  3SCI E;  2MST A;  3JQM A;  1NDP A;  4JI1 J;  4B17 A;  4PXD A;  2CYY A;  2YVS A;  3W2V B;  3TZY A;  2UV8 A;  2CPH A;  4TN2 A;  2HHH F;  2C2E A;  5SUH A;  4USK A;  4C11 A;  2HK2 A;  4WYL A;  1QAI A;  1V3S A;  2XUL A;  4LQ3 A;  4Y65 A;  4RWW A;  2EC0 A;  4LSN B;  4RO0 A;  3KUG A;  2Z56 B;  3MUT P;  3TX8 A;  1UWB A;  3W5X A;  4LBP A;  3HJV A;  2V9K A;  1UJ4 A;  3S6E A;  1S9F A;  1Z2L A;  4F0H A;  1HBM A;  4UW2 A;  3FVY A;  1WEZ A;  3TYT A;  2KH9 A;  1KQK A;  3IR6 B;  2AEF A;  3IM8 A;  5ETQ A;  3RYL A;  3MM8 A;  3SBM A;  2J0W A;  2D3O 1;  3GON A;  4PZV A;  2UUB J;  1NJZ A;  4K2J A;  4LFC J;  4CM0 A;  5H9E K;  4B02 A;  4KHP J;  3BBB A;  3PFO A;  1MG7 A;  2PO4 A;  5HO4 A;  2CRL A;  4M5G A;  2QLJ B;  4FVC A;  4PG7 A;  4DLG A;  4LBH A;  1N6Q B;  4YR2 A;  2ZJQ Q;  3O2I A;  2HVD A;  2GHW A;  2RML A;  2XY5 A;  3QJL A;  1TKT B;  1CJV B;  3ZZZ A;  1T9Y A;  5CYM B;  2NRE A;  3OVA A;  5DJB A;  1Y00 A;  3HHN B;  1N5V A;  2XYH B;  3BO2 A;  3U1N A;  4J9K A;  4EMD A;  5BJR A;  4OHY A;  1SIW B;  4EFA C;  1TV6 B;  3SCJ E;  2QL5 B;  4A8W A;  3SMZ A;  1VC0 A;  2C2N A;  2YNF B;  3RJM B;  3RTV A;  1JXE A;  3M6X A;  4HL9 A;  1XJW B;  3V81 B;  2V4J B;  3GE9 A;  3D28 A;  1WKK A;  4DN0 A;  4RNN A;  2MPU A;  4IR1 A;  3CJ8 A;  3CD0 A;  5E3P A;  3KJV A;  4EBD A;  5IQQ A;  5KFF A;  1LQ9 A;  3FEY B;  1LW0 A;  2AJF E;  7FD1 A;  5ETS A;  3TJ8 A;  5E33 A;  4DN9 A;  2DNO A;  1X4B A;  2FZK B;  4USH A;  2RIJ A;  3W9J A;  2G2Z A;  4AYB D;  3CWJ A;  3IGV A;  1BXN A;  3LQV A;  2RD5 C;  4ZIW A;  5C5J A;  1FKP A;  1K47 A;  3N4W A;  4ZCM A;  2HND A;  3QGH A;  1NJW A;  5IV4 A;  3MOZ A;  3THV A;  1I3O B;  1SKW A;  2HRT A;  3I0R A;  5FD1 A;  2MQO A;  1R0A B;  3OUY B;  1NB7 A;  1JKH A;  2XI2 A;  3D6T B;  3CCZ A;  3PVX A;  1BC6 A;  3GFZ A;  2WSE C;  1PSD A;  1XK8 A;  2D3O R;  3CVK A;  3HK2 A;  4KHM A;  5FLX Y;  2IMW P;  2GJF A;  4IFY A;  4LF9 F;  1U48 A;  1E6Y B;  5D0R A;  2V68 A;  1IKW B;  3N28 A;  1JXV A;  3DDN A;  3VF0 B;  2V8H A;  2CPZ A;  3DOM B;  4WTO B;  1HMV B;  1VRT B;  3JSB A;  1HKA A;  2AJ4 A;  2ZH2 A;  2RQM A;  3M8W A;  3GFX A;  3K7R A;  3PTW A;  5L8R C;  3VTI A;  1HNX J;  4KGK A;  3L9Z A;  1Z4U A;  2WVC A;  2HRY A;  1HD0 A;  2VAS A;  1RT2 B;  2XQC A;  1S0V A;  2VA2 A;  2ATC B;  4CWB A;  2UXD F;  3HZE A;  4EUV A;  5KFI A;  1R43 A;  4DZD A;  2YPZ A;  2DHS A;  3E3X A;  5GAG U;  1R8H A;  5B0B A;  4DX5 A;  4JI6 F;  3PEJ A;  1T8E A;  3MD1 A;  2AWZ A;  2AJQ A;  1TL4 A;  4OHZ A;  5KFT A;  1KVI A;  4RR5 A;  2MZT A;  5E7O B;  2MKY A;  4TYB A;  3PHE A;  2VG6 B;  2ZEJ A;  4C8Z A;  4JI1 F;  2FZC B;  2C3M A;  3HT0 A;  3LP2 A;  5DZ6 A;  5CAB A;  4X4O A;  2NUU G;  3CCQ S;  1EP4 A;  2CNL B;  2JFK A;  3OVS A;  4Z7C A;  4GC7 A;  3K17 A;  3UW1 A;  4MK7 A;  4OZ0 A;  4M94 A;  8AT1 B;  5F8G A;  2GJI A;  3G87 A;  4P71 A;  4R0E A;  1S9G A;  5CZX A;  1NH7 A;  1FRM A;  1FEH A;  3B78 A;  1B4S A;  4X4T A;  2ILY A;  1WSV A;  4ED5 A;  2IJR A;  1F5A A;  4KO0 A;  1H0H B;  1EQM A;  2YY3 A;  5KFJ A;  2Z4P A;  5GAG I;  3CJQ A;  2MHN A;  4KR0 B;  3R8Y A;  3LO3 A;  1WD6 A;  1KWM A;  4ICL B;  3VV2 B;  1G1X A;  2HHU A;  4K4V A;  1JLC A;  5EWE A;  1DQA A;  1ZA1 B;  2VB6 A;  5KFD A;  4LFC F;  3WIV A;  4NA3 A;  5A8K A;  2LXI A;  4UZB A;  2BAN A;  3UE2 A;  5KTQ A;  5KFN A;  2ZKU A;  3HF5 A;  4QR0 A;  4USM A;  5KG2 A;  3FFI A;  2W7O A;  3HVW A;  4OJ3 A;  3BV8 A;  1P1L A;  2LKZ A;  5IWA F;  1QVF R;  2Q3P A;  1IKV A;  1LXN A;  4FNI A;  3BF4 A;  4GVB A;  4YHH F;  3DNC A;  3NS7 B;  3AH6 A;  1SVD A;  3SSQ A;  2KHD A;  4HDH A;  1QTN B;  2HQI A;  2Y1R I;  1RWO B;  3TUZ C;  1SKU B;  2WBR A;  4CNY A;  2P8I A;  2CWK A;  1FDN A;  2CJQ A;  2RS2 A;  3H8Y A;  1TK8 A;  2W24 A;  1YTY A;  3Q89 A;  4MYT A;  5CXT A;  5THW A;  5E0O A;  3H5Y A;  1VQ9 S;  3A1Y G;  1VBX A;  4I69 A;  4R25 A;  4X4P A;  3MFI A;  2R7R A;  1QAJ A;  4RBV A;  4QJV A;  1RAB B;  4ZVT B;  2HGM A;  4NRU A;  3R6G B;  1L5U A;  5J2P B;  2A6O A;  3RRH A;  1WUU A;  4WF9 Q;  2OSQ A;  2VBX A;  4CTA A;  3BSO A;  3U1M A;  4RNO A;  5D6G A;  3BN4 A;  2AEJ A;  4AUK A;  3SV4 A;  2LQ9 A;  4Y2C A;  2BQU A;  3H59 A;  2VG5 B;  4KT0 C;  3H5U A;  1TUV A;  2NCK L;  2XYG B;  1VHI A;  3AD9 C;  4UOF A;  2VOO A;  5LMN F;  3H4B A;  1FCA A;  4B9M A;  1HFE L;  1FKA F;  2YKQ A;  1AYE A;  4CLU A;  5C2C A;  2QMU B;  3QYY A;  2CQ1 A;  4HAC B;  3MPU B;  1VMB A;  3QGG A;  3QZ7 A;  1F2H A;  2KYX A;  4B3R J;  2C3P A;  1VQP S;  3HVT B;  1RTD A;  4M95 A;  4C8Y A;  3J81 j;  1SC4 B;  5AE1 A;  2IDL A;  2FYX A;  2W9B A;  3TVK A;  1U0H B;  2I38 A;  1FKO B;  2PC6 A;  4Y2K A;  1RTH B;  2VG7 B;  5FII A;  1P9Q C;  4A46 A;  3MM9 B;  2CPJ A;  2BE2 A;  3OBI A;  3C6T B;  4B3T F;  5CYJ A;  2BJ9 A;  1RAE B;  2RIL A;  1RZM A;  3KDO A;  1O51 A;  1F5B A;  3GB0 A;  1RAA B;  4OI3 A;  1HW8 A;  2NQP A;  2BKN A;  2ALY B;  2XWY A;  3N79 A;  5AJ3 F;  2D3U A;  3LH2 S;  1T3N A;  1HNX F;  3NP5 A;  3Q83 A;  2WOM A;  2LA6 A;  2KT5 A;  2FJE B;  3ILL A;  4DR7 J;  3BO3 A;  4C2M A;  5IZH A;  2XY6 A;  3ENV A;  3FSI A;  3W3S A;  1NHK L;  4ED3 A;  1M1H A;  3M8Z A;  2H54 B;  3CD7 A;  3V4I A;  1RWP B;  3BB5 A;  1PKU A;  3VAH A;  2CUY A;  2HNY A;  2POK A;  2W01 A;  5KG5 A;  1IKY A;  1T9T A;  5J2M B;  1H73 A;  2BJE A;  3I31 A;  2G2Y A;  4CO5 A;  3KJN B;  3JTO A;  1U1N A;  4ZVQ B;  1REG X;  2ZD1 A;  5IT9 Y;  2MZJ A;  1P8G A;  2FVC A;  1HQU B;  3DMJ A;  2KZZ A;  3BH6 B;  5I3U A;  3C15 B;  1DLO A;  3TZZ A;  2ZM6 F;  2M4M A;  3IN5 A;  2E1A A;  3IS9 A;  3Q8R B;  4EU0 A;  2KFZ A;  2ZH3 A;  4EBE A;  2DBB A;  2XY7 A;  1XQI A;  4V19 X;  2XEX A;  2ZE2 A;  3G6E S;  2A1B A;  3C14 A;  2BQ3 A;  1IJF B;  3HHD A;  1TKX B;  1D0E A;  1R0B G;  4H4O B;  1CG2 A;  3PYF A;  2RF2 A;  3ENW A;  2ERR A;  4OJ1 A;  1KC8 T;  3CJ0 A;  3FCH A;  1B70 B;  1YVF A;  4L3N A;  3RB0 A;  1NAQ A;  4CH7 A;  1T95 A;  1HWU A;  5F41 A;  2DNL A;  1S6Q B;  3IG1 A;  4QIW D;  1YI2 S;  3GYN A;  4URQ U;  2CQ4 A;  1EB0 A;  3NWR A;  3TAM A;  3W8P A;  2Y9H A;  2QGF B;  3HVA A;  2HAF A;  4DR3 J;  1TAQ A;  3T41 A;  4I67 A;  2VFV A;  3M2V B;  1RP5 A;  5CYQ B;  1QE1 B;  4PAB A; 
#chains in the Genus database with same CATH homology
 4QYZ K;  4U7U D;  2Y8W A;  3QRQ A;  1WJ9 A;  3QRR A;  4DZD A;  2Y8Y A;  3QRP A;  5H9E K;  2Y9H A;  5H9F K;  5CD4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...