3QSGA

Crystal structure of nad-binding phosphogluconate dehydrogenase-like protein from alicyclobacillus acidocaldarius
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
285
structure length
285
Chain Sequence
b'MKLGFIGFGEAASAIASGLRQAGAIDMAAYDAASAESWRPRAEELGVSCKASVAEVAGECDVIFSLVTAQAALEVAQQAGPHLCEGALYADFTSCSPAVKRAIGDVISRHRPSAQYAAVAVMSAVKPHGHRVPLVVDGDGARRFQAAFTLYGCRIEVLDGEVGGAALLKMCRSAVLKGLEALFLEALAAAEKMGLADRVLASLDASFPEHHLRDLALYLVERNLEHADRRAHELGEVAATLCSVGVEPLVAEAGYRRLTRVAQVRAALKQRPGDVRAWLRSLANA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NAD-binding phosphogluconate dehydrogenase-like protein
publication title Crystal structure of NAD-binding phosphogluconate dehydrogenase-like protein from Alicyclobacillus acidocaldarius
rcsb
source organism Alicyclobacillus acidocaldarius subsp. acidocaldarius
molecule tags Structural genomics, unknown function
total genus 108
structure length 285
sequence length 285
ec nomenclature
pdb deposition date 2011-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03807 F420_oxidored NADP oxidoreductase coenzyme F420-dependent
A PF09130 DUF1932 Domain of unknown function (DUF1932)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 3qsgA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3qsgA01
1P45A 4W9NC 2OL4A 4M49A 1ZMTA 5L4NA 2CZCA 3OIFA 4GVLA 4NNJA 2ZK7A 5T57A 1AN9A 1PWXA 2WYUA 3ZU3A 5C7IO 3GEDA 2GD1O 3B20A 3OEYA 1YB4A 2NUAA 3HG7A 4IDAA 4N5MA 5JFOA 1ZNQO 3ZWVA 2IYOA 1PQWA 4FC6A 3VOSA 4FJ0A 3BMCA 3WS7A 5IAAA 4EJ6A 3DBVO 2NADA 3FCOA 4IY1A 1ZCJA 3O03A 1ZZEA 2VCYA 3UN1A 2PTGA 4DLLA 3NT4A 4J0EA 3LZ6A 3AM4A 3QSGA 1VM6A 1NFQA 5TJ9A 2NQ8A 5DBIA 1U7HA 3SX2A 5C37A 5C3MA 4ZQHA 4IBOA 1LSOA 4GSKA 2ZQZA 3UCXA 2DBQA 4NK4A 3AY3A 4O5OA 4D46A 3PIIA 3OIDA 3S2EA 1WNTA 4JROA 1AUPA 1DXYA 4YJHA 5AQ1A 2VHYA 1HDOA 1LXCA 1OI7A 2P91A 4CQMB 1O94A 1R0SA 2Y1CA 3RSHA 3KYCB 2BKAA 4HFRA 2IEDA 1X7HA 4YQZA 3F3SA 5CFZA 5A06A 2SCUA 3AJRA 1D7OA 4WNCA 3OJLA 1U4SA 5I8ZA 2D3TA 1XU7A 1GYRA 4D45A 3BMQA 2DC1A 4KP7A 4KWIA 4OMUA 5BSGA 4U5QA 2CF6A 4YCAA 3VKUA 3L6OO 3DFUA 4UULA 1JAXA 1EVYA 2CUKA 2VRCA 1WXDA 2A9FA 3DXFA 4CV0A 4IXWA 3F4LA 4N5LA 5KNLA 5EIOA 3C24A 3VTZA 2J3HA 1ZK2A 3RQSA 1HSOA 4GX5A 4GH5A 4E12A 1SPXA 4Z3KA 1R0KA 3EYWA 3OQBA 4XQGA 1KEWA 4FJ2A 4ALNA 1PJCA 4MVJI 1X1TA 4DMMA 4BO8A 2VHXA 2CD9A 4TVBA 4LCEA 5EMHA 4LN1A 1RYDA 1KVTA 3MJ4A 1S7CA 4WCFA 4TQGA 1GADO 1NPYA 4E5YA 4BNMA 4HFMA 2ZCVA 2GDZA 5JSFA 3M6IA 4AG3A 4YPOA 1IPFA 2ILTA 4FS3A 4UVGA 4WLUA 3JTMA 4NBRA 5DCUA 4R9SA 5I8WA 4E31A 5KVSA 4BNUA 1U8XX 1E5LA 1XR3A 4ONEA 1P31A 2DTEA 1E3LA 4IDEA 3C85A 1NP3A 2BFOA 3GZNB 3DOCA 4NDNE 3RJ9A 5CEFA 4AJIA 2QIOA 1OBFO 2LDXA 1H9BA 1UDAA 3CMCO 3AU8A 1YQDA 3RI3A 5B12A 5ITVA 4BNFA 3H7AA 4RVDA 3ADOA 5BNIA 5CDUA 2GN6A 2QG4A 2Y0EA 2GO1A 3JQBC 4J4TA 3G79A 5JAQA 3RD5A 1M67A 3Q1LA 4HFNA 1SAYA 3S1LA 3A9WA 4I5EA 4EW6A 4HNHA 2C59A 4DPMA 2PKQO 4J0FA 2Y0CA 4ALLA 3V2GA 4TZKA 4G2NA 4BO3A 1U3UA 3GPIA 1EZ4A 4J7UA 4LVUA 5ICMA 2Q49A 3DAPA 4D44A 1LU9A 2YY7A 2ZYAA 1FK8A 4AJNA 5IFLA 2QW8A 1P0FA 3E03A 4QEDA 3PEFA 1JQBA 2BELA 1LLUA 1C0PA 4OXNA 3ETGA 1TT7A 1HTBA 3CTMA 3GGPA 3KM0A 3TL3A 5K9ZA 5H83A 1ISMA 4M55A 1DB3A 2ZCUA 1C0IA 3JD4A 3H5AA 1LEHA 4MIYA 1T2EA 2B36A 2X9VA 1W0CA 3EGOA 3QIVA 1OMOA 3OMLA 4DC0A 4XIJA 1HDZA 1YKFA 1GCUA 3DQPA 1F12A 2P68A 2PD4A 4R5MA 1SNYA 4WEQA 1LSJA 2GZ1A 1Z7BA 3S2IA 3T7EA 2YV3A 2ZATA 2I3AA 4U8GA 3WYEA 1PJBA 7MDHA 4Z0TA 4A5OA 4WLOA 1YO6A 3UHAA 4D7AA 1EFLA 3HZZA 5B1YA 3T4EA 1FDWA 2VWQA 2D5AA 2O3JA 2X22A 4IS3A 5A03A 1A71A 3NRCA 4JBHA 5FFFA 4EUHA 5BSFA 3RBXA 1F06A 3GVHA 4PG7A 2EXXA 4R69A 1JDJA 3HFSA 1E3WA 2CVQA 3KVOA 1UR5A 4RVUA 1PTJA 4PIVA 2A92A 2JFHA 4QXMA 4YEDA 5JO0A 5I7FA 4DLBA 4Q3EA 3WBBA 3DO5A 1E7YA 4JJFA 3VH2A 4N54A 1PZFA 4B8WA 2ZQYA 3FPCA 2YFQA 1M66A 2QYSA 3VTFA 3WYCA 4UVIA 2Q4BA 1U2GA 3ABIA 1P77A 2HSDA 1U7TA 2NU6A 5BT9A 4K28A 1NVGA 1JAYA 3IC5A 5TSDA 4KUGA 3DAFA 2PD3A 5TLSA 4F46A 2YDXA 4TSKA 1K6XA 3TOXA 3WWYA 2O2YA 3I9LA 4DBZA 1DJQA 2VQ3A 3SC4A 3JYPA 1NPTO 2YHIB 4BMSA 2HK7A 2JAHA 4YQYA 3TFQA 1P33A 1PQUA 4AJLA 1JWAB 4ZRNA 2ZIZA 1IE3A 5ILGA 5CG1A 4CODB 5F3RA 7ADHA 4UUOA 3GZ4A 5C7LO 2ZTVA 3JD1A 1YBAA 1E1MA 3VPHA 2NVBA 4RV9A 3ON5A 5IG2A 3WTBA 4J1TA 5IN4A 3SEFA 2EW8A 3AI3A 2D0IA 4NBWA 2V6BA 3MTJA 4RF5A 1WAMA 5U4QA 2X0IA 4CQMA 4FQ8A 2FP4A 4I9NA 1DC5A 3KYCA 1EE2A 2EF1A 1ZJYA 4K6CA 1IHYA 2OP1A 3S2GA 2YYYA 2I66A 1CIVA 5A05A 4ZJUA 3LYLA 4D3SA 3DBHB 3F9IA 2VHWA 2EW2A 4TROA 3L0DA 3ZU4A 4AFNA 3PP8A 2CDAA 1T2AA 3RUAA 4J49A 1WLYA 3JD3A 3L6EA 3H9QA 3JQGB 3E5RA 2C2XA 2ZB4A 2FWMX 2DAPA 3L4BC 3MJSA 5TT0A 4EUEA 2FY8A 2I3GA 3R3JA 1R12A 4YB8A 5BNTA 3H6KA 4WUVA 2V7PA 5JMPA 3CUKA 3S2FA 3ZU5A 4P4NA 3W8EA 4FFLA 3GUCA 3IOYA 3BHIA 1KOLA 2C7VA 4H15A 4Z0HO 3NDJA 3RIHA 1WZIA 5L7TA 5HM8A 4FR5A 4BNHA 4XWYA 3RU7A 2WDZA 2UYYA 1OZAA 2X4GA 4P4LA 1GY8A 4PFJA 3IUPA 1YL6A 4ZQBA 5TNXA 2J5QA 4W82A 5L7WA 3NV9A 3PI7A 4I5DA 1GL3A 3U0BA 3WMWA 4M1QA 4W99A 1I3MA 4IQ0A 4IS2A 3PLRA 3Q11A 4FOSA 3ONEA 2BGLA 3SBOA 2VN8A 1ZXLA 5DDIP 4Z9YA 3UGKA 3FBTA 3SLKA 3EC7A 2G5CA 1I2ZA 3VAZA 2IZ1A 4MVJD 2VWGA 1GYQA 5JW6A 3GZNA 1PJTA 2NVWA 3WGGA 4K9DA 1SO8A 3PJGA 5C7OO 4PRLA 3MJVA 3DOOA 4BGUA 3QW2A 2P2SA 5CG2A 1B8VA 1MG5A 1UDCA 4WEOA 3ZCXA 1CDOA 5IZCA 4CUZA 2P5YA 3I3OA 1GCOA 1O6ZA 3WSVA 3I1JA 4ALKA 4B7UA 4UEJA 4PVDA 2YFHA 2OUIA 3RUHA 4E2YA 4GGOA 4RGBA 2DVMA 4CMGA 4CMKA 5THKA 4JJIA 1SOWA 3DTTA 1Q0QA 4YWJA 1N8KA 2C29D 4DWVA 4LMPA 1E7SA 1UAYA 3VPSA 4WOJA 3WQQA 3ICCA 4IZHA 1IPEA 3M1AA 3WGYA 1D1TA 3DZIA 1DHTA 5LC1A 3B6ZA 4PCVA 4A73A 5A04A 4Y6RA 3KUXA 1TLTA 2ZB7A 5FYDA 1PGQA 5A02A 3W4JA 3SC6A 3ZWXA 1I3KA 5I7VA 1HDYA 1W8DA 4RVGA 5DN9A 5FEUA 4BV8A 1A4UA 4XYLA 2AEMA 2FZWA 5L53A 4I8XA 4XX0A 1EEHA 2JKVA 4NU5A 2FOIA 1HSZA 2JD2A 1NHWA 5CPFA 1EK6A 1LI4A 1YS4A 4J1SA 3VVBA 4LMRA 2OXIA 5LDHA 5DT9A 3D4OA 1ULSA 1ZK4A 2O7SA 1BSVA 1E3SA 3A14A 4WLNA 1QKIA 3ANLA 4RDHA 4MOWA 5I7SA 4H3VA 2OBYA 4MJLA 2I67A 2CDBA 2VNAA 3BHJA 1B3RA 2BI7A 3GDFA 5JDIA 3NDIA 3RBVA 2Q4EA 3L9WA 1HF3A 5A3VA 1M6WA 1J5PA 2O23A 2E49A 1XDWA 4GX0A 1R66A 3NYWA 1NYTA 2DPHA 4BO1A 4GLLA 4QUKA 1F14A 1C1XB 1KBZA 2HU2A 1ONOA 4JBGA 4BO2A 4DVJA 1XWFA 3JQFC 3CEAA 4PLTA 1I32A 4CLXA 4LGVA 4NZ9A 3ENKA 5B37A 4OSOA 1DJNA 1PJLA 3FN4A 3PYMA 4MDHA 3U4DA 4A03A 3VDQA 3CINA 4Q3BA 4RPKA 3E8XA 1XSEA 5HS6A 1K6IA 1YQGA 2O3SA 3GK3A 4ND3A 1IYZA 3U4IA 4DUPA 1G0NA 1FJHA 5ER6A 5G2OA 3TJRA 4RO0A 3OJEA 1IUKA 3H9EO 4CM7A 3BHMA 1F17A 3CZMA 2W2LD 3EY4A 4R54A 5DOZA 2B4TO 3VDRA 3HADA 2YHIA 3OIGA 4C7KA 3H8VA 3PQFA 4DRYA 2RIRA 5CDTA 2AQIA 4XA8A 2NV6A 1K3TA 1E6UA 2VTEA 4L74A 1DAPA 3TZKA 1E0DA 3QVXA 3GOHA 3ETDA 4RZIA 2V6FA 3SJ7A 4QX6A 4URFA 1XA0A 2I6TA 3HJAA 1T2CA 4YR9A 4TRRA 4BNNA 2C82A 1UXJA 2J3JA 2FN7A 5FI5A 1SCUA 5KVQA 4ZICA 2Q50A 2Q3EA 3K9QO 4XJTA 1LSSA 1ZK1A 2VZ8A 1YBMA 2HJSA 3JYNA 1GPJA 3OSUA 3LDHA 4QT0A 3ZN2A 3V8BA 1T24A 3DBHA 3RFVA 3QHAA 4II2A 5DOVA 3IKVA 3QVSA 3AM3A 1KYQA 4CPDA 3KB6A 3JQGA 3TSCA 4XGNA 2OGUA 2H6EA 4CM3A 3NJ8A 3OA0A 1PZEA 2R00C 3INTA 2DTXA 1QRRA 1XIVA 1ZO8A 4A7PA 2OZPA 4NHEA 1P1IA 1T4DA 1PWZA 1V3UA 1LLQA 3KLPX 1SB9A 3I5MA 4EDFA 5KWEA 1HT0A 3ULKA 3H5NA 4RPHA 1ZK0A 3VH3A 3IJRA 5COQA 1HDXA 3BTVA 5CDGA 2E37A 1ZW1A 3D7LA 1YRLA 3UOGA 1UJMA 1XCBA 4BKQA 1TB4A 1E3IA 3KOUA 1K0UA 4LISA 4CMCA 4R01A 3JQAD 2A4KA 2PFGA 2VRBA 5F5LA 1ZSVA 4CUKA 4FOOA 4GPD1 3GF4A 1Y7TA 4FFRA 3U5TA 5H82A 2IODA 3FTNA 3RASA 4NBVA 4FFOA 1TA4A 1MUUA 5TIIA 3JQ9A 5TF4A 4MVJP 3QRWA 2DM6A 3CMMA 1F0YA 1LQUA 3HE3A 4PLWA 1HE4A 1IL0A 4XKJA 1PR9A 3KO8A 3HN2A 2H5LA 4J3FA 1ISHA 1ISJA 3ADPA 1DRUA 3VPFA 1DLIA 1PSDA 4S3MA 2B35A 4NI5A 1I0ZA 3RU9A 4R4JA 4B4UA 2W98A 3A28A 1YONA 3NTOA 1T25A 1GR0A 1UXIA 1ZFNA 3PYLA 4NK5A 5K6AA 5TGDA 4NJMB 1BGVA 3PHIA 1KERA 3QP9A 3ENNA 2CY0A 1HYHA 3M1LA 3GRKA 4XYBA 3WNVA 1MB4A 3RUEA 1BTOA 4ROSA 2X0RA 1GDHA 1ZKMA 3K30A 3WTCA 5A3JA 1E77A 1XKQA 1ENZA 4WGGA 3WBFA 3K92A 3BZUA 4PLZA 3DMYA 3QVTA 1R15A 1TXGA 2JJYA 3OHSX 1I33A 3BMNB 2PGJA 3FI9A 4OXYA 3DFZA 1IZ0A 3CKYA 4U6QA 3NT2A 1JW9B 1L7DA 4YT2A 1QORA 1X13A 3L77A 4IPTA 2QRKA 2IE0A 4WOKA 3AY6A 3B1JA 1EE9A 2PR2A 4LSMA 3K2EA 4YJGB 4ALMA 4J9UE 5C5IA 5HBRA 4BKPA 4IIUA 2G17A 3G3EA 4YT8A 4AJEA 1KY4A 4FC7A 1HZZA 4OO3A 4J1QA 3RUDA 1VL6A 1YBVA 1VJTA 2Q46A 1ADGA 3WXBA 5J23A 4QQRA 3GH3A 3BMOB 1QV7A 3FRJA 1ZXBA 1FDUA 3OQ1A 4J9VA 4B4WA 4D42A 1KIFA 1UZLA 3CIFA 3GC6A 4PLHA 2BHLA 1BHSA 5IDQA 1HETA 4ND2A 3IKTA 2NU8A 4AJKA 1LLCA 3KBOA 1C1XA 1KVQA 1GUFA 1PJSA 3CXRA 3E18A 4J4HA 4N5NA 4OOEA 2Q1UA 3W6UA 1Q7BA 1Y81A 6ADHA 3G49A 1PGJA 1XHLA 4KQWA 1JA9A 1SEPA 3U49A 2VRCD 1C0LA 2F00A 2GASA 3LT1A 2DBVO 2YUTA 2H63A 4JP3A 3FNFA 2W2KB 5A9SB 3LSYA 1AHIA 4GVXA 4HKTA 3WGHA 4OGWA 1CWUA 4JLWA 2YV2A 3I9NA 2Y0DA 1D4FA 3OEWA 4A26A 1KVSA 4AJPA 3MOGA 5FI3A 3TPCA 4BOYA 1L1FA 3KSUA 5CDSA 1CF2O 1UAGA 2JCXA 3HNPA 4JCOA 4OIMA 4BNKA 1FDSA 1XGKA 3GQVA 5JBIA 2YW9A 3PXXA 4JIGA 1MP0A 2EJWA 2GUGA 2H1SA 3TOZA 1XQ6A 3JQCA 1AXGA 3HDHA 3V5NA 2EV9A 3HB5X 2I99A 4KTVE 4DL9A 2WD7B 3E9NA 3QVOA 1GAEO 1ZSYA 3EVTA 2HCTA 3K5PA 2X8LA 3ETEA 5A4DA 3TQHA 4B79A 1NR7A 3AUUA 4E2XA 4R1UA 1CRWG 4RL6A 1Y8QB 3TNLA 3FWZA 1EBUA 3WGIA 1PX0A 3ZWWA 4YJFB 4EZBA 1B8UA 1ORRA 1P9LA 4O63O 2YHUA 3MOIA 1X7GA 1PL8A 5THQA 2UUPA 4R1SA 1R4NB 3PJFA 3G1UA 2WE8A 4K26A 1ENPA 2AEJA 2EEZA 4XR4A 5MGBA 1NPDA 2BFMA 4I5FA 2WWRA 4BV9A 4CMHA 4NH4A 3EZLA 1E1NA 2Y93A 4L8VA 4CM9A 2VWHA 3DZKA 3NUGA 1JLLA 4I08A 4CMJA 3Q9UA 4FN4A 4GSLA 1YJ8A 3ANNA 5JAMA 2AXQA 3I83A 3PJDA 4GI2A 1PR3A 2C07A 4D79A 2WD8A 4QO7A 5JC8A 4CM4B 4QFDA 4WCDA 4JK3A 4OXKA 4BNWA 3MWDB 5B4UA 4RLSA 2VZ9A 1FF9A 4WLFA 4D0SA 5IZ4A 2DUUA 3R1IA 3JYOA 4UUPA 1YQXA 5CEEA 1BDBA 1GZ4A 1W4ZA 5IDWA 2XXBA 3DONA 2VYVA 4PLGA 5KKAA 3G0OA 1I5RA 4BNXA 1ENYA 3PTZA 5KJEA 1HDRA 4RPJA 4UVDA 4ID9A 1GFSA 4DC1A 1ENOA 2FRDA 3PWZA 4ALIA 4DYVA 3NT5A 4HX5A 3RUCA 3HQ4O 1NTOA 4GX2A 2VHVA 3R6DA 4XRRA 1P1HA 2HK8A 4DQXA 2Y66A 4Q3NA 1NASA 5JS6A 1DRVA 1UXGA 3OETA 1GUYA 4NFSA 5IXSA 1V6AA 3RC9A 1QYXA 4IJVA 4BKRA 4MINA 5JDCC 4Z3DA 4A27A 3VVCA 4TKLA 3CZRA 1LDEA 1F8FA 1NBOA 3HUDA 1PU2A 1E6EA 1JTVA 3TL2A 2O4CA 3I9MA 2PK3A 4ITUA 3U4CA 3RJ5A 4DLAA 5I9NA 4NJMA 5IN5A 4Q3DA 4TMFA 1EQUA 4IMRA 1WP4A 4CM1A 4NR0A 3D5TA 1HLPA 3RFTA 1E5QA 3WX0A 4LRSB 3RVDA 4B3IA 3RAJA 4XZ3A 1I3NA 1BXGB 3CSDA 3R0IA 4MIOA 1MXFA 1DFGA 1H2HA 1EVZA 2AMFA 4Z0PA 2VTDA 2FMUA 4FFNA 3KLMX 3E48A 2B4QA 2EKPA 1CQIA 3EMKA 3BMNA 1K89A 3F5SA 4TRMA 3QWAA 4ZU3A 3WR5A 1O5IA 3GDGA 4RPLA 2ET6A 4R9RA 5CPBA 4CV2A 4DA9A 4EJ0A 3DZHA 3LLSA 1A4IA 3AI1A 1T1RA 2HUNA 4GBJA 1ZIDA 4IDGA 4ZD6A 1X1EA 3RBZA 4E4YA 3ITKA 1VRWA 4P22A 3QWFA 1J0XO 4YJGA 1VPDA 1PEDA 2UVDA 2OP0A 4J16A 3FR7A 1DBVO 2P4QA 1NXQA 1YXMA 3Q6IA 5CHEA 3WDSA 2FSSA 3JYQA 3QLJA 3PYXA 2AQHA 4IJUA 1Z45A 4DQVA 3JQBA 4YBZA 1NNUA 3BMOA 2VOJA 4FCCA 1D1SA 3DMTA 1DC6A 4GKBA 1EQ2A 5EINA 5T67A 1ISGA 5EJ2A 1GV0A 3WICA 1P1KA 1RM3A 3D4PA 3MWEB 3S55A 2AE1A 4L4XA 4RVHA 1T26A 3RROA 3ZNNA 4EUFA 1C3VA 1CERA 2Y05A 3KTDA 5KJFA 2CDCA 2W8ZA 2Q2WA 3FWNA 1HEUA 1XLTA 2NTJA 4CMEC 2W4QA 3QVWA 3D3WB 1PZHA 3QQPA 4OYRA 1DIRA 1RM0A 3F4BA 4BL5A 1Y6JA 1B2LA 4TKMA 4FPXA 3WLFA 4QFCA 2B4RO 2GZ2A 3H9UA 3AUAA 2IEBA 2W2KA 2ZB8A 4R1NA 5A9SA 4ND5A 3OA2A 1LBEA 3LT4A 4QTZA 3TZ6A 3ROQA 4R68A 3H4VA 4FW8A 3GGGA 5F1KA 3VPGA 4CMIB 5JAZA 2Y1FA 3CPSA 3MTGA 1H2BA 1PIWA 4I5GA 3ZWBA 4PLCA 1A72A 1YWGO 5L45A 1RJWA 4HY3A 1PS8A 5AYVA 3FD8A 1LDBA 1BXKA 4H16A 1V9LA 3G17A 1LLDA 3COSA 2PH5A 4IUYA 3NTQA 1LX6A 1H6CA 2B5VA 3QWHA 2R6JA 3MJTA 3GRPA 3HDJA 1YB1A 2P5UA 4I9HA 4Y6SA 2WD7A 2HMUA 2HQ1A 4TRNA 4NU6A 3WOHA 4HV4A 3H2ZA 1P74A 4IQ8A 1Q0HA 1RYEA 1Y8QA 3ANMA 4BNTA 2Y99A 1DIBA 4PN3A 3UCFA 3ZWAA 4FIZA 4OHUA 3ROMA 5JYEA 2PKQP 1PL7A 2TMDA 4YJFA 1H6BA 2EWMA 2VT2A 2Q2VA 4BUCA 5IF3A 2X86A 3AUSA 2YQ5A 4TWRA 2BI8A 1R16A 4R3NA 8ADHA 4CR7A 3WQRA 1R4NA 1X7DA 1WDKA 3OICA 2J5KA 4XJSA 4B7CA 4KUHA 4LSWA 3O9ZA 1PJ3A 4C7JA 2VUSA 2B0JA 1YL7A 1E7RA 2OO5A 2VHZA 4GAEA 2UUOA 3O26A 4J90A 1TEHA 1I30A 1VE9A 2WSBA 5TC4A 1VJ1A 2D2IA 1Y5MA 3DL2A 5DP2A 3EAGA 1ONPA 3JQ7B 4BO7A 4NPCA 3B1KA 4OM8A 2HRZA 1IOLA 1HL3A 3OJOA 3TFOA 1MXHA 1BG6A 1AXEA 4XYGA 5F1OA 4CM4A 2PZMA 3WIEA 4OJNA 1I3LA 1LNQA 2O3TA 3JD2A 4P4GA 1MV8A 1Q7GA 4E3ZA 4EYEA 2GN4A 5AXCA 3ST7A 4YAEA 1G0OA 4MVJA 3NTRA 1T2FA 5A5EA 4L4RA 1MLDA 1UDBA 5L4SA 3DTYA 3HSKA 4ZQGA 3UXYA 1Y5RA 1GZ6A 1JKJA 4BO4A 3B70A 3WGOA 3GNQA 1ZH8A 4M8SA 4UAGA 3TN7A 4CL8A 4EJMA 1NQAO 2PH3A 3E1KA 1M75A 1IB6A 4HXYA 3G1TA 1SB8A 1X0XA 1TVEA 4LRTB 4ZGWA 9LDTA 3AOEC 3K8ZA 3WIDA 4OAQA 2VOEA 4HFJA 4QO8A 4Q39A 3H2SA 3L4BA 1YH3A 2NSDA 4J2HA 2J3KA 3DHYA 3I4CA 4AVYA 1UXKA 4PZEA 3LC2O 3V1TC 4RORA 5KJ6A 1L7EA 2GN9A 1DOHA 1K2WA 1S6YA 2X7HA 5DNAA 1B7GO 3ZNPA 4PVCA 4R3WA 1CETA 2VYND 4DIFA 4B4OA 3M2PA 1H5QA 3ZNOA 1BXGA 2VWPA 4TZTA 1B0AA 3CE6A 3K2BA 1PGNA 4CLRB 4KDFA 5FF9A 3PK0A 3ZHBA 2WJPA 4U7WA 3IMFA 4Y9DA 1PGOA 2JAPA 5EESA 4XR9A 2P9EA 3RUIA 5JYDA 4WKGA 2I65A 5DULA 3ZHZA 3MZ0A 2GN8A 1PJ4A 4X54A 4EITA 1BVUA 3GNTA 3GY0A 3EK2A 4O59O 4NQZA 3W8FA 1LTHR 3WLEA 1UZMA 4YAGA 1GUZA 1ML3A 4G81A 5JNLA 4L75A 3FNHA 1N1GA 3RC2A 4DTIA 2P9GA 2NTVA 2IRWA 2Z1MA 1RKXA 1V3TA 1PQPA 4K1LA 4CLOB 1DDOA 2OOSA 1NQ5A 3W4IA 4CM8B 4QECA 2BGKA 5DP1A 1LDMA 4D0RA 4BS9A 2NM0A 1KEVA 3Q2KA 1FDVA 1VSVA 1QYVA 2NVUB 4BVAA 2JCYA 4TRJA 3ZWMA 5T8KC 1DRWA 1KVUA 1XG5A 3DWFA 3KHUA 5COBA 3BTOA 1BW9B 2EP7A 3GVPA 2NTNA 4BB5A 3AY7A 5L95A 2C7GA 4RLHA 4GQAA 1B16A 1H94A 2Y1OA 2FR8A 3E9QA 3OJ0A 4WLVA 3IUSA 3ZV5A 2PZJA 3JCZA 4IXTA 5T5QA 4CL3A 4IJKA 4IIVA 1CYDA 3X2FA 1DO8A 3DB2A 4ALJA 5K6AC 4PLVA 3HDQA 3ASUA 5AVOA 4AJJA 2DT5A 3GVIA 4J2OA 4YT5A 1VKOA 3D3WA 1I10A 3E5MA 3ZHXA 2B37A 3GHYA 1EUCA 4PZDA 2YQ4A 1GEGA 1LDGA 1J49A 1EFKA 1ISFA 3WFIA 3GMDA 4ZVVA 4AJ1A 1WVGA 3WGZA 1QLHA 2X5KO 4IINA 2HMVA 1VL0A 2DBRA 4D3FA 3RFXA 3B1FA 3PDUA 2AE2A 2C5AA 1U3WA 4BMVA 5AXBA 2XPCA 4BGIA 4OL9A 4CMIA 4WPGA 5I9LA 3VH1A 1GQQA 1O8CA 3PRJA 4WJZA 5DCWA 3PWSA 3PZBA 1D8AA 2EERA 4MP8A 2FHSA 3BXXA 2VUTA 3O38A 1LDNA 3QA9A 4J43A 4E30A 4MKXA 1QYDA 4YA6A 1C1DB 3RUFA 4XQEA 5FWNA 4BNJA 4ND1A 1XYGA 3F1LA 2F1KA 5U1PA 3INGA 2AW5A 3PHHA 1JKFA 4ESOA 1O95A 3WFJA 1E3JA 3GG2A 2CVZA 4ZQEA 5MDHA 2QZZA 3WMXA 2XXJA 2Y68A 4B4VA 5F1PA 2XOXA 3GFGA 5JAIA 5L51A 3JQFA 4E21A 1R0LA 3JQ8B 3TDKA 2HRBA 5JLAA 4RCVA 4K6FA 4PRKA 1N9GB 3VZSA 5CAEA 5ILOA 1ZEMA 1X15A 4BMNA 1IZ9A 1NHGA 4UVEA 3UW3A 2WYWA 3WWZA 3NX4A 5B4TA 1WWKA 3GDOA 2EGHA 2DU8A 4D3DA 1WDMA 2JD1A 3DEYX 1KY5A 4BIIA 5GY7A 5CEJA 4CUJA 3QWIA 5KOIA 3MCVA 1T1SA 4XQCA 5JCJD 2W90A 2O3UA 1CEQA 2QHXA 3GVXA 4IDBA 1A7KA 4XDZA 2C5EA 5KJ1A 1I36A 2DLDA 4EGFA 1GPDG 4D41A 1H93A 1MFZA 1KC1A 1KEUA 1YL5A 4U6SA 1V3VA 2QZ9A 3N58A 4MKRA 4FFPA 3TF5A 3JQ7A 1Q0LA 3KV3O 3IL2A 3KYBA 3EHEA 1KVRA 5BNFA 4JN6B 4U0JA 2Y1EA 3UAGA 3UVEA 1HLDA 4WLEA 3WNQA 1YOVB 3WQSB 3QV1A 1CQJA 1Z73A 2EG9A 2PGDA 3W8DA 1NQTA 4XQ9A 3WSWA 5EPOA 3LF2A 4YTEA 3SVTA 4LW8A 1XQ1A 1QG6A 3DAGA 3MJCA 3WG9A 2Y67A 4BKOA 3GFBA 4YRAA 1X0VA 1IULA 5KVCA 1GV1A 3AFMA 4XGIA 3F46A 5DBGA 3P5SA 3ZW8A 4BNYA 4WCFC 3K31A 3KSZO 2RAFA 2WTBA 4BNGA 3TWOA 3EZYA 4IDDA 5DBFA 4AJ4A 4F6CA 2HDHA 2R00A 3GGOA 3P2OA 3AK4A 3C7DB 2RHCA 5I7EA 1SEVA 3D4NA 3E6AA 3KEQA 4DIBA 1SOVA 2CMDA 3ASVA 4OH1A 3ZWYA 1VKNA 2OHXA 4YRBA 1VLLA 1PJQA 4A2CA 3IIEA 3LT0A 1IY8A 1Z74A 4UVHA 1WZEA 3ONDA 1MC4A 1DAOA 3OM9A 3DOJA 2GSDA 3U09A 1R4MB 1UXHA 3FHLA 2AQ8A 4I9UA 3BTSA 2VUUA 4MP3A 3RCBA 3ZWPA 3ZZNA 1NQOA 4EEZA 3F1KA 2D1YA 4BKUA 1NAHA 2JFGA 8LDHA 3PPIA 2BD0A 4CLRA 2C20A 2CVOA 2WM3A 1ZUD1 3VHRA 5ITWA 4RPGA 1FMCA 1Q2XA 5ADHA 4RF3A 1E92A 1HE2A 1B3BA 2CFCA 3H9JA 4YAJA 4LK3A 2IZZA 2GNAA 4Q3AA 3I9KA 2D4AA 3AM5A 5G0VA 4BO5A 3ZHYA 3BYZA 1G1AA 3IS3A 3JQDA 4MO2A 2EP5A 4BGEA 3U3XA 3IAHA 1YGYA 2G0TA 3E82A 5BR7A 3P19A 4XCVA 3N74A 2E4AA 3ZV6A 1K5HA 2HMSA 1VSUA 2IDZA 1U4OA 3GN2A 1QP8A 2CSUA 2I76A 4CLOA 1UUFA 4RZHA 3KEOA 4I1IA 5EL0A 4CM8A 1OFGA 1QR6A 4RDIA 4YACA 5DF1A 1N92A 1DSSG 3HHPA 4YRDA 5KJCA 2NVUA 4L4SA 4KMSA 4GMFA 5KKCA 5IDYA 1ONNA 1BVRA 3W6ZA 2DTDA 1E1LA 1BW9A 3C7AA 1UZNA 3NDRA 5U9CA 5BSHA 1MGOA 4J7XA 4BNVA 2RCYA 3E9MA 2GCGA 2O48X 4UREA 1B14A 2ZTLA 2X58A 4GX1A 4Y6PA 4TVOA 3MJEA 3RC7A 3X2EA 2HAEA 5I9MA 4CV3A 3U9LA 3F47A 5BSEA 5HRUA 4P8RA 2NU7A 5GZ1A 4R16A 2V65A 2C2YA 3OJFA 5HWSA 3BA1A 2Y1DA 3AUTA 3JSAA 1ZK3A 1FXSA 1LRKA 4MVJM 4CQLB 4CV1A 1QV6A 3K73O 1NWHA 3SLGA 5ENVA 3ZWOA 1PL6A 1R6DA 4B3HA 2EHDA 5EN4A 1HE5A 5HTOA 4B7XA 1WDLA 4W9NA 1ZBQA 1G6KA 5EQDA 4CLDA 1KEPA 1HDGO 1BMDA 4MPDA 3H3FA 4CM9D 1E1KA 5JXWA 5GMOA 1X14A 4Y8VA 2G82A 1V35A 3JQEA 1LSUA 4E5MA 1O0SA 3LF1A 1U1IA 1Y9EA 4J91A 3V1UA 5A1TA 2HJRA 1N1EA 2P9CA 1D3AA 1N5DA 2V6GA 4G5HA 2B5WA 2VNSA 4YAIA 3AFNA 4IGFA 2AHRA 1DC4A 3NJ4A 1ISIA 3PWKA 3T4XA 4E0BA 2RBEA 3PGJA 4F6LA 4M87A 4YJDA 5G0WA 3GT0A 4CR8A 3FPLA 2VYVD 1ADBA 1PJ2A 1U3VA 5EERA 1C1DA 4IQGA 2YV1A 3FR8A 4IGEA 2NWQA 1MX3A 1V8BA 4O1MA 3LT2A 4GWGA 3UKOA 4B3JA 1DFHA 3VH4A 2CNBA 2O3QA 2PKRA 1AGNA 1DPGA 4GLOA 1U5CA 4W6ZA 4BNZA 4KUEA 3DZBA 3PIDA 1ULUA 2X0NA 1DFIA 3ROPA 3JQ8A 1Z75A 3W4KA 5JE8A 5L4LA 3PFWO 3DMTC 4M54A 5LDGA 4BNLA 1E6WA 1V0JA 1W73A 3BIOA 3H3JA 5L3ZA 1M2WA 3GPDG 1N9GA 4BO9A 3GHHA 5TRTA 4BHTA 3M2TA 1EK5A 4BB6A 3ZI0A 3D5QA 2Y1GA 2NU9A 3OQ6A 5JPIA 1PZGA 4II3A 1BRMA 3PQDA 3PHLA 1GQYA 3ZDFA 4E2ZA 1XEAA 2X5JO 3LC7O 2NQTA 1ZSNA 3HN7A 3UF0A 3JQ6A 2JHFA 3BTUA 4NBUA 2IXBA 3OECA 2BRUA 2IZ0A 4B8ZA 4BQPA 1GTMA 1LC3A 1JU9A 4HBGA 3PGXA 4RF4A 4AICA 3KXDA 1XELA 2O4UX 4XYMA 2A35A 5BQFA 3HFGA 1ZEJA 4KWHA 5DZSA 4JX8A 1Y8RB 3DHNA 3GVCA 3DZGA 3PVZA 1LA2A 3GNSA 2O3RA 3OH8A 3RKUA 4XYEA 3WGQA 2PV7A 1BXZA 4DPKA 1NX6A 2GZ3A 4NFHA 1NVMB 2C0CA 1FDTA 1N7HA 1ZMOA 3GA0A 2HMTA 3L4SO 1YOVA 3ONFA 1C14A 3GEGA 1VC2A 3EUWA 2B83A 3VPXA 1R37A 1I8TA 3W1VA 5F21A 2EKLA 5LCXA 4HP8A 3VC7A 2WE7A 5F5NA 3GR6A 4EBFA 5IDXA 3JYLA 1Q7CA 3ICPA 3N7UA 3FF4A 2V6MA 3DZJA 4GWKA 1CJCA 1TT5B 3DR3A 4MVJF 1IHXA 3BAZA 4R51A 4R41A 4CMAA 4HADA 3KSDO 3AWDA 3FTPA 4OOFA 3A4VA 2C54A 5A9TA 2DUWA 3LLVA 3DBLB 2QRJA 1AE1A 4PLPA 5ES3A 2DPGA 1U8FO 3F5QA 2BLLA 3QWBA 4KZPA 4OKNA 1P1RA 2HLPA 4JJGA 4CQMD 5KVVA 3Q0EA 3ZNQA 3AI2A 3I9OA 2DKNA 3MEQA 4J7CA 4M86A 1UP6A 4FD3A 1R4MA 5AOVA 2DQ4A 1ADFA 1BWSA 1H9AA 3C1TA 3TZQA 1LRLA 1QSGA 1QLJA 4CM6A 3QJ5A 1H6AA 1GD1O 1K6JA 2EJVA 3I23A 5IZCC 3V2HA 3NAQA 2JCVA 4MVJH 4EEXA 2PWZA 3ZH2A 3DBRB 1U5AA 1B15A 5KCZA 1HYEA 1WMBA 4R5HA 4N7RA 4DMLA 3UFXA 1GEEA 2PA3A 4ZA2A 4E5KA 2PZLA 1A7AA 1T4BA 2NACA 1P44A 4FGWA 4AJ2A 3RC1A 2WMDA 3NGXA 1VJ0A 4IMPA 3GAZA 3U4HA 4FFMA 1Z7EA 3RWBA 5ER9A 3O8QB 1I2CA 4IDFA 4O0LA 5JO9A 4L0QA 5IXYA 4YVFA 5JDCA 4DQUA 2D8AA 4RF2A 1WPQA 1JVSA 4Q3CA 3FBGA 3HDYA 3IP3A 4IJWA 4F3YA 4F45A 1SC6A 4E33A 1T2DA 4XB1A 1I2BA 2FPIA 2YJZA 3EDMA 2DBZA 3GEMA 1NFRA 1A9ZA 1BDMA 2FSVA 4O6VA 4UUNA 3ZW9A 1YVEI 1ADCA 1B26A 1EBFA 4N18A 1ZVMA 4PGFA 1P0CA 1U2DA 1UH5A 4WECA 2PY6A 4Z9XA 3R3SA 1RPNA 2RH8A 3PFFA 1HZJA 5KIAA 2DFVA 2ZTUA 4A10A 2BFAA 4XDYA 5EQFA 3SJUA 3PHGA 1RWBA 2J5RA 4NIMA 5TT1A 2RH4A 2UDPA 4RVFA 4FBGA 4J4BA 5AXDA 2TMGA 4AL4A 2FR0A 4CQLA 3KYDB 4Z6KA 5JC1A 1DIAA 2JL1A 5JDIC 3Q9NA 5GZ6A 4ZRMA 1YJQA 4ND4A 5GZ3A 2OORA 4Q9NA 2OBNA 3Q3CA 1DIHA 3D0OA 4YXFA 2HO5A 5G4KB 5JCXA 4KTTE 4E6PA 3CH6A 4W4TA 3ZGYA 3OFSA 3I6QA 3NEPX 2AG5A 2X9NA 2E82A 1NFFA 2QQ5A 2O7QA 2AQKA 4KQXA 1JKIA 2AG8A 3WJ7A 3Q2IA 4QSMA 4DREA 4CMBA 5DCYA 4ZN6A 2FPPA 2ZYDA 1LDYA 4DPLA 5JY6A 3H9GA 3OBBA 4AJOA 3DC2A 1U3TA 2BMAA 4DBVO 2ZJ0A 3A06A 3JQAB 3ZV3A 4JBIA 4XGKA 4GL4A 1EVJA 1PGPA 1MFPA 4PG4A 4CLEA 3D64A 4G65A 2IYPA 1SZJG 1ID1A 1Z82A 1GQ2A 1WW8A 3GUYA 1U9JA 2E6UX 4JGBA 3UICA 1Y1PA 3GG9A 4CMEA 1A9YA 1HKUA 1GZ3A 2JFFA 5G0TA 1DEHA 2D59A 2CF5A 4XB2A 1HE3A 5CP8A 3VZRA 1Z6ZA 3O4RA 4BQRA 3P7MA 4J6FA 3ORFA 1NVTA 5AXAA 2H9IA 2O2SA 5K0ZA 2GGSA 3FNGA 3ROKA 4JNKA 2Z5LA 3OP4A 2FR1A 2Z1NA 4OKIA 4RQTA 4ZQFA 4AJHA 1Y8RA 4PG5A 4CR6A 1HRDA 3FNEA 4NJOA 1EDOA 3S8MA 4BO6A 3OF2A 1UP4A 1P3DA 2NNLD 4C4OA 3GN1A 4MP6A 3C7CB 1ZJZA 5ENDA 3BMCB 2PZKA 4OQZA 3DHEA 2DFDA 2VZ0A 2G76A 3I52A 1DHRA 2EGGA 3K6JA 5TX7A 2Q45A 2I9PA 2PLAA 2GYYA 4P38A 3IQDB 1U28A 1Y9AA 4NFYA 1SBYA 2YDYA 1F8GA 3ZU2A 2AEFA 5CDYA 2BF7A 4Y67A 4YYZA 3I9JA 2FZEA 2QRLA 3LQFA 4OQYA 2J6IA 1NAIA 5TJHA 2QYTA 3I4FA 4IZIA 4KDEA 1QMGA 3WGTA 3IP1A 1TT5A 4FJ1A 1YDWA 5A9RA 3ITDA 1JN0A 3UUWA 4XIYA 2QX7A 1AHHA 3FSRA 4LCJA 4PG6A 4YJHB 6LDHA 3NKLA 1LRJA 2YZ7A 1HYGA 2P4HX 2Q1SA 2WYVA 4CM5A 5HS4A 4R1TA 2BGMA 2GR9A 3JD0A 1YDEA 5B4VA 5G0SA 1O9BA 2XF8A 1OOEA 1EUDA 3DBLA 3GLQA 4OSPA 2VYNA 4CLHA 5ICSA 4WASA 4ZHSA 2Z95A 1E3EA 3TZHA 2POQX 1I01A 3EVNA 4DXHA 4MIEA 2G1UA 3TRIA 3PJEA 5A5FA 1NWCA 3JQ9C 3VKVA 4UEKA 4MVJE 2I5PO 4JP2A 3BMQB 5T64A 3GMSA 3WJAA 4XRGA 4BNIA 3LK7A 1Q1NA 3C3XA 1I24A 1DLJA 3ZV4A 2ZB3A 1M6HA 4IDCA 1LJ8A 1HXHA 1UP7A 2O50A 4INAA 3UH1A 1B8PA 2PD6A 1TI7A 3QY9A 4WK6A 2X6TA 3L9XA 1HWYA 3L6DA 1NR1A 4W7IA 2FPGA 3C1OA 5H81A 4RJTA 4EI2A 3I6IA 3CTVA 4MVJG 3DBRA 5L7YA 1NM5A 5JY1A 2JHGA 1E7WA 4RVSA 3AU9A 1PS0A 1YB5A 1E7MA 3PDJA 4HUJA 3VZPA 2Q2QA 4DGSA 2W2LA 2PGLA 1H6DA 1VL8A 1P1JA 2ZYGA 4UEOA 2J3IA 1OAAA 5TS3A 1QYWA 2HK9A 4DIOA 4WCFB 4U0KA 5IJZA 3O8QA 2VT3A 2EIHA 3AOEA 1YE3A 4E13A 2B69A 9LDBA 3C1AA 3EW7A 4PG8A 4PLFA 1JVBA 1E7QA 1W6UA 3INRA 1HDCA 4RQUA 3IDSA 2Q1TA 3AOGA 4FB5A 3LC1O 3UCEA 3PZRA 1EMDA 5HA5A 1O89A 2GF2A 2D5CA 1MC5A 4WNIA 4YT4A 3RKRA 3K96A 2ZJ1A 2GERA 1A27A 5L40A 1DIGA 4GKVA 2BFPA 1RM4A 3PHJA 2ZKLA 4FDAA 1P1FA 2Q99A 2J8ZA 3VZQA 5JMWA 2AA3A 4E5NA 2HKIA 1M76A 3L07A 1XU9A 3T7CA 2A94A 1LUAA 1SMKA 1WMAA 2UAGA 5T6BA 2PNFA 4PZCA 3KYDA 2WEKA 2EKQA 5G4LA 1H0KA 4HNGA 4YDRA 4FSHA 1VI2A 2GPTA 3LVFO 1N2SA 4L9RA 1MA0A 4HWKA 2R2GA 2X23A 4JQCA 5G4KA 1RM5A 3A1NA 5TQVA 3IJPA 3SXPA 1GYPA 2X0JA 4A0SA 1N7GA 1LQTA 3ZWNA 2OMEA 1EUZA 4E5PA 4DYDA 2ZTMA 1LC0A 4J1NA 5COAA 4L73A 4GMGA 4M89A 3TZCA 2NLOA 2JD0A 1KC3A 4W7HA 2Q1WA 3H65A 4JXKA 4YAKA 4LVCA 4E2WA 5T8KA 3PLNA 4XEHA 3GAFA 3WB9A 4KOAA 4NMHA 3C8MA 3ZWCA 2RHRA 4FGSA 3V2UA 1EDZA 1KS9A 1C0KA 1PS9A 2IXAA 2LDBA 3H5RA 3D3EA 2X9GA 3HB4X 3JQAA 5KTKA 1KETA 3DDNA 3QE3A 3HWRA 4GGPA 3F6YA 4L76A 2XAAA 3JV7A 2HMWA 1QYCA 5L9AA 4IM7A 1JWBB 1MG0A 4ILKA 2UV8A 4Z9FA 1J4AA 3D1LA 4XD2A 4BGVA 4D43A 4WE3A 1A5ZA 2X1HA 4S1VA 5G0UA 1E3WB 2OFPA 3PQEA 4E32A 1QXSA 3DZFA 1EVIA 1OC4A 4Y98A 2GLXA 1DC3A 4MKZA 2GRAA 5JCJA 4CJXA 1J6UA 3NGLA 4PLYA 1GU7A 3WYBA 3KETA 3STHA 1ARZA 4NG5A 3V1YA 3LU1A 3KRTA 4UUMA 3U62A 2X5OA 1OC2A 2BH9A 3P2YA 4H7PA 3AW9A 4BO0A 2E48A 3KZVA 4NBTA
chains in the Genus database with same CATH superfamily
5GWXA 3CZ9A 3C4JA 2YNMD 4Y1FA 1ZNYA 2O5RA 2RK6A 4Y6QA 2OL4A 1KAGA 4ZO4A 3W7AA 5JMOA 1N4DA 1L4KA 5ALYA 3R7DA 3OIFA 3H6HA 3IDQA 1P18A 2VA8A 2JEOA 3D2LA 4NNJA 1AN9A 3QF4B 1ZOOA 2XUHA 3ROXA 2BCEA 4HWRA 3ZU3A 1IY2A 1E4OA 2FEKA 4MCIA 5ECWA 3CRRA 4RXTA 5A4FS 3JATB 3EQ7A 4NABA 3TLKA 1QS0A 1ZA1A 4FC6A 4Q1FA 1U0NA 2WP8J 3EFHA 1KDZA 3U26A 2ZUSA 1REQB 2J3LA 1FTQA 3MRXA 1EP3B 3IRUA 4FLMA 4PZYA 4X8LA 5KOJA 1RQRA 2NADA 1ZCJA 3Q3GE 4C0SA 3UN1A 2A9QA 3QSGA 3QBDA 1JMVA 1VM6A 2JIDA 5CB0A 4PYRA 5C37A 2CXQA 1OWPA 2V54A 1SM4A 2CVFA 4KC0A 2K7ZA 4BQIA 3DOUA 2JAQA 2YMLA 3Q72A 2DBQA 4Y2PA 3AY3A 1RYZA 1IN4A 4QNMA 3TVTA 2XEDA 3S2EA 3TW8B 4JROA 3KFVA 3OF3A 1JHDA 2FW8A 4YJ2B 5AQ1A 3CNHA 3MQ2A 4PGAA 2PMEA 2C5SA 2VHYA 1JVNA 3MK31 1FQKA 4CDRA 4F4JA 4TZ0A 2QT9A 5EEHA 1O94A 1R0SA 1NJGA 1TJNA 3I05A 3IT0A 1L5WA 3KOYA 3ZKWB 2IEDA 2R7NA 1INLA 4BFYA 5KTMA 4ZC8A 1XZHA 2A5GA 3F3SA 1OWLA 3LWBA 3PUZA 5I45A 4WNCA 2P9TA 1D7OA 4IIXA 3WQHA 4NOKA 2PWBA 3A27A 2R85A 5I8ZA 2J4FA 4IHJB 1XU7A 3DMPA 3MS7A 4LYHA 3E9DA 4ESVA 2HK6A 2VBFA 4OMUA 3R9WA 4M36A 1VHQA 1JSCA 4YCAA 1C3JA 3KVVA 2BRUC 3L6OO 2JJMA 1P7ZA 4BKMA 3ZXYA 4JXJA 1C9NA 3X1DA 4DMCA 4KYIB 4CV0A 3QNMA 4LKOA 3DXFA 4BASA 2HWYA 4BFSA 2GEFA 5KNLA 1BZYA 3QJYA 4X45A 1OXMA 1AKYA 3RQSA 4GX5A 3CISA 3CN7A 4N03A 3KYIB 4GH5A 3CZPA 1JDZA 5DIZA 4Z3KA 3H5OA 1YF3A 1T5DX 3KT0A 1R0KA 3OQBA 4QU8A 1KEWA 4Q0MA 4C87A 1UQUA 1PJCA 2NAPA 2X8WA 2ZS7A 4R40A 4MVJI 2XVAA 2SKEA 4LJSA 4BO8A 4FKBA 1P17A 1EZZA 1RYDA 4K9KA 4MRPA 4MJ3A 2ZFUA 1DT3A 3MJ4A 4O2RA 5JOQA 1ZKDA 2I4TA 3BH7A 1NPYA 3FMGA 3CUSA 2AFHA 3FPBA 3L5OA 2HQBA 3M6MD 2K7FA 3NFRA 5LQSA 1Q16A 3VJKA 2X42A 4AG3A 1NJ5A 3OZCA 2J3EA 1J70A 2QMZA 3A4YA 1Z4MA 1SZPA 4MKIA 5KNDD 4FS3A 2W11A 3JTMA 1I4OA 2AK2A 1Z62A 5KVSA 4FNGA 3DXXA 5FPQA 3IAS6 1MABB 2QLLA 2ZP1A 1E3LA 1OAOA 2W2TA 3C85A 5CEFA 1MF7A 2HFKA 4RD4A 3AF5A 1M8PA 3EJ6A 3ORQA 4AKEA 4AJIA 5C8DA 2I1QA 3VR1A 4UM9D 1HNNA 4KQGA 4B3FX 5DGCA 2DRIA 2ZDGA 4EG5A 3AU8A 4CGYA 2Z3ZA 4I1PA 5LNK1 4FDMA 4Q9HA 4LF8B 1X7XA 1Z06A 4BNFA 5JV5A 4JP8A 3C3EA 3VR2A 3DYIA 1ZJ6A 1Z28A 5BNIA 2WWXA 1I80A 1HQKA 1BMQA 1JHYA 3RD5A 3MGAA 4QUAA 3S1LA 1MHPA 2FA9A 3R7AA 5C81A 1VKHA 3A32A 4GI5A 5BWMA 3HSSA 1ZITA 5DJ5A 3B6JA 1DX6A 1PJRA 2A30A 4BO3A 5KMGB 3OZEA 2FSIA 4G2NA 5K0CA 1TFUA 3GPIA 3KQQA 4V2IA 1T4CB 1ZL2A 3DAPA 4IX1A 4R2MA 4G5QA 4I50B 1NN0A 1PE0A 4UM8B 5AW0A 2R3SA 421PA 1RPZA 2MOKA 3LUAA 2TSYB 5E38A 5IFLA 1CUIA 3E03A 1RPTA 1D5WA 5KQPA 1JQBA 1P1BA 2BELA 3BE6A 4OL0A 1WBBA 1C0PA 1MPXA 4WK0B 3SQXA 3QFFA 2QROA 1EU1A 2PX0A 1FRZA 3KM0A 3GGPA 3DDOA 5K9ZA 4TV9A 3WL7A 1DX4A 4XQ0A 4DLRA 4BVHA 3JWJA 1C0IA 1CUAA 2N3ZA 3KUCA 5EEGA 2I55A 3H5AA 3O92A 1JT2A 2B9EA 4MIYA 2WINI 2YVKA 5ALMA 2PEYA 5HEKA 3EGOA 2CL0X 3QIVA 3O21A 3SWWA 4XX0B 2J33A 1OT3A 1DAHA 1HDZA 5EP4A 1F12A 4R5MA 1SNYA 3S2IA 2Y4NA 2AZMA 1N2BA 2DLNA 2K2WA 3EAQA 2GTIA 4OHPA 4U8GA 3WYEA 3U1VA 3ZZUA 4A5OA 4RX1A 2JLVA 1KY3A 1YO6A 1YB6A 3OQIA 2DZDA 2GHIA 2PJZA 3E1GA 3FPHA 3O4JA 4HHEA 4M60A 4QA9A 4HVCA 1ZVQA 3NRCA 2G63A 4B2YA 3EQ8A 1CY2A 1T1IA 5A5DA 2EXXA 2IPNA 3V34A 1NJ1A 1L8AA 2I3BA 1N2CA 2AN9A 3HFSA 5C53B 1BD4A 4JUFA 2I29A 1KEKA 1MKYA 1UR5A 2GRUA 1U94A 4RVUA 3SIXA 4CKZA 2A92A 3M6XA 4QXMA 1D09A 1PL0A 2XUPA 2PNJA 4IUDS 3BCSA 1H23A 3B9PA 5M2QA 3X1YA 1JX6A 3DO5A 2PT6A 2R1VB 4N54A 4B8WA 4R7TA 4Q4CA 3ICVA 3PUHA 1JIJA 1UJBA 3MM4A 3H4MA 2YFQA 3E22A 4KBGA 3JAKA 3VTFA 4UVIA 5JBNA 5IH3A 4Q4JB 4KQFA 3TR6A 3WRVA 3R0XA 1WQ4A 1ORTA 3T61A 1KO1A 4K28A 1NVGA 1WF3A 5B6IA 3DAFA 5BW5A 1OLSB 3IB6A 5KYWA 3QF4A 2D4HA 3H8WA 1H69A 1NNSA 1L5OA 4QVIA 4WFIA 3JATA 4R9VA 3FUWA 3AH8A 2NXWA 3HO1A 3FUVA 1SIUA 3I28A 2E1RA 2B4KA 1DJMA 3B7PA 3DJFA 4OU4A 5ANRB 4UEQA 3KQVA 3UMBA 3M0EA 2HXSA 4JI1B 2QM0A 4D9JA 5KQLA 1REQA 1NJFA 2EATA 2LVBA 4BQEA 2OO5C 1UMBB 4YQYA 4K6KA 1ZGBA 1WB4A 2GNOA 1WB6A 2P2GA 5TQ0B 4AJLA 4KN6A 3H17A 4LZZA 5FTKA 5J5VA 2FLWA 5KC9A 5ILGA 2BFCB 2VHTA 4RU1A 2H18A 3BKWA 3MLEA 3CF2A 4XGRA 3T9DA 2UYOA 1KFCB 1RJFA 2IXTA 5I8PA 5JWOA 1E1MA 1XLUA 1SHZA 3ME5A 4X7RA 2NVBA 3R09A 4DQDA 2GAOA 4P31A 3FTFA 4FIDA 1VRVA 3TW8A 4YJ2A 3SEFA 2WJGA 1D5CA 1SCUB 1TZKA 1Y6ZA 2EW8A 2REOA 4NBWA 3HP7A 3MTJA 2XCIA 2Q2NA 2WSIA 1OREA 2OGTA 3H2JA 4YRGA 4FQ8A 3UXMA 3ZKWA 3KV1A 3IEUA 4I9NA 4DV2B 4P6VF 5DLYA 5JTTA 4DNPA 2I66A 3ZD7A 3LYLA 2X6QA 4IX9A 3SIRA 3L8DA 3DBHB 4FFWA 3SK0A 3VJRA 4TROA 3HMQA 3D8HA 2JIPA 4LYEA 4N0MA 4ECEA 2OCYC 2OUKA 2CDAA 3BGIA 4NCIA 1T2AA 1GKIA 4MKFA 5HIIA 3RYIB 3LYUA 4J49A 4EGJA 3ZOKA 5KNBA 1BS2A 1P2GA 1R6XA 4IHJA 4ZVOA 3JQGB 2EFYA 4EW2A 2H2FA 2ZB4A 2BZGA 3L1KA 3OLWA 3SLRA 2EHJA 4BZWA 3UHFA 2DAPA 1OLUB 3L4BC 3IA7A 1FU7A 2BMDA 2JBWA 3MJSA 3V8VA 4RTQA 3SOPA 4F04A 2C8VA 3OQVA 1P0IA 4YB8A 5HRAA 5KSWB 1T9GR 2VH5R 3OLYA 4B6PA 3ZZTA 1IM2A 2ZBQA 2BL4A 3K72B 1QTNA 3E3LA 2KHZA 4MWBA 2DFPA 2PJRA 2UZ3A 2WPNA 2AOWA 4ZV4A 1Y9JA 2C83A 3NDJA 1F3OA 1N2XA 3RIHA 3LKDA 3DEJA 1FSZA 1YNOA 2E4UA 3B12A 3IPCA 3AEYA 5L7TA 5HM8A 1L4HA 3X2SA 1AB6A 1L7MA 3PFIA 3FNBA 4D98A 1ZX1A 4QLOA 1CF9A 3RU7A 6YASA 3DE6X 4GEGA 2UYYA 4P4LA 2X4GA 3VNQA 1KGDA 1GY8A 4CL2A 2CHFA 1Q1AA 3QG5A 1AK1A 1YL6A 1U7PA 5TNXA 2IF0A 2J5QA 4HRAA 4BMOB 4W82A 3UPUA 3NV9A 3PI7A 1EG7A 4C4ZA 4Y2TA 4NOLA 2I80A 3WMWA 5AM2A 4EQZA 1I3MA 1XAHA 4NMMA 5AHKA 3SJZA 3TNJA 1QUFA 3U7FB 1MV5A 1RXSA 1XOIA 3WRXA 3PVSA 3CIOA 2XGOA 2BGLA 3VDXA 3SBOA 4JJ8A 3ZTWA 3JRXA 4ERNA 5I4BA 3W34A 4Z9YA 3FBTA 4KR6A 4QDTA 4RIEA 1I2ZA 3VAZA 2IZ1A 1MABA 2QF7A 2VWGA 4J0JA 5AICA 1GYQA 3KCQA 2C94A 4FNMA 1E2KA 2NVWA 2CDRA 1I6KA 4LAFA 3R6GA 1WSAA 1DG9A 1HE8B 2PYDA 2X2OA 1MIOB 4K2AA 1IK4A 4PRLA 2CYAA 4AM8A 4GXRA 5CDFE 2JI7A 1R9MA 4PS0A 1B8VA 3LJKA 3C7KA 5ICFA 2JF0A 4F2HA 1N2EA 2NZJA 3KDAA 1U65A 3ZHRA 5KQRA 4PC3A 5IZCA 5J2TB 5EHZA 4IHQA 3ZGVA 2P5YA 4MLPA 1GCOA 5IKOA 1ZD8A 5TPWB 4E70A 1TIKA 3K9GA 4B7UA 3EVFA 4PVDA 3RUHA 2QRPA 1QKKA 1U0GA 5THKA 4Z49A 3DTTA 5HR5A 4LMPA 2FR8C 3QMMA 4U1RA 1U9ZA 2PX6A 4WOJA 3VPSA 3ICCA 4KJZA 5KMGA 1JEJA 1RRPA 2ATXA 4Q21A 1O6BA 2Z98A 1Q22A 1EX6A 5DTIA 1S8OA 1D1TA 1T4CA 5A5VA 2XDAA 1N5OX 4FYKA 4I50A 13PKA 2W4IA 4QOJA 1DHTA 5DM2A 5LC1A 1ZR2A 3VNUA 2C2GA 3K1TA 2JFZA 3OCJA 1RRMA 5ALUA 1XD2B 2W4MA 5AIAA 5A04A 5CR9A 1FS6A 1BEUB 3RVNA 1KH2A 3I62A 2OBLA 1UK9A 4YRSA 2IXDA 3W4JA 3SC6A 2PJUA 3AB8A 4HPJB 3BS4A 4MQ6A 5DGTA 2O8NA 1EWYA 4B46A 4RVGA 3VZCA 1GA1A 1L6RA 1CKEA 1XZIA 2CJYA 4BV8A 2AEMA 5IJAA 4F9TA 2QUZA 3OQOA 1WTAA 4KQMA 5JS1A 3II6X 4XX0A 4YLEA 1VIVA 3AESB 2FOIA 2IU3A 1BWQA 2GH1A 5B36A 1NHWA 1YS4A 2K5UA 4J1SA 3EWSA 3VVBA 2HHLA 1Z2AA 2OXIA 3W77A 3RYHB 2UYCA 2HD4A 3L8FA 3PQ7A 5KDOA 2BEUB 4NOJA 1FVXA 4OREX 3D4OA 3MCWA 4UCFA 5DT9A 2UYHA 4ZT7A 4LOJA 2O7SA 1BSVA 3S1AB 1LPOA 4WBNF 3ORHA 1PX2A 1KJ9A 4RDHA 4KIWA 821PA 4MOWA 2C2ZA 2ZJ6A 3N5KA 4H3VA 2XA9A 5CTAA 3TNLA 1XVTA 5AVYA 5J4HA 1W44A 1L5MA 1B3RA 3GDFA 5JDIA 3CF6R 3QKTA 1GRNA 3RBVA 5ABPA 4D8WA 1M6WA 2OSBA 1Z0ZA 1J5PA 3BGSA 1XDWA 3HV2A 2W6OA 2AR7A 4GX0A 4O4HB 1CNMA 2F2TA 2W6QA 1NYRA 2CZQA 3FUCA 1KBZA 2CXNA 2P11A 1TEXA 4JL6A 2JG3A 4EECA 3BFXA 1WHSB 4BO2A 1Z4PX 3N2EA 5HZGA 2EBHX 2R1VA 2FPOA 1DPFA 1YZLA 3GMTA 4JA2A 3CEAA 3BB1A 2Q9AA 4CLXA 4NZ9A 2YCLA 5KCMA 1AMOA 5LSAA 3ENKA 2HF8A 5KB3A 2ZRDA 4Q4JA 3L7LA 2ENUA 1PJLA 3ESAA 5AJXA 1XLVA 5ADWA 3E8XA 3ZDEA 5LQDA 1TKCA 3BE8A 1XZEA 2IYLD 1OLSA 1FA9A 1L3IA 2Z4TA 3EDOA 3I12A 4IUBS 4QUEA 4DNOA 1RHKA 2EZUA 2VUHB 3GK3A 5AKYA 3FGPA 1E1DA 3CF4A 3U4IA 1WUTA 5ER6A 1Y4AE 2XUJA 1YQEA 4K81B 4EA9A 2AEEA 1IUKA 1QR2A 3H9EO 4RD1A 1DELA 4RK6A 5BPHA 1Q14A 4DCVA 1I7DA 2ZIAA 3R8CA 3VSDA 2G09A 1AS3A 4HQFA 4I6GA 2Q5JA 5K05A 4MR7B 5EKTA 1NY6A 2N1MA 1UMBA 3N8DA 2QU8A 4V0LA 1CQWA 1K5PA 1MAVA 1MTZA 2AMLA 3I4LA 4XA8A 4AJ9A 5C80A 5TQ0A 1K3TA 3SC2B 1JBQA 3G5MA 3F74A 1GT6A 2Z2XA 2BFCA 3TZKA 3R9KA 4Q37A 1P0MA 3QUQA 3CNLA 3ETDA 2VBGA 1K98A 2V6FA 2ZI3A 3T3NA 4URFA 5KHAA 3R6TA 4TXJA 3SQNA 2I6TA 4C4TA 1I1QB 3QFHA 5D7BA 4TRRA 1V3QE 1D03A 1GVNB 2PS0A 4IIEA 4W5JA 4BNNA 4I2VA 2ZM6B 2QRGA 5FI5A 3LUBA 5JSZB 1SCUA 1THMA 1P80A 3Q5DA 2Q50A 3AYXB 2Q3EA 1NUPA 1U11A 3K9QO 4XJTA 4FXOA 3WE7A 2I2WA 2HJSA 3FMVA 1JFLA 3WGJA 1Z88A 3GP5A 3AZPA 2RGRA 1PN3A 1T24A 3C8UA 3DBHA 5C1IA 1WU7A 3OKAA 1TVKB 2XT9A 3ZJYA 4X6XA 2ADMA 3AM3A 2ODEA 4OFBA 1L5KA 1KYQA 2PX5A 3MBOA 3RYIA 2D0OB 4MPPA 2O8FB 4A6EA 1CJUC 5EMNA 4CPDA 5CMLA 1EXNA 1J21A 3JQGA 3KB6A 5P21A 4KAXA 3K70C 1WUJS 3E53A 1UL1X 4M0PA 4BC0A 3HXOA 4CM3A 4PY2A 5EZYA 5CW2A 4O1IA 3OA0A 1OLUA 5KU7A 1PZEA 3INTA 3PSAA 2NPFA 3RRXA 4J94A 4LDNA 4OMDA 4A7PA 2OZPA 3P9XA 4KZKA 1CZOA 2AG6A 2P6MA 3F9CA 1JLLB 4EPVA 2PO5A 1T4DA 3AUXA 2IH5A 2PT9A 2VRWA 2YN0A 3FDIA 3Q88A 1GL9B 1J9ZA 1MO5A 3BKXA 3G5TA 3TSYA 1LLQA 2ZUVA 3KLPX 3WVNA 4PFQA 1AZWA 3X44A 5CA1F 3HWWA 3NBAA 4EDFA 2NSHA 4RETA 3VH3A 3ULKA 4M2LA 4UTVA 1ZK0A 2ZRGA 2VIIA 1DX9A 2ZWVA 4LMBA 4OFZA 1YJXA 5ALHA 2J07A 2X5XA 1M34E 1TMYA 4ZYXA 2CXRA 4LZWA 2F8SA 1ZW1A 3TQSA 3UT5B 1B23P 3IELA 3SX0A 4IDQA 3RSSA 1UJMA 3Q0IA 1XCBA 5DTEA 1J24A 3UXEA 3VR5H 1TB4A 1E3IA 3MCUA 2WB4A 5AKZA 1DO2A 1YR6A 2A4KA 2BSAA 2VRBA 4NDZA 1AUXA 5F5LA 3LNTA 3VX4A 4DEYA 3DMGA 5C34B 4FOOA 4GPD1 1MHTA 2UKDA 1FLDA 1RTTA 1P39A 1Y7TA 3GF4A 3GCGA 2ZBEA 1QK3A 3O2NA 3PS9A 1XD9A 1YSCA 2IODA 2X2PA 3PNVA 1MRZA 2WJ4A 1EGQA 1TK2A 3AUKA 4TUYF 1CF4A 3KP1A 1GARA 2NUPB 2X1MA 4FFOA 5T64A 4ZVRA 3LNCA 1L5NA 3ZIAD 3JQ9A 4W5TA 2DM6A 1NZFA 2ZRLA 1R4ZA 2P1DA 2VDMB 3BGDA 3E3MA 4Y6LA 2WU3A 3GL9A 3TL6A 3V8MA 1MVLA 5B58C 1VI5A 2BFBB 3CRNA 3I01A 1PR9A 1HKHA 1V8DA 2GJ9A 2RD2A 1MIOA 2M1XA 2X7XA 1ISJA 4OA8A 3TNDA 1SURA 1UK8A 4H6VA 1Q1GA 4ZVKA 4NI5A 3RU9A 1OZFA 2IY7A 4R4JA 1RE1A 3A28A 1M6EX 2JJQA 1YONA 5J2TA 3NTOA 1FX1A 3O94A 3PYLA 3RSCA 3RSGA 5K6AA 5TPWA 1EWKA 4H1WA 1CIPA 4NJMB 3K70D 5C1DA 1ZA2A 1BGVA 3CW9A 3PUIA 4UUQA 1P75A 3IT1A 5JIBA 5IHXA 2WFMA 3OZAA 2HA4A 2WIAA 4IIHA 4W1SA 5BW8A 1KI3A 2Q9CA 3ABQB 3IQWA 4FMBB 2WWWA 4XYBA 3WNVA 1BKDR 2MJLA 4EKDA 1I13A 2YXEA 3WAGA 1DO0A 2AX3A 2V3CC 4ROSA 3HUUA 1KJ8A 4Q7JB 3RFCA 4F3KA 3WTCA 5HYVA 4C3OB 4P0QB 5A3JA 1KWKA 2NO9A 1K7XB 3WBFA 4YV0A 3K92A 2XLBA 2LE0A 1AH2A 4U8HA 3VBEA 2ZUDA 4GR5A 1KEEB 1QHFA 2IUYA 2GK6A 3OG9A 4LY6A 2O2CA 3DFZA 4MIKA 3FHJA 4OXYA 2ZREA 4U6QA 4EW3A 4YV2A 1EK1A 1NSYA 3NT2A 1SWWA 2NAFA 3E27A 1L7DA 3SSOA 3ENWA 3GX1A 4M37A 3W6NA 3G9QA 3R5KA 3A6EA 2QRKA 3AESA 1RBMA 3AB7A 3AY6A 4ZJYA 5BV1A 1EE9A 2XUOA 4YJGB 3UPDA 4KFUA 1GPYA 3RYHA 3VC2A 1SQ0A 1G8JA 3O5AA 5J4LA 1F7VA 1J97A 2F1JA 4AJEA 4HK4A 2BEUA 3O0DA 4C4RA 3Q6NA 4CU5A 3SAJA 1W88B 4J1QA 3S1AA 2YXNA 5K01A 2BH2A 3ZGZA 3KKKA 1P6UA 4GRIA 1ZOPA 4HEHA 4KL8S 3ZHQA 2RHLA 1ADJA 4NNOA 1C7QA 2BFDB 3GH3A 1U7OA 1O94D 3BMOB 1ZXBA 4J9VA 5JJLA 4A8TA 2GF9A 3GC6A 2A59A 1YZTA 4TYYA 3OD5A 5ENZA 3SIWA 5KI6A 2DR3A 1CJVC 3I04A 1W48A 3MT0A 3IKTA 4B3TB 4JZYA 2P9BA 1YJAA 2RJ3A 4RM2A 1QGDA 3QU4A 4GSYA 1LLCA 1ZQ9A 4O4HA 3Q7QA 3TTWA 1OYOA 3ELUA 4EIWA 4YQEA 1ZMBA 1XV5A 3U1TA 1IIRA 1PJSA 1ZM7A 1UM8A 1WHSA 4Q82A 2V6IA 5PNTA 4AWAA 4LJRA 4AZTA 3CNQS 1U7WA 2DPLA 3E18A 4L6CA 5FDFA 4N48A 2QLNA 1Z0DA 4D80A 2RKWA 2QM7A 2Q1UA 2XI4A 3CB2A 3W6UA 2WUFA 3VNRA 4CBVA 4F2GA 3A2KA 3EE6A 1PGJA 3LPNA 4KQWA 2M6SA 1JA9A 4RHEA 2GASA 1D6NA 1MH1A 4L08A 4OXXA 1CUFA 1LX7A 1MW9X 1U81A 2AUMA 2O1XA 2YUTA 3BRSA 2WQZA 1CLUA 3CM0A 3DWIA 4I7EA 3FNFA 4JP3A 1UC5B 4BMYA 1VKJA 4GVXA 4C6RA 1R8YA 1FJ2A 2PANA 1MRNA 1XCPA 2ZJ5A 1IJFA 5K4AA 3D5EA 2G67A 3HJRA 1PLJA 1XCLA 2X3UA 3IMGA 1T9KA 5FI3A 3TPCA 4BOYA 4CIBA 2OHIA 1CF2O 1IWPB 4MR7A 3HNPA 4JCOA 4TUYB 1E66A 4C08A 4M9UA 4HQKA 5JBIA 1I4LD 3WISA 3KAJA 3SC2A 5BY2A 4CU2A 1PFWA 2GO7A 1R5NA 4G5GA 5KBYA 2E5WA 4RSHA 2A33A 3W8RA 5BSUA 3V5NA 3DW3X 5GONF 3V9PA 1HGXA 3OSZA 5C35A 1GPKA 2ZJ4A 4ISBA 3U0VA 3KZKA 3I76A 4LY0A 4MW9A 1TPZA 4AF7A 2AYXA 3M3HA 1PZNA 3KEGA 5AKKA 1L7XA 3KOWA 1CRWG 1V5GA 3C14C 4RL6A 4EVSA 5JSZA 2FDCA 4JI0B 1P9NA 1PJAA 2B1IA 3QPCA 1EBUA 4JOSA 1PDWA 5JHHB 1Q7RA 1E1YA 4EZBA 3C3WA 1B8UA 1DTSA 1ORRA 1ZD3A 3EN0A 3MLAA 1TVKA 1T3ZA 4IIFA 3VR2D 2UUAB 5THQA 1YRAA 2A5JA 4F3CA 2O8FA 1DDGA 4RPIA 1R4NB 2MIIA 4K26A 3QM1A 2EEZA 4MA5A 1G21E 1G9XA 1IATA 1D2GA 3JVEA 3P0JA 2C77A 1QFMA 2BGNA 2WWRA 3KPYA 2VF5X 1T5IA 4G5XA 4I5FA 3MMPA 1T8PA 1Q20A 2YWGA 4LJ5A 4I1SA 7GPBA 4NH4A 5HZHA 2QAGB 4KXMA 2QTTA 2WKWA 2E55A 3DZKA 5IJ9B 1JLLA 2G9ZA 2C4HA 3QBVA 4I08A 4MYUA 5DISB 4AY5A 5LOVF 4RTJA 3RTDA 3TCKA 2MCFA 2XNDD 1QVAA 1OILA 2G9QA 3DFIA 3KLNA 1FRQA 1YMQA 3NORA 2ZAIA 3LY5A 4MQEB 2AI1A 5C5EA 5F64A 3TMYA 4FS8A 2OKGA 4F72A 1OQAA 2Q4OA 3DT6A 1CEXA 5JC8A 3LDAA 1SKMA 3C45A 2VT6A 3JZAA 4RLSA 3UT5A 5EJ8A 1FFEA 4MICA 4JBYA 3DCIA 3RTAA 3LHDA 1T34A 3OTGA 4UUPA 1GZ4A 3G2KA 2OK8A 4MS3B 4Q9IA 1TJYA 4UBIA 3V7YA 3DONA 5DRYA 3OBIA 4JQOA 5I9BA 5KKAA 4FFBB 1I5RA 1E3DA 3ZY6A 1ENYA 2LGJA 2RHOA 3EIUA 1HDRA 3PTZA 1V2GA 2HA3A 1GFSA 3CRW1 1ENOA 4ID9A 2FRDA 1JKJB 2W2XA 4TV8F 1K8ZB 4M6WB 4JUCA 3TR0A 4DYVA 2DR0A 2VDKB 3EVCA 3RUCA 3TXAA 3G13A 3H9CA 5H59A 3C0KA 3PDIB 2JEYA 2NUPA 1P1HA 3RAPR 3F90A 4DQXA 3QLVA 3EGCA 2I6GA 3F5FA 4X97A 5DNDA 4PTZA 3T41A 3A0RB 2VCHA 3OETA 2SBTA 2PAFA 1SBZA 1BU8A 1V6AA 3G82C 1OXBB 1QYXA 2VDOB 3GLVA 3KJHA 4H7IA 2BFBA 4BRWA 2QQGA 1AXRA 4XFDA 1Q0TA 4Q1VA 3SBDA 1WSDA 3D43A 1M72A 3E4DA 3VGJA 2HEIA 2CXXA 2W93A 5LQKA 2Y6VA 4IICA 4LNHA 2XD4A 1PU2A 3HUDA 1JEQB 1JTVA 1CJTC 1HG0A 1SBHA 1EI9A 2LKCA 4ITUA 1EP1B 2P8SA 2YMPA 2B9VA 3DF9A 3E0XA 3GRYA 3MRVA 4Y9SA 2R5NA 4NJMA 4QU0A 3PCTA 1EQUA 1OROA 4Z1MA 1WXHA 2IITA 3G0IA 1C7FA 3I5AA 2XMPA 4GXTA 4N1AA 1JQAA 1VBKA 4LRSB 5D5PA 4B3IA 4NEGA 3ZK8A 1I3NA 3FF1A 3NBFA 4RSGA 1LZLA 1MXFA 2JFPA 3NRJA 5LWHA 1H2HA 4MSUA 1P7PA 1N0HA 1GDDA 3IIJA 3ZH9B 3RIMA 3VJMA 2GNPA 2V7BA 3D3NA 1Z38A 5AUPB 1I0IA 1ZGHA 2P35A 3B3JA 5FCDA 2B4QA 4CFYA 3K1AB 5LIPA 5FPSA 1IJBA 3U4MA 3EMKA 1LV7A 3FETA 2GOYA 1FUEA 1GSAA 2HGZA 3MD0A 1KEEA 1O3YA 2FX3A 3NEJA 3WR5A 2GCEA 2AN3A 4R2JA 3RS8A 5AKXA 2RJOA 4Q00A 2N9UA 4R9RA 4DLUA 4CV2A 4V1CI 4HB3A 4RK7A 1CRZA 3DZHA 2CWWA 2XMCA 3AI1A 2FAXA 3TM5A 4OHMA 2F3UA 2TRSB 3HXKA 3AKYA 3ONWA 3ITKA 1M2GA 3QYAA 4MYDA 4EH1A 1H8HA 1XLWA 3QWFA 3I6BA 4P22A 4R2XA 4RACA 3L1HA 4YJGA 1QHSA 5CUQA 2UVDA 2HFJA 2C61A 3FR7A 2C0QA 2O07A 3NAMA 5FWAA 2FQWA 3W2HA 4BY9E 2IFTA 3WIOA 2R11A 1NXQA 1UFRA 1JFRA 2PCJA 1NF2A 2FN3A 2WLTA 2WIFA 3OU2A 4NKRA 3ZQ6A 3OUZA 4PZAA 1W88A 2BWJA 1ODCA 2AQHA 4KPGA 2P9QA 2QPTA 3TZBA 4DJ5X 1CR6A 3UANA 2BFDA 1MDBA 3KL2A 2IWHA 2C42A 4DQVA 4REOA 3BMOA 2AZTA 4YIHA 1D1SA 4ITVA 3GEIA 3LFUA 3GUUA 3H0KA 4R05A 5IARA 4B87A 1KAMA 2XVMA 5LP6F 1GV0A 3B6MA 4JP1A 1N2ZA 1UBEA 2AE1A 3I8XA 4X9XA 1VCMA 4NPHA 4CT0A 1CERA 1UWLA 5KJFA 4JBWA 1SG6A 2CDCA 2OYRA 2W8ZA 2AFVA 3FWNA 2JS7A 2Q2WA 2R1ZA 3BZWA 1KPHA 1QH8B 2ZQ5A 3IHWA 4PYOA 3TCNA 1QDLB 3GPLA 1NTRA 4C0AC 1P2TA 1PZHA 4YUVA 3GYBA 5DHQA 2PU5A 4GEKA 1CV2A 1FYXA 1RM0A 1RS0A 5AW3A 1JDBC 3F4BA 4JQYA 4BL5A 4A92A 1B2LA 1HQCA 1VCOA 4I6EA 4QFCA 4RHFA 3WLFA 4EVIA 5BMVB 1Z5GA 3GLRA 1RWKA 4Q48A 3GLIB 3BWVA 2IEBA 4XIIA 1RAFA 3DKKA 3W2TA 1THGA 2GCNA 4DSNA 4GXQA 1LBEA 7ADHA 3I01M 2XDQB 2SECE 2V1UA 1L7OA 3MF4A 1V1JA 3MFQA 1OXKB 1YRWA 4I3HA 5F9MA 3ROQA 5JAZA 3VPGA 4RKQA 1UJNA 3IHTA 4B71A 1NUHA 3MTGA 4OP3A 3CZQA 5MGNA 3Q9SA 2MSCB 4IWXA 5L45A 1RJWA 2V0CA 4U2GA 1R8SA 1L7AA 5AYVA 3FGNA 3G85A 5FNZA 5K0LA 5ADVA 2QTZA 4FYVA 1BXKA 1NVUQ 1V9LA 2R86A 2DOKA 3V1MA 3G17A 3VYWA 3ZCRA 3OM8A 1T13A 4IUYA 4N40A 3AF4A 4OHCA 3QWHA 2DQZA 1QG0A 2L42A 3HNOA 4B4DA 3RSQA 2BGIA 3CV3A 1RLJA 2I2BA 1J99A 3HC7A 4BLPA 5DGIA 4ZCPA 4RJIA 4CKBB 5IJWA 2VK2A 3QXHA 3T3GA 5HUJA 3Q41A 2QZ4A 4BB0A 3N8GA 3ZLUA 3QKUA 2R7MA 4XFJA 3V4ZA 5AT1A 2XECA 4K40A 4ZVLA 3VR3D 2J9GA 1KL7A 4BMXA 1ZG3A 1NDQA 4PN3A 3ESCA 4W8HA 5C8YB 1BA2A 4FIZA 3EBOA 4ZEOA 4ZI5A 3KQKA 1E3TA 4PIMA 3PFBA 5E9WA 5FO1A 2PKQP 1PT8A 2TMDA 3DE1X 4U7JA 4BVKA 3DFFA 2OVBA 4TYPA 2EWMA 3NS7A 1NUUA 2FXVA 2V1XA 4L6IA 2Q0XA 1X80B 3PC2A 3AUSA 2C2MA 4H27A 4NE7A 5F4BA 1R16A 1QO0A 3I2IA 4FYWA 1UJ4A 3L79A 4KGZA 4CR7A 1GILA 5DSTA 1DNPA 1R4NA 2D1SA 1MOZA 2NPIA 3WQBA 2YKGA 2Z6QA 2BE7A 3UK7A 2WVAA 3UT6A 3ELWA 4L22A 1EM6A 1PJ3A 1R18A 4TT8A 4ARZB 2VUSA 3HJGA 1E89A 2B0JA 4JT2A 3VU3A 4GGMX 4PXSA 4KKXB 1GPNA 2XQGA 3OPQA 2QAGA 1E7RA 3LDUA 3UJCA 2WZDA 1JR2A 3AJEA 5IJ9A 4JI2B 1I30A 3D0RA 3AR2A 2RIPA 3EAGA 1ONPA 4UFNA 2JGIA 4QBGB 2WG1A 4ZDIA 4Z86A 5SYNA 4MQEA 4PE5B 1BRTA 4H7KA 4UM5A 3I04M 3I45A 4RV5A 1ZH6A 2ZVDA 1RRVA 3G0DA 3WIEA 5F7OA 1AM4D 4OJNA 2PL3A 3JD2A 2DY0A 4MGKR 3IIMA 5GOTA 1US8B 2QUKA 1Q7GA 3G2MA 3PE4A 4A8HA 1H8ED 1LNZA 4AMGA 4D4JA 2O2EA 3ST7A 4JT8A 4KITB 5CH5A 4YAEA 1T29A 4MS3A 4MVJA 3SVLA 1EA5A 1T2FA 3N76A 2I0FA 4FFBA 3HYSA 3GXBA 4WMLA 5JS2A 1P5JA 2H1FA 2WUWE 3DTYA 3K0FB 3NPAA 3DOIA 2Q6OA 2Q27A 4YH1A 1G3QA 4LY9A 4M76B 1EGMB 4M7RA 1JKJA 2OHVA 5D00A 4D8TA 5CFNA 4M6WA 2Y77A 4N0PA 4M8SA 3P0HA 3DJYA 4OUKX 3ZVRA 4AMUA 1NQAO 2BKXA 2PH3A 2JFYA 3I9V1 3I39X 3PDIA 2BSXA 3FWYA 4HXYA 1MAAA 2DG2A 1DIOB 3L7KA 3A36A 4OLAA 3VUFA 4PO3X 3WIDA 1GUDA 4D8XA 2HRCA 2R6GA 2OZKA 3NG1A 3H2SA 1YH3A 2P9FA 2CLIB 4YRFA 2ANBA 4A0QA 3KD3A 1ESDA 2ZXEA 4DFDA 1T3HA 4MRVA 4DZRA 5KJ6A 3JRNA 3FFAA 4FUTA 3E70C 3H83A 1K97A 1JEQA 4LSGA 5I48A 1L7EA 3FVTA 4M9XA 3FUTA 4YR7A 2GN9A 1K2WA 2BKLA 1R4AA 3PE3A 1NLZA 2F9FA 4JKYA 3UT0A 2NO7A 4PZPA 3ZNPA 5J47A 3A26A 1G98A 3BX1A 4R3WA 1CETA 2YN2A 5EZSA 3W5DA 3V48A 1AUOA 3WA6A 1FFCA 1H5QA 1WXXA 3M2PA 4OGKA 3WLOA 4BMPB 1UF9A 1J2RA 1OBCA 2KE5A 2WOJA 3PTLA 1G3RA 3D7RA 3VNAA 3ZNOA 2QT1A 1R6BX 3S27A 4YROA 1B0AA 1GNTA 3U3MA 1PGNA 1XDZA 4YRCA 4KDFA 5FF9A 3OI7A 4HVTA 1VJGA 2RB4A 4Y9DA 1FUYB 2OXEA 5JZVA 3COJA 4IEIA 4GOMD 4PNPA 1LH0A 4UAVA 3K1AA 2P9EA 3IALA 5D2CA 1UJ5A 2PS9A 3RUIA 5DULA 3A6PC 3ANXA 3IERA 4ZCQA 4XD7A 3RTCA 3T7RA 3STUA 3GWGA 3R9XB 1E79D 2RDMA 5IK2A 4O59O 3W8FA 5JCZA 4NCKA 4MV0A 3WLEA 2R1UA 4YAGA 1GUZA 3OZVA 4ARBA 5AM0A 1RQPA 5IC4A 1W36B 3FLBA 4DKXA 4J2TA 1N0UA 4C0QC 3A3YA 3FNHA 1WSWA 4UNRA 2P9GA 3B78A 1RP1A 3M4NA 4WY8A 2O7VA 2UYQA 4Q3OA 1F8YA 2QNRA 4CM8B 4CTNA 2B1QA 3NCTA 1TAGA 2H9AA 4ZDJA 4BS9A 3Q2KA 4DARA 4QDZA 1RXYA 2HOQA 1TM5E 3EXAA 4N0QA 5DFAA 4JI5B 2NVUB 4AO8A 4BVAA 1USGA 1VA5A 1ECJA 2OYSA 2X2FA 4QBHA 4B6RA 1KVUA 1V1MB 3NAZA 4AG6A 1IBMB 1EFAA 2O19A 5COBA 3BA6A 3BTOA 1XXHE 2EP7A 3GVPA 2NTNA 4BB5A 2B2CA 3SHOA 5KWVA 2JFQA 1Z6YA 2NTEA 3F67A 4FLFA 5E4TA 4RJJA 1B16A 4PO1A 3JALB 3B1ZA 3GT4A 2R8BA 3IUSA 3W90A 3LBFA 5I7RA 5FADA 4BFUA 1XKTA 3OF5A 4JB2A 4O4JB 2OA0A 5HVNA 1ZHOA 1I2DA 4EMTA 4ACAA 4HH4A 1KI4A 3AEUB 2E7ZA 4ALJA 1LFAA 5K6AC 1TL7C 1QH8A 4DQLA 3ASUA 3M1IA 5IVDA 4J2OA 2YJ3A 1JBKA 4LE0A 1YJBA 2YIVX 1F2VA 1I10A 5DYWA 1N6IA 5KDDA 3DKVA 1E60A 3ODPA 1FNBA 3ML1A 4K03A 1Z36A 2INGX 2ZRNA 4EL0A 1X1BA 1FDOA 5BMVA 4ZVVA 3GMDA 1P9RA 3QPAA 3WGZA 4HAZA 1QLHA 2X5KO 5HBGA 1FUKA 2JB9A 2ECFA 2VSOA 2XUKA 4P33A 5ECGC 4D3FA 1PI3A 4RY9A 4FYXA 1XEXB 2XDQA 4HDMB 4OQEA 3ISVA 1PQ4A 4KO4S 3ILYA 4OL9A 4CT4B 5LQJA 1COWA 2WF5A 1KZ6A 1Q7EA 4WBXC 2HU7A 1FDIA 1Z07A 3L0PA 5JEEA 1RWPA 4CRWB 1GKLA 3AR8A 5KVAA 1ULBA 3MOSA 3PZBA 2EERA 2HJHA 2WKQA 2VK4A 3LY8A 3N0XA 3I1IA 3Q85A 3URKA 4AC9A 3TI7A 3KR1A 4E30A 3W9YA 5CITA 2MINB 4MQBA 4OX9B 2HIMA 3B8HA 3X1MA 4B3RB 1WMEA 4HGYA 1F0KA 3CUEF 1B42A 1WUYA 3DXZA 2QXUA 1Z0AA 3F8SA 3IUMA 4YC7A 3RJTA 2XZLA 3F1LA 4N9QA 5U1PA 2GZRA 3NBMA 4CKBA 2AW5A 5DSXA 3QI2A 4KE7A 5B7PA 4MUMA 1W0KD 4OU5A 4AQ7A 1O95A 4RJKA 1KAOA 4PFSA 4LYGA 1E3JA 1RIIA 2D0DA 4H6XA 5JJ5A 4ZQEA 1V5EA 1ZNZA 3WMXA 4BN5A 5KAMA 2Y68A 4C01A 4B4VA 1NI5A 4DHWA 5JAUA 2WUVA 3J7AC 1R0LA 4KPFC 1UBJS 3OKFA 4PZLA 1ZNWA 2R68A 4MYHA 1OX4B 5C8YA 1FW6A 4RK5A 1O5TA 3CKMA 4F2DA 1N9GB 3M5DA 4HGRA 2GHRA