3QSGA

Crystal structure of nad-binding phosphogluconate dehydrogenase-like protein from alicyclobacillus acidocaldarius
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
285
structure length
285
Chain Sequence
b'MKLGFIGFGEAASAIASGLRQAGAIDMAAYDAASAESWRPRAEELGVSCKASVAEVAGECDVIFSLVTAQAALEVAQQAGPHLCEGALYADFTSCSPAVKRAIGDVISRHRPSAQYAAVAVMSAVKPHGHRVPLVVDGDGARRFQAAFTLYGCRIEVLDGEVGGAALLKMCRSAVLKGLEALFLEALAAAEKMGLADRVLASLDASFPEHHLRDLALYLVERNLEHADRRAHELGEVAATLCSVGVEPLVAEAGYRRLTRVAQVRAALKQRPGDVRAWLRSLANA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NAD-binding phosphogluconate dehydrogenase-like protein
publication title Crystal structure of NAD-binding phosphogluconate dehydrogenase-like protein from Alicyclobacillus acidocaldarius
rcsb
source organism Alicyclobacillus acidocaldarius subsp. acidocaldarius
molecule tags Structural genomics, unknown function
total genus 108
structure length 285
sequence length 285
ec nomenclature
pdb deposition date 2011-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03807 F420_oxidored NADP oxidoreductase coenzyme F420-dependent
A PF09130 DUF1932 Domain of unknown function (DUF1932)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 3qsgA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3qsgA01
2V7PA 4GI2A 5AVOA 1SAYA 2ZTUA 4LRSB 3GVCA 1ZZEA 4K6CA 2J5QA 4GGOA 2LDXA 5A9SA 4RDIA 4AICA 1P0FA 1BTOA 1DEHA 3DHYA 1BXGA 1Q0LA 2JD0A 3EVTA 5BNIA 4PN3A 1I2ZA 3OECA 1UXGA 3O26A 3G0OA 9LDBA 3OIGA 3ONDA 2X0RA 4Q3EA 3UGKA 1QLHA 4E31A 2GASA 3VPFA 2BI7A 1GEEA 4AJOA 1E92A 3OM9A 4OYRA 2ZYAA 3KO8A 3E9MA 1Z7EA 5JFOA 4CODB 4IGFA 4KP7A 2O3TA 2X9NA 3WSVA 4DTIA 4TKLA 2A94A 3ZI0A 4MPDA 1XGKA 1UZNA 4DGSA 5KIAA 3VPXA 1GL3A 1HXHA 2V6GA 1V35A 3AUAA 3D64A 3WGOA 3DDNA 3GZNB 1UXHA 1DIAA 3T7CA 3F6YA 3LT4A 2IXAA 3H8VA 5CDYA 4ALIA 3AY7A 3U4IA 1EE2A 3GPIA 3K96A 3ZU3A 1E1NA 1H2HA 1CETA 1BWSA 3EZYA 4LVUA 3DZFA 3WIEA 3BXXA 3WGIA 1A9YA 4NU6A 3VH2A 2X22A 1KYQA 1HYHA 1E7QA 1QRRA 4ZA2A 3ZDFA 4Z0PA 4BS9A 5JBIA 8LDHA 3JD1A 2DBZA 1U5CA 1XR3A 3RD5A 3V2HA 2P5UA 3NGLA 3KRTA 2B69A 4XB1A 3PQEA 5G2OA 5HBRA 4CMJA 1SZJG 4I1IA 1C0KA 4WEQA 4ALJA 4KTTE 4MVJF 5TC4A 4GBJA 1TA4A 1DIRA 2YQ5A 3AFNA 5HS4A 1NNUA 1PZFA 4CQMB 1F06A 4CM4A 3NX4A 1JKIA 3SLKA 2B35A 2UDPA 3PGJA 5I8ZA 3H9GA 5T6BA 1T26A 1HLDA 2HCTA 2DUUA 3LF2A 1HTBA 1Y5RA 1LTHR 3BTUA 3H5RA 3MCVA 1JA9A 3QWIA 3FWZA 1LDGA 3GAZA 4Z0TA 4GKBA 4R41A 4BNYA 3ZNOA 1I2CA 1I5RA 4DQVA 5A03A 1EDZA 2GRAA 3H3JA 2VOEA 3ZGYA 1X13A 2W2KB 3DEYX 4J9VA 3SJ7A 4E6PA 4RL6A 3HDJA 4D42A 1GADO 1I32A 4R1TA 1YOVA 1BHSA 4NU5A 2AQ8A 3EK2A 4ALNA 1UZLA 2EJVA 3FN4A 1E5LA 3BMOB 1Z75A 2ZTVA 3MJEA 4GVLA 4FFOA 3WGHA 1N1GA 1QSGA 1V6AA 3ZWAA 3L6OO 3WS7A 1RM5A 3D4NA 3JD0A 3OIDA 3DB2A 3ROQA 5DP1A 3GHHA 3ZWNA 1KERA 1N7HA 3DZHA 5H83A 2BGKA 3GDOA 1PR3A 1Q7GA 4L73A 2RHCA 4CM7A 3KLMX 1I3MA 4PLVA 5EPOA 2NM0A 5DBGA 4CV1A 1Y81A 1Y5MA 2PY6A 4J7UA 1E3WB 3A14A 1E0DA 5JMPA 3I83A 2PV7A 2Z1MA 3H9EO 3WOHA 4DL9A 3LYLA 3JQAA 4RPJA 4D7AA 3WG9A 5IF3A 1M6HA 1MX3A 1MA0A 1T2EA 4IDBA 4ZQHA 4ITUA 1LC0A 4GX5A 1PR9A 2CDAA 2NVUB 2HJSA 2QG4A 3B20A 2YZ7A 4CQLA 1KVTA 4CV3A 1JN0A 3MTGA 1MC4A 3U09A 1SOVA 3INTA 5C7LO 1DC5A 2VYND 1J6UA 3JV7A 4DXHA 3LF1A 4XWYA 4CLOB 3RFVA 1EVYA 3QSGA 2XPCA 1GR0A 1KEUA 4YJDA 4OO3A 5CEFA 1KC1A 3D5QA 4EUFA 1YWGO 2BI8A 3EY4A 3JSAA 4QXMA 3NEPX 4PLZA 4UREA 3HFSA 2YHIA 5I7VA 1XCBA 3H2SA 5JLAA 1BXKA 2QRJA 4LMPA 2H6EA 3AI2A 1NYTA 2E4AA 3N7UA 1MG0A 2G76A 4LRTB 3JYLA 1TLTA 3VHRA 2JCXA 4II3A 3KBOA 3ZW9A 5JW6A 1UH5A 1EBUA 3WB9A 2C54A 1Y9AA 4BNWA 3M1AA 4WE3A 2Z1NA 3CZRA 4IJUA 3DZKA 4E5MA 3WIDA 3DMTA 3NYWA 1EEHA 4MKZA 4UVGA 1PJ2A 4II2A 2WE8A 2EW8A 4R9RA 4BB5A 5JO0A 2BRUA 1YL5A 2HMVA 2O3JA 3GZNA 5JDCA 3WWZA 3U4CA 5F5NA 3I4FA 4QT0A 1M67A 3ETDA 3FTPA 3GEMA 1BSVA 3PWZA 3VTFA 2VT2A 2JFGA 3LLSA 3W1VA 3ZNPA 1E7RA 3RKRA 3D1LA 1AE1A 3E48A 3TRIA 1DDOA 1JW9B 3PVZA 4B4WA 1XSEA 4U7WA 4HNGA 1OC4A 2AE1A 3M2TA 3OA2A 1QYVA 5JDIA 1QV7A 3N58A 4FDAA 5DCUA 3VH4A 4CR6A 1FXSA 2FSVA 3D3WB 4W82A 1WLYA 4YRAA 1PJCA 3E5MA 4I9NA 5CPFA 5F1OA 1JWAB 1KEPA 4XIYA 5EINA 1UP4A 4D0RA 3JYNA 4PLGA 1X7DA 4KWHA 2I3AA 2Y99A 4E2WA 2TMDA 3IDSA 3MJTA 5ER6A 3QVWA 4CQMA 5IZCC 5L7WA 4CMIA 4P22A 2VNSA 4RF2A 4FD3A 4TQGA 1PX0A 2ZQYA 2CVZA 3NJ8A 3RFTA 2H1SA 4ZVVA 3OF2A 1PSDA 4HY3A 1K6IA 3L4SO 3OQBA 1HDXA 4AJLA 3KETA 1FDTA 2ZTMA 4JIGA 1YL7A 2QYSA 4GH5A 4YJHB 4PLCA 3LC2O 3LT1A 3OHSX 3AM4A 2VYVA 3K5PA 5JYEA 2DLDA 5F3RA 4DMLA 4G65A 4HV4A 3PIIA 2W2KA 3Q1LA 4A26A 1PQUA 2EP5A 4MO2A 2XAAA 3NV9A 2P9CA 3TN7A 5FI5A 4WNIA 3GUYA 5I9NA 4J1TA 4AJ1A 4NHEA 4OQZA 4YWJA 1EE9A 4H16A 1HEUA 4E2ZA 5BQFA 2C5EA 4BNGA 1ZSNA 2Y1CA 5L7TA 2VWGA 2JAPA 4MVJA 2J3KA 4BMNA 3WGGA 3L0DA 1TT7A 5A04A 3AW9A 3RKUA 3QP9A 4JCOA 1DXYA 5GY7A 1UP6A 4H3VA 4EJMA 1A4UA 4BNKA 3PZRA 1IE3A 1XU7A 4KOAA 4NBWA 5BT9A 7MDHA 2HMTA 3Q11A 3RI3A 5JXWA 4R1UA 2J6IA 3DTYA 1NWCA 5F1KA 2J5KA 1IY8A 2AE2A 1RJWA 5I9LA 3DOOA 4Y67A 2HMSA 4XGIA 1B7GO 3VDQA 3F47A 3HWRA 3RASA 1B8UA 4PIVA 2NTNA 4J4BA 3OP4A 4CV0A 2X5KO 3R6DA 4QECA 1S7CA 3GVPA 3SXPA 2I3GA 3KSUA 4M8SA 2Y93A 1YGYA 3FPLA 1ISMA 1RKXA 2ZB7A 3U62A 5JCJA 2OORA 4PLHA 4U6QA 2NU9A 2CMDA 4MVJE 1B3BA 1PU2A 4Z9FA 4U6SA 4TSKA 4RVUA 4H15A 4J4TA 2DT5A 1ZCJA 2EW2A 4OJNA 2VQ3A 1K6JA 3WGQA 3ETEA 3RAJA 1GV1A 2W8ZA 1O8CA 3E18A 4J7CA 1OC2A 4P38A 4AJKA 1BMDA 4L4XA 4DPKA 3E03A 4MP8A 3KSDO 4XDZA 3K8ZA 3DMYA 3GG9A 1CJCA 4Z9YA 2DU8A 3S2EA 3B1KA 3QRWA 2OGUA 3RROA 1LLCA 3ORFA 4WKGA 4E33A 4IUYA 4GPD1 2AA3A 2Y68A 5H82A 4RVDA 3OA0A 4RLSA 4JX8A 1WMBA 3A4VA 4EJ6A 3JQ8A 1SC6A 4I8XA 1E1LA 2I5PO 1AXEA 1LSOA 1R6DA 4RF4A 3PGXA 5A05A 2NNLD 5KKCA 5B4VA 1NWHA 5A06A 5IXSA 3CINA 2PZKA 1E1KA 3JD2A 5MGBA 4RQUA 5JC1A 1PJ4A 1E6WA 1MUUA 3BTVA 3QIVA 2D4AA 2E37A 1GZ6A 1YE3A 2VZ8A 1JAXA 4RF3A 3I9OA 1PL6A 5JCXA 1HDGO 3F9IA 3WYCA 3DBLA 3P2YA 3VVBA 1NASA 1Y9EA 1TT5A 2FPGA 3ON5A 2D5AA 4N54A 4EZBA 5KKAA 4TVOA 3VKUA 3DL2A 2FRDA 4I9UA 3DZJA 4NBVA 4BNHA 5KVVA 2UUPA 1Q1NA 2X9VA 3SX2A 3GNQA 2FPPA 2ZB3A 2VWPA 4D3SA 4F3YA 2B4TO 2QIOA 1XYGA 4YDRA 4GX2A 1NVMB 1WZEA 2JCVA 1BXGB 3Q2IA 3C7CB 4PLTA 3E9QA 3SJUA 5K9ZA 3QWFA 3DXFA 4YJFA 3TZHA 2X58A 2GDZA 3GNTA 4WGGA 4BGVA 3GMSA 1W73A 5IAAA 4FFNA 4RJTA 4H7PA 1J0XO 3COSA 3DO5A 3ZHBA 3ZHXA 1OAAA 3UAGA 4UVDA 3WQRA 5CDUA 2R2GA 4D3DA 2X6TA 4EITA 4ND1A 3PIDA 4CM3A 4IGEA 3AFMA 4HFNA 5A02A 3JQDA 3DBHA 4WOKA 2NACA 4J16A 3OEYA 4YJHA 3B1JA 1YB1A 3OMLA 4PLWA 1N92A 5JAMA 1GQYA 1R12A 3DHNA 3GVHA 5BSGA 4CMAA 3I9LA 1MXFA 1UAYA 1R37A 2Q49A 3PRJA 3EZLA 4A10A 1P3DA 1XELA 1Y8QA 2PWZA 3W6UA 4YT5A 4Y8VA 3HB4X 4WUVA 4XA8A 2DTDA 2VTEA 5GZ6A 4E30A 4CMHA 2CF5A 3LK7A 1AHIA 4PG5A 3TL3A 4YAGA 2FY8A 2BF7A 1DHRA 3GDGA 3JQEA 5F1PA 3BMCA 3H5NA 1E3EA 3UH1A 1D8AA 2Q4EA 4YQYA 3AY6A 1C1DA 3RC7A 3P7MA 4BNNA 4IZHA 1F14A 1GQ2A 2BD0A 4XZ3A 4IPTA 3BTSA 4CM4B 2DAPA 5DULA 2AEFA 4GL4A 3NAQA 1N9GA 5AXAA 3B70A 3Q2KA 4PG7A 2D5CA 2UVDA 2VRCD 4HUJA 1WP4A 2Q1TA 3OETA 3T4EA 1DRVA 1KY4A 1VC2A 1DOHA 5DOZA 2B83A 4PCVA 4DIBA 3PFFA 3TZCA 3H9UA 2JL1A 3ZHYA 4FC7A 4IXWA 1P1RA 2I67A 3IMFA 1DIHA 2EV9A 3ASVA 1MV8A 4E5PA 3RQSA 4RLHA 4MDHA 3JD3A 2C2YA 1XLTA 2VHXA 4Z9XA 4ID9A 3NKLA 3IAHA 4YRDA 3C85A 1NQAO 4YB8A 2EEZA 3JTMA 5DBFA 1MP0A 1YOVB 2GERA 3HG7A 1B16A 1H6CA 4ZHSA 5BSEA 5ADHA 1PGOA 3FR7A 1PEDA 1GCUA 4R9SA 5TGDA 4GMFA 5I8WA 2XXJA 5DF1A 5BNTA 2HK9A 5ER9A 4CR7A 1ZXBA 4EI2A 2SCUA 3AK4A 5B4UA 1HDYA 2WYWA 4R1NA 3OJ0A 3GT0A 4J3FA 4XQ9A 4XJSA 4UEKA 4ZICA 5FWNA 3DTTA 3NDJA 5CHEA 4BNVA 4CLRB 2X0JA 4MINA 1QYWA 5FEUA 3MJSA 3W6ZA 1GD1O 4EYEA 1NP3A 4IIVA 3TPCA 3DOCA 4RPKA 1HZJA 3F1LA 1P1HA 4D41A 2EKLA 2X86A 4YPOA 4ALMA 1UP7A 4BO8A 1MFPA 2YDYA 1KOLA 2JCYA 4KMSA 2PGDA 2CY0A 1UUFA 5COQA 3WNQA 3M6IA 4JJFA 3NDRA 4ZN6A 2BGLA 2FZWA 1PGPA 2ZJ1A 3NT4A 4DA9A 1F12A 4CQLB 3NT5A 4P4LA 3WBFA 3QWAA 3RUAA 2DBQA 1QP8A 1SB8A 4YTEA 4ND4A 2YV1A 4HXYA 5A9TA 2EG9A 2X5JO 3DMTC 1NPTO 4G5HA 1V8BA 3KUXA 1KIFA 2O3QA 4HFRA 2P91A 2BFAA 2FN7A 4B7XA 3B1FA 1E6EA 4KDFA 1FF9A 2PTGA 1RPNA 2X0IA 2YHIB 5IJZA 3WICA 5JDCC 2C7GA 4XYEA 3TL2A 4E13A 1LDYA 1YBVA 2NVWA 4J2OA 3BHJA 5FF9A 2XOXA 3L9WA 1DIGA 1I36A 4PG4A 1T2DA 3IJRA 1VI2A 2VNAA 5THQA 3MZ0A 3EDMA 1KS9A 2WWRA 5JDIC 2P9GA 3BZUA 1I3NA 2RBEA 2NSDA 2Y1GA 5L4LA 2BFPA 4BV9A 1VJ0A 1E3LA 2O50A 4NH4A 1I0ZA 4EGFA 1E5QA 3PJDA 4OOFA 4GMGA 3S2GA 1BG6A 3R1IA 1N8KA 2OP1A 3GN2A 4BL5A 1OZAA 2HUNA 1M6WA 3ZU5A 4IS3A 2H5LA 3H2ZA 2ZATA 3PQFA 3O38A 1KVSA 4OMUA 4BQRA 2FHSA 2RIRA 1DC3A 1HZZA 4MKXA 2NV6A 2IE0A 3FSRA 1DO8A 1FDSA 3I9NA 1QMGA 2PGLA 4FW8A 3V1UA 1O0SA 5JAZA 5IN5A 3GR6A 4CM6A 3WGYA 3V1YA 4CUZA 3RU7A 4MVJG 4NPCA 2PZMA 1ZBQA 3K6JA 4YVFA 2Q2QA 3I6IA 3PYLA 1FMCA 4BO2A 1LX6A 4CLDA 3AUSA 4BNIA 1V0JA 3GOHA 4Y6PA 3GGGA 4YT8A 1QKIA 1VL0A 1E7SA 4ROSA 2VYNA 3P19A 3I6QA 1BDMA 2GR9A 1QYCA 2GN6A 5CDGA 4HFMA 5T57A 4JP2A 3AY3A 3H5AA 1UXIA 1KC3A 2YUTA 3PHLA 1U3WA 3ZNQA 1MLDA 3GPDG 1HYGA 2C82A 4OSPA 2O4CA 2FR8A 2HQ1A 4QFCA 4PRKA 1ENOA 5JYDA 3LT2A 4CMIB 2FOIA 1X15A 4MP3A 3DOJA 4B7CA 5ENDA 1DRUA 1ZO8A 2B0JA 1QV6A 1I3LA 3O9ZA 1ZIDA 3KEOA 4Y98A 4NFHA 5IG2A 1E3JA 3QQPA 1HL3A 2YHUA 1EK5A 5DP2A 4NZ9A 4WLOA 1KEWA 1XQ6A 4JJGA 4FJ0A 4C4OA 2HDHA 4ND3A 4ZQBA 1HETA 3I9KA 1H5QA 4OSOA 1U7TA 4W99A 2HRZA 1YXMA 5AXCA 3ROPA 1U4SA 1PJLA 3RUIA 5MDHA 4BB6A 3RUFA 4DC1A 5F5LA 1E7WA 2Y0DA 4Y9DA 4GLLA 4WLVA 5HM8A 1PJQA 4XQEA 2ZCUA 5GZ1A 2C7VA 2YQ4A 1ZEMA 3QE3A 1YQXA 1PJ3A 4M49A 1E1MA 3AJRA 2A4KA 3ICPA 3FRJA 1N7GA 1PQWA 2O3SA 1Q7BA 1MXHA 4XJTA 3RFXA 2JAHA 3FNHA 6LDHA 4IDAA 1DFIA 5IFLA 3GFGA 1IZ9A 4BV8A 4YAIA 5TX7A 5A5FA 4PZCA 4IDGA 4CLRA 3BIOA 1X7HA 2HKIA 4PLYA 3GZ4A 4R51A 3IQDB 1UDBA 3PLRA 3FNGA 1ULUA 1EVZA 3OJFA 2CDCA 3TOXA 5IDQA 4G81A 3EC7A 4BMVA 1D1SA 1P1IA 2OO5A 5LC1A 4BO3A 1GYPA 3OIFA 5KJEA 4LK3A 1FDWA 1NFFA 2PH5A 3I23A 3ZZNA 3U5TA 4E5KA 2V6FA 4XDYA 1ID1A 3CTVA 1RM4A 2PD6A 3VTZA 3EW7A 2I9PA 3ZU4A 4XYGA 1NHWA 4OIMA 4Q39A 3VPSA 3PHGA 4XYMA 4LGVA 3BTOA 2VHZA 2PLAA 2FZEA 3TOZA 3IC5A 2FSSA 4WLEA 4XYBA 1VL8A 2DBVO 2VOJA 5KJ6A 3ZN2A 1XHLA 5DOVA 2P5YA 3INGA 3VZRA 1NR1A 1WXDA 1WZIA 3DAPA 4J43A 4GLOA 4TVBA 3KEQA 4JBGA 2D59A 2PH3A 2YJZA 1ENZA 2Q1SA 3K92A 2YY7A 3JYPA 4BNMA 2NADA 1D1TA 1B8VA 1YH3A 3C7DB 1GPJA 2PGJA 2DKNA 4OKIA 4ZGWA 1NQ5A 5ITVA 1ML3A 4O1MA 3L77A 5ES3A 1LLQA 2HK8A 4RV9A 1G1AA 3CEAA 5KJCA 3A28A 4YBZA 5FYDA 3ROMA 1E3IA 3WSWA 3GN1A 4NK5A 4OOEA 1JQBA 2JFHA 5CEJA 3JQ8B 3WJAA 1Z73A 1G0OA 1L7EA 3ZV3A 3FR8A 3F1KA 4NFYA 2H9IA 4B3HA 1LSUA 2CZCA 3DZIA 4GGPA 3MOIA 4FS3A 4NBUA 4RPHA 4B3IA 2HU2A 3PXXA 5C5IA 2VUUA 4KTVE 3KOUA 1BXZA 5KVQA 4FQ8A 3G49A 2NQ8A 3WFIA 1TB4A 1P1JA 4EJ0A 5A4DA 4UVHA 1EZ4A 2RH4A 5IDXA 4MVJI 4DUPA 5EJ2A 2Y1FA 2OBNA 3U4HA 2Y67A 4R54A 1KBZA 3DBLB 3H7AA 2AG5A 2B36A 2FP4A 4K28A 3PJGA 4J49A 1TT5B 1U28A 5EQDA 1NAHA 1RYDA 1YB5A 4IINA 4RCVA 5HTOA 1PZGA 2JJYA 3OJEA 2J8ZA 4NQZA 5A9RA 1ENPA 1U2DA 2EGHA 3GRPA 4LSWA 4BHTA 5CG1A 3GMDA 4Q3DA 2Q1UA 3WDSA 5G4LA 4XEHA 5KOIA 4AG3A 3Q6IA 4ZJUA 3PI7A 1JDJA 2HAEA 4PVDA 3LT0A 1FDVA 4HFJA 4M87A 3K2EA 3TSCA 3R3SA 2X8LA 2VT3A 3PPIA 4D44A 2NU6A 1WWKA 2WD7A 4YJFB 3K30A 4MIOA 1YJ8A 4YEDA 1HKUA 1ISHA 1HRDA 3DWFA 2Q1WA 5IZ4A 3IUPA 4NMHA 3JD4A 4O5OA 4ZQFA 4F45A 1LLDA 1AHHA 3HDQA 4DLAA 3FBTA 1MB4A 2G1UA 2EWMA 4MIYA 1C14A 3JQBC 2QX7A 3GF4A 2GUGA 2Q46A 2OBYA 2XXBA 1PJBA 4FPXA 4WNCA 1NBOA 3D5TA 1GUFA 4ZQEA 1SOWA 2O48X 1C0IA 5L4NA 4AJEA 3GQVA 3JQAD 4RQTA 3DBHB 2WYVA 2HRBA 1W8DA 3QV1A 4WLUA 1YBMA 4F46A 3FHLA 1LDMA 3ZNNA 2GZ3A 1T4DA 3WQSB 3U3XA 4N7RA 4YQZA 3JQCA 4CM9D 4HX5A 4J1SA 3VKVA 1R0SA 4CLXA 4ZQGA 4B8WA 3UVEA 1J4AA 3ICCA 1AUPA 1NFQA 3TZKA 3CUKA 2EP7A 4OQYA 4R68A 2O3RA 3U49A 4FJ1A 4MVJM 5FI3A 2ZYDA 1G0NA 3RU9A 1Z6ZA 2JKVA 4BUCA 4IXTA 3AUTA 1EUCA 3UHAA 1Y8QB 3PJFA 4W7IA 5B4TA 4M54A 3QVTA 2J3JA 1ZSVA 5COAA 3KTDA 3C1OA 4FR5A 3GC6A 3PP8A 1GZ3A 1T2CA 1V9LA 4XGKA 3I1JA 4PFJA 1YDWA 3IS3A 4I5FA 5BSFA 1NXQA 3RC1A 1PS8A 1DPGA 4IQ0A 2O23A 4NBRA 3BMCB 3HFGA 1A5ZA 1GUYA 1YB4A 2D2IA 3PK0A 4NDNE 1EFKA 1C1DB 4TKMA 4GSKA 5B1YA 4K1LA 1JTVA 3MEQA 5C7OO 1K3TA 1IUKA 3ZV6A 3WFJA 1N9GB 1T2FA 5TLSA 3VZSA 5A3VA 3LC7O 5CPBA 4RPGA 2EF1A 4PLPA 4I9HA 5T8KA 5JC8A 4XQCA 3ANMA 3ULKA 2WYUA 3GG2A 4BNTA 3G1UA 2WSBA 3GA0A 1VSUA 1Z45A 3CMMA 2DUWA 4XR4A 2DM6A 2E82A 2HJRA 1CYDA 2BELA 3F5SA 5EESA 3LDHA 3E9NA 3ANNA 4CMEA 5EQFA 1Q7CA 3KVOA 1LSSA 3JQ7A 3F5QA 1Q0QA 3NDIA 1ISFA 4TRJA 3RUCA 3PDUA 3ZU2A 2Q2WA 4DQUA 4L4SA 1MFZA 3Q9NA 1V3VA 2AMFA 2E49A 4QO7A 1NX6A 1RYEA 4WPGA 1WNTA 2BFMA 3Q0EA 3AU8A 1ZK3A 3ZWYA 3V1TC 1ISGA 5T5QA 1HE4A 5G4KA 4ZRNA 2C20A 3HDYA 1CF2O 2IEBA 4OXKA 1X0VA 3X2FA 3KYCA 3S55A 4KUGA 3K73O 1QXSA 1LRKA 2QRKA 3RBVA 4AFNA 3PEFA 1TI7A 3T4XA 4CQMD 3OICA 4TRRA 5U1PA 3RUHA 2ZQZA 2BMAA 4W7HA 5I7SA 5ITWA 4XR9A 4NJOA 2BH9A 4J1NA 5CG2A 4TROA 3IP3A 5KVCA 4RORA 2WJPA 4D46A 4BOYA 1PS9A 1YO6A 4CMCA 4E0BA 5L51A 4E2XA 1KVQA 4WASA 3BHMA 1UZMA 4N5LA 2TMGA 4DBZA 1MC5A 5JMWA 3ONEA 2VYVD 3FNFA 4R4JA 1SEVA 2CNBA 3RWBA 4BKOA 4BKPA 1K0UA 3ST7A 3O4RA 3PWSA 4G2NA 5ILGA 3AOEA 1WDLA 2VRCA 2F1KA 2HO5A 4B3JA 2I66A 3QA9A 4HADA 2DTXA 2JD1A 1DB3A 2UV8A 1BW9A 5C3MA 5DBIA 4FN4A 3DC2A 4BNZA 5TF4A 3OBBA 3FD8A 4WLFA 1LI4A 4WJZA 1P1FA 1R4MA 2C29D 4QFDA 3R0IA 1SPXA 3UOGA 4JBHA 4YACA 1O5IA 1Y6JA 2WEKA 4WCFC 3B6ZA 2PD4A 1LDBA 4Q3BA 5A5EA 1DJNA 5THKA 3IUSA 3L4BA 4Z6KA 4WOJA 4UVIA 1IB6A 2C59A 4CLHA 4J6FA 4LSMA 2DBRA 1XEAA 3UW3A 1WW8A 3ZV4A 2D8AA 4JBIA 3D7LA 5TRTA 4KDEA 2G0TA 1LRLA 1PQPA 3DFUA 4IIUA 1I24A 3W4JA 4CUKA 1LJ8A 1XU9A 5IXYA 3MOGA 3UFXA 1M66A 1PJTA 4RPLA 5ILOA 1T4BA 1JKFA 2BLLA 2GN4A 4BO4A 2NUAA 3NT2A 2GNAA 2AEMA 5T67A 5JCJD 1LLUA 4O59O 4D43A 2Q50A 4XX0A 1JLLA 1SBYA 1SEPA 2QRLA 4WCFB 3TFOA 2FR0A 2VN8A 4A5OA 2GCGA 3EMKA 4FB5A 2EJWA 3UXYA 1ONNA 3GRKA 3PHHA 4WEOA 4UAGA 3L07A 5JE8A 3JQBA 1VSVA 4CMKA 1C0PA 1P74A 3BMQB 2VZ9A 1ZUD1 3LZ6A 3RVDA 1P44A 3LVFO 4UEOA 1MG5A 5IDWA 1OI7A 3ITKA 2V6BA 4W6ZA 2EKPA 3RSHA 4BQPA 4ESOA 1JU9A 2AG8A 1RM3A 4PLFA 3PWKA 1BVRA 4FGSA 2D0IA 4YJGA 2NU7A 3ASUA 3L6EA 3RJ9A 1HE3A 2PZLA 2UAGA 1NM5A 1U3UA 4RVGA 4QX6A 2OFPA 1LQUA 1KVUA 1KY5A 3GEGA 1U3TA 4NG5A 4ONEA 4A73A 1RM0A 3BMNA 1XDWA 1LUAA 5L3ZA 1C3VA 1VE9A 4P4NA 1YDEA 2VRBA 1NHGA 1QLJA 3AU9A 3NGXA 3FBGA 3PZBA 4MOWA 4Q3NA 4FSHA 4DYDA 4EUHA 5G0WA 2RH8A 2BGMA 1A27A 4CUJA 4AJNA 1T2AA 1VRWA 1LSJA 4J0EA 4Q3AA 5I7EA 3ZWBA 3WJ7A 1R4NA 2D3TA 3D3EA 3GHYA 2E48A 1A9ZA 1B2LA 4BGEA 3KYBA 4DYVA 2WTBA 4RVFA 1W6UA 1OOEA 4MVJP 5DT9A 1AXGA 2GGSA 4B7UA 5BR7A 1UJMA 4N5NA 3TFQA 2BKAA 2HMUA 3MWEB 1IZ0A 1HF3A 3HQ4O 4BO1A 1Y8RA 3WNVA 4JGBA 4FOOA 4M86A 1DBVO 1HT0A 7ADHA 2W2LD 1L1FA 4J4HA 4R16A 1OFGA 3TWOA 3V5NA 4BNLA 2PNFA 5U4QA 2Z5LA 3W8DA 1G6KA 2NTVA 3PDJA 3VC7A 3GGPA 1X7GA 4A0SA 1EMDA 4GVXA 4CJXA 2NTJA 5AOVA 4LMRA 1FJHA 1Y1PA 3C24A 1GZ4A 4CM1A 5KNLA 1GFSA 4B4OA 3RBZA 4CM8A 4YRBA 4UUMA 2IYPA 4OXYA 5DNAA 2X1HA 3HUDA 2P4QA 4FJ2A 4MJLA 3UF0A 1DLIA 4Q9NA 1LDEA 4E4YA 1EQ2A 1NQOA 4YAEA 2HK7A 4OHUA 1Z74A 3I9MA 3TNLA 3O03A 4JN6B 3KXDA 2IXBA 4MIEA 1H2BA 3AM5A 3RUEA 1F8FA 3ADOA 3F4LA 2B4RO 4GX0A 1IOLA 4YR9A 1E7YA 5BSHA 4YCAA 1ZK2A 1HWYA 1YL6A 3V8BA 5AXBA 3IKTA 1I01A 1WDKA 3CH6A 2R00A 1XIVA 4OH1A 2FWMX 1SCUA 3GUCA 3I4CA 5K6AA 3JQGA 3JYQA 1O89A 2CSUA 2GN8A 4J0FA 2ZKLA 3D0OA 3EAGA 3ETGA 4DMMA 4J2HA 1A7AA 3GAFA 4MP6A 1X1TA 1ADFA 1PL8A 3C3XA 3INRA 3S1LA 4IM7A 5CDTA 3WX0A 2JD2A 3MWDB 1A71A 4FFPA 5TT1A 3WMXA 4D79A 4ND2A 3WQQA 1U5AA 2DVMA 4PG6A 4UVEA 1Z82A 5EMHA 3ZHZA 4RVSA 3PLNA 4BIIA 4NJMA 4R5MA 2HMWA 4XGNA 4PZDA 4PZEA 1ARZA 3SC4A 1TXGA 1YQGA 4B4VA 3WTBA 2Y1EA 4UUOA 5B12A 1PGNA 3DONA 4CR8A 4DVJA 4IQ8A 1AGNA 4DWVA 1VJTA 1Q2XA 2CVOA 2AHRA 4E12A 1VKNA 3O8QA 3PFWO 3E5RA 1SB9A 1YS4A 3HDHA 2AQHA 3W8FA 1N2SA 4WECA 4Y6SA 1IULA 4IJVA 4OXNA 2UUOA 4WCFA 4AL4A 4DLLA 5LDHA 1ZMTA 2X7HA 2VUTA 3DZBA 3R3JA 4B8ZA 3L6DA 2Y66A 5KWEA 3WGZA 1ZKMA 4OKNA 3BMQA 4R3WA 1CWUA 3KB6A 5F21A 4JROA 2VWQA 1P45A 3C1TA 2WD8A 5COBA 3ROKA 3Q3CA 1VM6A 1LRJA 3G1TA 4QO8A 4IMRA 1CRWG 3E82A 1B14A 3ENKA 5ENVA 4TZKA 2WD7B 5IN4A 4A2CA 2RCYA 4ND5A 2Z95A 3UN1A 2GZ2A 1YBAA 5KTKA 4KQWA 4TRNA 3AM3A 3W4KA 2OHXA 2Q4BA 1IHYA 1M2WA 3LU1A 1F0YA 1ZMOA 3NUGA 1C1XA 1PJSA 4ALKA 4OL9A 1NPYA 4GQAA 1I2BA 1R0LA 4O6VA 1WVGA 3EGOA 2O7QA 2EKQA 4K9DA 1ZNQO 3I5MA 3S2FA 4CLEA 5GZ3A 4FOSA 2GLXA 5EN4A 4E5YA 2B4QA 1U8FO 3FPCA 2VZ0A 1X1EA 1B15A 4D0SA 1D4FA 2PKQO 4EW6A 2O3UA 1HE2A 1WDMA 3DHEA 4RZIA 1DFHA 2DQ4A 3F46A 3LLVA 3DBRB 1LDNA 4D3FA 4EEZA 3ZH2A 3HSKA 2DTEA 4XD2A 1ZEJA 4IDCA 5DDIP 4ZU3A 4INAA 2Y0EA 5K0ZA 4FCCA 2GF2A 5G0TA 1ZSYA 3V2GA 2ZCVA 1ZFNA 3W4IA 2O2SA 1GYRA 1GPDG 2OUIA 1HSZA 1ZK1A 2ZJ0A 1JVBA 5DN9A 3WBBA 4JJIA 1ZJYA 4KUHA 3IP1A 1RWBA 1PTJA 4TWRA 3CIFA 4KUEA 2OXIA 1O95A 1YKFA 3VZQA 3KV3O 5JAQA 1DFGA 2NLOA 3LC1O 4HBGA 2IDZA 2V65A 1HDRA 1R15A 2OP0A 4E2YA 8ADHA 5I9MA 4CMEC 3SBOA 1SNYA 3KYDA 2JHGA 2NVBA 4BO5A 3I9JA 4PVCA 1U8XX 3S2IA 3JQFA 1YJQA 1P77A 4IY1A 1CERA 1I3KA 4XIJA 5CAEA 2DPHA 1EVIA 4CMGA 3UUWA 1ADCA 1IL0A 3QHAA 1EUZA 1EQUA 1GY8A 2B5WA 3C7AA 1H0KA 1ZVMA 3LSYA 2FPIA 3VAZA 1SMKA 1A4IA 3CZMA 4AJ4A 4I5GA 5JS6A 4DREA 4AVYA 4S1VA 2POQX 2LDBA 2RHRA 4FFLA 1PGJA 4BVAA 2QZZA 3OEWA 4UUPA 1NVTA 4XKJA 1DC6A 2PKRA 3GH3A 5TNXA 4Z0HO 5G0SA 2CVQA 3JQ7B 4W9NC 4OAQA 1R16A 4QEDA 1YVEI 4IMPA 4P4GA 5L9AA 4UEJA 4J90A 4XCVA 3CTMA 2O4UX 3G17A 2YV2A 4CM9A 3DAGA 2ZIZA 2NQTA 4I5DA 3VH1A 2OZPA 3VPHA 3HNPA 3C1AA 9LDTA 4F6LA 2HLPA 4GAEA 4NIMA 4BO7A 5TSDA 4E32A 1XA0A 5G4KB 4LN1A 2FR1A 3AOEC 3KYCB 2PFGA 1D3AA 5CDSA 3NTQA 4IDEA 1Z7BA 3DAFA 4L74A 3VDRA 2ET6A 2PD3A 4IDFA 1O9BA 3ZW8A 2IYOA 1XKQA 2A35A 2GN9A 3DZGA 3P5SA 5TJHA 1F8GA 3CSDA 4JK3A 1EDOA 4XQGA 1P0CA 3OJOA 2PK3A 1BRMA 1ZK4A 1PIWA 2VCYA 3KLPX 3MJCA 4R5HA 3CPSA 3M1LA 4RVHA 4UULA 4U8GA 2CF6A 5A3JA 2I76A 3L4BC 2GD1O 3W8EA 4TRMA 4O63O 1I33A 4B79A 1VLLA 3OH8A 4BGIA 3HADA 2EHDA 3KM0A 4NK4A 2WM3A 4EUEA 1X0XA 4NR0A 4E5NA 4DLBA 1JWBB 2Q3EA 3RIHA 3VOSA 4EDFA 1P31A 4J7XA 3IL2A 4RDHA 4JP3A 1PWZA 3PHIA 2V6MA 4NI5A 2VHVA 1GAEO 1BW9B 3T7EA 3KZVA 5B37A 2WE7A 4CV2A 3IJPA 4MKRA 2YW9A 1R4MB 1XWFA 4L9RA 2YDXA 3MJ4A 3WWYA 4AJPA 1DAPA 4DRYA 3H6KA 3ZWOA 1YONA 3WR5A 2CDBA 2R6JA 3FF4A 3D4OA 3H9JA 4CMBA 1BDBA 4HP8A 4HNHA 4AJJA 1H94A 3HN2A 3F3SA 1T1RA 3FWNA 5A1TA 3UCFA 1KVRA 4L8VA 2X4GA 2WMDA 3WLFA 1PL7A 3WMWA 2O7SA 1K2WA 2Q45A 1NFRA 2YYYA 5EL0A 4I5EA 2Y1OA 2EGGA 3HB5X 1EFLA 3BHIA 3ZWXA 4B4UA 1CEQA 1WAMA 4YAKA 3CXRA 1ORRA 2BFOA 1WMAA 2OL4A 4U0JA 4FGWA 1OMOA 3DBRA 1JVSA 4LCJA 4QSMA 4E3ZA 3GDFA 1U7HA 4R3NA 5G0UA 3UCEA 2OMEA 5DCWA 2AQIA 1H9BA 1X14A 4FFMA 2IEDA 3GVIA 2I65A 1J49A 4JQCA 4L76A 4QTZA 4FIZA 3D4PA 3GVXA 4ILKA 4WLNA 1UDCA 2J3IA 3V2UA 2PZJA 4A03A 2W98A 4M89A 1HE5A 4Q3CA 3FNEA 1HLPA 2DPGA 3VPGA 4BKRA 1HYEA 1LU9A 4QUKA 3LQFA 1E6UA 4IJWA 3ZWWA 3ITDA 1B26A 5L4SA 3EYWA 3U0BA 4YJGB 2YFQA 5JPIA 5IDYA 3QJ5A 4N18A 2EIHA 4HKTA 5KCZA 1TVEA 1ZH8A 4ZD6A 3FCOA 1BGVA 4URFA 3ABIA 3HE3A 3RBXA 2JHFA 4BKUA 4R1SA 4DPLA 5BNFA 3TDKA 3U4DA 4DC0A 2XF8A 3BMOA 1ZW1A 2X9GA 5CP8A 3QWHA 3QWBA 2ZTLA 4RO0A 3KSZO 2QW8A 3BMNB 3HZZA 2GZ1A 5DCYA 4EBFA 4FFRA 3Q9UA 1Q0HA 4NFSA 1BVUA 2GSDA 2QQ5A 2IZ0A 5EERA 1NVGA 1D7OA 4KZPA 1PWXA 5LDGA 1ISJA 2C07A 3CKYA 4N5MA 2BHLA 4WCDA 1R4NB 1CQJA 1ONPA 4GX1A 2D1YA 1M76A 2Y1DA 3GEDA 4WK6A 1LC3A 1ZJZA 2CFCA 3JCZA 3DFZA 3RC9A 1LNQA 5I7FA 1E3WA 4X54A 1H93A 1LXCA 2GO1A 1O94A 3OJLA 4J91A 4XRGA 4S3MA 1LEHA 2JFFA 2QHXA 4IZIA 4CPDA 5EIOA 1Y8RB 1VJ1A 3ZWCA 2IZZA 3UICA 4D45A 2O2YA 2NVUA 2ZYGA 3ENNA 3QVOA 3FTNA 3ZWPA 4BNXA 5JAIA 3DBVO 1EUDA 1UR5A 1E77A 4AJ2A 4Z3KA 4KWIA 1H9AA 4BO6A 4AJHA 1GYQA 5CEEA 5JSFA 1W4ZA 3IOYA 3F4BA 4LW8A 4RZHA 2PA3A 1JAYA 4YXFA 5C37A 1GDHA 2R00C 4CLOA 3PHJA 4PG8A 2IODA 3X2EA 3ZCXA 5K6AC 4IQGA 4CM8B 1ISIA 1NQTA 5U9CA 5L40A 1DIBA 1XQ1A 2C2XA 4JNKA 1K6XA 3GY0A 3PTZA 4UUNA 4W9NA 4YA6A 1S6YA 5HWSA 2YV3A 3K2BA 1MGOA 5ICMA 1CDOA 1F17A 3JQ9C 2VWHA 3OFSA 1EVJA 4W4TA 2UYYA 4DQXA 2C0CA 3WYEA 4GWKA 1T25A 1A72A 1LQTA 3SVTA 4R01A 1GCOA 2F00A 1IPFA 3ADPA 1I30A 3PJEA 4TMFA 5TS3A 1DRWA 1B8PA 3NTRA 1IPEA 3ANLA 3CMCO 3K9QO 2DC1A 2ILTA 1UDAA 2HSDA 3I3OA 3WLEA 4CL3A 1NPDA 4DIOA 1DLJA 3MTJA 3TJRA 3FI9A 5L7YA 1J5PA 3G3EA 2EERA 4C7KA 1O6ZA 3JQGB 4IDDA 1VKOA 4U0KA 2IZ1A 4IBOA 1E7MA 1EBFA 1HDZA 3WYBA 4TZTA 3BAZA 3UCXA 4MVJD 1CQIA 1FDUA 3RCBA 1P1KA 4L75A 4A7PA 5L53A 1OBFO 4QQRA 4PGFA 3H65A 3H9QA 1DSSG 4P8RA 1U9JA 3SLGA 4F6CA 1M75A 1PZEA 3TF5A 3OQ6A 3WGTA 1LA2A 3GK3A 4NJMB 3GLQA 2P4HX 5A9SB 4JXKA 2W2LA 1QG6A 3QVXA 2VUSA 4FBGA 4U5QA 4I08A 5C7IO 3D3WA 4ZRMA 5T8KC 2X0NA 1HDOA 5TT0A 1CIVA 4J9UE 4IS2A 5HRUA 4MVJH 1V3UA 2QZ9A 3QY9A 2P68A 4BNFA 4CL8A 1DJQA 6ADHA 2P9EA 4C7JA 1VPDA 4E21A 3O8QB 5AXDA 3AI1A 4M1QA 1QORA 3GGOA 4XRRA 1UXJA 1GV0A 4NNJA 1LBEA 3ONFA 1EK6A 4K26A 4LISA 3H3FA 4BNJA 2PKQP 4K6FA 5L45A 3PQDA 4BKQA 1ZK0A 3CE6A 2ZB8A 3BA1A 3UKOA 3KHUA 4BGUA 5KJ1A 2B37A 1AN9A 3SC6A 1W0CA 1KEVA 3E8XA 3GFBA 4IJKA 1ULSA 5G0VA 4RGBA 3A1NA 3QLJA 1QR6A 2GPTA 2EXXA 1DC4A 5FFFA 5LCXA 1FK8A 1T24A 3L9XA 3HN7A 2A92A 2FMUA 2CD9A 1XG5A 4Y6RA 4GWGA 3RC2A 1H6BA 1GUZA 2J5RA 2VHYA 2VHWA 5AYVA 3EHEA 2AXQA 2Q99A 4RF5A 2NU8A 2B5VA 4XB2A 4CM5A 3ZWMA 1C1XB 4GKVA 3STHA 5IZCA 1P9LA 4KQXA 1PGQA 1ADBA 2AQKA 2ZK7A 1I10A 2A9FA 4L4RA 5J23A 1H6AA 4L0QA 4BMSA 4OGWA 5GMOA 3RUDA 3EUWA 4DBVO 2G82A 1E3SA 4M55A 5AQ1A 1I8TA 3ZV5A 2Q2VA 1NTOA 4PRLA 1HSOA 4DPMA 3IKVA 1U3VA 1H6DA 1Y7TA 5TQVA 3VVCA 2ZB4A 3N74A 3JQFC 4ALLA 1V3TA 4FC6A 4LCEA 4XYLA 1QYXA 4YT4A 1ADGA 2NWQA 2X23A 3VH3A 1L7DA 4JLWA 3C8MA 2E6UX 1P33A 1A7KA 5JY6A 1ZXLA 3H4VA 5KJFA 3NRCA 1K89A 3U9LA 3AWDA 1VL6A 1DAOA 1NR7A 2VTDA 4NBTA 4YYZA 1HDCA 5H81A 4R69A 1GTMA 2G17A 3A06A 3DQPA 3QVSA 3ZWVA 1IYZA 1NAIA 2H63A 2X5OA 3TZ6A 3MJVA 1R0KA 1YRLA 3AI3A 2YFHA 3G79A 4HWKA 2GYYA 1PS0A 2W4QA 5L95A 2Y05A 3E6AA 5DZSA 2I99A 1B3RA 3HJAA 4YAJA 1ENYA 1N1EA 1SO8A 3KYDB 2DFDA 4LVCA 4DIFA 3SEFA 4OM8A 3K31A 3TQHA 1JKJA 3E1KA 1K5HA 3TZQA 1ONOA 1GQQA 1TEHA 4BNUA 1KETA 3DR3A 1QYDA 1UAGA 5JO9A 1C0LA 1GEGA 3IIEA 4EEXA 1B0AA 2OOSA 2CUKA 3JYOA 3PYMA 3P2OA 2AW5A 3WTCA 5CFZA 2QYTA 3NTOA 3WXBA 1IHXA 1U1IA 2P2SA 1U2GA 4GSLA 5HA5A 3OSUA 4BO0A 1DHTA 2AEJA 3BYZA 5KVSA 3PYXA 5JY1A 2RAFA 3NJ4A 4J1QA 5HS6A 4YT2A 3M2PA 2C5AA 2I6TA 1YQDA 3JQAB 5TIIA 1GU7A 3A9WA 3EVNA 3I52A 3S8MA 3QW2A 5T64A 1R66A 5JNLA 1T1SA 2Y0CA 2IRWA 5ICSA 4A27A 1UXKA 1N5DA 3HHPA 3GNSA 3RJ5A 3OQ1A 1U4OA 4AJIA 2W90A 2DFVA 1PZHA 4Z3DA 3VZPA 1WPQA 3JQ9A 2G5CA 5TJ9A 3AUUA 4BO9A 2PR2A 3JQ6A 4O0LA 3AOGA 2J3HA 2WDZA
chains in the Genus database with same CATH superfamily
1U2EA 2DBYA 13PKA 3HB1A 2ZTUA 4B8YA 1PT5A 4LRSB 4PY2A 1VMEA 2MSEB 3CO0S 4L85A 4DLRA 2ZJAA 4GGOA 3I28A 1UINA 2GCOB 1VB3A 1TJPB 2O8CA 1BTOA 2P3SA 1FE8A 1CUWA 1KJ8A 1Q0LA 1A3CA 1G8JA 2KPOA 3ZLTA 2ZWPA 3EXHA 3RVPA 3KQWA 1LVGA 3RTAA 5ALRA 2G80A 3O26A 3G0OA 4LG1A 1C7QA 4XPIB 2VDJA 2IYSA 3OIGA 1QK3A 1N2IA 3ONDA 4JJAA 1DQPA 4YCDA 3PFHA 4BFWA 4UM5A 4EHAA 4E31A 4NC9A 2GASA 3CLHA 3QOFA 1AMNA 1EX9A 1ZI8A 3AKCA 4RCZA 3BCSA 1E92A 3HVHA 4LHVA 3K6SB 3K70C 2Q41A 1ZMRA 3KO8A 1RYFA 2NO0A 4KLRA 5AI4A 2F64A 2REQA 1Z2NX 3B3AA 1XVUA 4MAFA 4RETA 1MCZA 3QNMA 4CODB 2BFEA 3ILHA 3GCZA 4IGFA 3M4XA 2JVIA 5LLSA 1PWHA 4KAXA 3EC1A 3MJFA 3N8GA 5ADWA 1V71A 4WIAA 2ZJYA 1GSHA 1YUBA 2WWWA 3PNVA 4WGFA 4P93A 2DHDA 3FFXA 5TEWA 2XEXA 5ILQA 4Q9LA 1OROA 4DGSA 3TLYA 5KIAA 4H1UA 1Y6FA 2QXYA 2JDID 3DDUA 4PXAA 5EIXA 2IKSA 2P79A 3LUJA 3TNFA 1NXXA 1GILA 3LPNA 3AUAA 1OI2A 3JTEA 3KYJB 3RNOA 4G85A 4ESEA 1RLUA 3PRYA 1E96A 3ANSA 2M6KA 5I8PA 1FFYA 3RAEC 2C4MA 5DT2A 1A9SA 2G4VA 2O5VA 2WPNA 4ENUA 2IXAA 4HSGA 1KKUA 2W2TA 4KNWA 1I9CA 4ZT4A 3H8VA 1JLHA 2AI1A 1NI3A 1Z12A 2VAPA 3LFHA 3OX1A 3U4IA 3K96A 2WKRA 2WA2A 3GJQA 4E7PA 2C7RA 1SC1A 1XRLA 2I6UA 1HYQA 1CETA 4MV7A 1BWSA 3J80A 2YKGA 5SV2A 1I51A 3BXXA 2W7TA 3EW9A 4NAUA 3VH2A 2X22A 1KJQA 4Q15A 2ZT6A 2F3PA 1YHNA 3ILVA 4ENWA 3ZY6A 4US2R 3SDSA 3JD1A 3DYBA 2BKXA 1IBMB 1AX9A 2DBZA 3RD5A 1J0BA 3OLZA 4A0RA 3NGLA 2AEEA 3I0MA 5F35A 1GLVA 4ZI5A 3SNHA 3HCAA 3N7TA 1F51E 4PBSA 2NSHA 1XDGA 2ZJZA 3EIHA 3EGXB 2WTMA 421PA 1C0KA 2JIBA 1TKRA 4WEQA 1ZJ4A 4KYUA 4KTTE 1I80A 2VXOA 1KKMA 4ICIA 4XSHA 1QIGA 4MHTA 1LD3A 2HWXA 1DIRA 1Z4KA 3AFNA 5EJ6A 1N4DA 2BL4A 1XZ8A 4H4EA 1PZFA 4IIDA 2YICA 3ZOKA 3JALB 1GN8A 4CM4A 2I1QA 4JBNA 3SLKA 1JKIA 1WB6A 3KFLA 1BQ3A 2ZUTA 3TD2A 2UDPA 3WWZA 3PGJA 4TV9F 5T6BA 1F2VA 2ISQA 1VLJA 1T26A 2EHJA 4AF7A 4EP1A 4G4JA 2IH5A 1J23A 1Y5RA 3BTUA 4NWIA 1TIKA 2R6ZA 3IQGX 3SDBA 1VMAA 2A30A 4CKWA 1AA6A 1I9GA 5IHPA 1SVIA 4HNUA 4L4UA 1L7PA 2QL6A 2QYHA 3FWZA 1LDGA 1V25A 4INOA 3GAZA 4LXQA 5FWYB 1TM1E 2OTCA 3FUWA 4GKBA 2RGGA 4X3OA 3RTEA 3UJAA 4IGKA 1T1GA 4G0QA 1YNOA 2HF9A 3H2IA 3D43A 1SXJA 2H29A 1M2EA 2ID4A 5A03A 3GP8A 1HM5A 1P9NA 4MR7B 2APJA 1UFOA 1XMVA 2AJ8A 4CXMA 1K7CA 1Y98A 2W2KB 2ZETA 1MC1A 3AYXB 1OFHA 1RAAA 2C3PA 2VEDA 2JRCA 2XLCA 1W2GA 3QFFA 3R41A 4J6EA 4DHEA 2RARA 5ALQA 1GADO 2IHBA 3PXEA 2Z3ZA 4GXQA 4TN1A 4D42A 4R1TA 1T9BA 1CUYA 4F3TA 1CKEA 3U13A 1ECFA 5CIYA 2YJ4A 4LSZA 3V1LA 1KOGA 2IS6A 2PG3A 3FN4A 1DWQA 4LOHA 1S4QA 4NRDA 2C88A 2H4YA 1Z75A 3LCVB 2CKMA 3VO8A 1BKSB 1EPUA 3DV2A 4CEIB 1I6KA 3WIOA 1MZVA 1H4QA 2IOQA 2MINB 3WGHA 2FGKA 1XEXA 3DT9A 5HMLA 3BD9A 3L6OO 3WS7A 4E5UA 2QUZA 4H08A 4TMKA 3JWJA 1XMIA 4D9FA 3J7AC 3WQHA 2YIMA 1XRMA 3GHHA 4N40A 3SFVA 3KDPA 3BRWD 2VDQB 3QXGA 2ZYUX 3HSYA 5LYJA 4NL4H 4Q1VA 1ZAKA 2BGKA 3WDKA 1CQJB 3GDOA 5A2QA 1Q7GA 4L73A 2JF0A 2Q8QA 3KLMX 4PLVA 2AD1A 1QU3A 4Q4HA 1Y5MA 2PY6A 2Q28A 4RGVA 4KJZA 1E3WB 2W2OA 5JMPA 4H7KA 2PAAA 3CEMA 4EKEA 4D6PA 4ZI7F 4RTOA 4K87A 3TE6A 4OHFA 2ZT7A 2Y6UA 1GARA 2YJNA 2GNPA 4YMWA 5LZ8A 1M6HA 5AD1A 1M3SA 5JCZA 3CS3A 4ITUA 5IKEA 3HVRA 4GX5A 1RXEA 3I2FA 3ZKAA 5CCEA 2HJSA 1RRPA 3B20A 2YZ7A 3HKDB 2VTVA 3UK2A 1FDOA 1JN0A 1PVOA 5JJCA 1J2EA 3NG1A 2CVHA 1R0CA 4JT4A 2X1MA 4UAJA 3X44A 1PT9A 1DC5A 4X94A 2JPDA 4NS1A 4ZYWA 2FFBA 3JV7A 4JP8A 1C7FA 1KEEA 4F97A 4PAQA 4XWYA 3B7WA 4QBFA 3TAUA 1RZRA 4P7JA 3QSGA 1M2VB 3D4IA 1J8VA 4QXRA 4C6HA 2A9QA 4H1HA 5IBRA 1IDN1 4EUFA 1WVIA 1YWGO 1PR5A 1XD9A 2R8ZA 3EY4A 1V8FA 1ZM2A 3SEZA 2H2FA 4YRCA 4MQFB 4DIUA 3QLUA 3HP4A 2ZG6A 2BCGY 4UREA 4AN0A 4KPYA 1XCBA 1IN5A 4HLUA 3TXYA 2ASVA 3V7FA 1N0IA 1AK2A 1NJGA 3BKWA 3LUGA 1UK7A 3ZEIA 5K99A 3B2EA 2P3LA 3AI2A 3DF7A 3KVYA 3O74A 2VF2A 1FZQA 1GQOA 1MG0A 1J7KA 1ZJ6A 4GEGA 2I80A 4EQ6B 2ZB2A 3SFZA 1PK8A 4II3A 3KBOA 4TLCA 4V0QA 4M21A 1Z56C 4L0DA 4Q9DA 4UU0A 4QSHA 4QRDA 3A3YA 5J4VA 5KBYA 3WRVA 1UH5A 4DLYA 3WB9A 2VT6A 3C45A 1CUCA 3DR5A 2YMQA 2C58A 4YHBA 2IV7A 4BNWA 2GTIA 3LUPA 1RRVA 2Z1NA 3CZRA 1UKYA 1P2DA 1FNBA 4IJUA 4KE8A 3O8RA 4EDHA 2C03A 2IK8A 3NYWA 1EEHA 1M8KA 2OGTA 3H4TA 1UWCA 1Q3HA 2ZI7A 3CLKA 1UBLS 4L02A 4H60A 2EW8A 2YYZA 1P91A 4KIGA 4R9RA 4YJ2A 3B3JA 2WT8A 1O95D 4BB5A 1QPGA 2BRUA 3N2LA 3TLMA 3BK2A 1YL5A 3AUKA 3OQMA 4TQAA 2ZUBA 2FZCA 2O3JA 4ZKEA 2Q07A 2ZP1A 3GZNA 5E9JA 1CQIB 3I2JA 2EZ4A 2Z4TA 3QV2A 5JCOA 3ZJ5A 3OZEA 4LV5B 1XB2A 3KFVA 3FGNA 3OT5A 1BAPA 2WBLC 1DMRA 2FN3A 2QX4A 2YVKA 3VO2A 4QT4A 2QMUA 1ZCAA 4BY9E 4KQIA 5C7YA 1UPBA 2MSLA 1P6XA 1X7WA 2J6BA 3E48A 3C7TA 4UEWA 2FPPB 2XCUA 1RWWA 3O83A 1DDOA 1JW9B 1Z22A 3OCYA 4LK2A 5EKTA 3BJEA 5GONB 3H1AA 3GLFA 1IVYA 1UMDB 3K0FB 3NBQA 3F6CA 4HNGA 4IO1A 1AQIA 5J4YA 3N58A 4FDAA 5DCUA 4Z0NA 2QNRA 3EVEA 3FRHA 1HNNA 2H1WA 1SURA 4DS3A 4EEKA 5F1OA 5CPFA 2P8JA 2Y77A 3HWX1 3QI7A 4G36A 4QEKA 3EJWA 3SF0A 2JGLA 3KEGA 5JWOA 3G5MA 4PLGA 1DC8A 2G70A 1S96A 4JB3A 3I6ZA 4NE9A 4RAQA 2IBSA 1RPAA 1K8QA 3DZ8A 4G5SA 4CMIA 2Y4OA 4JSRA 4RF2A 1YI0A 4HDSA 3OC0A 2ZQYA 3OTIA 4MUHA 3RFTA 1Q95A 3PC8A 3ZBTA 4CEIA 2BV3A 3B2QA 3OF2A 1EE1A 2SECE 3AMVA 3FLEA 3NQ41 5JJ5A 1T8PA 1N0UA 4HTFB 1AZLA 4PNZA 4AJLA 4YI3A 3C3WA 1RWMA 2D2FA 5LJLA 1TIPA 4HDOB 3W6PA 2XMQA 3LHSA 1N7IA 3JR3A 1Z17A 3GFTA 3JZDA 1WTCA 2RKWA 3ZDBA 1JAIA 5B58C 4N65A 3P32A 1RXIA 3K5PA 1S8NA 2BMFA 3MM4A 4BFYA 4IFBA 4KN9S 3GLIA 4G65A 1P3JA 3GJXC 1HORA 2ZRFA 2VJYA 3KSMA 2EP5A 4M9RA 4LZNA 2VHJA 3AEYA 1AKWA 3HKEA 3LWZA 3FY4A 4MUGA 2P9CA 3TN7A 1R5JA 2H0QA 1KMHA 1Z6YA 4WNIA 2I6GA 5FI5A 1XVAA 4ZVUA 4LBWA 2PU7A 2XECA 2R6DA 3I34X 4NHEA 2DF8A 5FADA 1QO9A 3H1PA 1HEUA 1R6XA 3GCWA 3SOZA 2TS1A 2SKDA 1OA1A 4BX9A 5L7TA 4V0RA 2WVGA 1O0CA 1USWA 4EVRA 2JCSA 1TM2A 4IDOA 4MVJA 2IYFA 3I5UA 1QGED 3D6HA 5A04A 5JVDF 3OPVA 1MBZA 2FW1A 1K9SA 3QA3E 3THWB 1M74A 3LOQA 3TCNA 1NQWA 2X77A 1DXYA 3ZYZA 5KNCH 4PSCA 5EEGA 3P0JA 4NZZA 4BNKA 4ACAA 1L4MA 4NBWA 3L06A 3G8YA 3ND9A 7MDHA 3QX3A 3V3TA 2JFQA 4GZLA 2Z5FA 3DTYA 2MCFA 3UENA 2J5KA 3ZDZB 3HCOA 4IH4A 5TQJA 4EYGA 1M0SA 1EB8A 1TM3E 3L7JA 4FI3F 3DOOA 1NVVQ 4LJ5A 4XGIA 5C3UA 1HQCA 3KALA 4NYJR 4LBYA 3VDQA 2IUUA 3RASA 2D06A 3AERA 1PDWA 1CFZA 3Q7RA 1RTTA 4CV0A 1YMQA 2X5KO 5ALIA 3U3KA 2QL7A 3O8CA 2B30A 3BN3A 4X6YA 3SXPA 4HGZA 1YZYA 3U7IA 2I3GA 3ZI4A 4Z4EA 5I4BA 3VYRB 3HCCA 3PUJA 5JQGA 4BJ3A 4NAVA 3CLSC 3HI4A 1COZA 4PS0A 4ENVA 2I87A 4ND6A 4NTZA 3SHQA 3IE1A 1O9GA 4DQDA 1VBNA 1Z37A 4BXOA 2X2OA 3FYTA 2AJBA 1L5FA 1OBHA 3ZEAA 1RHKA 3OT4A 3WGQA 2CLOB 1ZA2A 2QVGA 3ETEA 2F55A 4I6GA 3LQ2A 4AY5A 4E11A 1IIRA 2ZZMA 2W8ZA 2YC2C 3E18A 4J7CA 1OC2A 4ZIRB 2B78A 1BMDA 2CCKA 4DPKA 1NDHA 2PL9A 3E03A 2GD2A 4Q19A 2EQBA 1L4UA 4LECA 1FX0B 4DM4A 5EHXA 2CW5A 3P5BA 1Z68A 4HH1A 3ORFA 2VJKA 2AOUB 2F62A 3AESA 1HQKA 3N05A 3ELWA 1S9DA 2AA3A 1JDUA 3R7WB 4RVDA 5JSZB 2E6KA 1HPLA 3KSRA 1LBHA 3A4VA 3RRNA 3VR5A 1Z06A 3WLSA 2GESA 2PMBA 4KEAA 1E1LA 1K06A 1NJ1A 3AG6A 3MPUA 3QYJA 1AXEA 4LIPD 1R6DA 2XMBA 3AF4A 3GLRA 5ECWA 5LP1A 5BO5A 3PGXA 3QXSA 5KKCA 1TMYA 3O2QB 2Q5LA 1G6Q1 4QULA 3FWYA 3CINA 5FI1B 1E1KA 1X94A 3JD2A 3MCUA 4LPSA 1XAIA 3T1NA 3TDNA 5JC1A 2BSQA 1CYEA 2PT5A 2P4EA 2NSLA 2E37A 4WXEA 2F4VB 1GZ6A 4JVSB 4TYPA 4IOMA 1JAXA 5AKHA 4QFBA 1J0AA 2VDWB 1CDEA 3OWXA 4RMJA 1NMEA 5JCXA 3WYCA 3F9IA 1TM4E 4DJTA 3ICWA 2V7TA 3FMPB 3NYRA 2B21A 1VP3A 3P2YA 4FKZA 1KYIA 1NASA 3AR8A 3LP6A 1I3CA 1TT5A 3TRDA 4B48A 2R4TA 2ZSHA 4IGIA 1KY2A 1XXHE 2QMOA 3BXFA 5FR2A 4RFSA 2XB8A 4N54A 3OLQA 4F12A 1QNFA 1GA4A 1OH8A 1AUOA 3IEXA 3DL2A 4Q4JB 2Q6LA 5D3QA 3L18A 3HDTA 5AJHA 4BNHA 5KVVA 3H8JA 4UNSA 4IO0A 1SK8A 3CRW1 3QENA 2E5LB 1PG5A 2C83A 2ZB3A 3EIEA 8ATCA 1IQPA 5E6UA 4YDRA 4DB2A 3AUYA 1ODKA 1YSCA 3ZLVA 4JI1B 5BMVF 4MUIA 2DE0X 3S6JA 1VBMA 3S8EA 3ILYA 5K9ZA 3WOVA 1W36B 3L7BA 4OGFA 5FV4A 3DXFA 3QE2A 3BWBA 5GWXA 2WVJA 1GTG1 2EFYA 3X3HA 3PCTA 2ZROA 2PFKA 5EGSA 4BB9A 4QGSA 1RBZA 2GDZA 1YJAA 1I5EA 5EUBA 4AUEA 4DV2B 5BPFA 3KAQA 2IXEA 3RYTC 4KNYA 2XRYA 3COVA 1NLYA 2X0KA 2W70A 3ZHBA 1L7QA 3EHDA 4ESHA 4XVHA 3DNMA 1OAAA 2JHPA 3SC2A 3FLBA 3V8EA 1PJ8A 4OFWA 4P86A 2X2EA 2X6TA 2OQVA 3W9UA 3LBAA 5C52B 2XWQA 3PIDA 3B85A 4N5IX 2WABA 4DZZA 5SYNA 4K9QA 3L5KA 1EUYA 3HFJA 1UWKA 2WIJA 3DBHA 4G8DA 5L8VA 2AX4A 1GNLA 4WERA 4EG3A 3KZNA 5HF9A 3QFRA 2WUWE 3SBEA 2NACA 3FOAA 1L5VA 5FTJA 4QGHA 3IBYA 2O8EB 1N2JA 1L4EA 1IQ0A 1PZNA 4TM7A 1YB1A 4BAZA 1F4VA 2O1XA 1N92A 5CGQB 4PX9A 5JAMA 3TG8A 3H1TA 3P0FA 4HZUA 5D7BA 2XDQB 1CXZA 3AR6A 3GP5A 1AKUA 3OZXA 5EHQA 4JJKA 1OTYA 5I5EA 3DHNA 5BSGA 2J6CA 1KI2A 1JJVA 3I9LA 4B46A 1MXFA 4KRXA 4FHZA 1R37A 1N3BA 3DKVA 5IEBA 1S2MA 1VTKA 3L0BA 4IXMA 2F2TA 3A05A 2Q49A 4Y2VA 4A10A 4C7XA 2ZUFA 2RHMA 1UC5B 2A1TR 3W6UA 3LBNA 3VI3B 3VSCA 3EZGA 3G0HA 1RXVA 3JZMA 1P4JA 1Z36A 4M1SA 1X80B 1RRGA 2RONA 3L79A 4M99A 4CMHA 2CF5A 3R20A 4C6TA 1NVXQ 1YZNA 1AHIA 1SXJC 5T4HA 1UM9B 1TVCA 3P9KA 4J8PA 4YAGA 3L6RA 4C9BA 4Y6OA 1M0TA 1MVOA 3DQZA 3MPOA 2BF7A 1DHRA 1EH5A 4O29A 1E2BA 1R9GA 2JIZA 5C1BA 3JQEA 4DGQA 2HWYA 2ZAYA 1D8AA 5CX1B 5C51B 1YMVA 4YQYA 3BDVA 4MV1A 4ARSA 1KBQA 1C1DA 4NCKA 3NHFA 1BFKA 4IZHA 4GBGA 4M1TA 1GQ2A 2PN1A 2BD0A 3HCPA 4XZ3A 4DQKA 5M34A 1SUAA 1XKLA 3BTSA 4ESVA 3IEVA 4UNNA 1CP2A 2WZDA 4GL4A 3VZBA 2JAOA 3DD1A 1OXUA 2QL5A 3B70A 3FYCA 2D5CA 1KQOA 3FMFA 4RJ2A 5JNVA 4Q3KA 1ESDA 1WP4A 1V7PC 2GM9A 3EGDA 3T4EA 4QUJA 2P6MA 1DBQA 5DXFA 2OYRA 1R8JA 1JLRA 1SU6A 1IXSB 2HEIA 2QMZA 4EFLA 2Q6VA 1T15A 4POOA 1I2AA 4FB4A 1WSAA 4J03A 2QRHA 3VR6D 2W4IA 4HNRA 2V7XA 4NPAA 5E1DA 2QBYB 3H9UA 3QEMB 3DOIA 1TUIA 2JL1A 3IHTA 4C0SA 3F6RA 2XUKA 3ZHYA 4FC7A 5BY2A 1U8EA 2I67A 1Z0DA 4EHHA 5KYKA 2EV9A 4CWAA 1GKUB 2AKYA 4RLHA 3QMWA 4EHIA 2C2YA 2VHXA 4BCDA 4ID9A 4N3CA 1ZH0A 3NKLA 3BK7A 3K5HA 5FQOA 5EJEA 3SK0A 2KI5A 2RC5A 4JT2A 1ORVA 3ZIDA 3A1VA 3JTMA 3Q85A 1YOVB 2GERA 1ODCA 1B16A 1H6CA 2QN3A 2VSYA 3KAPA 5B6IA 2JDIA 2E7ZA 3FR7A 5ADHA 1PK7A 4R9SA 2UYCA 1A77A 4GMFA 3BSFA 5JQWA 2BFFA 1K97A 1W4LA 2WHRA 3BGSA 5AKJA 5A7HA 4I50B 5FUWA 1MT0A 1P2TA 2RIPA 3X2SA 1ATZA 2YXNA 3PL1A 2VJNA 1WCYA 1PDVA 4UCFA 4Q47A 3LPCA 2WYWA 3OJ0A 5I9IA 1W94A 5KOHA 4XJSA 4UEKA 3D6FA 5FWNA 1X7XB 4HQFA 1QIMA 2QTCA 2X0JA 1H69A 4Q24A 2QN2A 1NIJA 4C20A 2A8YA 3X1MA 3MJSA 5FEUA 4U02A 1RQLA 1U98A 1FPQA 5E8RA 4BRSA 2IH4A 3R7NA 2YN2A 3QLUC 1S3GA 1HZJA 3F1LA 1P1HA 2CL6X 4OJKA 4HLUC 2X86A 4H4CA 1Z33A 3UWDA 1SQGA 4UFNA 4AS2A 1MFPA 2OBFA 1KOLA 3CNQS 4KMSA 4EHFA 2FK8A 3BJRA 2PGDA 5COQA 3WNQA 3NDRA 2FZWA 1L8AA 4CNBA 4ZEXA 1C8KA 2CEKA 2YXPX 3GD5A 3NT5A 1G20A 3QWAA 4FFWA 4JY7A 5F7OA 4WQMA 1VJRA 3PBKA 2DFKB 1PYOA 2YWDA 4IJ6A 2ILVA 2YV1A 4H18A 2ZXUA 2RB4A 4MVCA 2I4IA 2JJ8A 3QTLA 4RW0A 3O2SB 2X5JO 4HDKA 3GUUA 3WISA 4ZOLA 5HFJA 1NPTO 4G5HA 2BN4A 2OD9A 3QGMA 4PWYA 3MCZA 5IS2A 4FVTA 4HEJA 2NO1A 4OHPA 3KUXA 2DOKA 3ZWKA 2WJGA 2FN7A 4B7XA 2CMKA 4AN1A 1E6EA 4KDFA 2O8DB 2BRUC 2XXAB 2GYUA 1FF9A 4KO3S 1NBMD 5IJZA 2YHIB 1SWWA 3S1AA 4B84A 4LRXA 2OQRA 4OSEA 2BIFA 1IVNA 5JCOC 5KYNA 1KSJA 1ZVVA 4WV3A 1E2UA 4KYIB 1HTTA 3HPRA 1GUDA 1PUXA 2Z1DA 1LDYA 1GAWA 3IAEA 8ABPA 1P17A 2NVWA 3V7UA 3IT3A 4YJKA 2M2IA 5LL6P 4HH4A 3L92A 3L9WA 1DIGA 1K4MA 2EX1A 4PG4A 3SQMA 3EVFA 3KEFA 5CCDA 1T2DA 1T6BY 5DK6A 2G1JA 3NPMA 4NV1A 2VNAA 4DA7A 3CUUA 1XALA 4QWWA 2YINC 4C7BA 1VSQA 1KS9A 2Q5FA 2FFQA 2QQFA 1MX9A 3ORQA 5CVDA 3W90A 4M1YA 5CT8A 3V4PB 3A10A 4YWHA 2WB2A 1FTWA 4BE7B 2HQRA 3SR0A 4BV9A 1VJ0A 4NH4A 2O50A 4EGFA 4TSFD 1E5QA 2BFCB 3PJDA 2ZTSA 1F5SA 1NVBA 2AN9A 4ZJYA 2VT7A 4GR5A 3S2GA 5L3RA 1ZUNB 1IY2A 3BRWA 3K0AB 4KSYA 1P6UA 1VE6A 3X43A 4JOCA 1M6WA 3FZQA 1I2DA 2H5LA 3IELA 2O14A 3O38A 1KVSA 4OMUA 5FTKA 3TS1A 3BQNB 1DC3A 3FIJA 4MKXA 3DKPA 1OLXA 2NV6A 4JJZA 5KTMA 1JDNA 4JMPA 3PC8C 5BUQA 1B6SA 1M2JA 4YGXB 3WB1A 3SZLA 3V1UA 4UMDA 1RWKA 2FEMA 3C14C 5IN5A 3VUEA 4B6OA 1FU4A 3U4QB 1IN1A 1EG7A 4CUZA 4YR7A 1OWMA 4MVJG 4NPCA 3ND7A 1G21E 2IT1A 1G3UA 4PSDA 4XIIA 1FXWA 1N2EA 1V1MA 2YXEA 3K6JA 1TDJA 3CNLA 3KWJA 4IFTA 3QXCA 1ZI6A 1J22A 3I6IA 4HEHA 1CY4A 1KHTA 3PYLA 4LI3X 2Y2VA 1FMCA 2ZIFA 1LX6A 4BO2A 2BEUA 4I1VA 3GCGA 4Y2GA 4DILA 3GGGA 1OXMA 1TECE 3PFGA 3CJTA 1VL0A 1X8LA 1E7SA 3DE5X 4NULA 4ROSA 5LMCA 1B6GA 1ZBDA 2G83A 2W2MA 3QPUA 4HDQB 4YFYA 4EFNA 4NFLA 4NMWA 4TXNA 5T57A 5CDGA 1ECGA 4ECAA 1YRWA 1Z5GA 3AY3A 4QREA 2YZKA 1UXIA 4BKMA 1J2TA 4HUQB 5KNBH 4ARBA 5C4IA 1GXSA 3CWQA 4PHFA 4V1CA 2C82A 2DWCA 1XMOB 5AKEA 4I1SA 4YV1A 2XWBF 1ZAYA 4BUZA 2GCEA 5CITA 3DOJA 5ENDA 3IILA 1ZO8A 2PGXA 4X1KA 1XRQA 2B0JA 2I3BA 3ECSA 3WL6A 5IJAA 2LRHA 4N41A 1BKDR 4F7DA 5B57C 2W6IA 3TXXA 1KEWA 3FCCA 1TQ6A 1E2DA 3FCUB 2XQIA 3TW8B 3LXRA 4QDJA 3LBYA 4B3CA 4X8HA 4ZQBA 3VBCA 3EA4A 3N39C 4YRSA 4Z2AA 3ROPA 1NVEA 1PJLA 4LQLA 4MV3A 3RODA 4B5LA 3FMOB 4BB6A 2O8NA 5AI6A 1XV5A 2OV6A 3CLTC 2PBRA 5FJJA 4ZEWA 2J3DA 5HJ5A 2BFBA 4E1VA 1I7DA 3SHTA 3TL6A 1PJ3A 2A5JA 2J7KA 3ZGNA 3FHTA 3ZTWA 1F6BA 3MWEA 4DDWA 3EVDA 3OOYA 4GIBA 1IY0A 4LV8B 3N0RA 3T5DA 4JLJA 2WSYB 3RTDA 2V3CC 5D01A 2IS2A 2JGNA 3QBDA 3CB2A 2B2NA 1VCMA 3SE0A 2X4LA 1B76A 5ANRB 3S2YA 1K5PA 2N1BA 1NTRA 2JGDB 1EA5A 4LE1A 1QO0D 2H4XA 4W5RA 3W78A 1G3RA 2JAHA 3FNHA 1TPYA 5CVUA 4C29A 4IDAA 1ZKDA 6LDHA 3PVSA 1SPBS 2OYSA 3GGSA 3O3NB 2MSDB 3QXXA 4MKGA 5DGCA 5ARDA 1FL9A 4YAIA 5TX7A 4PZCA 1EI9A 2RI6A 3K1YA 4KO2S 2HKIA 3SAJA 1R27A 4HH0A 4Q03A 5J1TB 2Z8ZA 1ULUA 5I3CA 4YMGA 2CDCA 5DYGA 5IVPA 1LPPA 2ZSAA 3I2KA 3LDUA 1GZSA 1WXEA 3D2CA 4BWVA 2OO5A 2HH9A 1D2GA 4BO3A 1XTKA 5EPEA 3F7MA 2VAMA 1QQ7A 1FDWA 1NFFA 1YUMA 3OOSA 1EM8A 3TW6A 5M29A 5A2GA 2WINI 4PRZA 4YCMA 1YJ5A 2L17A 3MWGA 2XRZA 1F48A 1RM4A 4OAPA 3UV3A 4FZRA 3VTZA 3FFWA 3EW7A 3LKDA 4AKEA 4Z51A 4XFKA 4FYJA 3VPBA 4Q39A 3VPSA 1JFLA 4OUDB 4AY3A 3GARA 3PHGA 1HX7A 4GQIA 2CV1A 2KLHA 2VHZA 3F3YA 3NH9A 2VL7A 1CY6A 1Q0PA 1R6BX 2VVTA 2WHYA 3H3XA 4BLPA 3UMGA 4CGYA 3ZN2A 1F5NA 5DOVA 1L5HA 4M60A 3SPXA 2RB5A 2RG1A 4HK4A 1MEJA 1WXDA 1WZIA 1Z2AA 1JR4A 4J43A 4KMOA 4L8LA 5G1OA 4GLOA 1L4NA 1C30B 1KYYA 1SVNA 4HAUA 2HGSA 2YJZA 3NO4A 5EVJA 3K92A 4OJQA 3TJMA 1YC2A 3L8CA 4ME6A 3Q3JB 4URYR 1T6XA 4BNMA 1B8VA 2A0XA 1H8EA 5KAMA 4OHCA 4ZGWA 2Q62A 3HCBA 4O4JB 3L77A 5ES3A 4B3GA 4G0MA 2ZJ2A 2XT6A 1FRZA 1XXHB 4W1PA 4BCBA 4HRAA 2I4MA 5HDQA 3A28A 3K32A 4YBZA 5FYDA 5KJCA 3DGFC 3HVJA 1SCDA 3VV3A 1N6OA 2JAXA 3EULA 1I7PA 2Q6IA 5DNDA 1Z6GA 1Y5LA 4GE0A 4EMTA 4BMZA 5K0SA 1U9IA 4Q9IA 5C31A 2E85A 2QMHA 1JHZA 2FUKA 3ZV3A 1BS2A 3C6ZA 4B3HA 3RSFA 3DYVA 1LSUA 2IEZA 4FS3A 3KEMA 4GRIA 4NBUA 2HU2A 2ZM5A 2GVNA 3R6WA 1IG0A 4TXLA 4WRRA 3P45A 3ROXA 3SDZA 3NM5A 4FQ8A 1W52X 4FYWA 4DR5B 3OTWA 2ZREA 1LI7A 1EZ4A 5JH7A 4RNDB 3S27A 1Z5UA 4MVJI 5EJ2A 2OBNA 2Y67A 5HTKA 3RSCA 1QQ5A 2FZGA 3R9XB 2J9XB 2WFZA 2AG5A 1EGVB 3RYFB 3G8AA 3KXLA 3PFCA 4EY6A 1EHCA 2F59A 1KDTA 1NAHA 3PC4A 5SZIA 4EWLA 2Z5VA 5B1IA 4X65B 2QN7A 3GDHA 4EYQA 5JZ9A 1U8CB 1AGRA 4NPHA 2ZVPX 1MW8X 3LUFA 4L5BA 2Y1LA 4HR7A 4NQZA 1ENPA 1U2DA 2ON6A 3PQ7A 4OYYA 1WTAA 1CS0A 1Y8AA 1NN0A 3CBQA 3I9FA 4LSWA 3GMDA 5EKDA 2MSCB 1VPVA 4MLPA 1G3QA 4Q3DA 2EYQA 2ZBPA 4DMFA 4J0CA 4QJBA 2GNOA 1ZOLA 1W4RA 3GJSA 2FJ0A 3REGA 2A9OA 2JBHA 1JDJA 2FEOA 2PFSA 3COPA 3LT0A 1QONA 2XI4A 1O7JA 1VYHA 4FGZA 4DLUA 3T06B 3H0CA 3HXKA 3PPIA 1U2TA 2NU6A 1WWKA 3L0CA 4YJFB 3G6KA 5DHAA 3ZGOA 4GSYA 2PUBA 3CVXA 1USIA 5CYOA 4N01A 1VPEA 4CT5A 3DV0A 2C04A 1GIAA 5KSOA 1KDRA 2QVCA 2Q1WA 2WF8A 1XCLA 4NMHA 4PTLA 2F17A 4O5OA 1LLDA 1IHDA 5CLGA 2G1UA 2EWMA 2Y1KA 2FMFA 3E7WA 2WKPA 2BY4A 4JLMA 2GUGA 4LE2A 2I8CA 4G24A 4B7ZA 3T15A 4NVRA 4O2AB 5H8WA 4RHTA 2Q3LA 3D5TA 1GUFA 1NF8A 4ZQEA 1GPKA 2BGUA 1SOWA 4KPFC 5ITZB 2J0EA 3JQAD 2EBWA 2H2DA 3TVYA 3LM8A 3QV1A 5FOQA 1YBMA 4F46A 5JRZA 1LDMA 1UCFA 3ZNNA 2H4ZA 4FGKA 4N7RA 3U3XA 4PWZA 2OPBA 5EE1A 3HXPA 4HAIA 1W7AA 4FDTA 2VP4A 2AC2A 3A4YA 3BXEA 3KTAB 1ILWA 1BA3A 3RT9A 1GZUA 3UVEA 4PZLA 4DEVA 1KIMA 2EP7A 1P4SA 4RCYA 4WFQA 3PEWA 4Q34A 2K5UA 4MRAA 3OZGA 3AVYA 3H05A 2OOKA 4LAFA 5FI3A 2ZYDA 4X6UA 2GBPA 5FAXA 5HDBB 5FR1A 2JKVA 4BUCA 1EUCA 1RU3A 1PNVA 2H8GA 3KQUA 1F0KA 3QOWA 1EP9A 4JWKA 3QVTA 2J3JA 4JU8A 2QPLA 1M72A 5HZKA 3GC6A 3PP8A 1T2CA 3SXUA 4WAUA 1XNGA 3OZUA 1UF9A 1JBEA 2EKDA 2JFNA 2MMGA 3DV9A 3IS3A 1L5QA 5BSFA 1NXQA 3IAFA 1A95A 1FP1D 2W83A 3L2OB 1YZTA 2BKLA 1C3XA 3BJZA 3I45A 5JATA 2BH2A 3D7RA 1LPMA 1XP5A 3BMCB 4MYRA 4UBJA 4ASUA 5F2NA 1A5ZA 4TUYB 5D86A 3WIVA 2V5VA 1Z8FA 2D2IA 5J4HA 3PK0A 2G1PA 3O8DA 1A88A 4O2LA 3RARA 3B3GA 5B1YA 4TL8A 4YIHA 2ZS9A 4RJKA 3AEQB 1KZHA 4C04A 1IUKA 2HREA 2IIBA 3U80A 1S2GA 4F2HA 5LXTF 4OQEA 5IJ9A 4RMIA 1N9GB 5JXIA 2ADOA 3VZSA 5TLSA 2GHIA 2VQEB 3WK4A 2O0MA 3BIJA 5CPBA 4ZHQF 1QB8A 2EF1A 4F1JA 3RVKA 4AZ3B 5JC8A 4XQCA 5GV8A 3ZE6A 1VYUA 3GG2A 2IF0A 3NPAA 3IAS6 1KNXA 1KE1A 2WSBA 1SKYB 1Z45A 4XR4A 4E22A 2P9YA 4MVYA 4U2FA 2GCIA 3D6MA 2QJRA 1CYDA 2BEVB 5DBHX 4QYIA 2C4NA 3IUJA 4N39A 5EESA 1ORDA 2BMDA 2HADA 3BB3A 4KGVA 2V7QA 4NABA 1V11B 1WLSA 3L1JA 5B2FA 3MBOA 3QVUA 1Z34A 3F5QA 1PT7A 2BCJQ 3JX9A 1FQKA 2EFJA 4OHZA 3NDIA 4TRJA 1GZ7A 5FHRA 3B1YA 2H2WA 4RAOA 3ZU2A 1Y1TA 4L95C 2F67A 1P7CA 3UMMA 5SY6A 5J43A 1E0KA 3ZIAD 4JHXA 1E6CA 4O4IF 1NX6A 1MO3A 3PB3A 1JQKA 2RHJA 1G8MA 4V0NA 1YMUA 2D62A 2GSWA 3AU8A 4IKOA 3QVJA 1ZK3A 1ISRA 3UMSA 3CXUA 3ZWYA 2AZMA 5T5QA 1GG8A 4MZXA 4G1CA 4BVKA 2FZVA 2QAJA 3LCCA 2IEBA 3TEMA 4R1LA 1FYWA 5HR5A 1Q7TA 2HIMA 3SZRA 4ZAVA 2OCAA 3K73O 1D6MA 4Z9AA 3BIXA 3C98A 6GPBA 4ER0A 3NVAA 1ZRHA 2WNSA 2PX4A 4CQMD 1GT91 2WG1A 3JVIA 5I7SA 1U0GA 5CVVA 5EUQB 3ZDCA 2R4QA 3FVQA 3NWOA 4C0QC 5CG2A 5KVCA 1F4LA 4D46A 2BM9A 3OD1A 4YRQA 5L51A 4JI3B 1KXZA 1KVQA 5CR9A 2X7JA 2ZRDA 3EFHA 3L4JA 1UZMA 4MRPA 4DMKA 1WKVA 1GR1A 3UMFA 3S29A 1JPUA 1XC7A 4LE0A 4EKDA 1NUHA 5B64A 1RR6A 2QL9A 1UPUA 4R2XA 4EA6A 4DBZA 1MC5A 4GI5A 3U56A 5DFAA 2VYVD 3DP7A 4XM0A 1SEVA 4KPUB 3I92A 4P2BA 3T38A 4MQUA 2NO7A 4BKOA 1K0UA 1WHTB 3ST7A 3WYDA 2GM4A 4GKKB 2GVDC 1DGQA 1WZ2A 2JH8A 1TTPB 1XTVA 3AOEA 3BILA 2HPZA 5AT1A 4AQYB 2UU9B 4WZAA 3R3WA 1MR3F 2I66A 4YDSA 2QJWA 5GQSA 5K4HA 1YCDA 1Z39A 2GK6A 4BCCA 4QC2A 3GJ4A 4C7OB 3DC2A 1FFHA 3OCVA 4WJZA 1CULC 3VR6A 1K7SN 3KSBC 3R0IA 2F1OA 4FS8A 1KYVA 3PNQA 4DEXA 4X20B 5DWVA 1Y6JA 4RMGA 4WCFC 3R40A 4ZVOA 4EHKA 5KPDA 1Y7HA 3V1KA 1K9VF 2PD4A 3JARA 3P2KA 4L3VA 1ZLXA 2JIQA 2QRVA 4HH3C 5THKA 3ZDEA 2G36A 4R40A 4RFLA 1PQ4A 5BSUA 3ZBQA 3MJDA 3KOZA 4WDQA 3RRJA 4Z6KA 4L9WA 3DVAB 1W1IA 1UBSB 2AKEA 4FNGA 2G7ZA 4LSMA 1G21B 2WJHA 2XUFA 3AFOA 5TPZA 4B6RA 3UW3A 2HPHA 4HNSA 2YHSA 4C05A 3HY3A 1ZM9A 2D8AA 4R2JA 1S8AA 3QQ5A 2AHOA 4JBIA 3D7LA 3PDIB 5I51A 4KDEA 1SIBE 4KX5A 2HA0A 1T4MA 1ANKA 1LRLA 1PQPA 4FLEA 4IIUA 3TQQA 1SUDA 4D99A 2J5XA 3A2KA 3ROZA 5B3KA 4RPLA 2GKGA 4HAYA 2BLLA 4BO4A 5BVGA 4R9VA 5ILOA 4N6NA 4IRXA 2D8MA 4X91A 2YN4A 1C4OA 1LLUA 4D43A 3LYAA 1JLLA 1WULS 2CBZA 1SEPA 3AGQA 2XTNA 3CLRD 4W8GA 3CZ9A 2I2BA 1A9OA 4MR8B 3TZLA 2O0KA 4UU7A 2GCGA 1ICEA 2O2GA 4ZMRA 4LJ4A 4Y6QA 2R62A 3IVGA 2H52A 3UXYA 2OHVA 2A9PA 1SZDA 3GRKA 1QK5A 1YBFA 1OZGA 3L7LA 3QNWA 3S1SA 1T9ZA 2V3WA 3UJPA 3IB3A 4WEOA 4UAGA 5K0TA 3JQBA 1VSVA 1FUIA 1Y9JA 2WMOB 3OLXA 4Y2TA 4YECA 3T7TA 3OPYA 1DAGA 3FHOA 4OKSA 1YASA 3A1WA 4KQGA 1VKZA 3WIUA 1I4DD 5CX4A 1KZGB 1R74A 5EFZA 3G5UA 3VPAA 2BBSA 2OSVA 3LI2A 1U65A 5ICFA 2ORVA 4PLFA 1X92A 2ZRCA 3UIEA 1V8OA 4G0YA 4Y1FA 2FCRA 4ZOQI 5LP6B 3HYSA 3EUFA 2QTFA 4K9NA 4XWAA 1SGWA 2IUFA 3HA5A 1T13A 1POXA 4RVGA 1VFPA 4EB6A 5CBPA 4QX6A 1O95C 1XVIA 4B87A 2VBGA 1LY1A 1FW8A 3UPUA 2H5IA 1GGFA 3AJEA 4NG5A 4ONEA 3DWIA 1P2VA 4A73A 4CFZA 4JL6A 4CF7A 1C3VA 1DBIA 2CLFB 1OUMA 1NHGA 3X1YA 4PQFA 2WWIA 4AROA 4Q3NA 4X7BA 5LZ9A 4DV5B 1BE0A 4PQRA 2JJ2D 2RH8A 3DPUA 2I1VB 1T2AA 4AP5A 5GPBA 4G5XA 3W2GA 5EWMB 3ZWBA 1I7NA 1Q15A 1DV1A 3IA2A 4GP9A