3QSYA

Recognition of the methionylated initiator trna by the translation initiation factor 2 in archaea
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
415
structure length
415
Chain Sequence
b'MAWPKVQPEVNIGVVGHVDHGKTTLVQAITGIWTSKHSEELKRGMTIKLGYAETNIGVCESCKKPEAYVTEPSCKSCGSDDEPKFLRRISFIDAPGHEVLMATMLSGAALMDGAILVVAANEPFPQPQTREHFVALGIIGVKNLIIVQNKVDVVSKEEALSQYRQIKQFTKGTWAENVPIIPVSALHKINIDSLIEGIEEYIKTPYRDLSQKPVMLVIRSFDVNKPGTQFNELKGGVIGGSIIQGLFKVDQEIKVLPGLRVEKQGKVSYEPIFTKISSIRFGDEEFKEAKPGGLVAIGTYLDPSLTKADNLLGSIITLADAEVPVLWNIRIKYNLLERVVGAKEMLKVDPIRAKETLMLSVGSSTTLGIVTSVKKDEIEVELRRPVAVWSNNIRTVISRQIAGRWRMIGWGLVEI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Translation initiation factor 2 subunit gamma
molecule tags Translation/rna
source organism Sulfolobus solfataricus
publication title Crystal structure of the archaeal translation initiation factor 2 in complex with a GTP analogue and Met-tRNAf(Met.)
pubmed doi rcsb
total genus 47
structure length 415
sequence length 415
ec nomenclature
pdb deposition date 2011-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3qsyA02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3qsyA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3qsyA01
2P5SA 3MWJA 3ONWA 2V3CC 2BCGY 3C16C 2RC5A 3NBXX 1AS2A 3MWYW 1CRQA 1Z63A 2WICA 3L82B 2VEDA 4DDUA 1ZU5A 3JVVA 3LAWA 2XGJA 3HWSA 2W58A 3CWZA 3GLHB 5IHPA 4OBEA 1G3IA 4ASUD 2VNJA 3A4NA 4UXJA 2CDNA 4Q1FA 4D26A 1CULC 1KTVA 2CE2X 2E9SA 2FN4A 1GJRA 4FWIB 3W34A 2XTNA 1TTTA 1WP9A 1WMSA 1UADA 4TN1A 4LJ9A 1G7SA 1F2TA 2IA5A 1OJLA 3AV0B 1RZ3A 4A0RA 5AUOB 1A82A 1FNNA 4OQXA 5DNYB 4UJ3A 3K09A 3B2EA 1X8LA 1D2EA 3W5UA 3IEVA 2NQ2C 1KDOA 2HYDA 2IBMA 3A4LA 1Q81D 1W0KD 2FSFA 3FDIA 4PC1A 3EZ9A 2NZ8A 3JZAA 3OE7A 3GJ3A 1ZBDA 2JCSA 4HAUA 2NO7A 1DBSA 2C2HA 2QUZA 5C4GB 4DCSA 4B3BA 5IDVA 3MSXA 2G88A 3RRNA 1NVVR 1W36B 1JR6A 1E0SA 1S72B 4PX9A 5KNBA 1A2BA 2D4HA 2RGBA 3ASYA 2WWIA 1AQUA 3IPYA 4HB0A 4LV5B 2FFAA 4MYTA 3MJHA 1FUUA 1JA0A 1W47A 1A4RA 3TMKA 3DDCA 2RAPA 1N25A 2WSSD 2LKCA 2QSZA 3EPKA 2ANBA 2XTMA 1I2MA 2EW1A 3D6TB 1YRAA 2ZIAA 2OG2A 3BBPA 4YHBA 2XNDA 1ZAKA 1TEVA 4URVR 3IHWA 4RD4A 5GVSA 3F8TA 1T6NA 2AD1A 2OBNA 4IDNA 4EPTA 5JLJA 3EIQA 3G4SB 1IM2A 4RFSA 1R0WA 1A2KC 1G4UR 1GRRA 3BE4A 3B9PA 4K46A 4YXWD 4R2HA 2NPFA 3BH6A 1NRJB 1GZSA 1G8YA 1Z6YA 2FMXA 4AKIA 3WP1B 3NKVA 1XTQA 4LJ6A 2OUKA 2GXAA 4LYHA 5B57C 5GADl 2PZGA 1F2UB 2ZR0A 4GOJA 2ZJ2A 1XCMA 2HDNB 1CJKC 4FI3C 4Q4AB 1Z0FA 3SNHA 1YR8A 2ATVA 1XCPA 4UQOA 3RSLA 4F93B 1E2MA 4XD7A 3BWDD 1FNCA 1N6NA 4TL6A 1HQYE 4RD2A 5C1BA 2CCGA 1WQ1R 3EWSA 5HCIA 3ZBTA 2D74A 1FUKA 1KAGA 4A0GA 3GEEA 4N1AA 5TDHA 3CRRA 2CNWA 4UKDA 3K70D 2CCJA 2ECKA 2KJQA 2YOGA 1NLFA 2VF8A 1VQPB 2AKYA 3BAFA 1Z0IA 2DERA 4G0NA 3CH5A 4B34A 1VECA 1CJUC 5LDDC 4AC9A 3E20A 5B64A 3G0HA 3GLIE 4X8MA 2NO1A 2ZRJA 5F98A 4KFSA 4A36A 4BEJA 3B1VA 1YR9A 1U99A 3G82C 3OE7D 4BEBA 1W46A 2QAGB 2ZRFA 2KI5A 3CX6A 3KQKA 1J99A 2JA1A 4DB4A 3QBVA 3SU8A 4XWKA 2H7VA 2IS4A 1E1QA 1GNQA 1ESNA 4G1BA 4Q4HB 4YMVA 2QP3A 3K70B 1F3OA 1W7AA 1XTRA 3AKDA 2ZRDA 3RS0A 2VNHA 4HB3A 2QRZA 4M1TA 4PPQA 1DS6A 3VU9B 4O2LA 1P4SA 5TMPA 1WXQA 1GRNA 4OI1A 4GZLA 5FOUA 2R9VA 3SJBA 3GLHA 5EE9A 3Q9LA 5DN6D 1B0UA 1NG1A 1VCOA 3QXJA 1S96A 1AK2A 4JT4A 2PL3A 4FMDB 1P72A 3BORA 4XJXA 3H86A 4Q1DA 3EIHA 5AUNB 4ZI2A 4YAOA 5E7JA 3QUSA 2RGCA 3QENA 4TQAA 4PQFA 1FNDA 2RHMA 5EE3A 1HT2E 4E03A 2HCBA 1JI0A 1KKLA 4B3GA 2XX3A 3CR8A 4URXR 1KAOA 2A5GA 1R5BA 3TUJC 1CIPA 5SZHB 2ZPTX 4TYPA 5JSZA 5JRJA 1AGPA 3GP8A 3TBKA 4TZ0A 4TMVA 1NN1A 2Z43A 1RYHA 4DLXA 5F9HA 5A4JA 1S9HA 3AF2A 4RKEA 1BH2A 2D3WA 1RPZA 2GZAA 3PVSA 2CLDX 3WRXC 1OLOA 4O0MA 1NBMA 1SHKA 1AS3A 1CJTC 3QKTA 4ITRC 3REFA 1G3RA 1GKUB 2D06A 2OCPA 3L0OA 3LFUA 4RCZA 4CZ2A 1KHTA 4JLDA 1OB2A 2JLQA 1E2IA 3R9XA 5CLLA 3NH6A 3QKSB 4DZZA 2JLXA 3TK1A 1BX1A 2PJRA 1CQXA 1TU4A 1TUEA 1Q44A 4MRNA 4MRVA 4NMMA 5JBQA 2PH1A 3JQQA 5GJWC 2FX3A 1S0UA 3Q85A 4C0BA 3EARA 3AQ4A 3RAPR 4KVGA 2NGRA 1D2MA 2A9KA 2WIBA 3X1YA 2GCOA 1OE0A 2ZXUA 3K9LA 1DAKA 3FWYA 4MRRA 4D0LB 1HA3A 2G3YA 4GMXA 3CNOA 1COWA 2EVWX 3OHMA 4TMZA 2QP9X 1IQPA 3NC1C 1GL9B 2ZJBA 1E9CA 4E09A 4ZDIA 3CB4A 3MD0A 2QQ0A 3LW8A 3N70A 3KDSE 3I5XA 2AFIE 3C5HA 3BH0A 1TAGA 1I2DA 1KKMA 1CRPA 5DGXA 3PXGA 2GNOA 4JBWA 2AHOA 1U0JA 2GEDA 3K53A 4GP7A 1I4LD 2ZU6A 3BB3A 2JIZD 3FFAA 3L43A 2OTJB 4EQ6B 2REXB 2HLDA 2OZEA 2I4IA 3KZ1E 1CXZA 1E69A 2ERXA 1LNZA 4ZV4A 5J5CA 2C99A 4TWZA 1L7VC 5B2ZA 1TQ4A 3AGPA 1E98A 4V0LA 1GP2A 1OHHD 3PR1A 4P4UA 5KTYA 2HT6A 2X2EA 3A36A 1NNEA 1KY3A 4EPVA 1VPLA 3PJRA 4NZYA 3QFTA 2REBA 1VG8A 5F2EA 3WMGA 1NVXQ 1W2GA 3FE2A 3PUXA 1JR3D 4XIGS 4R71A 3ZIAA 2GK6A 3S1AA 1KI1A 1JJ7A 3R9WA 3OFND 3UANA 4TLBA 4NP6A 4ON9A 3NBFA 1G21E 2J9RA 4LUCA 3RDPA 1KI2A 2VZLA 3AVVA 3LBIA 4NTZA 5KO2A 2XXAB 1FRQA 3QG1A 2Q0HA 1Y63A 3HR8A 4RFSB 1JBKA 3RC3A 4M1OA 2JIZA 1QGAA 4EQ6A 4PR0A 4I4LA 4I99A 3N5CA 2RH5A 1LV7A 1IONA 1Z22A 2BSAA 2GTPA 2A5FA 2ORIA 4R9UC 4RD6A 2IC5A 4MGIR 4NL4H 4QJ3A 1N0WA 3PV0A 1XMVA 4RVCA 1G291 1ZYUA 2GAAA 5EJEA 4Q21A 3EAQA 4P0TA 1Z2AA 1GVHA 2ZITA 4EKDA 1DO0A 2GJ9A 3AEZA 1QHSA 3THYB 1Z0DA 2YVUA 3LV8A 3RS3A 1PUIA 4L9SA 4LWZA 2ZI3A 4ZDWA 2OK7A 1DARA 5KOYA 1GG2A 3LQQA 4YLGA 5EP1A 4GOKA 5C46F 2C77A 1VCNA 3MHPA 1NMYA 5L3VA 2FE4A 1T0HB 1KZ7B 1FPMA 3LO5A 4EPXA 4PPFA 3DO6A 2R6GA 4FK8A 3LVRE 5JS8A 1KRHA 1VYUA 1XF9A 1N6PA 2C03A 4MKIA 4OQFA 3SJZA 3B6EA 1D1NA 2CVFA 3CMAB 2W0SA 5JWOA 1VYVA 2Z6VA 3QVUA 4B44A 2OFWA 2A3RA 4G5SA 4LJ5A 4TQUS 3KQLA 4XWAA 2W6JD 4C7OA 4KITB 4TSFD 3B1YA 1SXJC 1WA5A 2BGIA 2BJWA 5EZ6B 4MQBA 5FUWA 4TLEA 4Q18A 3HP1A 4Q03A 4DB2A 4CIDA 1QVGB 2WTUA 3HU3A 1XE1A 3A1TA 3PENA 4HLCA 2GK7A 5AK0A 4UAJA 4OYHA 4TTRA 1U9IC 1GNRA 1BO6A 4L9WA 3GLIA 3LNCA 2G6BA 1UPTA 2ZVQX 2B92A 4JBXA 4JZKA 4U5XA 3UKDA 3W6PA 4JLJA 2W2XA 3A37A 3THXA 4PO8A 3ZYCA 3U6BA 4DT1A 3CCEB 5THXA 1NMXA 2OM2A 2CK3A 4CEHA 3A58B 4ZGQB 3I55B 5IRCD 1SM4A 3VX3A 1OIWA 3VR3A 5BXQC 3R8FA 1IN6A 4UNRA 2ANCA 3CR7A 3BD9A 3FPKA 4GMDA 4KCGA 2IWHA 4C0JA 3AVXA 1P73A 5H68A 1PVOA 4M4SA 1IN7A 4G3XA 4GP6A 3K70C 1VQ6B 3W5HA 2FA9A 5FUXA 3FB4A 2V1UA 4C0SA 4HZUB 2OEPA 4BE7B 3WBJA 3GFOA 1W0JD 4M8NE 2DWQA 3ADKA 4IHQA 1N6IA 1BMFD 3RANA 2J0UB 2ZM5A 4HLUA 1YVDA 1E2LA 2QM7A 2HUPA 3GMTA 4LOAA 4XWOA 3ZVMA 3KUCA 5HZHA 2ONKA 4JL8A 3IKJA 1VCIA 3EZ6A 5DIFA 1W4AA 2KBFA 4DCUA 2ODNA 5JZVA 1SGWA 1R7RA 2BMDA 5F9FA 3B85A 4OL0A 5KYKA 4MGZR 3IILA 3T1TA 2PCJA 3C4JA 4LHZA 4RZXA 3WY9A 1TL7C 2RMKA 3R9IA 4YMUA 3AVTA 3SFZA 5KSWB 2FDCA 4YAFA 1VIYA 2IHBA 1EESA 2F1HA 5JWRA 3MUFA 2HJGA 4NYJR 1H85A 4DKXA 1YZUA 4CVNA 3G71B 1G3MA 3TQFA 2QTFA 1E6CA 1I4DD 5CITA 1S4QA 3TSWA 3C15C 4PO1A 4WVFA 4BFWA 3CCRB 4BLOA 2CL7X 3AKCA 2KE5A 4P4TA 1II0A 3VO1A 1OFHA 2YV5A 2VHJA 2B8WA 2ATXA 2DFLA 4DVGA 1XXHB 4LBZA 1JAHA 1X6VA 4MRSA 4XVRA 1ZIOA 4NCJA 4B33A 3CCQB 2PEYA 1JXOA 3V4RA 3B5JA 5FUVA 3CIOA 1NDHA 3CF6R 3GJ8A 4DLRA 4G1UC 1F2UA 2NG1A 2OLJA 4B2LA 4GL2A 2GJKA 5DSZA 1F20A 3MRSA 2JJ2A 2ZETA 2QBYA 2DCUA 1T3SA 3IBGA 3I5YA 5GJVC 1TQ2A 1Z08A 3WRYC 1LF0A 2WSSA 4KV9A 2HT1A 1A8PA 4C7OB 3OEEA 1T8UA 3CCMB 4QBIA 3F3YA 3AVWA 1S1MA 2OLKA 1C4OA 3NVAA 4LI0A 1PV4A 1XJ0A 2XNDD 3VFDA 3PUZA 2J7PA 3T35A 2GXSA 4LRWA 3VO2A 3MGCA 3RSOA 4V0OA 2QDXA 2IXEA 1WRBA 2VL7A 4WAUA 4A1FA 1M1KD 2QAJA 4BGDA 4C0LA 4PSVA 4HEJA 5TARA 2WPDA 3J81k 3T06B 2QT1A 3REGA 4CGZA 2ZQ5A 3IO3A 1E2EA 2QE7A 4NCIA 1H8EA 3KQNA 1ZNZA 1QGZA 3KXIA 3SYLA 2IL1A 5LB4A 4Y9RA 4H9GA 3BS4A 1G1MA 4QGFA 5A5GA 1MRSA 1ZMXA 3W5VA 1G8HA 4D4MA 4JSTA 3FMOB 4M21A 2CCKA 3KKNA 3FGNA 1Z6GA 4DCVA 1Z0JA 3AP3A 2GA8A 1VCMA 1N5LA 3QE0A 1W2BB 5BN5A 4N3GA 2OE2A 1Q20A 1QHNA 1XNJA 3IQXA 2BWJA 1ZVQA 4B3XA 1DVRA 2FJUA 1DAIA 4NKRA 2EYQA 4JLAA 5FOVA 5CK5A 1O87A 3K0CC 2ZRMA 2CMKA 1X8KA 4AK9A 4CEIB 1GM5A 1W35A 1IXZA 4M9XA 2JJ1A 1E4VA 2CRVA 1BOFA 2PCLA 3AKEA 1FQJA 5DISB 1W36D 2ZUDA 1VTKA 4YQFA 2QG6A 4Q47A 4DIDA 2IXGA 1ZINA 1ZD9A 1SKQA 4QXAA 1KK2A 1E63A 4RD3A 4HE5A 3IQWA 4P32A 1VHLA 5H1YA 4PZZA 3VAAA 2QE7D 4WBSA 1P9NA 3GEIA 1UKVY 4C43A 1YR6A 2BC9A 4KBFA 4HUQA 5CLQA 4ZIRA 4RJLA 2QA5A 3CF2A 1J7KA 3CPWB 2GF0A 4KO8A 4TLDA 5HTKA 1NJGA 4TL7A 2R6AA 3QKSA 3KQHA 2PLFA 1IBRA 1HE1C 3THWA 3GJ6A 4CEJB 2WWHA 2GXUA 2JGNA 3ZD7A 2JASA 1JJVA 2QPTA 2Y8EA 4POAA 3VHXA 1EWRA 1N6OA 1XTSA 3GCGA 1KJZA 4EJSB 2NZJA 5DN6A 1AM4D 2XJ4A 2Z83A 4V0MA 621PA 1MABB 2ZRCA 3KJGA 3SQXA 2GRJA 2ZR9A 4NYIQ 4QJ5A 1HT1E 1NI3A 2D2EA 3BFXA 4YALA 3H0KA 4ARZB 1GVNB 5JEDA 2VYQA 1EP2B 2Z4SA 1U0HC 1VQOB 2C9CA 1KI7A 1U90A 5HKKA 2BMEA 2ZANA 3QKUA 5DO9A 1OHHA 2C9OA 2J59A 3LO8A 2V4ZA 3M4YA 1J70A 1RFLA 1LB1B 2D2FA 1KI4A 3GFPA 1W49A 3PEUA 5KSPA 3MLEA 2JLSA 3W6NA 1W4CA 4LHWA 4JJZA 4NCNA 1FZQA 3CCUB 2G9NA 1XD2B 5CJ2A 1UAAA 3UWKA 2RCNA 4B6FA 3OZXA 4TMKA 2GEUA 2OV2A 3B7GA 4IJMA 1CJVC 4A92A 1LS1A 4BFSA 1Z2CA 5KDOA 5L3QA 2C5LA 2IUSA 4AY2A 1JQJC 3W3AA 5CIWA 1N6HA 1UMKA 3HU2A 3ZJYA 3T5DA 4L4UA 4TT3A 1NG9A 5C18A 1UKEA 3E2IA 2H92A 1YJ9B 1CR2A 3TSOA 3P27A 2ZRLA 4JLMA 1RKBA 3C14C 3L0PA 4D81A 5ANRB 2VP0A 5FUYA 3FKSD 4HYYA 1E1RD 1MO6A 2QNRA 1HH4A 4Y0AA 5JMTA 2IX3A 1MOZA 4YAWA 3CCLB 3NDBB 1Y3AA 1B2RA 2NO9A 1QG2A 2J45A 3KX2A 4MITA 1AS0A 1KO4A 1ZM9A 3OIVA 3B1XA 3GLFE 4G5RA 4OI0A 3T61A 1VQNB 1NSFA 1YITB 1QRAA 2QGNA 4UXIA 5EUQB 3TH5A 1KK1A 2IYZA 4R98A 4LJAA 1LS6A 1OKKD 5FOWA 2MSEB 1FOEB 4KODA 1ZP6A 5HR5A 4PZLA 4UJ5A 1DAEA 3DOFA 1ZCBA 1QDEA 2DWOA 2BBWA 1BYIA 1ZIPA 3QPWA 4PXAA 1CNFA 5G40A 1DAMA 2P3SA 3SJAA 3SOPA 4DWJA 2BMFA 3TJZA 3ICEA 3U7GA 2GQFA 4GI7A 1Q0UA 1KJYA 3K8YA 4M9ZA 1T8TA 4M1SA 1IY2A 1ZNXA 2RKOA 4LCBA 3BC1A 3SR0A 2CL6X 5G41A 1SVMA 2KBEA 4X8LA 3UWOA 4IVRA 1VQ4B 2O8BB 1FP6A 1OPXA 1R6BX 1E2QA 4G5QA 3SI7A 4JVLA 1W1WA 5B58C 5FTNA 1N2CE 2VP5A 3THXB 3EZ7A 4V02A 1RRGA 2P6UA 2J41A 3RLFA 1RE0A 4P3YA 3IIKA 4YONB 3CRW1 1YZGA 3QF4A 2J46A 4M1MA 2RGGA 2X3UA 1PLLA 2WM9B 4PC7A 2PZEA 2VSOA 4JMPA 4MDEA 2W6IA 1OIVA 1E99A 4NHOA 3W2IA 4NE2A 4MDFA 2QMEA 4KFRA 1ZUIA 5D3MA 1SVIA 3U44B 5TY0A 1ZC3A 4ZCMA 2BBOA 4F4CA 4C3ZA 4ZO4A 1H8HD 4GNKA 4Q4HA 4U02A 4V03A 4FXPA 1FMJA 2CK3D 2OXCA 4LYFA 4LHYA 4TMTA 2QN6A 1TLLA 2NTYC 2X2FA 4KAXA 4D4LA 1G8PA 2WKQA 4D0GA 2O8EA 3HYTA 4OI2A 1YRBA 4LZZA 2CLCX 3QF4B 1NLYA 1QHYA 4B71A 1FW6A 1NVWQ 1KMHB 2UVQA 3PFIA 1EK0A 3LLUA 2GESA 1XBTA 1JA1A 3UG7A 2DFKB 5KPDA 1RW4A 4ASUA 1F48A 3SN6A 5EQTA 1QHGA 5HCNA 1VQ7B 1OW3B 1BYUA 4S35A 5FI1B 1AJEA 2B7CA 4Z8XA 3EIEA 4PANA 3PG5A 4DJTA 1F2TB 4OJKA 4OHWA 3E5HA 3VMFA 3UATA 2BMWA 1E9RA 3C41J 1ZCAA 3GLHE 1KDRA 3LQRA 4HATA 1N0VC 3WYAA 1KQSB 1KGDA 1CBUA 1MO3A 2QQEA 3QOFA 4IKEA 2LCFA 4G1VA 1CEEA 2IHYA 5EXTA 1C1YA 4DLVA 4RZ3A 1YZLA 5KSOA 2WJVA 3L0SA 2VBCA 1UBGA 5JJIA 2H18A 1N5KA 1QVFB 4KSCA 3K0CA 5CDFE 4TL8A 4XH9B 5CJPA 2VIIA 4MKGA 3O8CA 2KB0A 1Z0KA 1II8A 1W48A 2QMUA 3KFVA 4DUGD 3FJOA 3CC7B 2P0EA 2XB4A 1KMQA 2ZYTX 5KSZA 1DAGA 1EFRA 1SXJD 1YKSA 4JVSB 4NU0A 5CYPA 4C0HA 1TEXA 2IF2A 2V54A 3V9PA 2WZQA 4WXPA 2AWOA 4JYCA 5K8TA 1P2TA 2I1VB 1IHUA 4RSGA 3T1OA 2GCNA 4CW7A 1ZD8A 4DSOA 1JALA 1T9HA 2SHKA 1TNDA 1OF1A 3RHFA 3CRQA 3E1YE 1Z5ZA 4HAZA 4M9QA 5FFMA 3EPLA 4HI0E 2IYUA 5DYIA 2G0TA 4E5UA 3SFVA 3LDAA 3SC3A 2V7QD 3DEFA 4GBMA 1II8B 1KDPA 4AD8A 2BVNA 3RNLA 4LY6A 3GQBA 3CZPA 2QP4A 3A1SA 1M34E 3DPUA 5EP4A 2QPAA 1AA9A 4DLYA 4JBYA 2GKSA 1TMKA 2H5EA 1N3BA 3THOA 3FYHA 1T4GA 2R2AA 1ETUA 3QXCA 4N0DA 4RD0A 1RRPA 1KO5A 4AYWA 3UG6A 2HF9A 3TAUA 1X8JA 3O8RA 3TNFA 4QL3A 3OF5A 1QF9A 4PHHA 2REOA 4P4SB 2CJWA 1NBMD 1T0JB 2ZTSA 4A9AA 5JHGB 2PEZA 3CCSB 3PITA 4M2LA 1EFUA 3QF7A 4QNMA 1FNBA 2O8DB 2PJZA 4Z8YA 1H65A 1SVLA 1D5CA 4Q1BA 4ZDKA 5J4HA 2OBLA 3FMIA 1GIAA 1KOFA 1MV5A 3PUYA 2F55A 2XSZD 5IK2D 1N6RA 4AURA 3C5CA 3OW2B 5JCZA 5DHAA 3B8HA 4HE6A 3RRZA 1YJWB 4Y7CA 4KXFB 4BFYA 3WYFA 3QEOA 4BECA 2BM1A 4LC1A 1W4RA 1ODFA 1COWD 1JR3E 1EFTA 1DEKA 3HPRA 2YOFA 2WAYA 4RFVA 2PLRA 4DDTA 3HPQA 3PQCA 4MGKR 2GJAA 4B75A 1XB2A 4P4SA 4TTQA 2WAXA 4ZGNB 2GEVA 4AF7A 2IK8A 3KUDA 5L8VA 3H84A 2EFCB 1EX7A 1CR0A 4AF6A 4OK5A 3NHBA 1R10A 3AGQA 2ZJAA 5P21A 1B23P 2B21A 3CM0A 4MA4A 3UXMA 3P4XA 3IIJA 1K6MA 1G3QA 1HE8B 2ZROA 3WP0A 2ZYWX 2VO1A 3BIFA 3NBZC 1US8A 4Y9UA 1E64A 1VG0B 1II9A 4DEXA 5HXBA 4MKFA 2MMCA 2WWXA 4EUNA 4C0AC 1CP2A 1WF3A 1TQ6A 2FF7A 2XOKA 2PX3A 4JLOA 2FEOA 1XRJA 5SZIA 1MO4A 4Q1CA 4NYIR 2RGAA 3I8XA 4WOPA 3BFVA 1O3YA 2DFNA 2NO6A 2RGEA 4RD1A 4MKHA 2ZE7A 4GDFA 2EWWA 1KDTA 3WXMA 1YR7A 3UMSA 4W9MC 4DLZA 4URYR 4XOIA 3OEED 2JLVA 2F6RA 1P3JA 1XJQA 4RKFA 2JLYA 3JQRA 2CE7A 2XZOA 1P6XA 5AJVB 5LB2A 2O8CA 3AF3A 1Z83A 2OXRA 1ONBA 3T5GA 2G1JA 3E70C 5BQ5A 5LD2C 1S2MA 1QG4A 1SULA 2QSYA 2VYFA 1WB9A 1NP6A 4H1VA 3EXAA 4MYHA 2VNKA 4A2WA 4U9UA 3WHLA 4II7A 3GLFB 5FOSA 4XSHA 1YE8A 2FPLA 2VP9A 4OJQA 3D3QA 1KD1D 3VR4A 1NL3A 1IN4A 2DEUA 2EU8A 1WCV1 1QGYA 1M6NA 2ZU0C 4TYNA 2VHTA 4FMDF 5EP3A 1UKYA 2N46A 1QFZA 5J40A 2QEXB 5HE9A 3MWLA 1MKYA 3CPJB 3LRPA 2DYKA 1Q3HA 3SYNA 2CXXA 2UZ3A 3L8ZA 4U00A 4DCTA 4FINA 5GJBA 1GSIA 5L3SA 4RZUA 4JL5A 421PA 2VH5R 4US2R 3TW8B 2OESA 3FMFA 2FSHA 2I3BA 3U2QA 1IXRC 4AKEA 1UBCA 2R44A 2H17A 1NSTA 4Q7KA 1KJWA 1XPOA 1XP8A 4X8OA 2IYVA 2ZI7A 3CONA 2ZJ8A 1S8FA 1VMAA 2VRWA 1W36C 2TMKA 4JVNA 2JLWA 1AZTA 2VP6A 3FPAA 3GPLA 1NBME 2ZS8A 2O52A 1J8MF 3SHFA 1UFQA 4Q1AA 4A82A 721PA 1UDXA 2WJGA 4TZ6A 3GLGE 2H16A 3CMEB 3UIEA 2ORVA 1EFRD 5GVRA 1KYIA 1ZM4A 2WSMA 3ECCA 1FQKA 3LH5A 2H57A 5FTJA 5CDFA 1Q57A 4WZAE 4ZKEA 4DDVA 1G3UA 2RGNC 3NXSA 1U0LA 4DC9A 1G16A 1P9WA 3W2GA 2OAP1 3GEHA 4EFMA 4BLTA 3QXXA 5LD2B 2P6NA 2P67A 3DMDA 1ZC4A 1OXTA 4PPNA 4NONA 5CK4A 2EIXA 4FIDA 3HR7A 1UBFA 1E2JA 2IYQA 3O47A 3U60B 4PAMA 4IRUB 4KHZA 3ICQB 2YZ2A 3LD9A 1E1RA 1K8RA 1XZQA 2WKRA 1GAWA 1JB1A 3FKSA 3GJ7A 3MG9A 4XSGA 1BMFA 4TLAA 3UPUA 5BWMA 3DZDA 3QSYA 4IEIA 1Q82D 2GXQA 3OIYA 2GCPA 1VG9B 1BIFA 1PLJA 3EASA 2O8BA 3L2OB 1A7JA 1GAQA 2WMOB 1E32A 2LWIA 3X1WA 3P32A 2O8CB 2O0HA 2IWRA 1ZM2A 4ABYA 5EZ5A 3DMNA 4FCWA 3E1SA 1DAFA 4E22A 5L3RA 3QBTA 4PAQA 4CDGA 4KFTA 4URWR 2R65A 1YIJB 3CPHA 4Q4LA 1W44A 1E96A 4Q4AA 5FPTA 2OFOA 1QFJA 4D4JA 2J7KA 2IW3A 1L8QA 4JS0A 3BJIC 4QHYA 1Q22A 2EFDB 2MSDB 2P5TB 3OIUA 4B47A 3NDPA 5JECA 4HDOB 3W2EA 4YDSA 1JECA 1HTWA 1OIXA 5KDLA 4Z54A 1OV4A 3BOSA 3ZQ6A 2D7DA 1R0YA 3ZVNA 4Q9LA 2FZ4A 1UDWA 4HAWA 1JPJA 4BFTA 1E79D 2F3TA 4NDZA 4OHZA 4QBHA 4R2IA 2HJVA 3VR6A 1UM8A 1AKYA 2DR3A 3WHKA 1FX0B 3FFBA 5JWHA 1KSGA 2BOVA 4M1WA 1XD9A 4G01B 4Q1EA 1V43A 1FRNA 3W8NA 1G5TA 1OXVA 1XDBA 2GAOA 2W6ID 4KFUA 2BV3A 2IEYA 3HDTA 4DHEA 5FOXA 4XTRA 5EMNA 4Q4JA 3SHWA 1Z29A 5FBVB 3LWNA 4TSFA 4BFUA 5AJWA 2AX4A 2ZRAA 3KKOA 1FTSA 2V8OA 1K5GA 4Q5IA 1CF4A 2R8RA 4B6EA 2QORA 4ILEA 3I4LA 2O0JA 4LHXA 5FBLB 2FU5C 4ZKDA 3P1JA 2QT0A 1QUEA 1D6JA 1FFHA 2MMGA 3VNVA 1DDGA 3B13B 4ZPXA 4JIMA 3AF0A 4YC7A 2K5UA 3QVVA 4NBSA 2W2TA 1NVVQ 2QMOA 2A30A 4XVQA 2WJJA 4IVQA 4ZCIA 1OYWA 1ZRHA 2D62A 2FG5A 1R5NA 3PCRB 3U4QB 4M0LA 5EE0A 4J0QA 4DSNA 5DHFA 1G17A 1ZNWA 3AVOA 1EXMA 1E9DA 1HURA 3F0TA 5E95A 4PPGA 2ODWA 4B35A 5TVKA 4TYWA 1TVCA 2ZJYA 4US1R 1HQCA 1G41A 3HJNA 4HB2A 1SHZA 3RS4A 4PC6A 1HEIA 4OKSA 1L2TA 1KSFX 2ZAOA 2IYTA 3B82A 1Z06A 1TU3A 1N8RD 3VNUA 2GZDA 3JVUA 2HLDD 2QAGA 3NIBA 4B76A 5AWFC 3U4QA 1KI6A 1AMOA 3I73A 3CD6B 4EPYA 1U2RA 1IY1A 2BBSA 4QRHA 2FSIA 2BBTA 4LBVA 2WWYA 2QTZA 1WDTA 3U61B 3AP1A 1HUQA 5TV2A 4I1OA 4B32A 4TMXA 1JJ2B 1XXHA 2ZUCA 3QG5A 3TW4A 4CEHB 5JCPA 2GBLA 2ZJ5A 3KKQA 2JLZA 1NN3A 1E0JA 1NJID 1EGAA 4AWXA 4B48A 3DM9B 3G6EB 5DI3B 3L0IB 1KI3A 4YDHB 1R2QA 1E9BA 2OCYC 2QPOA 2A7QA 2X1VA 4Y0VA 2AXNA 2B8TA 3PUVA 2VF7A 1QHHB 5HZKA 2KWIA 5GV7A 2YNMA 4CEJA 3W8RA 4ZIRB 2R6FA 4Q9KA 4KLZA 1QBKC 2Z4RA 1KK3A 3QNUA 1YJNB 4V0NA 2V6JA 1ZD1A 2WJYA 2WBLC 2OO7A 5HPYB 3CRVA 4KYIB 2GVZC 3I92A 1BS1A 4W5WA 2QM8A 4D82A 1HY3A 5BYJA 3W90A 4HZIA 4QKQA 4P33A 1OH5A 1SVOA 5FR2A 1CS4C 4UNPA 5D3MB 2NOAA 3WYGA 1G64A 3K0SA 2QGZA 3U3JA 1RJ9A 1GO2A 1MR3F 4URZR 3EZ2A 3T1QA 1VQLB 1G20E 1GUAA 3EPHA 3CLVA 4MGYR 1N0UA 2DBYA 2I1QA 4EJSC 5FPKA 4TQ9A 2ZEJA 1K8AD 3W9YA 3BB4A 1FL9A 1RVDA 2YWEA 1RYFA 4KU4A 4P31A 4PHFA 5GJCA 1UBEA 2NPIA 4FWTA 2IYLD 2BEJA 2WJIA 2ZRIA 4KVAA 4B2IA 1P61B 4D25A 1YI2B 2ZSFA 2C8VA 1M74A 5EXPA 1UF9A 1M8PA 1F60A 3ND8A 1GOTA 3WBKA 2CL0X 1ZW6A 4HAVA 4CT5A 1DAHA 4GFDA 3SBEA 3AVYA 2O8FA 2B5OA 4QOSA 2F7SA 1JQLB 3EZFA 5E7MA 3G5UA 4W7SA 4PC3A 3R7WA 1TQDA 4CRWB 3RC8A 2HYIC 2EYUA 1XFAA 3OEHD 3SDZA 2CNWD 2BF4A 3X1XA 1IN5A 1DE0A 2BJVA 1E94E 2GILA 4D2IA 3CF0A 4G5OA 4KLNA 2WVJA 1G6OA 3OZVA 1KC8D 3ZQJA 3FOZA 4MUAA 1RRCA 3JQPA 4XVUA 2OTLB 4TL9A 3QIAA 1YJ5A 3K0AA 4B2PA 1J8YF 5UKDA 1F6BA 3KJHA 3TR5A 4I1UA 3KQUA 4N0EA 2NMVA 3ZZTA 5C4MA 2L0XA 1P5ZB 1S1CA 3OEHA 3H2YA 2HF8A 4M22A 2JLUA 2XNJA 3CBQA 3PEVA 2XITA 4HLQB 2ZSAA 3C7KA 3MFYA 3DKVA 5F3WB 2P2LA 1OFTA 1NY5A 2VLIA 2YHSA 4HB4A 4HLUC 1JEDA 5J47A 2N42A 2JJ2D 4JLBA 2XZLA 2A5JA 5EXSA 1T3HA 2PT7A 3BGWA 4PC2A 2ZRKA 2P6RA 4M1KA 1ZM7A 5TB5A 2FWRA 5FR1A 2E87A 1Z6TA 2XOKD 1PLKA 2F9LA 4M1YA 2C04A 4LJ8A 3VQTA 3OJWA 4XD7D 3NG1A 2YWFA 1AIPA 1GRQA 1IAQA 2VP4A 4IDPA 2CEAA 2G0NA 3KB1A 2Q3FA 3SEAA 4A8JB 3PEYA 3AP2A 4FW9A 4IFEA 3HU1A 3UMRA 4QBGB 2FFHA 2ZRBA 3LLMA 1KSHA 1JAIA 2BHRA 4IOLA 4LDJA 3BERA 4ZI3A 3U3MA 3I61A 1GKYA 3ZLJA 2VSFA 3I62A 2AD5A 2VNIA 2Z0MA 2YJTD 4PSKA 3NEYA 2VTKA 3U3KA 4TLCA 5J4LA 3EX7C 1KNQA 2IYSA 3QFSA 2GJ8A 4HAYA 3VKHA 3KJIA 3K09C 1E9EA 1U8YA 4BUJA 4FCVA 1SXJB 3NWJA 2G83A 2QRNA 2Q9CA 3X1DA 5J4YA 4WQMA 1QG0A 1DADA 1DOAA 1NLZA 4OK3A 2J0VA 4B3CA 3PUWA 4QFMA 3QXSA 1G9XA 1QZXA 3B1WA 4A2QA 2W6JA 1G6HA 1XCGB 4PFSA 1CTQA 4S2EA 1DPFA 1Q1EA 1Z3IX 2GWHA 3K0EA 4LBYA 3ZBUA 4Q9JA 2DB3A 4Q7JB 4ACAA 3Q5DA 1YZQA 5JFGA 1M7BA 2QZ4A 4DXAA 3I56B 3AF1A 3K9NA 4ERNA 1Z8FA 2X77A 1JEEA 3CCJB 1K5DA 3EA5A 5AUPB 1Z6AA 3KFXA 4EDHA 4EPWA 3ADCA 1GR1A 3GJ5A 1HYQA 3F5FA 4RY2A 4JVMA 3RRYA 3R8CA 5JI3E 1BQEA 4NYMR 2GZHA 3CNNA 4WW0A 3AVPA 3A1WA 1IOZA 2ZRNA 4LHVA 5FBWB 1EP1B 1CR4A 3ZH9B 1N5IA 4O25A 1GKIA 3V76A 4DUGA 1IY0A 4NH0A 4UXHA 1KSJA 1EFCA 1US8B 2WPDD 2VP2A 2ZE6A 4WZ6A 3I3SR 4OHYA 1CLUA 2IF0A 1DG1G 5LBIA 4EFNA 3BH7A 2V7QA 221PA 4IEEA 2DWPA 5CIQA 4IDQA 1Q1QA 3A4MA 2PMKA 3VKWA 4RCYA 2JDIA 2X8AA 2QI9C 2VHUA 1SXJE 4PAOA 1GAJA 4C2TA 5KNCA 4IXNA 1AKEA 2JJ8A 4UNQA 4B74A 4DT1B 1WBDA 5FPHA 3FHOA 1KI8A 4PHTA 1JXMA 4C4PA 4DQLA 3IGFA 2AR7A 1VHTA 4M53A 1ELOA 2CHVA 1W5SA 1SZPA 2IUTA 1AGRA 1XEXB 1TF7A 3KKMA 4IXMA 4BPBA 1U81A 5AR1A 4LGMA 4JLKA 1XU4A 1EWYA 1A1VA 2XNSA 1KY2A 1XMJA 4PZYA 4K81B 3QQ5A 2O0KA 3QEJA 4LK2A 4A0HA 4ESHA 1AN0A 2PX0A 3EG5A 2FZLA 1ANKA 1KK0A 4LV6A 3W2FA 3OIWA 1SQ5A 1TPZA 3CXCB 2ZS9A 5E7IA 5C2JB 2YINC 3IEUA 4A8JA 5JSZB 4DSUA 3T12A 2PMDA 4JJKA 3TR0A 4U7DA 1UJ2A 2R62A 3OJXA 2IS2A 2KSQA 1G19A 3VX4A 1IJEA 4F38A 3W3ZB 3FVQA 5J4KA 4AYTA 2V55B 1E62A 2F43B 2QA4B 2W83A 3DZ8A 3ADBA 1BJKA 2C78A 3CWQA 5SZJA 2ONJA 1NKSA 1SXJA 4Q00A 1MABA 4EAQA 2J0SA 1RIFA 3X1ZA 2Q9BA 3PEWA 5DE3A 1GDDA 3LX5A 1EWQA 1CNEA 2YWHA 4GRAA 3S1AB 2X19A 2ZR7A 3K9HA 2HCJB 1U8ZA 4H1UA 1U9IA 2XEXA 4LBWA 2QL6A 4AKGA 3FHCB 5KSYA 2QAGC 4ESVA 1XEFA 5KHOC 1X86B 3QKRA 2OK8A 1CR1A 4PO9A 1XPUA 3DL0A 1W34A 1BX0A 5FL7D 1KMHA 3OFNA 2JEOA 2BCJQ 4BLQA 2QMHA 4Q66C 1DO2A 2JATA 1PUJA 1E2PA 1CKEA 3I32A 4KYUA 5G3ZA 3OZWA 1ESMA 2IYRA 2XAUA 2DFTA 3IDQA 1T5LA 4KSBA 2F9MA 4QGAA 5IT5A 4DLTA 3CRMA 4JT2A 5CM9C 5CYOA 5FI0B 2DETA 2AN9A 1ZUNB 1ZUHA 5FTLA 2O8DA 5L3SB 3CW2A 2J87A 4B73A 1VQMB 1Q86D 4QG7A 4QHSA 2J0QA 4LPKA 5FPYA 1P2UA 1DTSA 4JKYA 4CF7A 4NYMQ 3TGPA 5D3QA 1P2SA 1H8ED 3TQCA 4IFBA 1E4YA 2A78A 2QROA 2BIFA 1XPRA 1LVGA 4QNRA 3BRWD 1G5PA 4G5GA 1JNYA 1FP7A 1NJFA 1N6KA 2R6CA 2ZVPX 1G4AE 5EP2A 5G53C 3DVLA 1XEXA 5L3QB 1VYTA 1Q3TA 4OQMA 2J0UA 2RB4A 4OQNA 3WMFA 4B3DA 1KI9A 3LBHA 2QTVB 4FMBB 1LF5A 4YMWA 5TR9A 2RHDA 2PZFA 4ACBA 4C0QC 4C9BA 4HDQB 4CT4B 2GF9A 1OH6A 1G7CA 5GV8A 2IYYA 1QUFA 1NF3A 5DYGA 3OZUA 1CJMA 5KDDA 1Z6XA 2ZUBA 3P26A 1S3SA 2V6IA 1XTKA 3TUZC 1P2VA 5FTKA 3QPUA 3FMPB 4NYJQ 4A2PA 1WBBA 2OT3B 4QJ4A 1ZJ6A 4LYAA 1MRNA 5AJXA 3RVBA 3CUEF 2F1IA 2YC2C 3A1UA 2IT1A 4I81A 2C95A 2ZJZA 1ZM3A 3QY0A 3X2SA 2QENA 3Q7PA 4EIWA 3U6KA 1M7HA 2JDID 3D8BA 1FMLA 3TAHA 3H1TA 2EQBA 2C9YA 1EX6A 3GFTA 4V0KA 4O3MA 3NH9A 3R20A 3CRZA 1XTIA 1SKYB 2C96A 3TVTA 1XD2A 2ZRGA 1Z28A 1KO1A 1ZU4A 5BN3A 3RABA 1QX4A 3MCAA 3ZC3A 1W4BA 4DDWA 1UEIA 2OCAA 1E9FA 1GTVA 2Q3MA 1D2NA 2H8KA 2FEMA 1Z07A 4Z1MA 2LKDA 4BFVA 4QGHA 2J5XA 2QTHA 3HYRA 2IXFA 1MT0A 2ZE8A 1J9ZA 4LV8B 1M7GA 1G7TA 3Q3JB 4MRPA 3U7HB 2GHIA 1E2GA 1WE2A 3LXXA 1W0JA 4Q19A 1OB5A 3K9GA 5CB6A 1XMSA 1NIJA 3I72A 3R7WB 3SYKA 3U3OA 5E3HA 4FCTA 1E0AA 3TIFA 3KTAA 6Q21A 4OHVA 2DHRA 5HE8A 3RS2A 1G8GA 4EPRA 1KIMA 2YWGA 2J3EA 3FHTA 1I7PA 5KU1A 1RRFA 4WA7A 5FL3A 1Q1BA 5H8WA 5H5JA 2IYWA 3LBNA 5AUQA 4Q02A 1T3LA 1T5IA 2XNCA 1J90A 2A5YB 2AL7A 2YYZA 3L8YA 4GT1A 1C9KA 4KJZA 3VR1A 1QFYA 4DLWA 5K8IA 5K8UA 1YZNA 1XX6A 2XZPA 3VU9A 3AKYA 4IOJA 4P6VF 1TF5A 2AK2A 1GNPA 3NHAA 3Q8XB 4O2RA 4GSYA 1W2HA 3AUYA 5KPJA 1X1RA 2BGJA 3RRMA 1K73D 3A6PC 3LXRA 3FTQA 1N5JA 4MUBA 2FSGA 4EFLA 4TYYA 1KI6B 5DH9A 2PT5A 1OFUX 2ZE5A 5G3YA 3CZQA 2VPPA 4X8HA 1TX4B 1E0KA 2C98A 4DCNA 2QEQA 3H4MA 2F43A 2NIPA 3AB3A 4HZUA 4MH0R 821PA 1GL7A 4DQKA 3NC0C 5B30A 1IXSB 1LFDB 3VHLB 4BZPA 2FOLA 4KI0A 3THWB 1AQYA 1OH8A 3ADDA 3WNCA 4D4KA 3T34A 3MAAC 4I1VA 4LX0A 2OHFA 3ZVRA 1QHHA 1OGIA 1CU1A 1Q1ZA 1SVSA 4PGOA 4TYQA 1YZKA 4A4DA 2ZRPA 4A0FA 4ZCLA 2XJ9A 3GD7A 2HMAA 5EUMA 1JR3A 2OSBA 4LPSA 3QKRB 5H70A 1Q21A 1OT3A 1E2HA 1U8AA 3ETLA 1VIAA 2WHXA 4BLSA 1VQ8B 1YHNA 2FNAA 2GETA 3UMFA 1YU9A 3UK6A 3RS7A 1FNMA 3GJ0A 4CYMA 3EW9A 521PA 2ZSDA 5KNDA 2ORWA 3ZD6A 2QU8A 5AJYA 4BQSA 1IB0A 1NKTA 4C30A 3A1VA 2IS6A 2BKUA 3ES9A 1IN8A 2O5VA 2OFXA 3W5IA 1F5NA 2F3RA 4AKHA 1W0KA 2W0MA 3EA0A 2ZI9A 4D0NA 2Q21A 8OHMA 4NPHA 1Z0AA 1G18A 2YKGA 3GJXC 1D9XA 2DY1A 2Q3HA 2ZYUX 3A8TA 3CX7A 4OK6A 5FH9A 2GBLC 5K8LA 1W5TA 2QBYB 4N3NA 4CEIA 1M1YE 1GITA 1YHQB 4L15A 4HUTA 3AF4A 4F92B 4PQRA 1VQKB 1NMZA 5IF9A 2WOJA 4URUR 3IHLA 1E2FA 1K9MD 3C8UA 4IDOA 4LJYA 2EFEB 1KNXA 2IUUA 4BLRA 3THYA 3CCVB 4QHTA 4WIAA 4HLDA 3ND9A 3QFCA 5FOTA 5ELXA 4B4DA 2B7BA 2V1XA 1QVAA 2JJ1D 3EC2A 1XZPA 2EFHB 3M0EA 1MO5A 2JLRA 4UNNA 1NN5A 1S3GA 3U5ZB 3W5JA 1MH1A 2N1BA 3GLGB 3WNBA 3KKPA 4BRWA 2ZS7A 3LX8A 1Z47A 1XJCA 4OI4A 2J1LA 2G1KA 3VR5A 2B6HA 4M9SA 5JJLA 2HV8A 3LA6A 2FFQA 4JLPA 4PHGA 4A6PA 3V00A 3RS5A 1H8HA 1A5TA 3SJCA 4AIIA 4AI6A 2ODBA 2BN4A 3ZGXA 4Q4JB 1U94A 2DPXA 4F4IA 5JI2E 3LW7A 4YMSA 5DI3A 1R8SA 2FGKA 3IPXA 3TKLA 5BW8A 3CX8A 3T15A 4V0ME 3K0FB 1W87A 2VQSA 2ZI4A 3B78A 2EFGA 2QY9A 3LY5A 1OXXK 1XTJA 3TE6A 4D6PA 2CNDA 1L4UA 4LYJA 1E9AA 2BKEA 2Z5FA 1SVWA 2Q9AA 3TSZA 2R6DA 4QM6A 2ZAMA 3KJEA 5JEEA 2QTLA 3SBDA 4IOKA 1KZGB 4ARZA 4MYCA 4C0KA 2AFHE 2OCBA 3JZMA 1DELA 2ZRHA 2CHGA 4TTPA 3K0FA 3D31A 3K0AB 3ZVLA 2A2ZA 1EFHA 2VHQA 1VG1A 2BM0A 1OSNA 3B60A 3IIMA 4I1SA 4Q7MB 4UNSA 4YAUA 4YMTA 5CM8B 4K1XA 1PJRA 2GVDC 1QVRA 2JAQA 4NCHA 5CB8A 3B1ZA 4JSYA 1VQ9B 5JJKA 1L4YA 4E07A 3QFRA 2ASEA 2HXSA 1QHXA 3AH8A 4QGGA 1P60A 3M1IA 4DRZA 4OHXA 3QXHA 4LJ4A 3TVDA 1E1QD 3DKPA 4GPTA 2XB2A 3I1FA 1GWNA 2ERYA 4DSTA 2R6HA 1JPNA 3DOEA 4HUQB 4W5JA 3OAAA 5E4FA 2BMJA 3KTAB 4FMCF 4F91B 1FDRA 2CBZA 3U7FB 1Q7YD 4Z1MD 2WWGA 3QPVA 4WZBE 121PA 1P75A 3TRFA 4BFZA 1XEWY 3U7EB 2WOOA 3Q5EA 2UKDA 4DBLC 2BPOA 3EWAA 3NEJA 3PIRA 3EPJA 1GL6A 4F4JA 3I8SA 5FL7A 2G77B 2NO0A 1TADA 4B43A 3CC2B 1YQTA 2FPKA 3GLFA 1OFIA 1R8QA 5JRZA 4Q9IA 3W6OA 3KXLA 3KXKA 4PSAA 3VTKA 3Q7QA 1OXSC 2YOHA 5J4VA 1NVUQ 2VSXA 1ZNYA 1OXUA 3MWKA 4F7DA 2WKPA 3QI2A 2D7CA 2ZSBA 4L8GA 4TT3D 4DLSA 4QM7A 4BZQA 3RWOA 1SKYE 3NTUA 2ZSEA 3RYTC 1LY1A 4OQLA 2ZJOA 1E2NA 2FPMA 4HSEA 3BFKA 3ZZUA 1OGJA 2RGDA 2HXYA 4F7WA 2WJHA 1R5OA 5SZKB 3GLIB 1GFIA 1OH7A 4C2UA 4Q7LA 3OAAD 4JLNA 3KL4A 4EH1A 4FMCB 1H42A 1TUIA 3SE0A 3WMEA 4AG6A 1D9ZA 4BASA 5DLQC 2GJSA 3Q72A 2V9PA 2AXPA 1UEJA 1T91A 1OKKA 1J2JA 1E79A 2Q6TA 3CH4B 3EC1A 1GILA 5FBRB 3AM1A 2CHQA 3ASZA 3W2HA 5BN4A 3TLXA 3VR2A 4PQYA 4BPRA 3SZRA 4BLPA 3ZZ0A 1EP3B 5EXXA 5TXGA 4ZDJA 5DI9A 2A5DA 3BXZA 1BKDR 3NBYC 3ZS8A 5JHHB 3RWMB 4JLVA 1LW7A 2AK3A 1XEWX 5LPNA 3VKGA 3MMPA 3SQWA 3LVBA 2AWNA 1FX0A 2WWWA 2WV9A 5FTMA 2W2VA 1VQ5B 1XMIA 4TMWA 2RC6A 3N2EA 4PTLA 2CLSA 2W00A 4LSGA 4Q48A 2XSZA 1VDZA 5IK2A 2AKAB 2WIAA 1M2OB 2BDTA 2YC4C 2ZI5A 1NY6A 1TF2A 3O8BA 3SS8A 4Z51A 2IYXA 2P65A 1U98A 1JB9A 2OBMA 3P20A 2XXAA 1SVKA 3WNDA 1E2DA 1I4TD 3DM5A 4EJSA 2ODEA 1N6LA 1G8FA 2RGXA 4DLUA 5BYKA 4YXWA 1R0XA 3P4YA 1EG7A 3DHWC 4QC2A 2GPJA 1E2KA 1P7CA 2E1RA 4K8OA 2MSCB 4R7ZA 1NN0A 1PZNA 3ZIAD 1OYYA 5FBQB 4MYUA 3TUIC 1VKJA 3ZS9A 4IVPA 2WMNB 5A0FA 1E3MA 4KBGA 2VHCA 4Q9HA 1NIPA 2FGJA 1UKZA 1X3SA 3O8DA 1M90D 1E9SA 3AVUA 1HV8A 3CO5A 4IDHA 4A8JC 1RC8A 1KO8A 1XD8A 4LC0A 3QE2A 4NCKA 2PBRA 3V4FA 1R0ZA 2WWFA 5H59A 4BZXA 2RGNA 4W5HA 5EE5B 2FFBA 5AJZA 2F1RA 1P62B 2ZREA 5HKKD 4WXRA 1D8TA 1RJ9B 3OESA 1LTQA 2FV8A 2UZIR 3QJYA 2BEKA 1XWIA 3GJ4A 2GCOB 2F1JA 4AYXA 2CJWB 3MJRA 1YZTA 4HAXA 3IBYA 5AN9A 2ZYVX 3LVQE 4FN5A 1IJFA 1G5RA 3B9QA 4LJ7A 2FH5B 3CNLA 2IS1A 2HEIA 4JKIA 3N2IA 1KO7A 4XTCS 2H1LA 4JL6A 4Q01A 3ZDQA 3D7MA 4HDCA 4BWYA 3U44A 4RZ2A 4DEYA 3IO5A 2PIAA 2EWVA 2VA8A 1XXHE 2GDJA 3T1VA 4A6XA 3M6AA 3BK7A 1QH0A 2OILA 1FTNA 4GOXA 3KB2A 5JS7A 3BB1A 5FA6A 4US0R 3K1JA 4JYBA 3U3RA 2O8EB 2XTZA 3IUYA 1S9DA 2ZI6A 5EE1A 2O8FB 1R4AA 3AUXA 1QHIA 3CKLA 3CPEA 1AZSC 5FPSA 1X1SA 4A15A 4QBFA 2J7PD 4B3FX 4D80A 4BFXA 3CC4B 4AG5A 4BRUA 5KUTA 1DG3A 3FKQA 3AVQA 4IW3B 4L16A 5M04A 2CVHA 1G7RA 1DDIA 1P9RA 4FD2A 2IEZA 4L5BA 4DIEA 3GLGA 1V5WA 4GZMA 4IOMA 1Q12A 2OAQ1
chains in the Genus database with same CATH superfamily
2P5SA 2PUBA 3BF7A 3TNJA 3KYIB 5EHQA 2QTVA 4DFDA 3NBXX 1AS2A 4OV6B 1CRQA 1BE0A 1GFWA 2WICA 3UHJA 4E1AA 3LAWA 4EA8A 5HX7A 2FFJA 2I6XA 4MV1A 1ZESA 2P2SA 2W58A 4QXRA 5BN5B 3CWZA 1VMIA 3SICE 4D26A 1K9VF 3TZBA 5JYBA 1TK9A 3G7SA 4BXOB 2F00A 3W34A 1OLSA 5ILQA 1WMSA 4YCAA 1E0DA 1GTJ1 3I39X 1G7SA 2IA5A 2PU7A 5DNYB 1VIVA 4MV8A 4LRTB 4UJ3A 4EUSA 2R11A 4EUEA 1YQXA 5DV9A 2NQ2C 2P3LA 1KDOA 3LHIA 4HXEB 4Y2TA 4YJGA 2V03A 4B7AA 3A4LA 1Q81D 2FSFA 4DLUA 1CDOA 4H77A 1ZBDA 4BN5A 1DBSA 2QUZA 3VNAA 3OIFA 1CEXA 3MSXA 3I45A 5CIYA 1CZRA 3V1UA 1NVVR 2ZT7A 1LRLA 3JWGA 4L2IA 4OFXA 1YRQA 2DGDA 1E0SA 3VC3A 4ALNA 1XAJA 1WDWB 5KNBA 2D4HA 2WWIA 4HLNA 4IZ6A 3T7AA 1R0CA 4LV5B 4YAKA 3I04A 4BB6A 2QAIA 3WB1A 2CVPA 3MA0A 1Z38A 5E8JA 4JI5B 4MP6A 2WSSD 4MWCA 4TXJA 3CB2A 1ZK4A 3WNZA 3EPKA 3G7NA 1I2MA 2H63A 4DR3B 3NYQA 2ZIXA 2OG2A 4YYEA 1PGPA 2QLNA 1S8NA 1G2IA 4IHJA 5C7LO 1JLSA 1A95A 5ALUA 1PFQA 4YQYA 1ZL0A 5ESWA 4RD4A 1IOWA 3BT7A 1OUMA 1B74A 1T6NA 4IDNA 4EPTA 4HNSA 5LIRA 4REQA 4NR0A 1X13A 3DNMA 2IUYA 3BIWA 3Q5GA 4JXXA 3LIIA 4B81A 1G4UR 3G9TA 3ZY5A 3CN7A 1CD5A 3RHZA 4D92A 4Z6KA 4OJNA 4R2HA 4LF9B 4AKIA 3PBKA 1TKRA 3TRDA 1EMDA 3WP1B 2JFFA 1U7HA 1ZIYA 3ED5A 4A8PA 2AVDA 5C7YA 5ALVA 1H5QA 3CKMA 4HFRA 1CZOA 2VDQB 3ZCVA 2AYYA 2GXAA 1EB8A 2JGMA 2LR0A 3MERA 4Q4AB 1CSEE 1DIBA 3DO5A 3NWOA 2ATVA 3O8OB 4TWRA 3RSLA 5DWQA 1UAGA 5EHIA 1J8DA 3P0FA 1Z7BA 3ID6C 2AJLI 1BFDA 3LCJA 4TL6A 3TL2A 3SR4A 1JKMA 1JBQA 4RD2A 4KIGA 5C1BA 3MJSA 5AD1A 2AW3A 1ID1A 1H5NA 4JEMA 2D74A 3CMMA 3B36A 4A0GA 4Z4ZA 2AG8A 2X22A 3ASUA 4X7MA 3CRRA 4UKDA 1UJ6A 2L42A 1W93A 1Z4QA 3B51X 2CCJA 2ECKA 2ZLBA 1HEYA 3CEPB 3JTMA 1V4NA 3A9TA 1QC5B 2AKYA 3R3ZA 2W6MA 1SUSA 3MSCA 4ZYWA 3R8XA 4I9HA 4GXTA 4CIBA 2VT7A 1NQUA 3DOJA 3Q88A 3CH5A 4G0NA 3WLPA 3DVAA 4B7ZA 4MKXA 4MEAA 1QU3A 4WGFA 5JVDA 1VRWA 3K8QA 4JUBA 5B64A 2ZP1A 4GU5A 3V7FA 4RJJA 4A36A 5F98A 3UCXA 3BMCB 2JVKA 4JROA 4BEJA 4E31A 3OE7D 1W46A 2GN4A 3EXIB 1SUPA 3HCEA 4JBIA 4BVEA 1J99A 1KEWA 1Y1PA 4HWTA 3QBVA 1GPBA 1KTIA 1H5UA 1SCUB 3N87A 1V0JA 4GL4A 5BSGA 2E89A 2H7VA 4K9KA 5IS2A 3K92A 2EJWA 2I62A 4YMVA 5CXSA 4PICA 1BXRA 3KDAA 3GLSA 4AZ3B 3ER9A 2J6HA 4ZC8A 2ZRDA 1DG9A 1Z0ZA 4JB8A 4U7WA 4HB3A 5AKHA 2QRZA 4M1TA 4O2LA 1Y5IA 2OV4A 1T2EA 3N2GA 1ZS9A 2P69A 2O7SA 3Q9LA 5DN6D 3C70A 3MB8A 1VCOA 3ILSA 1P4RA 4JT4A 4C07A 1F9EA 3KDPA 3PPIA 1TAQA 3UA3A 3RVDA 7AT1A 1ONPA 2XW6A 3H86A 4OXYA 5AUNB 1DKLA 1SU8A 3QENA 4X0EA 3AHGA 4MO9A 3QU7A 3BMCA 5EE3A 3H83A 4EY8A 1JI0A 1KKLA 3IULA 4OP1A 4MYSA 1A98A 1I3KA 3AL2A 5EESA 2IBSA 4RH1A 5M3BA 4DA0A 3TUJC 1MMFB 3KKEA 2D00A 2QD1A 3LQ1A 4PAGA 3VPXA 4R6XA 3BRWA 2AOTB 3OE1A 2NV2B 3QRWA 5DBFA 3GP8A 3MELA 2HBRA 4TMVA 4BVAA 4PYOA 3AF2A 4HDMB 2D3WA 4CQNA 2C8LA 4QZVA 4MVWA 3C3EA 4ESOA 1YUBA 1JHPA 1RAIA 4AB1A 4OMCA 5ES4B 1DWPA 4GR5A 1EGQA 1G3RA 4HS4A 4YJ3B 3W05A 1Y6FA 1GKUB 3JPWA 2XB9A 4G2TA 3H8VA 4JLDA 3U4DA 3D2BA 1OB2A 4MIKA 1QE0A 3R9XA 1ODIA 2R6R1 4G0OA 3OX1A 3SDBA 4DZZA 3N2ZB 3TK1A 1TK2A 4EEXA 5J2TB 1OROA 1U4SA 2R7LA 1TUEA 2HU7A 3HABA 3VTAA 4MRNA 3OUUA 3ZWCA 3RVRA 3V8MA 2YRFA 4AM8A 3UW3A 4PYJA 1XTZA 1P74A 4E12A 4DEVA 2Y0CA 3JZFA 1BTOA 5GJWC 1X94A 3QWBA 1CRLA 5AKJA 3IE2A 4C0BA 4BO1A 5BMOA 1NRKA 2NGRA 1FJ2A 1D2MA 2WIBA 3X1YA 1CQJB 1OE0A 5AOAA 4KPFC 1E5VA 1RC1A 2ILVA 3R7NA 3RREA 4D46A 4Y6GB 2OCKA 1KY4A 1L3CA 4GMXA 4XRGA 5JXJA 1COWA 1LJUA 2EVWX 1DFHA 4GPIB 1X7YA 3F1LA 3OHMA 5BSTA 3NC1C 3HJFA 4C08A 4TV8A 1L1QA 1SHJA 5IJXA 4RY0A 4BBAA 4YRBA 1RYDA 4H60A 3OTQA 2XVXA 1CFJA 2WNSA 2BFBB 4RQUA 5BV0A 3B2QA 3ESQA 3CN9A 3V8EA 2WFAA 4JKOA 5LMZA 1RMYA 1TAGA 3BD8A 4CHTA 2VKTA 4ZQGA 3L4BA 5B7QA 2IGBA 1RHMA 1XAHA 2B5VA 2GNOA 3GBSA 3ILHA 1U0JA 3K53A 4UCQA 4UDXX 4GP7A 1JLLA 2ZU6A 3TD6A 4EZBA 4DV7B 4FHGA 3QHPA 2MTBA 4FFNA 2C3YA 5LYJA 4AAYA 1CXZA 3OKFA 1C7EA 2ERXA 1DDOA 2ZTMA 3GA5A 4TWZA 5F78A 1TFRA 5DB4A 1SIOA 5F73A 5AVTA 2Y1FA 1E7SA 5K0JA 3FPFA 2QQGA 1UJCA 1AV6A 2G7MC 1OHHD 3PR1A 3WWDA 3L92A 1QO0A 2CLHB 1WTCA 1VPLA 2BH2A 2C31A 4AT1A 5K6AA 4BO4A 5A3QA 1PT9A 2UZ1B 3I01M 3IHKA 1KYVA 4TXLA 1K88A 3VDXA 3KSUA 2GOYA 5D1NA 1DQZA 3T99A 5AKGA 4JP3A 4I5IA 2O50A 3EISA 3UANA 4DYVA 1EUYA 3NBFA 5DHRA 1G21E 4DLBA 1XP5A 4LUCA 1ZJWA 4Z4RA 5ED0A 3WZMA 5F76A 1KL7A 1TLFA 1Y9EA 4ZU1X 3O3CA 5DPMA 2Q0HA 2VYND 4RZHA 3MCVA 3M4NA 4HCJA 1QPBA 2GI4A 1NF8A 3LQKA 1ULAA 3RC3A 5MFZA 2ZTVA 1AKUA 4DQXA 4I99A 3S7ZA 4UHFA 4J1SA 1C5KA 3DE0X 3N5CA 2EFYA 1Z22A 3D4PA 1IEVA 2ORIA 2PS9A 3BHMA 1WW8A 3VNQA 1E7WA 4QJ3A 2CXTA 2C1ZA 1G291 1ECPA 1V11B 1XK6A 3OOEA 5GZ6A 1N77A 1XZAA 3EAQA 1Z2AA 4JHLA 2ZITA 2QRGA 2V8BA 4EKDA 3GFVA 2GJ9A 3AEZA 1QAQA 2HSJA 3C6QA 3TCXB 2QZSA 3ZDRA 4DV6B 3THYB 3L4JA 1F4LA 3DXFA 3IT3A 1UXKA 2YVUA 3LV8A 4IGFA 4KMMA 1A04A 3D26A 3HCNA 3VPCA 3IAFA 5K3DA 4LWZA 1FFGA 4P82A 5KVCA 3PCXA 1W9HA 2OK7A 1L5MA 3WGGA 2XT0A 3EY9A 3LQQA 3VZSA 3H97A 1FSFA 2C77A 1TW3A 2VPIA 3WTCA 1VCNA 2OB1A 4EJ2A 4UC0A 2FZWA 3BH4A 1T0HB 4EPXA 1FPMA 5F51A 1LJ8A 3T9DA 3DO6A 1NXTA 3FWPA 4QGSA 4TTVA 3VPGA 3LUKA 4COOA 4C3UA 1Q16A 1C8VB 2CFCA 4NBKA 4OQFA 3RIMA 5EOVA 1DRJA 1DJLA 3OC0A 2QLFA 1T5SA 4YHHB 1D1NA 1A97A 3CMAB 1DOHA 1FIUA 3BC9A 3DL2A 2Z6VA 3PYXA 5IVDA 2OFWA 4REQB 1E8MA 1L7MA 2FUNB 4LJ5A 1PJ7A 2W6JD 5A04A 3H5VA 5GM2A 3TEMA 4TMYA 4GVXA 4AMGA 4Q03A 4DE5A 2VAXA 3AERB 1LJLA 2WM2A 1QVGB 1W1UA 3D5QA 2WTUA 1WY5A 4HGNA 1XE1A 3A1TA 5CG2A 1IK4A 3ND5A 2GK7A 1ORVA 3HL0A 1M5TA 4ZO8A 4OYHA 1QB8A 3QKWA 1U9IC 3GZNB 3HUFA 3CESA 4TTRA 4YRSA 4MV7A 3UAGA 4MVJE 2I4OA 5EJGA 4HGYA 5TRTA 2FN3A 2PBFA 3PKIA 1JKJA 4L9WA 1J56A 3WLMA 3RPEA 3ERCA 3MRTA 2G6BA 2X0FA 4DMMA 4JBLA 2E6KA 3QE9Y 4J1NA 3M6UA 4TTJA 3EGVA 4JLJA 4DZRA 4Q3NA 4DC0A 2W2XA 5FLEX 3THXA 1EBFA 3U6BA 3CEAA 4DUYB 4DMKA 3GXOA 2BCEA 3CCEB 1A88A 3IMCA 4FR0A 5THXA 1MB9A 1NMXA 1PFWA 5D85A 2OMKA 4RS4A 3T7RA 1R6DA 5HS6A 4XLHA 3UJ9A 1IN6A 2WW8A 2HA0A 1NNLA 3OECA 2ANCA 4N03A 5KYVA 2WAOA 3L7MA 4P6YA 3WTBA 3HAGA 4GMDA 1QMGA 1LPOA 2IWHA 5JMPA 2ZAGA 1M2JA 5H68A 5ILOA 5DM70 2VBVA 1WD7A 3P96A 1TA4A 1HVXA 3BWBA 1PVOA 2GM9A 1EQ2A 2HLHA 1VI2A 1GPDG 5CT5A 2QM0A 1RMQA 4M46A 4YBRA 4ZVRA 2V1UA 3WBJA 1FJHA 2RI6A 3BYZA 3GFOA 4BQRA 3RAGA 5CB4B 1R3UA 3BXOA 4HNAB 4E51A 4RAOA 4WNYA 3ZVMA 1P2FA 2AZDA 4F11A 2ONKA 4JL8A 1FX1A 1VCIA 3E9CA 3L84A 1WMAA 3LRXA 4L4YA 1T9GS 3ZXXA 2XWQA 4HS9A 4O2BA 2BMDA 2ZCVA 4OL0A 1AKRA 3L1UA 2ZDHA 3OZFA 3OVMA 3COYA 1Q3KA 3IILA 3AR5A 1IB6A 1T3TA 2PCJA 1BA2A 4HHEA 4LHZA 3ZHXA 3ME5A 5H9VA 1B0PA 1ZISA 3EXG1 5KSWB 4QBTA 3FDXA 1I4OA 1VIYA 5KX5A 3GQBB 3ETEA 3RNOA 1VZ2A 2C5AA 3BIOA 3MUFA 5G0TA 1IBCA 4XWYA 1PDWA 5EJ5A 2CVOA 3R44A 4EMSA 2XF8A 1X9HA 3BZWA 5LDHA 3WJ1A 3W5CA 3O5AA 2O5CA 1YOBA 1L8AA 5BVHB 5CITA 1JBEA 3ESYA 4YGXB 4ENRA 1ZL2A 1RHJA 3JX9A 2KE5A 4I5FA 4P3IA 1E2BA 4XYMA 3TPCA 3AFNA 1CUJA 5AW6A 2PFSA 4B3IA 5BSWA 3GC6A 4BO0A 1V0FA 4LBZA 3EDCA 3PA6A 3MWEB 3RFXA 4Z7NB 3DD1A 5AKLA 1Y0BA 1L5OA 3LUGA 4R0VA 4U39A 3AONB 4NCJA 3R5FA 2PEYA 3T3IA 3B5JA 2C2WA 1L6IA 3CF6R 3ORSA 2M6KA 5AW1A 4P12A 2NG1A 1KBOA 1XZIA 5HZBA 3EIWA 4GL2A 4LRXA 3OZEA 3KCQA 2QBYA 2JJ2A 4XLFA 1J0AA 1GU0A 3R0QA 3DLHA 2WQ7A 4X45A 3ZLTA 3M81A 5G4KB 4JB0A 4Y2VA 3T4EA 4WNIA 5CP8A 2HT1A 2Y0PA 5TGZA 5JANA 3CCMB 3CV3A 1Z7WA 3TTUA 4OX9Y 3AVWA 3PC8A 1C4OA 5DOVA 3VFDA 4IIGA 2J7PA 4OXNA 4GICA 4WAUA 2QDXA 2IXEA 3TLBA 3KBBA 1THMA 4KN9S 3O0DA 4Q3OA 4KP7A 1F8UA 4HDNB 4PSVA 4RK0A 4EW3A 1SRQA 3ROZA 2HWUA 2Q8NA 2WPDA 1G60A 1W5AA 4IUCS 5TARA 3J81k 3G17A 2QT1A 2FRDA 2VQ3A 3HDHA 4J7CA 1P5HA 2ZQ5A 3AX6A 3IO3A 4G65A 4K6MA 4BKUA 4D9BA 2Q4BA 1ZNZA 2PN1A 2FPGA 1QGZA 4PYQA 5CYFA 1M67A 2IL1A 5LB4A 4Y9RA 4WZLA 5HWSA 5AXAA 3RIXA 4DNFA 4O5OA 1MRSA 3A1CA 4F6LA 3DBHA 3IUSA 4CMJA 1V11A 4RWZA 4D4MA 3JRWA 4NDAA 2E4AA 1Z4LA 3V8BA 2PO5A 5GIPE 1N2EA 4BB5A 1Z6GA 1BNCA 4DCVA 1ABFA 2GA8A 1VCMA 1W2BB 3BSWA 3ZXIA 1PJZA 2FRXA 1QHNA 4HN9A 3P0IA 3NNNA 5DKFA 4B3XA 4F1WA 1CW2B 5FOVA 2CV1A 1N33B 3IEXA 1X8KA 1Y7TA 1LSJA 2QZ9A 4CEIB 4H3SA 1GM5A 4X7BA 1MA3A 4FONA 1IXZA 3GG9A 1GPAA 5AI4A 4R9VA 2ZL7A 1FFEA 3IQGX 4ZOAA 2QDKA 3N59A 1I32A 1U2EA 4WXMA 2P4SA 1W36D 1Q7CA 1CK4A 4QDOA 4I2NA 3UQZA 4Q47A 1SZCA 1ZINA 2VT3A 1ZD9A 1ZMTA 3EBPA 3KOOA 2C9MA 1E63A 1BHJA 1G9TA 1YJBA 1J20A 4RELA 4EGAA 2XYQA 1VHLA 5H1YA 4A26A 2AR0A 1H3EA 1ACMA 4FILA 5DBEX 1NLMA 1SA0B 2Q1WA 4FM9A 4C43A 2GN2A 4QODA 2VTVA 4HUQA 3D3NA 1Q2UA 4J1TC 2HMVA 1A4XA 5G02A 4HV4A 3A2KA 2RH8A 4LQDA 4LXGA 2VR1A 2GF0A 4KO8A 3MTEA 4M86A 4CU5A 1JIIA 3A31A 2CUNA 4BO6A 3KQHA 1OC4A 2PLFA 1WZIA 3THWA 4ZGBA 1UWVA 4M38A 5BQ3A 2V97A 4GEKA 2EKLA 1NATA 2Z1DA 4Q7QA 5DNAA 5IARA 2JASA 5HUJA 2DPYA 4I4CA 3LTNC 4N0MA 2QPTA 1Z18A 2FPPA 3MXTA 4POAA 4BAGA 2E4YA 1N6OA 4P4GA 1KJZA 4P35A 4FNOA 4I55B 1T13A 3ODGA 2ON6A 3ZDZB 2DBZA 5PNTA 3KJGA 4ZQEA 2ZR9A 4HWPA 2ZFUA 3EZXA 3A8JA 2WHPA 1N3LA 1XLVA 1PW5A 3FF4A 3MJDA 2D2EA 3VVCA 1POXA 3DE1X 2KM1A 1A9OA 2VJQA 4ARZB 4YALA 1EM8A 1KYTA 1GVNB 2QUJA 3H0KA 3QUQA 1UQUA 2VYQA 4HEQA 1RS0A 2JRLA 4B4OA 1Z2DA 2A4MA 2PMCA 4IGEA 4QEDA 4IUDS 1I33A 3TL3A 1TRHA 2QE6A 1UOPA 1U0HC 3Q3HA 2C9CA 2P6PA 2MU1A 1C1HA 4NFHA 4CF3A 4KQ6A 3QKUA 4XKVA 1MUUA 4NZ9A 5DO9A 3TTTA 2O2CA 1OHHA 1MH9A 2HH9A 2O4UX 2V4ZA 3HCWA 3KUXA 1J70A 1LB1B 1JKXA 2D2FA 2APJA 3L8HA 4WUVA 1R6VA 3PEUA 4BO3A 1H2RS 1Y5RA 2VQDA 3I4FA 2Q0QA 4LHWA 4JI3B 4NV1A 3CCUB 3A3YA 1YHYA 4R05A 2G9NA 1XD2B 1VP3A 2DFPA 2YRXA 2BGRA 3LU1A 4RTJA 1WOYA 4OXKA 2OV2A 3B7GA 2C94A 1EK1A 3FDZA 1LS1A 5AKZA 1Z2CA 1GTMA 3BSYA 1N9KA 3GV0A 5GMOA 3TYXA 2H4XA 1FP2A 2I4NA 4LVCA 1BH6A 2JAOA 4QREA 3T4UA 4AY2A 3IJRA 4BP3A 1B16A 3CEJA 3N2KA 3ZHOA 2PY6A 1H4QA 4P93A 5CIWA 3ZKAA 2FOXA 2NTEA 5M2QA 4ZAGA 1RHRA 3KKZA 3A2LA 4L4UA 1NG9A 3EK2A 2QF7A 4RY8A 3RJZA 5TQ0A 4R3WA 4PX2A 3W04A 3WYEA 1YJ9B 1CR2A 2RI0A 1J8VA 2OFPA 3Q3VA 3H7IA 4FEAA 4Q93A 3TSOA 1YAJA 3COSA 1K0FA 1QR2A 1U2SA 4D81A 3PDUA 5FUYA 3NHMA 3UTDA 2AB0A 2VFAA 2GBIA 3CQ9A 4YS6A 5FX2A 1UK8A 5KYWB 1UDRA 5JMTA 4YAWA 2B2CA 3CCLB 4X1IB 5LA6F 2PTGA 4DWOA 1V3VA 2JGRA 3IX7A 1H2ZA 4ISCA 1X92A 4N3AA 3HJAA 4Y7DA 1B2RA 4ZZ0A 3MC1A 2NV4A 2A67A 1QG2A 2NO9A 5CGZA 2IPOA 4YUZA 1ICIA 1VLQA 3U4AA 2AC7A 3F4BA 3OIVA 1WP6A 3EGEA 1U31A 1V8DA 3PJGA 5KQSA 2HFJA 4MRMA 5KC8A 4LMAA 1VQNB 3TH5A 1YITB 3JR3A 1M2VA 3ENWA 4CL8A 3F73A 3F67A 1AQ6A 3B89A 2QZZA 5E6RA 4MUMA 2IYZA 3W06A 2DR0A 1V95A 1YB4A 4M0MA 2VPZA 4KODA 5LP6C 3AIMA 1PT7A 4RTQA 1HMPA 4BNGA 1BYIA 1ZIPA 3RV3A 2YHUA 4MNTA 5ITZA 4R1PA 3CUSA 3IP8A 2BMFA 4HGZA 4DWJA 2HQOA 1KAMA 1ADYA 1YBHA 3NU1A 4GI7A 3WQRA 4G4SP 5TJHA 2YN4A 1X2BA 3U7GA 3K8YA 4FE3A 1T8TA 2R8OA 4M1SA 2RKOA 2AC2A 1Q7BA 1UMDB 2O8NA 1GGVA 3SR0A 4EGCB 2CL6X 4NEHB 4UM8B 5G41A 4OAQA 1SVMA 2EX4A 2KBEA 3OTGA 3ICVA 2PBZA 4JN6B 2O8BB 1E2QA 3G0CA 3IEKA 2O2JA 2WM3A 3IHTA 1N2CE 2VP5A 4FTWA 3PE4A 1RE0A 1YI0A 3IIKA 2QR5A 3DDWA 3CRW1 1YZGA 2J46A 2JGIA 1E8NA 1PNQA 4D57A 4GUAA 2J3IA 4DRYA 4KN5A 1W5EA 2GRAA 3OPMA 3C7TA 2HB6A 4ARAA 1L5GB 2W6IA 4MDEA 1GSHA 1LGYA 5A62A 1XDGA 2ZXHA 1LVHA 2HZBA 2I1WA 3FVVA 1Y3DE 3W2IA 2JI8A 2IEIA 2Y76A 2OP1A 1FFCA 5J2UB 4KFRA 5D3MA 2BSQA 3E5NA 1P5FA 2HADA 3U44B 1DKOA 4BYGA 3RJ5A 1RLOA 3R6GA 4OMFG 4I50A 2AUMA 4LDAA 3RFUA 5KS2A 3RD5A 4FXPA 2OXCA 1QCYA 2JZCA 3ROMA 1D4FA 2DAPA 2YHIB 2QN6A 1N07A 1TLLA 3DBRA 4J07A 4E2ZA 1E7QA 3EGCA 5ITSA 3E9YA 3HYTA 2GN1A 4MW5A 3RU3A 3V97A 5ALLA 1SCNE 1TI7A 2GH1A 2P9CA 3R77A 4L08A 3SSAA 2DTDA 1NLYA 1SK8A 2BE7A 3OY7A 4L72A 4QRIA 4Z4WA 1NVWQ 4WK6A 3OMLA 1CUZA 2GESA 3J7TA 4OEHA 1V5GA 1XBTA 4U7HA 5DXAA 4B82A 5LR6A 3S70A 1LVUA 1J8FA 1KORA 1Y8CA 3G0IA 1RW4A 2PKCA 1F48A 1FFDA 3JD4A 3T94A 4MR9A 3EVAA 3KT0A 2LGJA 1OW3B 3DL4A 2F1KA 1U2GC 2FG7C 3KEWA 4TWJA 1OWMA 3GX1A 1D3AA 1NZJA 2P0YA 3KWJA 4DJTA 1I8DA 4YT5A 3BGDA 2PGLA 4OHWA 1ODSA 3P7MA 4DGQA 1E9RA 4EA9A 2IBTA 4EATA 3SZLA 1KGDA 1IL0A 5GOTA 3DE3X 1ST2A 1P1FA 3BPSA 4U7GA 3RVPA 2LCFA 4G1VA 2CYBA 1MD9A 2E4ZA 4QICA 3WMRA 4W5NA 3KJFA 3QUCA 4RZ3A 4WK2B 5EIBC 3V1TC 1U4NA 1M2NA 4F9EA 4O29A 4MVJM 2J48A 2JC3A 1QO0D 3TQTA 4TGLA 1YGPA 2BT4A 2NZWA 3LPNA 3A1NA 1RYYA 4PGGA 2QMUA 3FZYA 4IZOA 5HFAA 5EMKA 4DUGD 2WINI 3FJOA 3CC7B 5FDFA 3I6BA 3QP9A 1OVMA 4HX5A 3GVLA 4N5NA 1H94A 4NU0A 1I3NA 4F12A 1WV1A 2DWUA 2PVSA 4Y67A 4EL0A 1TEXA 2V54A 5FUMA 5EG5A 2W2QA 3DOOA 3ZVKA 2WF6A 1T8SA 5K8TA 2ZL5A 4ZTBA 4HT3B 5JFTA 3H11B 2F8LA 4Q9NA 4CW7A 4N3BA 1R4MA 3ZIUA 4BNIA 5DJ5A 2AX3A 2D13A 4R54A 4UHHA 1K2VN 3TQHA 3K7EA 1TNDA 3LCVB 1KZ9A 3QPAA 4LXXA 4MUGA 4XSVA 4UPEA 1VL1A 2VBFA 3CRQA 2Q29A 4F8JA 3GRPA 4M9QA 3NDJA 2FWNA 1H6CA 3KNZA 3ZLUA 4OGGA 2IYUA 4ZJZA 2G0TA 4E5UA 3SC3A 2YX1A 3GLRA 3HUDA 4GBMA 1DZIA 4KH0A 2R85A 1FVFA 1USKA 2BVNA 3C3MA 2ISSD 1FY2A 4LY6A 1UFRA 3BK2A 2PLNA 2X0IA 3EIXA 1RXSA 4PM4A 3OLZA 4XJTA 4P1VA 1M34E 4L8JA 2R60A 4P84A 5IH3A 1NPDA 3ZH2A 2DT8A 3K30A 3A6HA 3FDFA 2GKSA 1TMKA 2H1RA 5KYWA 3NHKA 4JP5A 1ETUA 1D0IA 2B1RA 2VDNB 4EM6A 4RD0A 1J2EA 1PFKA 1KO5A 1WY7A 1QFMA 3C7DB 4XDYA 1X8JA 2JFGA 1D04A 4GMFA 4C6HA 3TNFA 3OF5A 3SZ3A 3WIBA 3ZWMA 2DPLA 4OOEA 3DTNA 2YMMA 2REOA 3CG4A 2W2LD 4P4SB 4R8LA 1PZFA 1S7GA 3BNWA 3QV1A 1MAWA 5JHGB 1O1YA 3ZGLA 3WGMA 4M2LA 3G0DA 3GFFA 1EFUA 1T8RA 3FGZA 1DT5A 1LH0A 3DLCA 3MEQA 2WT8A 4Z8YA 5K51A 1H65A 3BA6A 1SVLA 3SZMA 1D5CA 1L9XA 4QLAA 1HYBA 2OBLA 4IIFA 3FDZB 2V6GA 1GIAA 2BEWA 2J9FB 5AI0A 3Q2KA 4RUKA 4LDPA 3A8KA 1N6RA 1XALA 3DLIA 4L7VA 3F6CA 1O95C 5C1IA 5FWYB 3RRZA 4Y7CA 2H0QA 1L7AA 1UMBB 2VTDA 4I7EA 3UTCA 2IDZA 3FNQA 3WSVA 1G21B 1Q92A 1SXGA 3KSAC 1DEKA 4H1HA 5ITZB 2YOFA 1NXOA 3OZBA 4NBVA 4QUHA 1O6CA 4D6YA 1QGED 3T7EA 3GLKA 1NMSA 9ATCA 4MEBA 3PQCA 3AB7A 5KYUA 1IWOA 2E4UA 4XUDA 1YB6A 1XB2A 2XUPA 2GBPA 4ND1A 2WAXA 2WKSA 4P4SA 1ZWKA 1WXHA 1PSDA 4CMEC 5KC9A 4JBGA 2X1HA 3BGSA 2B4TO 4Q05A 2EX0A 1LI7A 1UBJS 3NHFA 4AF6A 1BW9B 2OP0A 3V2HA 3NT5A 3UCFA 3AGQA 1U2TA 4QVAA 2B21A 4IXTA 1PW7A 4M7PA 4MA4A 5DEOA 3UXMA 3GGPA 2CSUA 1HE8B 1PWEA 3GRCA 3NEPX 3WP0A 2ZYWX 3BIFA 2DLCX 3I0ZA 2F3QA 4N7BA 4XR6A 2I2FA 1R8YA 3DBLA 4M7RA 2HN9A 3FRHA 3VNSA 3JSAA 4BMPB 3ODPA 5DGIA 1LWOA 1UMBA 1US8A 3RBXA 4EECA 4Y9UA 4X1KB 5JASA 1E64A 1VG0B 4HEHA 2CHUA 1Z4JA 3AFGA 3F5DA 3RAEC 3OHPA 4EUNA 1CP2A 1Y6ZA 5AW8A 4GI3A 1R4ZA 3MNFA 4NMXB 1LBTA 1MTZA 2QIOA 3TQSA 5E0KB 2YV1A 4BFLA 1YS6A 2XUZA 4GSKA 1KY5A 1W4LA 4F04A 1KYYA 3T9EA 1X7WB 5CFRA 4YQEA 4TXMA 2QRVB 5JNSA 1ISJA 4PGHA 3WXMA 5EIBD 3UMSA 3U40A 2CLIB 2WTXA 1FVOA 2Z08A 5CD1A 1E92A 2HRBA 3JQRA 5DRYA 4ZT5A 5AKKA 1P6XA 1RM5A 2O8CA 3IOBA 3I9FA 1U3FA 2FZ5A 1C8KA 3PGMA 2M2IA 2Q5JA 2G1JA 5LD2C 3ULKA 3KSMA 4B6OA 4E94A 2PL5A 2W4QA 1S2MA 1WB9A 1SULA 2VYFA 1FRVA 3A0RB 1G8MA 1NP6A 4D98A 2OBXA 1UWCA 2W43A 4PVDA 5H4GA 2HGZA 4LFBB 2GO1A 1WEHA 4JOBA 3G23A 4U9UA 2IZ0A 4II7A 5FOSA 1YONA 2NUTB 4V3CA 4MDYA 2VP9A 3N8NA 3D3QA 1JEYA 3VR4A 1NL3A 3IPAA 1T0BA 3V7YA 1QFSA 4FQ7A 1WCV1 1QGYA 2C20A 1ACLA 1PSWA 1CY2A 2P8JA 2QJTA 3KT6A 2B9EA 2C2YA 1IJBA 2FUEA 1F38A 1WDKA 2WTAA 3L49A 3QITA 5HE9A 5JDIC 3MWLA 2HWWA 3CIFA 4HTFB 1E9VA 2CXXA 3IMFA 4DCTA 2V65A 1W73A 5SV2A 1NBIA 5K0SA 5GJBA 5L4SA 1HFWA 5B4VA 1WSBA 2PV7A 4MVJP 3BCUA 421PA 3Q1LA 3EA4A 3RUCA 1KEEB 1RWVA 1IXRC 2ZBFA 4K6KA 5A4AA 1PV4A 3OQIB 2R44A 5ICSA 4HDSA 1ZUNA 4GKVA 1XOIA 5TC4A 1U3TA 1ARZA 1XPOA 4X8OA 4RGVA 2ZI7A 4CWAA 3IAM1 1SEPA 1S8FA 2VRWA 4REOA 2NXEA 2I7VA 3MCUA 4JVNA 2ZIVB 1AZTA 1RLIA 3FPAA 2JHAA 4IX9A 3GPLA 1NBME 3ZHQA 3CKKA 4Q1AA 1J5PA 2H5JA 4EF4A 1GXSB 4BEWA 4J7AA 721PA 1J0CA 4KKUA 1FTYA 2QQ5A 2ZTLA 2X1LA 1UBHS 3E9RA 3SLKA 1H2FA 3TW8A 4H7EA 4JBNA 4O5AA 1ZMRA 1GN9A 1MORA 2HJRA 2POQX 2BGMA 1ZM4A 4Y6PA 2EG9A 1IK6A 3DDHA 3FWZA 4EAAA 4R2MA 1FS6A 2AFIA 3LPAA 3UK7A 4BN4A 1NU8A 1U0LA 4DC9A 1PK7A 4EFMA 3W2GA 5JARA 4EZIA 3B1FA 1RXUA 2P6NA 3BN3A 1M1XB 1ZC4A 1V5IA 3C8ZA 5CK4A 1CETA 1DX4A 2A9PA 2NX2A 2R1VA 1UBFA 1E2JA 3B6JA 3BTUA 3IXLA 5D86A 3U60B 3RT1A 5T4EA 3LD9A 1E1RA 1K8RA 2O3JA 2VHVA 1P0CA 4RO0A 4RVDA 1P7PA 3T7JA 1OJ7A 4J1TA 3H1FA 3DZDA 3QSYA 3QGMA 1Y6GA 3AI3A 2XB8A 4XQFA 1GGMA 1VG9B 2Z8XA 4AKSA 2ECQA 4G4JA 5CA1A 5K99A 3JQCA 1KHHA 2O8CB 3X1WA 2FI1A 1UWKA 4TRJA 2O8VA 3BK1A 1BN7A 5JDIA 2WDZA 2IH2A 4ABYA 1R9GA 4ZO9A 3JWIA 1WUYA 2HF7A 4O6VA 1XZDA 3RM3A 3SQDA 4BO8A 3FLBA 3QWIA 1QAOA 1CY7A 3QBTA 3WV5A 4AY4A 4I1RA 3VV2A 4FDMA 4TTIA 2PUEA 4E6PA 4XEUA 2PSEA 3LA8A 4KQCA 1TE2A 2M32A 4RSMA 3V8PA 2OMEA 3RIEA 4ZJYA 1FXWA 4QHYA 1Q22A 4N01A 2MSDB 2X6TA 4JQZA 3NDPA 4HDOB 2YFQA 2A4KA 1T10A 4KIWA 4I3GA 1VGQA 2IEGA 4UPVA 5T3UA 1CUYA 4L5JA 4YRNA 3K1AB 2D7DA 1L4BA 3R2JA 3GJYA 1GUFA 1XCBA 2FZ4A 3UQYS <