3QSYA

Recognition of the methionylated initiator trna by the translation initiation factor 2 in archaea
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
415
structure length
415
Chain Sequence
MAWPKVQPEVNIGVVGHVDHGKTTLVQAITGIWTSKHSEELKRGMTIKLGYAETNIGVCESCKKPEAYVTEPSCKSCGSDDEPKFLRRISFIDAPGHEVLMATMLSGAALMDGAILVVAANEPFPQPQTREHFVALGIIGVKNLIIVQNKVDVVSKEEALSQYRQIKQFTKGTWAENVPIIPVSALHKINIDSLIEGIEEYIKTPYRDLSQKPVMLVIRSFDVNKPGTQFNELKGGVIGGSIIQGLFKVDQEIKVLPGLRVEKQGKVSYEPIFTKISSIRFGDEEFKEAKPGGLVAIGTYLDPSLTKADNLLGSIITLADAEVPVLWNIRIKYNLLERVVGAKEMLKVDPIRAKETLMLSVGSSTTLGIVTSVKKDEIEVELRRPVAVWSNNIRTVISRQIAGRWRMIGWGLVEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Translation initiation factor 2 subunit gamma
publication title Crystal structure of the archaeal translation initiation factor 2 in complex with a GTP analogue and Met-tRNAf(Met.)
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Translation/rna
total genus 47
structure length 415
sequence length 415
ec nomenclature
pdb deposition date 2011-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3qsyA02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3qsyA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3qsyA01
1P2TA 1X6VA 3TSWA 3QXXA 3IHLA 2FEOA 3IIJA 4KHZA 4MGKR 2XJ4A 4XWOA 3AP2A 2Q6TA 4TMTA 1DAHA 1W4AA 1R6BX 2GDJA 2QRNA 3LA6A 3FFBA 3UANA 2ZYVX 4JZKA 4NCIA 1VYUA 2JIZD 3WRYC 1TU3A 1W47A 2GCNA 2OEPA 1F2UA 3VNUA 3PEUA 2QAGA 3EWAA 3B7GA 1SULA 3HPQA 4G01B 2C9OA 1NN0A 2IYLD 2ZXUA 3DOEA 5F9FA 1AGPA 1MABB 4B3XA 2ZE8A 2JASA 3D6TB 1E9RA 4RKFA 3U7FB 2YC4C 3CX8A 3T5DA 4NU0A 4TL6A 3B5JA 5FTJA 1M7HA 4JSYA 2FN4A 4PR0A 2OAQ1 4Q7LA 4Q18A 1Q21A 2ZRFA 2AD5A 1G3QA 2VTKA 3QNUA 5J4YA 4KFSA 2Z5FA 1W1WA 3R9WA 4WQMA 1AQUA 4B2PA 1G8YA 2P0EA 4RY2A 1S3GA 5FBLB 4MYHA 2ZTSA 2BDTA 5J5CA 3X2SA 1G9XA 3B9PA 1EX6A 4DDVA 3I32A 1AS0A 1HE8B 3IBYA 1PUIA 2BBTA 3B78A 2RGNC 4UJ3A 1NLZA 2ZRAA 2R6AA 2VNJA 1PZNA 2AL7A 4TQAA 1KAGA 2CL7X 1R8QA 4NYJR 1D8TA 1FTSA 4ARZB 1X3SA 3VTKA 5GADl 1KGDA 1KD1D 1BS1A 2QGZA 2P6RA 4C3ZA 4GNKA 1DELA 2FPKA 2IYUA 3WRXC 4DT1A 2GBLC 3U7HB 4FIDA 1XFAA 4M1TA 1WXQA 3WBJA 2RGXA 4RCZA 2QGNA 1Q1BA 1QHSA 4NYJQ 3ADKA 4ACBA 5DI3B 3LVQE 4BRUA 4HB4A 3LRPA 4XIGS 1JQLB 5TDHA 2VP6A 1NIJA 4LYHA 1NVXQ 3JVUA 4ARZA 5C4GB 1GJRA 1A1VA 1G8HA 5LDDC 4CEJB 2LWIA 2CL6X 3IIMA 3DKVA 1E1QD 2Q0HA 1W5TA 2R8RA 1BQEA 1E2IA 1J9ZA 1BMFA 1KI7A 3KXIA 3KL4A 4PX9A 1SKYB 2WMNB 2J7KA 1E2FA 1SVSA 2GNOA 1YRBA 1XB2A 1TQ4A 4LYAA 4Q19A 4WZAE 5DI3A 2FH5B 1XPRA 1U94A 3PEWA 5LD2B 4R98A 1TL7C 3KX2A 1KI1A 1EXMA 3AM1A 4RSGA 4LCBA 5CK4A 3BE4A 5B30A 1JB1A 1NN3A 1Q1ZA 2FFBA 1TF7A 1ZCAA 1CLUA 2HMAA 4MA4A 1MO5A 1YZKA 2W6JD 3FHTA 2IYRA 1G7CA 1JXOA 4CIDA 2FF7A 3SN6A 2ZROA 2V1UA 4NZYA 2BCGY 4EPYA 3FPAA 2PEZA 2YWGA 1R0ZA 1P7CA 1Q0UA 2GTPA 1OXUA 2ZETA 4AY2A 4HB0A 2EFDB 4L9SA 1GDDA 3CWQA 2VHUA 3T1VA 3P27A 2ATXA 4OQLA 5FTLA 1ZNYA 5TVKA 4BFZA 1XX6A 4QG7A 2H7VA 3GFPA 5HCNA 4PC3A 4A6PA 2AFIE 3QF4A 4URUR 3QPVA 1OXXK 4W5WA 1N6NA 3FFAA 4ZV4A 5HCIA 2H18A 1TUIA 2GETA 2AWNA 2OBLA 4AYXA 1ZNZA 1SKYE 3C16C 5KYKA 5TARA 1Z0KA 3LX8A 3VHXA 4DSOA 1YR9A 1N25A 3RS7A 5J4HA 3QVVA 4JLDA 4HUTA 1I2DA 1F48A 3NDBB 4DC9A 3CCUB 2AFHE 5CLLA 5IT5A 1CJKC 1OYYA 5AK0A 3RRYA 4JL6A 5AWFC 2AWOA 4F7DA 2Z4RA 2R44A 1U2RA 4C0HA 5DH9A 2RC5A 2X19A 4LJ4A 4EFMA 4EH1A 1NMXA 3WNBA 1QHHB 4NMMA 3MCAA 4LV8B 3TAHA 5HE9A 4HUQB 2VP0A 3AKCA 4ZCMA 3E2IA 3ZBTA 4F4JA 1E9SA 1SVWA 2O0JA 4OYHA 2V6IA 2WM9B 4KO8A 2A5JA 5FA6A 2PT5A 1K73D 2NO7A 4B75A 5G3YA 1E1RA 2OHFA 4BLOA 3U44B 2Q3MA 2W83A 5FPTA 4K1XA 1GP2A 2GAAA 1G3UA 1GRQA 1QHHA 2KBFA 1VQ9B 3QXHA 4KVGA 3V4RA 3OAAA 1OH7A 4LUCA 5AUQA 5CB8A 2FJUA 4HUQA 1YZQA 4M0LA 5B64A 1ZM4A 1QGZA 3SE0A 3U3OA 2QP4A 1ZMXA 2QPAA 3QFTA 3PV0A 5EP3A 4F4CA 2R2AA 1FP7A 3EA0A 2JLUA 3LBNA 2P5TB 1Z2CA 3E20A 4B6EA 1BMFD 2ZVQX 3SJAA 5JWOA 2HYDA 1ZD9A 2G9NA 2QI9C 2AXNA 4PQRA 3I56B 5SZHB 1QG0A 1XPUA 2GXSA 4Q1FA 2QZ4A 1OFHA 4MUBA 3B8HA 3VO1A 1PLKA 3BFXA 4Q01A 4AD8A 2IUTA 1E9FA 1DARA 1CF4A 4BLPA 4EPXA 3GJ3A 121PA 2P65A 5BN3A 4D26A 4RJLA 2PZGA 4NCNA 3W5UA 1EGAA 4URVR 2IYZA 4P4SA 1R0WA 1J70A 4ZGQB 5KUTA 3ZBUA 2VSOA 3VR2A 1OXTA 3CCMB 4L4UA 4BFVA 3OEHA 3FHCB 3VO2A 2ZSEA 3W2EA 2OCAA 4GP7A 2Z6VA 3Q5EA 3EARA 2DY1A 2PCJA 2BBOA 2IYSA 4ZDWA 2FE4A 2QTFA 4Q1DA 1OIWA 1G5TA 2YKGA 3N2EA 1NF3A 3AGPA 1GFIA 3HR7A 5J4VA 1RRGA 4YMWA 3RS0A 4LGMA 1FW6A 3ZC3A 2QL6A 2W2XA 4WA7A 4Q4HA 3I92A 4BGDA 1FUKA 1II8B 1II9A 2GXUA 2V6JA 3H2YA 1YR7A 4QJ5A 5K8UA 2XNCA 5KTYA 4XWKA 2CLDX 1FMJA 1VG9B 1ELOA 3K0AA 2WV9A 5EE3A 2G1JA 3AKDA 4HDQB 5FL7D 2XGJA 1R2QA 3U3RA 4MDFA 4RCYA 2HV8A 2HF9A 1IN7A 4IDOA 2CNWA 2EYQA 3JQPA 5P21A 4BFUA 1DAFA 2YJTD 2PMKA 2WMOB 1KYIA 4C0QC 4TWZA 5EMNA 1NVVR 1N0UA 2RGCA 4A4DA 1SVOA 2O0KA 1VHLA 2FNAA 4OQMA 1UKEA 1G5RA 1JXMA 1S2MA 4NTZA 4X8HA 5JCZA 3LX5A 4R2HA 2PZEA 3B6EA 3BFVA 4QBGB 3C5CA 4DCSA 2ZE7A 3OJWA 4C0SA 1ZP6A 1I4LD 3RLFA 5TXGA 1G6OA 3KQKA 4FMDB 3OESA 3KJEA 2AD1A 1V43A 1XMVA 4ZCLA 1HEIA 4PSVA 1UKZA 2BKUA 2A5DA 1DBSA 3IO5A 3OAAD 5FOVA 2PIAA 1F2TB 5DHAA 1W0KA 3WYGA 1U9IC 3MWLA 5TY0A 1JALA 5L3SB 5BW8A 2V54A 3KB2A 4DIDA 4BEJA 3C5HA 3IBGA 1GRNA 4GL2A 3ZQ6A 2W6ID 1E3MA 3NBYC 4GRAA 3G82C 1XP8A 2I1VB 1DAIA 2P2LA 5BWMA 3EZ9A 1F2TA 1VQKB 4S2EA 5DHFA 2ZR9A 1E0AA 1X8JA 1FNBA 3GLFA 5FBVB 5L3SA 2GZAA 3WHKA 2FGJA 2ASEA 3OEHD 1CQXA 3D3QA 4B6FA 1AZSC 2FMXA 1KO5A 2DFNA 2ZI3A 3GJXC 3HU1A 2XNDA 3KUDA 4LY6A 2C98A 2B92A 3TVTA 3PENA 5KPDA 3VNVA 3BIFA 1AM4D 1HTWA 3PVSA 3EC2A 3FPKA 2OBMA 3FKSA 4Q1CA 4Q48A 1P6XA 2K5UA 5GJCA 2IXEA 3SFVA 4DVGA 3HR8A 1OFIA 2QNRA 2WWFA 4KSCA 521PA 3PR1A 3A6PC 2C8VA 1SVIA 3NEJA 2IL1A 1D5CA 1US8A 4TTPA 1QUFA 1AKYA 3ZS8A 4B3BA 4IKEA 1P4SA 2ZJ8A 4AKIA 1G3RA 4ZI2A 1U8AA 5KSZA 4DLVA 3B82A 3TIFA 1ZU4A 2G77B 3DVLA 1KDPA 4IOMA 2DPXA 3R8CA 3SC3A 1M34E 4Q9IA 1QVAA 1R0XA 1FFHA 2ORWA 1QFYA 3TRFA 3K70B 1RW4A 2CRVA 1KY2A 2VO1A 1NNEA 5JRJA 5JJLA 4URWR 4TQUS 2GILA 3TR5A 5FR1A 2G6BA 3QSYA 2CNWD 2P5SA 2QA5A 3CC4B 1G291 2F7SA 2C03A 3AVUA 4DLWA 5FTNA 1CIPA 4JYBA 2EFGA 1G7RA 2KJQA 4JLVA 3KKMA 2XTNA 1GNQA 1FNDA 3SJZA 1Z6GA 3OZWA 1D9ZA 1QRAA 1CJTC 1KK0A 4A0RA 3CR7A 4OQFA 2PBRA 3H0KA 2V3CC 2F9MA 4EIWA 1GAJA 3ND9A 4DLSA 4LBYA 3PQCA 4NKRA 1L4UA 2GF0A 4PFSA 4LBZA 1CP2A 3IO3A 4HB3A 3RVBA 3VR1A 1HUQA 2CCGA 1Q3TA 2ZRDA 4DSUA 3AVQA 1NN5A 4EFLA 1W0KD 1U0HC 4KAXA 1C1YA 2WWXA 1KZ7B 2O52A 4ITRC 5FUWA 4CT4B 4FK8A 4KITB 3RS4A 1QHGA 4MKHA 1YJWB 2QEXB 3UMSA 4K81B 2IEZA 4YAFA 1AMOA 3LO8A 3BH6A 4FWTA 1P9WA 3EZ6A 5HR5A 2W0MA 1ZJ6A 3HDTA 1GL9B 4LPSA 1DG3A 3QQ5A 3H86A 1DDIA 1ODFA 5HZKA 1RYFA 1YJNB 1Q57A 2H5EA 3PCRB 5L3RA 3V00A 1IY1A 2B7BA 1GIAA 3GFOA 5BN5A 4I1VA 4MUAA 3LQRA 4NYIQ 1JR3D 3K0CC 2GPJA 3THYB 3LD9A 3R9XA 1OKKA 3QG1A 2WVJA 1X1RA 1G41A 2XNDD 3NKVA 5KO2A 1D2EA 4URZR 5EE5B 3OHMA 1G7TA 5E3HA 1E2MA 1IN6A 5KNCA 2TMKA 5L3QB 3NHAA 3A4MA 1VG0B 3K9NA 1TPZA 1C4OA 2Q3FA 4Q00A 4KVAA 5KSWB 3C15C 1A8PA 1IJEA 1EFTA 1KJZA 1CR0A 4RFSB 3BB3A 3C8UA 1EFUA 1S0UA 4BFSA 3THYA 1T8UA 4ZKEA 4G5QA 4NDZA 4GZLA 4IW3B 3TSOA 1TNDA 2YYZA 4OI4A 3K9GA 2D2EA 1OT3A 1OIXA 4BZQA 4U9UA 3ZD7A 4IXNA 1Z6AA 4FCTA 1JEEA 2VHTA 2IC5A 3Q3JB 4RZXA 4RFSA 2CL0X 1Z6TA 2Q21A 2WPDA 1L2TA 2ANCA 1DO0A 4HAYA 3T61A 3TUIC 3NWJA 5FTKA 5JRZA 2A9KA 2GXQA 3C41J 3GLIA 1Z28A 3IQWA 1LTQA 4BEBA 4BFXA 3GD7A 3FB4A 1YZGA 3MRSA 4DB2A 1R8SA 1MRNA 2IEYA 1A5TA 3I73A 4GFDA 4JL8A 2RGEA 3ZLJA 3EZ2A 1OH6A 2ZAMA 5CLQA 2IUSA 3VKWA 1QUEA 1GWNA 3SBEA 3T35A 1E63A 1CTQA 1VECA 1ANKA 2Q9BA 3MWJA 2J3EA 5JEDA 1GL6A 2VP9A 4NCKA 4QHTA 1E96A 2GKSA 3AVVA 5J4LA 1NI3A 1Q7YD 4BFYA 5IK2A 3LW7A 3TLXA 3W8RA 2F55A 2UZIR 4TYWA 1P9NA 2CVHA 1T5LA 2D2FA 1YJ9B 3EAQA 4RZ3A 3SR0A 1KQSB 3VR4A 1Q3HA 2OZEA 4YAOA 4N3GA 4N0DA 2WKQA 1N0VC 4TTQA 3QKRB 1WB9A 1PLLA 1G8PA 4F91B 2ERXA 3Q7QA 4AC9A 3TE6A 4XVRA 5JWRA 2QTZA 1WBBA 4LZZA 4XTRA 1D1NA 5AJZA 3A37A 3RSLA 1W2BB 1P73A 3I61A 5DI9A 3P4XA 2KE5A 1T0HB 3NBXX 5D3MA 3Q72A 1OH5A 2BPOA 4UNSA 2O0HA 4UNQA 4M21A 4ABYA 3L8YA 4M9XA 1LY1A 2AKYA 2GK6A 3FHOA 3HU2A 3Q7PA 4Q9HA 3TK1A 4BLQA 1EX7A 3GP8A 2XZLA 5AN9A 1OKKD 2G3YA 2HEIA 4HEJA 4FINA 4V0MA 3QKRA 3W5VA 4B76A 3OIWA 5H8WA 4JJKA 5G41A 3CPHA 421PA 4IVPA 1SZPA 1JJVA 1X1SA 1N6KA 1LF5A 4K8OA 3B9QA 5AR1A 3CH5A 4A2PA 2QSZA 4LJ9A 1B23P 4C30A 5IDVA 2SHKA 1WA5A 4LYJA 1DG1G 4HAXA 3EIEA 5JS8A 2YZ2A 2QENA 4M1YA 1KI4A 2ODNA 2YWFA 1ZNXA 2XB4A 2VSFA 3H1TA 2D7DA 1ZUHA 2JIZA 3RSOA 3SBDA 3B13B 3CR8A 4IFBA 4YMVA 4V0ME 4QBFA 5KNBA 2WJJA 1ZIOA 3K9HA 1VQ8B 1VQNB 3ECCA 1LV7A 4B48A 3THOA 4B4DA 3PUXA 5JWHA 2GCPA 1GVHA 1KI6B 3QE0A 1QVRA 1MO3A 3FMOB 1YHNA 1KKMA 1S1MA 3CUEF 2WPDD 4W7SA 2DETA 4CVNA 1F60A 1TQ6A 4IDPA 1CNFA 1J90A 3QUSA 4YLGA 1G5PA 1M6NA 2QROA 4W5HA 2QTHA 4XVQA 2OTLB 1SXJD 3OJXA 2RGNA 1KOFA 3KDSE 4M9QA 1JBKA 1KKLA 4TMXA 4FMCF 3CNNA 3KUCA 3GJ7A 1VQMB 4MRPA 1GNPA 4QM6A 2OLJA 1OFUX 1SXJC 1CJUC 4TMKA 4US1R 1EESA 1NBMA 1XTIA 3AF1A 3NDPA 3CD6B 3B2EA 1Z6YA 1T6NA 5EXXA 3MUFA 3THWB 3WXMA 1X8KA 1DOAA 2JDIA 2OLKA 2QSYA 3RWOA 5JS7A 1IY2A 1E4VA 3PJRA 2AXPA 4YONB 2FPLA 5H59A 3FE2A 4LHZA 1MRSA 1OH8A 4NBSA 1E9BA 4V0OA 1YR8A 1FQJA 2CK3D 5TB5A 5FI0B 1Z6XA 5IK2D 1RC8A 1L7VC 2CLSA 3F0TA 2OUKA 2B5OA 2WWWA 2GXAA 1JI0A 1SVKA 2VP4A 2EWWA 5CYOA 3THWA 2OCYC 5FH9A 1NDHA 1NY6A 1NSTA 1VQPB 1NBME 3MG9A 2WAYA 1R7RA 3OZUA 1QGYA 1K5DA 3PIRA 3AVWA 2GJ8A 2QT1A 4JBWA 2FV8A 1UF9A 3VKHA 3W6NA 4TL8A 4UJ5A 1E1QA 2OBNA 2VF7A 2IW3A 1AS2A 3REFA 3DM9B 2YNMA 4TLCA 1E9CA 1Z5ZA 1IBRA 2DHRA 4ZKDA 2NO0A 4EPRA 1BYUA 1N5KA 3I4LA 3U7EB 4WZ6A 4QBIA 1YE8A 5DGXA 2BM1A 3A8TA 2QAGB 1RVDA 4BRWA 1X8LA 1ZD8A 2B6HA 1HA3A 3KJIA 1YJ5A 1TEVA 2MSEB 2E1RA 2ZJYA 3U5ZB 4DCNA 3CPWB 2W6JA 3EC1A 4KXFB 2QMHA 4LJ7A 4UXJA 1OFTA 4XOIA 4B71A 3EZFA 4NH0A 3VR3A 3W5JA 3W3ZB 3ZD6A 1Z47A 1E2LA 2CCJA 2X1VA 4LHYA 4NP6A 3AVPA 3P20A 4PANA 1P2UA 4OHZA 1A2BA 2BKEA 4KBFA 5FBRB 2WKPA 2W0SA 1D2MA 3OEED 4E5UA 4PHFA 1OSNA 1SVLA 2FPMA 2NQ2C 2OAP1 2ORIA 1OIVA 2ONKA 1T91A 2WAXA 3NBFA 1IXSB 1F6BA 4LI0A 3RANA 2REXB 4Q4LA 1KHTA 2QMEA 4KFTA 3LVBA 2NPFA 3NHBA 4JLJA 1Y3AA 1OXVA 1FX0B 4IOJA 5FBWB 3BORA 5BYJA 1JR6A 3D7MA 3VX3A 1G8FA 3OFND 4AURA 5L3VA 1G17A 1UFQA 3RS5A 1NG9A 2AX4A 4YDHB 1IN4A 3WP1B 1SM4A 3QFCA 4DT1B 2ZYUX 3TUJC 1XTSA 3QKUA 2FX3A 4G3XA 4G0NA 3WYAA 1JPJA 2G1KA 2BGIA 1AGRA 2JCSA 1KDRA 2HF8A 1NBMD 2CNDA 3DZDA 2A78A 2F6RA 1FX0A 1FNMA 1QHNA 1TEXA 3HP1A 4FW9A 4NYMQ 2ZE5A 2H92A 2BM0A 1A82A 1OXSC 4MITA 3WNCA 2JDID 2ZS7A 1CXZA 3B1YA 1KZGB 4AKHA 4PAOA 4Q1EA 1KNXA 3G5UA 2ZU0C 1C9KA 2ZI5A 3LBIA 4TT3A 2OESA 5FPSA 4CRWB 3UMFA 4OQXA 2Q3HA 2JAQA 1KTVA 2OSBA 3B1ZA 4OK3A 2GWHA 4TSFD 4F92B 1BJKA 2QUZA 1NY5A 5JZVA 4HAZA 4ZIRA 3NVAA 1H8HA 3JZAA 1B0UA 4NHOA 3TBKA 1H8EA 5GJBA 3CC7B 4D4LA 2QBYA 4A2QA 2W58A 4EFNA 2A5GA 4LHVA 4DJTA 1U0JA 4ZPXA 4KFRA 2XOKA 3TAUA 1VQLB 2WJVA 3SDZA 4CT5A 1FRNA 5CB6A 3MFYA 2WICA 1AJEA 1M1YE 4A92A 2O8DB 1VHTA 1NJID 4HLUC 1RE0A 2OFWA 2ANBA 4JLMA 4JLNA 4DDTA 1D6JA 221PA 2EFCB 4HATA 1KAOA 1T3HA 4Q7MB 3J81k 1FMLA 1VMAA 1W49A 2I4IA 5ANRB 3W90A 1RRCA 2BBSA 1W4RA 1QFJA 4EUNA 5SZKB 1EP3B 1NKSA 2QT0A 5FUYA 1Z0FA 3JVVA 3DO6A 4PAQA 4JSTA 4JBXA 4KYUA 4AKGA 2CVFA 2QPOA 3QF4B 5GJVC 4M9ZA 2VP5A 1OHHD 4G1VA 2QY9A 3W8NA 2WOOA 2F3RA 1Z2AA 2IHBA 4Q02A 4D4JA 5GJWC 2O8DA 1HQYE 1VIYA 3CRVA 1KI2A 4DRZA 1YITB 2OTJB 4JLOA 4A9AA 1XD9A 5G3ZA 1LS1A 2ZUCA 3ASZA 1QG4A 4Y0AA 3IPYA 2RB4A 4Q7KA 1GM5A 5DLQC 1AS3A 1DAGA 2BEJA 5CK5A 1W5SA 2EFEB 3ZVLA 2ZJAA 2ZR7A 1K9MD 4P33A 2ZVPX 4V02A 3KFVA 3SNHA 4XVUA 2NOAA 2PLRA 4FMDF 2QA4B 3SU8A 1Z3IX 2GEUA 4ESVA 2J1LA 3CKLA 5FL7A 3BWDD 2BJWA 4B3GA 3AVOA 4ZGNB 2WSSA 3TSZA 2CLCX 1Q1EA 3EPLA 4IDHA 2C04A 1GZSA 1ETUA 3IDQA 5JHHB 1CULC 1UBEA 3L43A 3TMKA 3KKOA 3SFZA 4IHQA 2WWIA 3REGA 1DAMA 5JFGA 5G40A 3CPJB 4DZZA 1UEJA 4G1UC 2GJKA 4TT3D 4LC1A 2RH5A 3K0EA 4A15A 1E32A 4RZUA 3IPXA 5LPNA 1U9IA 4MGIR 4QC2A 1CEEA 1QDEA 1VQ6B 1F20A 1W2GA 5CYPA 4M1MA 3C4JA 2JLZA 5DYIA 4LC0A 3EASA 1K5GA 2RMKA 5LB4A 3ZS9A 4A8JC 1GR1A 2YOHA 4JT2A 1A2KC 3IEUA 1H8HD 3CRMA 1UEIA 1H8ED 4A1FA 4P4SB 4O25A 2YV5A 1LNZA 1YI2B 5J40A 4U5XA 2XOKD 1P61B 2AK2A 2W6IA 3K09C 4HAWA 1NMZA 4AYTA 3KQUA 1Q86D 1QX4A 2GHIA 3MGCA 1ZBDA 3ZZTA 1BOFA 2XZPA 4B32A 3V4FA 3TH5A 4QOSA 4WAUA 2FOLA 4C2UA 5UKDA 4EKDA 5DSZA 1NVWQ 2NGRA 3I5YA 1VKJA 3TVDA 1Z8FA 4EQ6A 4KLNA 4F93B 1SVMA 1S3SA 1SKQA 1MKYA 3GFTA 4Q4HB 3CF6R 4CYMA 2Q9AA 3WBKA 1D2NA 1BX1A 4I81A 5DE3A 4B3FX 3TW8B 2J0QA 4JIMA 2C9CA 3LBHA 3A1TA 4JLKA 4MKGA 5DIFA 1XMSA 2QAJA 4DCVA 1E9EA 3K0AB 2BSAA 3ZZUA 3QKTA 3CCRB 3CNOA 5F3WB 2BMEA 1XTQA 4PPGA 4A0HA 1IQPA 5FI1B 1UJ2A 1W34A 2CEAA 2ZSAA 3PXGA 3F8TA 2PX0A 2CJWA 3ADBA 2FA9A 4PO1A 1Q81D 1P75A 5AJXA 1QFZA 3TKLA 1AN0A 3K8YA 4BQSA 4HDOB 4U7DA 1XCPA 4U00A 3CRRA 2REBA 3EG5A 5F9HA 4RD1A 1S96A 2DWOA 1FL9A 1N5LA 1XCMA 2WJYA 3VMFA 2JLRA 1NJFA 1ZM9A 4DUGD 2WSSD 1W7AA 3HWSA 1T4GA 2OXRA 3Q8XB 4D0NA 2A3RA 2FFAA 4IOLA 4DEYA 2DFTA 1FUUA 1YZLA 1T3LA 5EZ6B 5A0FA 3A58B 2EIXA 4M22A 3V76A 2ZJBA 1WMSA 2KB0A 1EWRA 5DNYB 2YHSA 3DPUA 4YQFA 4ZCIA 4URXR 2P6NA 2AR7A 4Y9RA 4MKFA 2ZRGA 1N5JA 4Y7CA 4YAWA 4LBVA 2P3SA 3AUXA 3TQCA 2GQFA 1NVUQ 2H16A 3K9LA 1FNCA 2X77A 4F4IA 5D3QA 3ZIAA 5ELXA 5EE1A 4LK2A 2BMJA 3OIYA 2I1QA 2VHQA 1EFHA 4Z8YA 3GLFB 4TQ9A 3AF0A 1KMHB 4K46A 2PEYA 5THXA 2QQEA 3X1ZA 3CCLB 1EFRD 1GSIA 4FXPA 5JHGB 5KHOC 2NG1A 5FPHA 1CBUA 3ZGXA 2F1RA 4C0AC 1UADA 2GA8A 2Q9CA 4EPWA 5FPKA 3I1FA 3AP3A 4D2IA 4RD2A 721PA 4JVSB 1U8ZA 4G5SA 2NTYC 4YMSA 2HDNB 2QN6A 3I55B 1IHUA 2BIFA 2XSZA 4JYCA 4PHGA 1H42A 3K0CA 1DPFA 1Q20A 2J7PA 1J8YF 2WWHA 5LB2A 2IS2A 3OIUA 4TTRA 2ZI6A 3QI2A 1HV8A 1KMHA 5H5JA 3AEZA 3KXLA 3EXAA 5SZIA 1US8B 2ZPTX 1JEDA 1JR3A 2VIIA 3OF5A 4IDNA 3SJBA 4TMWA 3U2QA 2J46A 4MKIA 1TU4A 4GOXA 2R9VA 4ON9A 2BMDA 3KQNA 2YWEA 1IY0A 2GZDA 2V8OA 5JSZB 1SQ5A 1XNJA 2J87A 4C0KA 4DKXA 5BQ5A 2BMWA 4Y9UA 1VQOB 3RDPA 1O3YA 4LOAA 3GLFE 3CW2A 3AB3A 1U81A 3VAAA 2V4ZA 2YINC 5FOXA 3W2HA 1XJQA 2VEDA 3KFXA 2A2ZA 5EQTA 1JR3E 2FZLA 2O8FB 821PA 1II0A 5JSZA 3F3YA 3CCQB 3ZDQA 3A1WA 3CF0A 1NKTA 4JVNA 3UKDA 4EPVA 4M1SA 3TUZC 3W2IA 1XEXB 1IB0A 3E5HA 4PXAA 3U4QB 4AI6A 1HQCA 4E03A 4GMXA 1ZD1A 2ZU6A 1E2GA 2HXSA 4LX0A 1ZUIA 4GPTA 3NC1C 4OJKA 4RD0A 1GKYA 4KODA 4QKQA 2IYQA 4MDEA 4DCTA 2O8FA 5JJIA 3THXB 2XEXA 3ZQJA 1SHZA 1T5IA 2C77A 2XNSA 3KKQA 4Q03A 3LQQA 3T1OA 4P3YA 5DYGA 2JATA 1I2MA 1XEXA 3B1VA 3MWKA 1YRAA 4OBEA 1QF9A 3U4QA 3PUWA 4QHYA 3ZIAD 1RYHA 3CBQA 2XXAB 2IUUA 3NBZC 4JLBA 3RS2A 4PTLA 5EXPA 3THXA 3L0SA 4MGZR 1GAQA 2FSIA 4WZBE 3FVQA 3TGPA 4XSGA 2CDNA 2ZQ5A 5JI3E 1IONA 1HE1C 3I8XA 2FG5A 1G3MA 2WSMA 3KKPA 5J4KA 4NYIR 1W36D 4B33A 4LWZA 4O2RA 2XXAA 2IS6A 4YALA 2IYWA 2Y8EA 3LXXA 4TLEA 3LW8A 1F3OA 2XSZD 3O8BA 1VDZA 2J7PD 1OPXA 2E9SA 1W36C 1Z22A 4BPRA 2HT1A 4TMZA 1OGIA 2NIPA 1S1CA 1PVOA 3T06B 3L2OB 4YMTA 4LYFA 4C7OB 1EFCA 2ZUDA 5CJ2A 3GJ6A 4IXMA 4RD3A 3R7WA 4Q66C 2O8BB 3OIVA 4LHXA 2QP9X 2W2VA 1CJVC 5TV2A 5CDFA 4TYYA 1MT0A 2RGDA 1DAEA 2IT1A 1OJLA 2C96A 2ZRNA 1KK1A 4WBSA 4B74A 3C7KA 3VX4A 2WIAA 5FBQB 1GILA 3SHWA 4C7OA 4D81A 2J0UB 4DB4A 1UKVY 1QZXA 3PUVA 1E0KA 4G5RA 2FSHA 3G6EB 1R5NA 2O8BA 5FUVA 4QBHA 3TR0A 1SXJB 2OG2A 3LLUA 2VF8A 5BN4A 2XZOA 3GLIB 4HLCA 1Y63A 1EWQA 3AH8A 1EK0A 4JVLA 3QXSA 5CDFE 1F5NA 4B44A 3QY0A 3Q5DA 1CNEA 2J0UA 1ZYUA 4F38A 3BS4A 3C14C 3W5IA 2ZRMA 4FCWA 2GEDA 1TF5A 2B8TA 2XX3A 3QE2A 1J8MF 4Q1AA 1SXJA 3AF4A 1HH4A 4WOPA 4GZMA 4UNRA 4TZ0A 1FPMA 2PMDA 2FSFA 1OE0A 2X8AA 2H8KA 4BFTA 1Q82D 3U61B 2ORVA 1BH2A 3GJ0A 1ZIPA 3ICQB 1NIPA 5IHPA 1NSFA 3B85A 4JLAA 4TL7A 3EPHA 1TAGA 1B2RA 3BD9A 4Q21A 4HLDA 1PV4A 3OE7A 1QGAA 2R6GA 3QEJA 3P32A 5CJPA 4KI0A 4X8MA 1G8GA 1KSFX 1SGWA 1RRPA 1N8RD 2WWGA 2DCUA 1QVGB 1Z0DA 2ZJZA 1XD8A 1SXJE 3CMEB 2CK3A 5D3MB 2RC6A 1WQ1R 4I1SA 3GLIE 2R62A 2KBEA 2H57A 3ZZ0A 1S8FA 1Q1QA 4PC2A 2QTLA 3DM5A 5DN6A 1ZM2A 3KKNA 3W9YA 2BWJA 3A1VA 4MGYR 5A4JA 2PT7A 4XD7D 2N46A 1W0JA 2C2HA 3K70C 4GBMA 5JMTA 5F98A 4EJSC 2QP3A 3JQRA 4DLTA 4DSTA 3ZVNA 1K8RA 3KQHA 2GK7A 3PUYA 2R6CA 1ZU5A 3ADDA 5K8LA 4RVCA 1XEFA 3SS8A 3QKSB 2J45A 1YQTA 5JCPA 3GJ4A 4M4SA 5B57C 2QMOA 2X2FA 4BE7B 4TYQA 1BO6A 2EFHB 4MYTA 1ZNWA 1FTNA 2CBZA 4HE6A 1X86B 5F2EA 1KO7A 1K8AD 2EYUA 3LNCA 5E7MA 1XZQA 4D0LB 1KK2A 2EVWX 3GEHA 2ZSBA 4LDJA 1VCMA 2YWHA 5FFMA 4PSAA 1YR6A 3N2IA 1W87A 3QKSA 2XNJA 5G53C 4J0QA 1E94E 2ERYA 1PJRA 2OFXA 2X2EA 4I1OA 4B3DA 4E22A 3EPKA 1XD2A 2ZEJA 3OEEA 1DDGA 3VHLB 1RFLA 2G0TA 3A1SA 3BH7A 3KXKA 3E1YE 2OK7A 3X1DA 2DERA 2OILA 3GCGA 4F7WA 2NZ8A 3FMFA 4G5OA 3NEYA 1GRRA 2X3UA 1JA0A 3ZH9B 3W2FA 1UDWA 1JQJC 2ZS8A 1VQ4B 4II7A 5KSPA 5EXSA 1H85A 4L15A 2IYTA 3U3KA 5M04A 3GMTA 3EIHA 4KYIB 3VU9B 2QEQA 3IILA 2QDXA 4LRWA 3VR6A 3OFNA 1E2JA 1Z08A 2G88A 3NXSA 4IEEA 3UMRA 3SEAA 2JJ1A 1ESMA 1GKIA 5E7IA 4AK9A 4PC1A 1XXHA 4PQYA 1IAQA 1T8TA 4UXIA 5FOSA 1E2QA 3CCJB 2A5YB 1YVDA 1P5ZB 1NP6A 4Q4JA 2JJ8A 5TMPA 4C2TA 3CIOA 3ICEA 1Z07A 3LAWA 2N42A 2XTZA 3RC3A 3OE7D 2GBLA 3VU9A 3L0IB 1WBDA 3UG6A 3WMGA 4AKEA 1P3JA 3G4SB 5EE9A 5E4FA 1E2EA 4O2LA 2QPTA 3UG7A 1ZINA 3BH0A 3LH5A 1KK3A 2GZHA 4TSFA 2P6UA 4DBLC 1E64A 4QNMA 4YMUA 1VQ7B 2VNHA 1AQYA 2HT6A 4LV5B 2ONJA 5DN6D 4E07A 3W2GA 1G6HA 1U99A 1Z29A 5DISB 5KPJA 1W0JD 1ZCBA 1ONBA 6Q21A 2HCJB 1GL7A 2HLDD 5KU1A 1HT2E 3VQTA 1XF9A 5HE8A 4HLUA 3FGNA 5AUNB 5BXQC 2R65A 1N2CE 3FOZA 2JJ2D 4GOJA 2IS1A 2ZJ2A 1XE1A 2H1LA 4RFVA 1G1MA 4QFMA 2YOFA 3IHWA 1ZUNB 1N0WA 1E99A 3BERA 4HSEA 3SJCA 2GEVA 5FOUA 4D82A 3A1UA 1LFDB 1N6PA 4MYUA 3SOPA 4H1UA 4PC7A 2C5LA 4G5GA 3QBTA 1VPLA 1RIFA 4XTCS 1T9HA 1Z83A 2KWIA 2WHXA 4IDQA 4OJQA 2IWHA 2C78A 1OHHA 2DYKA 1MOZA 3E1SA 3EWSA 3GLHB 4IOKA 2PX3A 3GJ8A 3OW2B 2DWPA 2PZFA 1TX4B 3CF2A 5GV7A 2BC9A 3O8CA 1K6MA 4YAUA 5B2ZA 2WZQA 4BLTA 1XMIA 3V9PA 5JLJA 4PPNA 1CU1A 2IWRA 3N5CA 3IGFA 1QHIA 2Z43A 1W44A 4GDFA 1IJFA 4TL9A 3KB1A 3LLMA 1VYVA 1XTKA 3CX7A 4HDCA 4Q4AB 4C0JA 5HPYB 2HJGA 4DEXA 4C9BA 3GLHA 1WDTA 1FNNA 2ZYWX 4JL5A 4NYMR 3SI7A 3MLEA 1FP6A 1NN1A 4RKEA 4Y0VA 3QFSA 1KY3A 4LV6A 4UQOA 1HURA 2JJ1D 1E79A 2O8EB 1IM2A 5KDLA 3L0OA 4S35A 3ADCA 4A8JB 2J41A 4Q4AA 2WIBA 3ZVRA 2FDCA 3PUZA 1WF3A 2VPPA 1IOZA 3ASYA 2GJ9A 1DVRA 5H1YA 1FQKA 4ZIRB 2OT3B 2J0VA 4HI0E 4HYYA 3HYTA 5HKKA 3GLHE 4QXAA 2VNIA 1OF1A 2UKDA 4FI3C 4QGHA 4FD2A 2QBYB 2O8EA 1RZ3A 1MABA 2A30A 4R7ZA 4A8JA 4GSYA 1P62B 4NE2A 4D6PA 4XSHA 4DQLA 3UIEA 4B35A 3W3AA 4KLZA 4PSKA 1OV4A 1S72B 2BBWA 5EP1A 5KSYA 1XBTA 2XITA 4MRVA 3K09A 1LF0A 5K8TA 1FZQA 1AK2A 3A4NA 2I3BA 1YZNA 2MSCB 4R2IA 1E9AA 2IYVA 2QMUA 4JJZA 4GT1A 2CXXA 3QG5A 5B58C 3QVUA 3WY9A 1XJ0A 4Q7JB 2FWRA 3PFIA 3LXRA 1W35A 2GJSA 3FTQA 4C4PA 4YXWD 1KJWA 2IS4A 3DHWC 3RC8A 4PZZA 1M2OB 3AVXA 5SZJA 2ZUBA 4TYPA 4OI0A 4FMCB 3IUYA 2ZI4A 2YOGA 1NLYA 1ESNA 1EG7A 4DCUA 3A36A 3MD0A 3CCVB 1G18A 5CIWA 2C9YA 2FFHA 2KI5A 1TUEA 2ZIAA 2B7CA 3ND8A 5KSOA 2IYXA 4AG5A 1UBFA 1ZC3A 2H17A 2JLVA 3FDIA 2ECKA 1TF2A 4WW0A 5HTKA 4G1BA 2HUPA 3AGQA 2WJIA 3NG1A 1UKYA 4HLQB 4CEJA 1Q22A 4OK6A 2HJVA 2Z83A 4QHSA 2OO7A 4A0FA 5KDOA 1T0JB 3M4YA 5EUMA 3SHFA 1ZAKA 1MO6A 4US0R 5K8IA 1KDTA 3HJNA 3CLVA 2W00A 2PH1A 3AVTA 1YZUA 2JLSA 2VP2A 4YHBA 2HCBA 4ILEA 1E79D 2F1IA 3EA5A 3IIKA 4DUGA 1KMQA 1BX0A 1L4YA 2EW1A 1KNQA 4QM7A 4UNPA 3RHFA 1MH1A 3DEFA 3M1IA 1G19A 2ZE6A 1U0LA 3SZRA 3BRWD 2QAGC 3BB1A 2DWQA 5EP4A 4DLZA 4C43A 2ZJOA 1EP2B 4WIAA 4HB2A 3OZXA 3CH4B 4IVQA 3CWZA 3RWMB 5HKKD 2IA5A 3K1JA 2HYIC 3L0PA 4OKSA 3RNLA 3CMAB 1BIFA 1S4QA 2VRWA 4PQFA 1G21E 2NPIA 3PITA 1E69A 1TADA 4NL4H 3MMPA 1EWYA 1GUAA 4JBYA 4WXPA 4DDUA 3QPWA 4W5JA 2WJHA 2REOA 4TLBA 4IVRA 2ZANA 4TZ6A 1T3SA 4Q9KA 3RAPR 4LJYA 2L0XA 1JPNA 4JVMA 4B43A 1BYIA 4H1VA 3TW4A 1QHXA 1E9DA 2ODBA 4IRUB 2ZI9A 4P31A 4U02A 4QJ3A 4EQ6B 4O3MA 1PUJA 1EFRA 2VYFA 3TQFA 2ZRHA 2VL7A 4HZIA 4TLAA 1GVNB 3T5GA 1R0YA 5AJVB 2UZ3A 1JECA 1KDOA 1E2NA 1W4CA 3W5HA 3DKPA 5JBQA 3HU3A 3PG5A 4Z1MA 4JKYA 1W48A 4M1KA 3P4YA 4CDGA 4PZLA 3T12A 4PGOA 3R8FA 1E2PA 4LPKA 1KC8D 1YHQB 4Q9LA 4O0MA 2O8CB 2OK8A 5LBIA 5KNDA 3RRZA 2CJWB 4I99A 4D4KA 1LS6A 3AQ4A 3FMIA 4JT4A 1MO4A 4KJZA 3I8SA 5E7JA 1FOEB 3BK7A 3U6BA 5AUPB 3U44A 4LHWA 2IF2A 4BLRA 3B1WA 4PC6A 1I4TD 1TMKA 1Z0JA 2O5VA 3WMFA 1I7PA 1O87A 4ASUA 2V55B 3A4LA 3AVYA 1MV5A 2G83A 1G7SA 2CE2X 4ESHA 4OQNA 3Q9LA 5C18A 2O8CA 1NJGA 4OL0A 1JAIA 2OV2A 3LVRE 4ZDJA 4OI1A 4R71A 4A36A 4RD6A 3CZQA 4OHWA 4Q1BA 2GF9A 5EUQB 4E09A 2UVQA 3ONWA 3CCSB 1XEWX 1JJ2B 3DOFA 3MAAC 3CC2B 1XRJA 3QJYA 1Z63A 4DQKA 1GTVA 1ZW6A 3DL0A 3QEOA 4M1WA 2IYYA 2V7QA 2N1BA 3U7GA 2BHRA 2GCOB 3UXMA 3BJIC 5KOYA 3QIAA 1G3IA 5EP2A 3L82B 2G0NA 1AA9A 4M8NE 4P6VF 5LD2C 2PCLA 1R5OA 4FN5A 2A7QA 2ZSFA 4QNRA 3RYTC 4P4UA 3MHPA 4OHYA 5GV8A 3EZ7A 2AKAB 3CM0A 5FL3A 2CHGA 4DWJA 2MMCA 4R9UC 1I4DD 1DE0A 3BC1A 4MRNA 1XTRA 1DEKA 1TQ2A 1N6HA 1UAAA 2GCOA 4PPQA 1XCGB 1COWA 3CB4A 2F43B 2WOJA 4M9SA 2BMFA 4QL3A 3GEEA 2VSXA 4ZDIA 1SHKA 4PO8A 5FTMA 1DO2A 1W36B 1CRQA 1II8A 1VQ5B 5C1BA 3FMPB 1TTTA 2R6HA 3FKQA 4I4LA 3BBPA 1N6OA 2OXCA 3CRW1 4QJ4A 3LFUA 1KO4A 2F3TA 5CM8B 1LB1B 4TN1A 1IXRC 4IJMA 3AP1A 1V5WA 1NRJB 5AUOB 3E70C 2F43A 3EIQA 4HAVA 1VG1A 3LDAA 2CHVA 3UWKA 1E1RD 2VYQA 4FCVA 4Z1MD 1NG1A 1NVVQ 4CEIB 4C0LA 5HXBA 1OLOA 1ZVQA 2ODWA 2ZRCA 3NIBA 3F5FA 1J2JA 3P26A 2FZ4A 2QM7A 2LCFA 4A2WA 1M1KD 1N3BA 2PJZA 1VCOA 2W2TA 1RRFA 2P67A 3P1JA 3W6PA 5GVRA 1GO2A 1XMJA 1Z0AA 3LO5A 2JA1A 5JI2E 4P32A 1AZTA 4ACAA 4NPHA 5EXTA 3BOSA 4A0GA 4CEIA 4AF7A 5GVSA 1E6CA 2ZRBA 3MSXA 4ZI3A 5JEEA 1CKEA 4AF6A 2ZYTX 4ASUD 4LJAA 3T34A 4PO9A 3VFDA 2IBMA 4DLRA 3AF2A 5HZHA 1M7BA 1S9HA 4HE5A 1KI3A 1M74A 2ZREA 3WP0A 1DS6A 3I62A 1U8YA 5FOTA 4KU4A 4N1AA 5KDDA 1KJYA 3RRNA 4OI2A 2BCJQ 2YC2C 3NH9A 2XJ9A 2V9PA 4X8OA 1XPOA 4RZ2A 3GJ5A 2VH5R 2VZLA 2V7QD 4N3NA 2HXYA 5FPYA 3LWNA 4HZUB 1YIJB 1QHYA 1WP9A 1YZTA 2ZRPA 3U6KA 4B34A 5CITA 4PZYA 4GOKA 1QBKC 1PLJA 2R6FA 4GI7A 1ZM7A 2D06A 2QRZA 1DAKA 1FDRA 1J7KA 1G4UR 2BVNA 2D7CA 4IEIA 4Z8XA 1N6RA 4DLXA 5L8VA 1WCV1 2RGGA 3KTAB 3LY5A 4AIIA 4QGGA 4DHEA 4DIEA 1CRPA 4JLPA 3W34A 3CCEB 3AKYA 1COWD 3QOFA 4HZUA 2GRJA 1KSGA 4EJSB 4BASA 2DEUA 3GEIA 1N5IA 3AV0B 3O47A 3AF3A 1KSJA 2IX3A 2VNKA 2WTUA 4ERNA 4LBWA 2GESA 1WE2A 4NCJA 1UPTA 2XAUA 1TLLA 1G4AE 1W46A 4TMVA 1KIMA 3IEVA 2CMKA 3KTAA 2BGJA 1VIAA 2WKRA 4YC7A 4V0KA 4QGFA 1FRQA 1UBGA 4L8GA 2QE7A 5FOWA 3TNFA 1E4YA 3M6AA 3X1YA 4W9MC 3IKJA 4EJSA 1VCNA 3H84A 4RD4A 2Z4SA 1UBCA 2VA8A 2BJVA 4M53A 4L9WA 4P4TA 3T1QA 3RABA 1KSHA 3AKEA 3R7WB 1N6IA 3QENA 4XD7A 2QTVB 3AUYA 4DSNA 3T1TA 2PJRA 2LKDA 4XH9B 5IF9A 4L5BA 1ZC4A 4M1OA 2CHQA 1OGJA 3G71B 3KJGA 4LJ8A 1CR2A 4CF7A 1L8QA 3QFRA 4A6XA 1P2SA 1U90A 3H4MA 5CIQA 3SYLA 3SQXA 3R20A 2MSDB 4GMDA 1QG2A 2WJGA 3VR5A 3O8RA 4IFEA 4MYCA 4NCHA 3SYNA 1NMYA 3CPEA 3NH6A 1E2HA 3T15A 3X1XA 4BPBA 3MWYW 4PAMA 4BUJA 4OHXA 5CM9C 4US2R 3ZVMA 2EQBA 2J5XA 3KJHA 4N0EA 4L16A 1P2VA 2NZJA 5J47A 3NTUA 5H70A 4CZ2A 4KV9A 3KZ1E 4URYR 3DDCA 2RHDA 2VLIA 1E2KA 4FMBB 4DLYA 4MRRA 1IXZA 1E2DA 1E98A 3UK6A 1KRHA 2CE7A 1XEWY 4XWAA 8OHMA 2GJAA 3WHLA 4CW7A 4JMPA 1W4BA 3HYRA 4XJXA 1XWIA 2JLQA 2ZSDA 3FKSD 1HY3A 3G0HA 1BKDR 1YU9A 2NO6A 5EE0A 5DO9A 1UMKA 3DZ8A 4B2IA 4JKIA 2JLYA 2XB2A 3CONA 3U3MA 1M8PA 4FWIB 1R5BA 3KQLA 4ZO4A 2J59A 1KI8A 5E95A 5IRCD 3CRZA 2ATVA 3K0SA 2J0SA 5AJYA 2FEMA 2IF0A 3S1AB 3X1WA 3GLGB 4EDHA 2OFOA 1W2HA 3B60A 1R10A 5A5GA 2AK3A 4MQBA 3WMEA 2D4HA 1AKEA 2ZR0A 5L3QA 4UAJA 4BZXA 1CR1A 1M90D 1GKUB 4B3CA 1S9DA 3IQXA 2OM2A 1LW7A 1N6LA 2ZI7A 2EWVA 4QRHA 3CRQA 4V0LA 1XTJA 3CZPA 2BEKA 4C0BA 1DTSA 1LVGA 3S1AA 2AHOA 3GLGA 3ES9A 2B21A 4DXAA 3JZMA 1DADA 1J99A 2F9LA 4B2LA 3U60B 3SYKA 4AYWA 2A5FA 4AWXA 3UPUA 4BLSA 2BN4A 4KSBA 4V03A 4CGZA 2BV3A 3O8DA 3UATA 2GVDC 2QE7D 4I1UA 1GOTA 2D62A 3ZJYA 5C4MA 3K70D 4ZDKA 1MR3F 2ZRJA 2GVZC 2ZM5A 1QVFB 1P60A 4H9GA 1E62A 1KO8A 2HLDA 3OZVA 3EPJA 1ZRHA 2FGKA 3QPUA 5EJEA 2DB3A 1YKSA 1VG8A 3GLGE 3D31A 1OW3B 1Z06A 5FUXA 4DDWA 2AN9A 1VYTA 3SQWA 2JJ2A 2KSQA 2B8WA 2QORA 3QXCA 1RJ9B 2D74A 1XD2B 1ZM3A 4A82A 3RRMA 2PL3A 2QG6A 2VHCA 4DLUA 3QXJA 3CO5A 3I5XA 2VQSA 2VBCA 2JLWA 2JGNA 3NC0C 1JAHA 2RHMA 1GITA 4PPFA 2PLFA 3W6OA 2F1JA 4Q9JA 1E0SA 1R4AA 4Q5IA 1JJ7A 3FJOA 4UKDA 2CCKA 1RJ9A 3CX6A 4WXRA 3BAFA 3DMNA 3GQBA 1NLFA 1JNYA 3QBVA 5BYKA 2Z0MA 2J9RA 2V1XA 1UDXA 1VCIA 1WRBA 1XXHB 2GAOA 2RCNA 2IHYA 4POAA 2OE2A 4Q47A 2ZS9A 4Q4JB 4D80A 3B1XA 1Q44A 2OCPA 3PEYA 3K0FB 2NO1A 1OB5A 2XTMA 621PA 1NL3A 2DBYA 1A4RA 1U98A 1E0JA 4JS0A 3CNLA 4GP6A 1TQDA 4P0TA 1HT1E 2F1HA 1CS4C 2JEOA 5FR2A 4BZPA 3EW9A 4M2LA 1JB9A 3WYFA 1OB2A 3I3SR 2YVUA 2ZITA 3DMDA 4V0NA 4BFWA 1JA1A 3L8ZA 3LV8A 4CEHB 1QH0A 2VHJA 1XZPA 2ZRKA 3WNDA 4B73A 2OCBA 3K0FA 1P72A 1OYWA 2C99A 1A7JA 1P9RA 2WBLC 2DR3A 2FU5C 1KO1A 4TLDA 2ZJ5A 2D3WA 4KBGA 2RGBA 3FWYA 1G20E 3FYHA 3BXZA 1G16A 1GNRA 2QQ0A 1EP1B 1UM8A 2QU8A 4UNNA 1GAWA 5H68A 3TJZA 3EX7C 4CEHA 1H65A 4YDSA 3QF7A 3GPLA 2ZAOA 1XXHE 3ETLA 2MMGA 1D9XA 5EZ5A 1Q12A 2RGAA 4UXHA 1KI6A 3UWOA 1IN8A 2R6DA 4AG6A 4BECA 1CJMA 1RPZA 4Z51A 2ZRLA 4B47A 1Z0IA 4HAUA 1XU4A 2DFLA 2C95A 3D8BA 4LJ6A 2IXGA 4LSGA 1M7GA 2RKOA 3CXCB 5TR9A 5JECA 3Q85A 2NO9A 2IXFA 2ZRIA 5JJKA 3M0EA 1VTKA 1KI9A 1TVCA 1GG2A 3JQQA 4X8LA 2ODEA 4YXWA 2LKCA 3HPRA 3U3JA 1XJCA 4MH0R 4OHVA 3VKGA 2EU8A 4PHTA 3BB4A 4PHHA 4EAQA 2BOVA 5AJWA 4WVFA 1IN5A 1RKBA 2E87A 3BGWA 4KCGA 3R9IA 2WWYA 3MJHA 4Z54A 2RAPA 4LJ5A 3N70A 2NMVA 4KFUA 4D25A 3RS3A 2QM8A 3BFKA 4BWYA 3PEVA 4QGAA 4D4MA 1HYQA 2IK8A 5C2JB 4MRSA 1AIPA 4OK5A 4EPTA 5C46F 2JLXA 1F2UB 4D0GA 1G64A 3K53A 2FFQA 3I72A 4TYNA 3MJRA 2BF4A 1CR4A 2FSGA 4NONA 2DFKB 1XDBA 3ZYCA
chains in the Genus database with same CATH superfamily
1H5UA 1P2TA 1KEWA 3TSWA 3BNWA 2NTJA 1YB1A 3IHLA 4D9NA 3IIJA 4KHZA 4MGKR 1U7PA 4EMSA 4NECA 1PSZA 1E1CB 4UEWA 1RACA 2XJ4A 2XMGA 3DLCA 4RMIA 3WMXA 4TMTA 2QRNA 2ZJ6A 2WV7A 1H6AA 3LA6A 4QECA 3FFBA 3MJDA 4JZKA 3D81A 3N0VA 1VYUA 5HZBA 2PO7A 1TU3A 1KMNA 1W47A 2OEPA 3VNUA 1WOSA 2QAGA 3EWAA 4FYJA 5LMCA 2V4DA 1NN0A 5KNBD 4F1KA 1MABB 1P18A 1T15A 5BMOA 3KU4A 2JASA 3D6TB 4C6RA 2Q5EA 4EG4A 4EY3A 1R4ZA 3EQ7A 2PSSA 4NX2A 1AH2A 2FPIB 4YJ2B 4ZTZB 5T4EA 1A27A 3B5JA 4OH1A 5FTJA 4JSYA 2ZRFA 3KZCA 2FCAA 2AD5A 2TS1A 4IJ5A 4DGQA 4DJAA 1NX6A 4KFSA 3ZHQA 1I3KA 3SF0A 3Q6MA 4B2PA 2VHYA 3KOZA 1PZMA 4NAHA 4RY2A 4UAVA 4JP3A 5DOZA 4B1FA 1I6MA 2VUHB 5HW0A 3X2SA 2GUGA 3B9PA 5TJ9A 1PJ7A 2WJPA 1LUAA 3LQYA 2V4UA 4HVAA 4MW0A 1PUIA 2WHPA 2RGNC 4UJ3A 2XQGA 3I9V6 3KKZA 2G09A 1PZNA 4TQAA 1JIIA 1R8QA 3L7YA 4UDYX 1EVZA 3C6ZA 4OHMA 1P5FA 5K3AA 2ZIXA 2QGZA 1B2LA 1R8XA 4H27A 1DELA 1KBOA 2ATIA 1NONA 3DE1X 4UTVA 2IYUA 4JT9A 2ZUFA 3I52A 2AQKA 4MUKA 4CCWA 4DT1A 1XFAA 3AJRA 1JIQA 1IJBA 4UATA 1XLVA 1OI7A 4HF7A 1WU8A 4L75A 1DIAA 2YWDA 2JEYA 3EGDB 4NYJQ 1AMUA 1YFJA 3TOVA 3PPVA 3LVQE 1MJ5A 1KQFA 3EXHB 3D6FA 3LRPA 2WM3A 1SQ0A 4XIGS 1JQLB 3N8KA 4HDSA 5H83A 2OYRA 1NIJA 3X1JA 3D8NA 4LYHA 1MJFA 3WADA 1NV8A 1GJRA 2P90A 1G8HA 5LDDC 4L1KA 1A1VA 3GGDA 4BOYA 3DKVA 1E1QD 2PAFA 3E9DA 1W5TA 5FNVF 1TUGA 2WAOA 3CZRA 4O4LB 1DQZA 1U2GC 1KI7A 5DGHA 3KXIA 4DUYB 3NM5A 2QRMA 3OTQA 2VH2A 2YNMD 2ZJ0A 5BSVA 2UU9B 1A9TA 1VRWA 4RK6A 5BOSB 1YRBA 1V11B 4Q19A 2F9FA 4WZAE 4BMVA 2WZNA 2MINA 3KX2A 1KI1A 5EWJA 4Q93A 3ZGVA 3M34A 4P6YA 2YNMC 5AK6A 1SQGA 1F8XA 1WVGA 1ZCAA 2FFBA 2HNKA 2AFIA 1UP7A 2DHEA 2GSWA 3EHDA 3BDAA 1YZKA 3JRXA 4MA4A 2DBZA 3QWBA 5I9IA 2XWSA 1YF3A 4ARIA 1G7CA 1L4LA 2MSNA 2FF7A 3K9WA 1CY6A 3KLBA 3OLWA 3HL4A 4XUDA 3VR3D 5FV4A 4TV9F 1Z0UA 3F90A 2V1UA 2PEZA 3OETA 4O4HF 3D7KA 3LY8A 3UENA 2EJBA 4MQ4A 3GVJA 2GTPA 3N7TA 4J6FA 4HB0A 5AXAA 3EY9A 1GZVA 2FJPA 3G9UA 4FSDA 3RCBA 3TRHA 3CX3A 4HVTA 4L9SA 1CUDA 1E0DA 4I9HA 2W5UA 3VVCA 4LOIA 3QJ5A 3D8UA 4OQLA 2ZBRA 3Q3VA 5BRNA 1VIVA 1AQIA 2QIOA 3TIVA 5IS2A 3GFPA 1ZO8A 4PC3A 4PINA 3WGMA 3V4LA 4URUR 3QPVA 1S2GA 3FFAA 1TQ8A 5HCIA 4UARA 1HL7A 2GETA 2AMFA 3SQDA 1O58A 1ZI8A 1ZS9A 4M49A 3UH0A 1ZNZA 1SKYE 3UN1A 3VSAA 4AYXA 2YFYA 1PGNA 3E6AA 1RI2A 5MFZA 3C3PA 2CXRA 3RNOA 1BGXT 1RWQA 3LIPA 3FPEA 2YIJA 3T6KA 1YRYE 3OT1B 1G2IA 2BM8A 2JLAA 2AG6A 1ODTC 3SLNA 1NUSA 3QVVA 3UCXA 4HUTA 4UFPA 3CCUB 1ZJ5A 5CLLA 2HGSA 4QPDA 4XPIB 5KYYA 2CXHA 2O7RA 3RRYA 5IWCA 4H7PA 4C0HA 4BGEA 1U2RA 1I3NA 4HADA 4G0XA 2NU9B 5AW7A 4NMMA 3DBOB 4P81A 3MCAA 3PVDA 3GX1A 4LV8B 3OOCA 3JD4A 1WNFA 1A7KA 1E3LA 2VP0A 4JCOA 1FLVA 3H2ZA 5JNSA 5COQA 4F4JA 3EMKA 2O0JA 4OYHA 1O2DA 4H4CA 1BCRA 2XQVA 3ICCA 2WIKA 2A5JA 2ZYGA 5FA6A 4WLUA 4RTNA 4U7FA 1K73D 4DV3B 4RXMA 1AE1A 1KIFA 2Q3CA 5AD1A 1RPNA 2FPRA 2IKQA 2OWEA 1GP2A 4I5FA 2CF5A 5K0BA 4WFJA 5LQRA 1BGWA 2HJWA 4BX9A 1VQ9B 1VGQA 1YRLA 1JU4A 4MEJA 5CB8A 1GY8A 3DZHA 3AFGA 1ACMA 3NALA 1WPRA 1QGZA 2GHTA 1JT2A 1M1NA 1KFJB 2P4SA 3MAGA 4XGNA 3F6PA 1KEEB 1ZMXA 4L08A 3QFTA 4RXTA 5EP3A 4F4CA 5JC1A 1UK8A 2DGDA 1LJ8A 1FP7A 3DXYA 4MWTA 4DY4A 2P5TB 2E0IA 2AV6A 3MXOA 1Z39A 4H6PA 1XQVA 4WACA 5F78A 3L40A 3SIXA 1XU7A 2P9JA 4UCQA 4B83A 3K0HA 4CKBB 1OZGA 3VO1A 3KLOA 1PJBA 3A9VA 4H15A 1YRHA 4YJ3A 2R66A 4BBZA 2GJRA 1XAIA 2P65A 4A03A 4D26A 4RJLA 2O2GA 1XIVA 3Q3GE 1WHSB 4HRVA 1J70A 1U1IA 3KPUA 3ZBUA 2VSOA 3Q38A 3USCS 3CNHA 3PX7A 1K92A 2ZSEA 3VA7A 3G8DA 2HK9A 2E4ZA 3Q5EA 1T8WA 2XT9A 2BBOA 4HG2A 5CA1B 1TMYA 4ZDWA 4FJ0A 4BB0A 3G2JA 4KKSA 1OIWA 1U1GA 4PGFA 1G5TA 3MGBA 2YKGA 3N2EA 3SEFA 1NF3A 2P6PA 4XDYA 3NMUF 2VPWA 1GFIA 3LOPA 4GVPA 4UAUA 5J4VA 3A7DA 3PNKA 6YASA 3VVBA 2UZ1B 4LF9B 2QL6A 5CB4B 2W2XA 3DB1A 4U7GA 3DH0A 5JD3A 3I92A 3IUMA 4BGDA 4GYYA 4N5LA 2GXUA 1G60A 5WRFA 1S2DA 3WFZA 2XNCA 2H06A 2HDHA 1PYGA 4RTMA 3FUCA 1CRLA 3GW8A 4OEHA 1SCQA 3H9JA 4OGGA 3E9NA 3N7UA 4MKXA 5FJJA 2WV9A 2YQ5A 1GT6A 2G1JA 4HNVA 1Y7TA 2O3QA 3WIOA 2XGJA 3HR4A 5E7QA 5FL7D 3HYNA 4EHDA 2HF9A 1UD2A 2EYQA 5AW9A 5P21A 4LVNA 1X9IA 3LBAA 2ZOSA 4BFUA 2XD9A 1KYIA 1WXFA 1MW9X 5AW4A 2HD4A 1NVVR 1W1UA 1RC0A 4QRDA 4R8LA 3PEFA 5BWCA 1TT5A 3RFXA 4L6IA 2FNAA 4OQMA 3T7TA 1G5RA 1S2MA 2ZATA 3BHMA 4LVCA 1SVUA 3X2FA 2PZEA 2ZFUA 1I6KA 4CDRA 4FFVA 4A27A 1M2HA 4EEZA 5BRJA 3EBPA 4WY5A 4R4JA 2FPSA 1WPQA 1NJ6A 1V47A 3PHBE 5I7UA 1G6OA 3WDKA 3LTNC 1VKZA 3KQKA 4RK1A 3MTEA 4CCYB 2IU4A 4MWZA 1Q0ZA 1JFRA 1U0GA 1XMVA 2QB5A 1HEIA 4PSVA 4D97A 4EJFA 1DRKA 3NATA 4V1CB 4ZO6A 2PIAA 1W0KA 2HLPA 1QR6A 1U9IC 2XRFA 2ZDGA 2V3WA 2AI3A 1SEVA 3EZXA 3II6X 4G9GA 2V54A 1JDSA 4L2IA 5BW8A 1Z5OA 5EC8A 2D2XA 3C5HA 3G05A 3CV3A 1JAXA 1G42A 5HIMA 3GCZA 4KPGA 2O3JA 3SVLA 1W1IA 4GL2A 5K0FA 2HTFA 1E3MA 4GRAA 5J5VA 4P36A 2BHNA 5GONA 1XP8A 2R7AA 5G1OA 2MYTA 3SLDA 1M34B 4G7XA 2SKCA 4BWGA 4EY6A 1F2TA 4S2EA 3KYJB 2LZ0A 4YRDA 3UJ9A 4QTZA 2ARKA 3SIWA 4JB8A 4WOBA 2B2NA 3HY3A 1EFVB 2NUTA 2W6NA 4LA4A 2G5GX 2KHZA 2ASEA 2PNFA 4CMEC 1XZFA 3B1KA 3D3QA 5C8DA 3O4GA 1L5NA 2FMXA 5HQJA 1OYVA 2AZTA 2ZI3A 3GJXC 4A0GA 3BCRA 4D44A 3EPPA 3NI2A 3NOVA 1AM4D 3PVSA 4GM0A 1IBLB 1WP6A 3FKSA 3FPKA 4X92A 3RT7A 1CY2A 1JQEA 1V3QE 3HI4A 1FCJA 2V7EA 3KPJA 5AHRA 2XMPA 5AK4A 5GJCA 4A7PA 4F12A 5JO0A 2BKXA 4EI7A 3A6PC 1CHNA 2C8VA 1EUCB 1DMRA 1US8A 4WK0B 4XX1A 1PQWA 4AP9A 4B3BA 2V6MA 4R2XA 4LJKA 3TGWA 4AKIA 2KPOA 1CC1S 2W6OA 4DLVA 1N4DA 3C3AA 3S5UA 3DVLA 3W5CA 1J2RA 3PFCA 4TKVB 1KDPA 3O26A 1O0CA 1I6LA 3DLBA 1E1MA 2ORWA 2GCIA 2Q41A 1QFYA 4RLFA 4WKBA 3A1CA 1PJ6A 1M0SA 2CRVA 2NU7A 4WK4B 4ZVSA 1NNEA 1FC0A 5JJLA 2P8SA 4URWR 3OPNA 4J94A 5FR1A 3MOSA 4J0CA 4K6OA 3NNNA 3QSYA 3DCIA 4OXQA 2P5SA 3ILXA 4W7HA 4XVHA 2H6EA 2QA5A 4XQ0A 4Q9NA 5CX1A 2FW9A 1G291 3AEYA 5E1MA 2F7SA 3AVUA 1UBLS 4OXXA 4LOHA 2R8ZA 1CQPA 3HB9A 5BUCA 2DPLA 1CIPA 5I6DA 4LDNA 2XMZA 4BO5A 3C7DB 4J43A 5AVSA 1EVJA 2ZYHA 1QGED 1GNQA 3E0QA 3VVMA 3SJZA 1Z6GA 4QQKA 5K7SA 2QJTA 2JKZA 1D9ZA 4I14A 5DT9A 3O5AA 4KKXB 3E1GA 5EG5A 2CB9A 5FBLB 4BO4A 3HCDA 5CHEA 1MN6A 3CR7A 2GTHA 2W2LA 4UBOA 1VJTA 3H0KA 4EG1A 2J09A 2F9MA 5E2IA 3WFJA 2HSWA 1RRVA 2HWXA 3ND9A 5CCBA 2OG1A 3BF7A 3A6KA 4JODA 2D3NA 4RM2A 5CLIA 4PFSA 1R8YA 4R68A 5FF9A 4HB3A 1HUQA 2CCGA 3HCNA 2ZRDA 1GGVA 4JUFA 4CM6A 3SZ3A 5F77A 2QL7A 3B48A 1GTZA 3ZXYA 4DSUA 1W0KD 1FJHA 4I9UA 1DTWA 2QR3A 5T4HA 3RSGA 1C1YA 1JKMA 1U3FA 2WWXA 3GZ4A 2D3TA 2Z8YM 3A0UA 3LE8A 4J1SA 4DLLA 4F06A 5FUWA 1FFXA 2I4MA 4CT4B 4GOOD 1IBMB 3GT0A 1QHGA 3VOBA 2YFKA 1PG5A 2BZ1A 2IEZA 1AMOA 2I54A 3IHTA 4WNAB 3BH6A 3BXGA 3UK0A 1UK6A 4FX2A 1B0PA 4P12A 1C4XA 1PNVA 1T4CB 2NXWA 2Y1OA 2W0MA 4GKVA 1ZJ6A 5D5HA 3WGQA 5KTOA 3W1WA 2VFAA 2QN8A 2O1SA 4EZEA 1ISHA 2FPXA 3H86A 1ODFA 3I9V1 1QGOA 1P4HA 1NW4A 4GKAA 4I8IA 4UEKA 2JLCA 2VT6A 3SLKA 3PCRB 4B17A 4I1VA 3DW3X 4ND2A 3UJAA 1SWVA 1JR3D 1UP6A 2GPJA 1WTAA 3AV3A 1A9SA 1T1GA 3LUGA 3PWZA 4KAAA 1WMBA 4PGAA 1YASA 4CMJA 1G41A 3NKVA 1A50B 5KO2A 1X19A 4I5EA 5LQNA 3ZVKA 1G6Q1 4MCJA 5EE5B 4CCAA 2QXUA 2PFGA 1FRVA 2RK4A 3Q12A 4G5YA 4OQYA 1IE3A 3OCWA 4P84A 5ECYA 4ZZ3A 5I48A 2TMKA 5KNCA 3NHAA 5L3QB 5JS1A 1AZLA 4Q00A 5HYVA 1E5DA 2VHZA 2Q27A 3WGZA 4R1MA 2QD2A 4JJ6A 3M6FA 2X6YA 1O5TA 1NX9A 1KJZA 4IAOA 1BE6A 4RFSB 3KHKA 3THYA 3ZY6A 1X7GA 4ZKEA 1SOWA 4GZLA 4ER5A 3PUJA 4LHSA 5H02A 3ZE9A 5EVJA 3TSOA 5FYDA 1G2PA 1XKQA 4ZYXA 3FZYA 3GPCA 4OI4A 1A72A 2D2EA 3DZGA 3KVOA 3ICPA 1LH0A 2V3VA 4YS6A 1SUIA 3W04A 5K20A 1JEEA 1EH5A 3OCZA 3OBBA 1H2BA 4EP1A 2IZ7A 2IC5A 4C5BA 2FVYA 3DAGA 3Q3JB 3Q7TA 4RSMA 1L7QA 1NLUA 1Z6TA 3X1KA 4AZ3B 2WPDA 2PUAA 1L2TA 3TLJA 1L5YA 2ANCA 4YTEA 1TGYA 3ROQA 5G0SA 1H2XA 3NWJA 2KYRA 3TUIC 3MWDB 4I5DA 4KYTA 1V3UA 3ZD9A 5FTKA 1NW8A 2A9KA 4JJ4A 3BREA 5KNCH 4MV8A 4A73A 3K2QA 1JPVA 1ZAYA 4Q1VA 3UAZA 2J85A 3MWGA 4MAAA 3QEBZ 3P9ZA 1F7VA 1Y7LA 1ABFA 2ALJA 2W2LD 2X76A 1YZGA 3FB4A 2ZJ4A 4RSRA 3SIPA 1VBKA 1YL6A 3WI7A 1UXJA 4WJKB 1FUYB 1PZEA 1N2HA 2I7VA 2PGIA 3EEFA 3PPIA 3TPCA 4IIXA 2ZAMA 2RH8A 2IUSA 3ELWA 5CLQA 4BDSA 3PL5A 3SBEA 3TYXA 5AH0A 3QNWA 4RNDB 5IJ0A 3OMLA 5EWMA 1E63A 4PS1A 3V42A 3NAQA 1RYDA 2XBUA 4I55B 1XN4A 3TB6A 3TQRA 3PBKA 3ZUPA 3PVCA 4AJEA 5ECWA 2O3SA 2FCRA 2VP9A 3IE0A 4LFAB 1G8AA 3HCBA 1FSZA 4XFJA 2LW7A 1BZYA 3TLXA 4GF5A 5F4BA 3W8RA 1P9NA 3BCFA 3EAQA 4ZVNA 3A3GA 1T24A 3SG0A 3H87A 2GHQA 1FYEA 5JAOA 1Q3HA 2EZ9A 1VMEA 1QBGA 4N3GA 3IODA 1BJTA 2YJNA 1WD7A 4TTQA 4HFNA 1WB9A 1EBUA 1G8PA 3SC6A 3Q7QA 4F91B 2HNBA 3COVA 5IBCA 1JHQA 1D3AA 1NF9A 4UUMA 3RSFA 3A37A 1W2BB 3JQ8B 2HBQA 1QWOA 2KE5A 1T0HB 4TRNA 3N2LA 1N2IA 2C5FA 1OH5A 4YUAA 4DABA 5EMHA 2JCYA 1B8UA 4YEJA 1N9KA 4RHYA 3TK1A 3Q7PA 4BNMA 1DC8A 3FHOA 3FDZA 4F4UA 3EXIB 3GP8A 1S7CA 5AN9A 2X2PA 2G3YA 4V0MA 4XWTA 3VPXA 4C0XA 3IQEA 5H8WA 4MB2A 2GBIA 2J3HA 4JJKA 3MS2A 3TI9A 3CPHA 4DA6A 4RHTA 4IVPA 1BDIA 4Y8VA 3VUFA 1SH7A 1WCWA 4HWSA 2R79A 2OD2A 1V4BA 3UMVA 4CR6A 5AR1A 1ABEA 2JFUA 3FOAA 4Z6KA 4LWQA 2DYIA 1B23P 1N8SA 3H0CA 1EZZA 4LISA 2JGEA 4N18A 4C30A 3WQQA 3ZZ1A 5LYJB 1WETA 4P7BA 4PYJA 2PWAA 2XCQA 1JW9B 2XUDA 1Y7PA 2G7MC 5AIAA 3IL2A 1TE2A 1NLMA 3OQ1A 1O0SA 3H1TA 5SY6A 4YRGA 4KQIA 4W8GA 4KPYA 4CN8A 4PHCA 2HMSA 2PSDA 4O63O 3MGAA 1SJ9A 2Z30A 3ZWMA 1Z6QA 3K9HA 4ZRDA 1GPH1 1ZH6A 1VQ8B 1KAMA 3ECCA 5D8DA 3E8XA 2OFFA 4JDUA 3THOA 4B4DA 1DQNA 1FPQA 3PEEA 2GCPA 1OLUA 2FZEA 3C4QA 4QUHA 4C87A 4F9EA 4HOYA 2I3DA 4W99A 1CF2O 1K63A 1XCLA 4OQDA 2QX7A 5AKZA 4I4TB 1C3OA 2WPDD 1JHZA 2B1RA 4KAJA 4LOLA 2AI1A 5K3OA 2H1FA 1F60A 1C9DB 3AR7A 1VSQA 2VUUA 3HBJA 4FE4A 4H7JA 4J0FA 4W5HA 2VRCA 1KJQA 5FTWA 1GSOA 1SXJD 2FOXA 1TZKA 2M6KA 4CM9D 4M9QA 3AWIA 3S7ZA 4E30A 4C4AA 3KUCA 5CH8A 4EYGA 5CG1A 4MPPA 5HKBA 3SK0A 1EVQA 1OFUX 1SXJC 2J5QA 1EESA 3A6FA 5FPPA 3F7NA 2OQ2A 5A5VA 3GK3A 2BZSA 4PBRA 3ETJA 3V8EA 4G25A 3WRXA 4RM0A 2GAFA 1T6NA 3KOMA 3MUFA 4E4RA 3X2EA 3GRCA 3MWEA 4BN0A 2OLKA 3RWOA 1MVLA 1IY2A 1YBFA 2C2BA 1H9BA 5AK3A 2YR0A 4X1YA 2V8BA 3FE2A 3H0EA 2CZGA 1MRSA 1OH8A 3HJFA 1N2CA 3FA2A 5FT9A 4PLWA 1DX9A 1FQJA 2I87A 2LDBA 3U17A 1V71A 5FI0B 4M0FA 2EDCA 3R6GA 3EBLA 3F0TA 1W4LA 5ALLA 5J2TF 4AJPA 1ID1A 3GIWA 4H3SA 3UUWA 1OLSB 4HDNB 2BUAA 3HGMA 3A8IA 4HQ6A 5CYOA 3THWA 3KM0A 1NY6A 2IKSA 4YACA 1VQPB 2B61A 3GG9A 2O2EA 2WLTA 3AJDA 2VYVA 5DTQA 3WKBA 5ENVA 3GHYA 1L5RA 2GPBA 3NDRA 2IOFA 4UJ5A 2YY5A 2ZBQA 2WSLA 4AS2A 3H3JA 2VF7A 2IW3A 4QEKA 1K0UA 2FDRA 1AS2A 1LWNA 5I7FA 1RXIA 1YULA 2FPOA 3E0XA 2IUFA 1C30A 3I04A 2O2XA 1WEKA 4K0RA 3C5VA 3PHIA 2A8YA 1UMCA 4TWAA 4EPRA 1VL2A 3I4LA 5DP1A 5EEHA 3C3YA 3T7SA 2IY7A 4QBIA 1YE8A 4BDTA 1KC1A 1O96B 2OGUA 2B20A 2QAGB 2XNKA 3SHQA 2A3NA 1DCFA 4BRZA 2B6HA 4OJMX 3UO8B 3KJIA 1TEVA 1X7XB 2E1RA 3DR3A 2ZJYA 3BXEA 4H4EA 3CPWB 2QAIA 2PUCA 2QMHA 4YELA 4XOIA 3DVRX 3ZU4A 1XU9A 3W5JA 1NTOA 4BB6A 1E2LA 2X1VA 4LHYA 4JI1B 4F8JA 4ZGGA 4WFKA 1I32A 4UD2A 1DZIA 1T5TA 4UU8A 2JGIA 3L7NA 5BR7A 2BKEA 4KBFA 4IIVA 1PGJA 3LYAA 4KXUA 4ND6A 1OFUA 2WKPA 1WF6A 3F6SA 3OEED 3PYXA 4GBED 3EGIA 1HF3A 4HJXA 4XQ9A 5DBGA 3U4GA 5A4AA 2IQ5A 5B3KA 4O8ZA 1Q0TA 1PJCA 5IDWA 2JW5A 2BJHA 4KW7A 2PKQP 5CVVA 4U6NA 1NATA 3RANA 4CETA 3U9LA 2QMEA 3KAPA 3GEMA 1PEYA 1AGYA 2NAPA 1L7EA 4BO9A 3S5JA 1YDGA 4IOJA 4YI5A 3S99A 3BORA 4LNAA 2F4NA 2BMAA 2J33A 3VX3A 2QGGA 3RJ5A 2VRCD 4AM8A 1VBFA 3HUUA 2OV4A 3R7DA 3GLRA 5IYNA 4YDHB 1YC2A 3QFCA 3OCUA 4DT1B 1SA0B 3TUJC 2O07A 3QKUA 3DEJA 3RFTA 3NUZA 3WYAA 1JPJA 2BGKA 2JCSA 4N65A 3DZDA 2CNDA 5AKJA 2A78A 1FX0A 1QHNA 2P9HA 2CLHB 3HP1A 5AW5A 1VGRA 1QXSA 3ZQKA 1X1CA 4LGCA 4IFTA 4MDHA 1QMGA 2ORYA 4U2CA 1IVSA 2DBRA 2BM0A 2H07A 3OA0A 4TUYF 5AKIA 2ZS7A 1CXZA 3MMXA 4EOGA 2Q4BA 3GEGA 4AKHA 4PAOA 4Q1EA 3EAGA 4KQ9A 3WWPA 3IJ5A 3LBIA 4IWXA 2AGVA 3BGVA 2FQQA 2IIQA 4HQFA 3U0BA 4LZJA 4KTVE 2QU7A 4CRWB 3UMFA 1EI9A 2E4YA 3FI0A 4OQXA 5JVDB 2BHSA 2JAQA 2OSBA 3ORHA 1TKAA 2WP0A 5I9MA 3K5PA 5M2QA 1WO8A 5FB3A 3PFNA 3GROA 2L69A 2QUZA 3A26A 4WDQA 2ES4A 2XGGA 3JXEA 4HAZA 3ZR4B 4Y6RA 3IOEA 3JZAA 1KWGA 5ALWA 3TX2A 2FN3A 3CC7B 1VM6A 4Q24A 2QBYA 2IZ6A 4DK0A 1OFVA 2W58A 1IEQA 5CLGA 1MDBA 3UAVA 3WRYC 4DA7A 3GL9A 4KFRA 3TCXB 2G9QA 3D7LA 2WJVA 1O1YA 3VKFA 4QUDA 3AJ8A 4JYMA 3VZPA 4CR8A 2F59A 4L7VA 5DBOA 5H82A 2IIPA 4A92A 1VHTA 3C1UA 2FXIA 3KPYA 2CLOB 2PX8A 2OFWA 2QDKA 2ZJ1A 4BYMA 221PA 5F3DA 3P45A 4ZVMA 1T3HA 3J81k 4QNNA 1Q95A 3V2GA 3T5CA 3SZOA 3MYRA 2BBSA 1W4RA 4G23A 3UB2A 2IXBA 3WIVA 2HRCA 4EUNA 2QT0A 2OA0A 4AJKA 3ZU2A 2R1TA 3AXTA 3JVVA 4MW9A 3LYUA 2EKLA 3IA2A 1CUIA 4JBXA 2QPOA 2HCTA 3M2PA 5KX5F 1RKQA 2VP5A 4I50A 1NMSA 4KQ6A 4PLVA 2H7CA 5EZYB 1W6UA 4K40A 4X60A 2VJAA 3DFKA 4B45A 4O4IA 2OTJB 1YKGA 3KSDO 4ZEWA 1JQKA 1XD9A 4QDOA 1JJFA 4JJFA 2JLBA 4RIFA 3ASZA 1N57A 1JLKA 1RDFA 2UV8A 2EDAA 4IQ8A 3JQ7A 1P4GA 3FOCA 1AS3A 4JUAA 2OY0A 3A8JA 2BEJA 5CK5A 1ZD3A 1EA7A 4ZYLA 5LA6A 3ZVLA 2ZR7A 4P33A 2K87A 1GQ2A 4C04A 2FYTA 4PZDA 3SNHA 2DQZA 3VU8A 2PLRA 4FMDF 2QA4B 2VTVA 4HL6A 1Z3IX 1N34B 2GEUA 1SUBA 1XQ9A 5EWLA 2BEUA 4ESVA 4PNPA 3HUFA 5HS6A 1JIXA 2P2DA 1FW8A 1VQ1A 2EBHX 3M9LA 4LRSB 3SF8B 1OZHA 2B94A 4ZGNB 1ZIDA 2JIQA 2ZXEA 4KRGA 4ALKA 3GAMA 1MZVA 2P77A 5JDCA 4ZRNA 3VTFA 3EPLA 3KBBA 2PUEA 3H11A 3K4HA 4F56A 1ETUA 3IDQA 1CULC 1RJEA 1Z74A 1AUVA 3KKOA 3IIEA 2OBFA 4G8DA 4JXXA 2A84A 3OKXA 3RBZA 1IXYA 1YHZA 2WE7A 5I01A 2I91A 3T7DA 2P7HA 2GJKA 3DL7A 3ZCTA 4YJDA 2HHHB 4S24A 4YRPA 2JRLA 1IWOA 2RH5A 2WVGA 3A27A 5ALEA 4F3YA 4ZGWA 3UCFA 5KWVA 4LVOA 4RZUA 4FYHA 3WK4A 3VDMA 1DFIA 1BROA 1TJ4A 1UPFA 3LI2A 4OJNA 2FUEA 4ZA2A 4OXKA 1CEEA 2V0GA 3DXFA 1VQ6B 4KR2A 4WY8A 2AN3A 4YV2A 3C4JA 4TV8B 2Y1EA 1X7ZB 3DONA 3O4RA 4YJ3B 4EO9A 3ZS9A 4I8DA 2E4AA 3RC1A 4UM9D 4A8JC 4RY8A 2YOHA 2TRSB 4IP0A 1DUSA 1A2KC 4IR7A 4JT2A 5DRTA 2WTXA 1OYOA 5HX7A 2NSLA 3UWPA 2ENUA 1PNRA 5TC4A 4QGSA 1YAHA 4O25A 1LNZA 4RS3A 1TJ5A 4Y2TA 5D84A 3ROFA 3TQQA 3BWMA 1P61B 4HAWA 3I4FA 4K88A 3UUGA 1QX4A 2ZXIA 1L7XA 3MERA 3STWA 2Z5LA 1Y7HA 2J07A 3NIFB 2GO7A 5G2OA 2G06A 3NNDA 4WAUA 2FOLA 5UKDA 3EXG1 2RGWA 2GM9A 9LDBA 3H75A 2PUBA 3EDOA 3WQRA 3AR3A 3IBSA 1PEAA 1VKJA 3OLQA 4GI1A 4QSMA 4KLNA 4NJMA 5EI5A 3TVDA 4AQDA 4BWFB 5FLXA 4NXNB 1SVMA 3RIYA 3ZNNA 2ZVJA 3K20A 4X65B 2YICA 3OSZA 4EEKA 3L7JA 1L4HA 4P83A 4PRLA 3CVUA 1XLTC 4YA6A 5GIPE 3HO1A 3H99A 2AJCA 2C9CA 4ZPJA 5DIFA 2QAJA 3WLNA 1L4EA 4D8YA 1OLXB 5F51A 5FO1A 1B8OA 4PPGA 4LF4B 4G65A 1CETA 1I3MA 3GPBA 5FI1B 1UJ2A 1W34A 3ETHA 3MSCA 1KYQA 4C5AA 2CEAA 2ZSAA 9LDTA 3F8TA 3I1IA 2CJWA 3VYVA 4EZBA 5DP2A 2FA9A 3F6BX 4PO1A 1Q81D 5AJXA 5EJ8A 5IWAB 1J4AA 1UMDA 3VO8A 3K8YA 1RCUA 1BE0A 1A4XA 5IT9A 4U7DA 3W6UA 1LRJA 3Q1LA 3L6UA 2REBA 3H6KA 3L02A 5F1OA 2YWCA 5IKEA 3HB7A 3Q0IA 1N5LA 2R00C 4N0PA 3G23A 4TWRA 5AVJA 4Z2YA 1P91A 2PGDA 3VMFA 4FOPA 1KU6A 1CUEA 1W7AA 4MR9B 1OTHA 3HNRA 4CM5A 2CMGA 1E2UA 2EJVA 5JU6A 2A3RA 1QP0A 4ND5A 3D64A 3I2JA 4BAUA 3LNNA 3R2JA 1FSPA 1YZLA 4LRUA 3GPDG 4ZYVA 3MUOA 1HE3A 1U3GA 2B4RO 3GVPA 5ESWA 3HCAA 3X43A 2ZJBA 2KB0A 5EMJA 1KVQA 2XNHA 3L1KA 7REQB 1C7EA 2WT8A 3DPUA 4ZCIA 1GA6A 1PT6A 2HMYB 2P6NA 3A1DA 4L2IB 3MPUA 4MKFA 2ZRGA 2P3SA 4Y7CA 4PZPA 4XPZA 3FMVA 3BD6A 2Y1WA 2H16A 3K9LA 2PMEA 5KOJA 1AURA 2Z2YA 2X77A 5EZQA 4BMNA 3TFQA 4R05A 1QQ6A 5GONB 1SKAA 3B12A 4QYIA 4Q7QA 3UGQA 4KX3A 1RJGA 4HQKA 2VHQA 3GUHA 1UR5A 3BRSA 2WTMA 3D02A 3KP1A 1KMHB 1I4OA 4K46A 2PEYA 1AGXA 5AFSA 3ENWA 2XIQA 2XE7A 4OYLA 1EXNA 1GSIA 5I7AA 1HK7A 2ZYIA 2NG1A 3ZGXA 3ICOA 4NJEA 3UH1A 6GPBA 3BTSA 4R2MA 1G9SA 1SUCA 4O2AA 4M7RA 5DYNA 1UADA 2Q9CA 2WIFA 3Q9NA 3Q2OA 5HDQA 4C0AC 3I1FA 1E92A 1UPBA 4EPWA 3OOWA 3LC1O 5JANA 1N8TA 2QN6A 2XWPA 2ZSIA 4JYCA 4QDXA 3RQSA 1A5ZA 3FSRA 3P2JA 5IZ4A 1J8YF 1I7DA 1I1QB 1P8JA 4XGIA 3OIUA 3SZMA 2QUIA 4JYPA 3E3AA 2R4TA 1JIKA 5GPBA 4D0RA 3KXLA 3EXAA 2UZ4A 1US8B 3DWGA 4MMZB 2XQIA 2VIIA 1YIAA 3AHDA 3NAGA 4U63A 1OVMA 4FUTA 4OB6A 3ELBA 3QNMA 1JMVA 3U2QA 3TG2A 2CDAA 3FNHA 1YRWA 2AG8A 4IQGA 3ROPA 4WKNA 3FAKA 2BMDA 3NAMA 4ILKA 3KQNA 2Q7DA 2OO3A 4DQUA 4YV0A 2J87A 1XOIA 4C0KA 4DKXA 5AP9A 5BQ5A 2PKRA 4Y9UA 2QS9A 3C6XA 3TAXA 3GLFE 1XA0A 5JMWA 4GRDA 1X7WA 4UDOA 1J9EA 2D0IA 3VAAA 2YXPX 3ZGNA 2YINC 1AVTA 1XJQA 2PX6A 4AL4A 1K89A 3PT5A 4EG7A 5JATA 3NEPX 2O8FB 1NPTO 2YJZA 3ESQA 2C84A 3W0LB 4ZMSA 3NKLA 4DV0B 821PA 5C51B 4F72A 1NKTA 3IAM6 1AY0A 2HK8A 2XKJE 2CHEA 2QYHA 3FTNA 3HL0A 3LBYA 3W2IA 3UGTA 1IMOA 2CL5A 2VXOA 3ZW9A 4W5RA 1LBHA 2VC2B 3NUQA 1IB0A 3E5HA 3U4DA 3IP6A 4CKCB 3U4QB 4ZGBA 4GMXA 3IOBA 3HJHA 1E2GA 2HXSA 1UODA 4LMPA 3OTHA 5HFNA 4D5EA 4RD0A 1JHUA 2OOKA 3CVJA 3ASRA 1XRNA 4QKQA 2NNWB 2D59A 3V9AA 1BWRA 1BXZA 4DCTA 4MDEA 4YRTA 2VTD