3QSYA

Recognition of the methionylated initiator trna by the translation initiation factor 2 in archaea
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
415
structure length
415
Chain Sequence
b'MAWPKVQPEVNIGVVGHVDHGKTTLVQAITGIWTSKHSEELKRGMTIKLGYAETNIGVCESCKKPEAYVTEPSCKSCGSDDEPKFLRRISFIDAPGHEVLMATMLSGAALMDGAILVVAANEPFPQPQTREHFVALGIIGVKNLIIVQNKVDVVSKEEALSQYRQIKQFTKGTWAENVPIIPVSALHKINIDSLIEGIEEYIKTPYRDLSQKPVMLVIRSFDVNKPGTQFNELKGGVIGGSIIQGLFKVDQEIKVLPGLRVEKQGKVSYEPIFTKISSIRFGDEEFKEAKPGGLVAIGTYLDPSLTKADNLLGSIITLADAEVPVLWNIRIKYNLLERVVGAKEMLKVDPIRAKETLMLSVGSSTTLGIVTSVKKDEIEVELRRPVAVWSNNIRTVISRQIAGRWRMIGWGLVEI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Translation initiation factor 2 subunit gamma
publication title Crystal structure of the archaeal translation initiation factor 2 in complex with a GTP analogue and Met-tRNAf(Met.)
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Translation/rna
total genus 47
structure length 415
sequence length 415
ec nomenclature
pdb deposition date 2011-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3qsyA02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3qsyA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3qsyA01
1SM4A 4QGFA 1ZRHA 4LOAA 1N6PA 1PLJA 4U7DA 4WZ6A 4IEIA 2REBA 2X19A 4AF6A 2YNMA 3NTUA 4C0SA 1AMOA 2J9RA 2D7CA 4GMDA 4OQFA 5KNBA 2KBFA 2NZJA 4C0QC 2CHQA 3PG5A 2G1JA 4G5QA 1P60A 1CS4C 4A6PA 1HURA 2IEYA 4G5GA 3BFVA 3T61A 1R8QA 4CEHB 3GEIA 4DB2A 3PJRA 1ZUIA 4OBEA 3M4YA 5FOTA 3BK7A 1U94A 4B47A 2VSXA 1G6HA 5J4KA 1AGPA 3AGPA 5JJKA 3L0SA 3CRVA 1TL7C 2P5SA 1OIXA 4GI7A 5HE9A 5JCZA 5FTJA 1PV4A 3KKMA 1E0AA 4U5XA 2XNDA 1KDOA 1OGJA 1W0KD 3K9HA 5E95A 5HCIA 4DLWA 5HKKA 4MGYR 1T3HA 1JEEA 1KI3A 5TVKA 3ZBTA 2A5JA 4LGMA 2JLUA 1E99A 1KI9A 1E2QA 2R2AA 1H8HD 3UATA 4BGDA 1ZM9A 2BBSA 1DG3A 3K0FA 4BUJA 1LF0A 2NPIA 3GCGA 2JLYA 1SKQA 1BMFD 3EIHA 4LJ5A 5AWFC 4RCYA 2J0UB 5AJXA 3RYTC 3QKUA 1P9NA 2ZU0C 4ACAA 3AKDA 3E20A 4F7WA 1QG0A 2RC6A 1J90A 4NYIR 3KQNA 2V7QD 2FJUA 4PO8A 2OK8A 3DMNA 3ND8A 3FFAA 4HYYA 4MRPA 4B6EA 5DNYB 3CCSB 4TT3D 4WQMA 2OLJA 2AXNA 3D6TB 1VQLB 2OCYC 2VRWA 2P5TB 5EE5B 1E2FA 5FBRB 3LV8A 5DLQC 2FZ4A 2J0QA 3AF4A 3BWDD 3THYB 1E2LA 3K70D 3UG6A 4EIWA 4HB3A 4BFWA 1XJQA 2WTUA 2CRVA 2DERA 1QHIA 4L4UA 4TMTA 4MGIR 2O8BB 4ZKEA 2ZRLA 1XMJA 3MSXA 3LDAA 1XXHE 4PQRA 3B9QA 5AJVB 3RSOA 4KBGA 1XZQA 1OFUX 1YRBA 2BPOA 1S1CA 1KI6B 1AKEA 4EQ6A 2WBLC 1W0KA 2GQFA 1KZGB 1Z0AA 1X86B 2ZI7A 3KTAA 3V76A 3OFND 4O25A 1IXZA 2QAGA 3LNCA 1JJVA 3LQQA 4ZI2A 4LHYA 1T3SA 3SS8A 1NP6A 3B60A 4AIIA 4BQSA 1E2HA 1EWRA 1H8HA 4OJQA 2D62A 2PH1A 1HEIA 5BQ5A 2IYTA 3I92A 4TMKA 1G3QA 3GJXC 4C2TA 2QSYA 4R98A 2OZEA 4LBVA 3FHCB 3C4JA 5FPYA 1BMFA 5SZIA 5IDVA 1GJRA 3AF3A 2JAQA 1G8HA 4TMWA 4NZYA 3AKEA 1II0A 3EPJA 2WPDA 3VKHA 3QEOA 5G41A 2V7QA 2OT3B 2ZRNA 1DAGA 4HUQA 2J7KA 4TT3A 4JJZA 5EZ6B 4PTLA 2BMJA 1E0JA 1K9MD 3RRMA 2IHYA 1XCPA 3CNLA 3GQBA 5CDFA 1QVGB 2CLCX 3A1UA 2Q0HA 1FRQA 1W44A 3T1OA 3ZQ6A 2CCKA 1E0KA 2RGNA 1YVDA 2WV9A 5F2EA 1F3OA 2R65A 1T0HB 2WJHA 3B8HA 4CT4B 3QPVA 3EIQA 3X1ZA 1N6OA 4LJAA 4DT1A 3B1ZA 4BRUA 4TN1A 2FEMA 3FYHA 1VQMB 2ZI9A 1SVSA 1AS3A 2ZSAA 2IXEA 1EX7A 1FQJA 1Z6GA 1ZP6A 2GCNA 2UKDA 2YOHA 2BOVA 4IOMA 2W2XA 3GFTA 1DAEA 5JEDA 2R6GA 2WKRA 5GJBA 3SYKA 1RFLA 2J3EA 3FKSD 4HAZA 4I1OA 3IO3A 3MJRA 3A1WA 1GAJA 5DI9A 4EFLA 3K9NA 1IBRA 2ZI3A 2I1VB 2GNOA 2PT5A 4MRSA 1GFIA 2ATXA 2IXFA 4HAYA 4DCTA 1X6VA 2IS6A 3SYNA 4EUNA 4BASA 1XEXA 4A6XA 4BEBA 4QNRA 4YXWD 1RE0A 2BMWA 2QG6A 2XNSA 1E2PA 1VG8A 4YMUA 1E9SA 1VIYA 3EWAA 5JEEA 3U61B 1M8PA 1GDDA 1QZXA 2KSQA 4LHZA 2VF8A 2HF8A 1GO2A 2Z4SA 1DO2A 4FMBB 4DQLA 1SVKA 3Q5DA 4YAOA 1XD2A 3SJZA 1P5ZB 3WHKA 4JLBA 4OHWA 1GG2A 1L2TA 2WAXA 1OH5A 2O8CB 4DKXA 5AK0A 3CWQA 4WVFA 5AJWA 5EP4A 1R7RA 1ZCAA 1I7PA 2F3RA 1FRNA 4ARZA 1TQ2A 4PSAA 4B3GA 5CIWA 1IAQA 2Z4RA 2Y8EA 1U9IC 4W7SA 3CZPA 2QN6A 2NOAA 4IDHA 1LY1A 4LYHA 5C46F 3TKLA 2VLIA 4FCVA 1B0UA 4JL6A 4DDTA 1N0VC 4G5SA 3MWLA 2XTNA 4PC7A 1ELOA 4JT2A 4E03A 1PUIA 3MAAC 2ZITA 3GEEA 3IILA 3KZ1E 4NL4H 3ECCA 1WF3A 1GL6A 2W00A 2ZETA 3T1VA 4I1VA 3RDPA 1NN0A 4B76A 2X3UA 2QTHA 1VPLA 1T6NA 4EPTA 1TEVA 1Z83A 4TMXA 3LWNA 5EE3A 4MITA 4JMPA 1J2JA 3FMPB 3FKSA 4P4TA 3SNHA 2VSOA 3QQ5A 3TQFA 4KFRA 3FHOA 2FEOA 1Z6XA 3DL0A 4WW0A 3OJXA 2OCBA 3F0TA 4MYCA 5DYGA 2BC9A 1G19A 2XB4A 3KQKA 2XB2A 3SQWA 3LO8A 4FW9A 3OIWA 4YAWA 2BVNA 5CJ2A 1VQNB 2WSSA 5IT5A 2FU5C 3IPYA 1NVWQ 4URUR 3BERA 3FHTA 1A1VA 1W4BA 4DUGD 4K46A 2V1UA 5TY0A 1ZINA 3MHPA 4MH0R 4AG5A 1EFCA 2VHCA 1D9ZA 5D3MB 3RAPR 5FBVB 1LVGA 3CX6A 2GETA 1O3YA 4TL6A 3EZ6A 1L8QA 1YZUA 2QP3A 3SR0A 1CRPA 1DPFA 2FN4A 2PCLA 3K9GA 1ZBDA 3TAHA 4BLRA 1ZM7A 3V00A 1BQEA 1S1MA 1DO0A 2N42A 1KY3A 4M0LA 1W36C 1A82A 3FKQA 3T06B 5LBIA 1GWNA 1WBDA 1E9RA 3WMEA 2WIAA 3N2EA 4EFNA 4HDCA 1I2MA 1VQ8B 3AP2A 4JVLA 1VG1A 4AYTA 5BN5A 3CCJB 1NN5A 4Q1FA 2GVDC 3ES9A 4Q03A 3PITA 2VHJA 2DFLA 4Q4JB 4D0LB 1NN3A 5LPNA 4ZKDA 1CEEA 3Q72A 4Q9IA 5TB5A 4TLCA 1P2VA 1NI3A 3LFUA 3QOFA 5B58C 3TVTA 2CK3D 4S2EA 4W9MC 3G0HA 4ZCIA 1U8YA 1OXTA 3MMPA 2CVFA 4R2IA 3T1QA 2DPXA 2FFBA 4NYJQ 4AK9A 4CEJA 5EQTA 2FOLA 2ORWA 1T9HA 4KAXA 1TF5A 3G82C 2O8DB 1DTSA 3RWMB 2VP2A 1EXMA 5DSZA 2JLRA 4L8GA 3LVBA 1P75A 4LC0A 2JLWA 1X8LA 1KJWA 4B34A 1N5JA 2OO7A 2NO1A 4A15A 4FN5A 4DUGA 3FMOB 2WM9B 3MWJA 5JWHA 3LBNA 1ANKA 5KTYA 4Q4HA 1G6OA 2AKYA 3B7GA 1Q82D 2ZAMA 1FX0B 3CPJB 3NC0C 1UADA 3D3QA 4LJ9A 4CT5A 1QFJA 4RCZA 1E98A 4OYHA 3ZS9A 2JASA 1VTKA 1ZCBA 1JPJA 2B21A 5K8TA 2RAPA 4C0LA 1MO3A 4DCUA 4H1UA 3WBJA 2FV8A 3U6KA 3MGCA 1I4DD 2ZYUX 4JLDA 1E64A 4AURA 3PUXA 4US0R 4DSTA 4B4DA 1BH2A 3GLHB 4QXAA 4GSYA 4FMDB 4RD0A 2KE5A 2BM0A 4GP6A 1E2JA 1MRSA 4B44A 2RCNA 4Y9RA 2QROA 2NO0A 5AUQA 4BEJA 1CR1A 4R71A 1OW3B 1Q44A 2CK3A 2PX0A 1XBTA 3A36A 3AP1A 4Q02A 1EFUA 2P6RA 1KK0A 1D9XA 2OBMA 3I32A 2E1RA 4EJSC 2O0KA 4G1BA 3S1AB 1LV7A 4A8JB 221PA 2HEIA 4EKDA 3OZUA 4Q7JB 3W2HA 1WQ1R 3OEED 1TQDA 4A2QA 4NCJA 2N1BA 1EP1B 4JLVA 4ABYA 4DXAA 4BFTA 2FA9A 4B32A 2W0SA 2CJWA 2QPTA 3WYAA 5CJPA 3HP1A 1WBBA 4C30A 5K8IA 121PA 3A8TA 4OHZA 2WWYA 1UEIA 3NBXX 3QG1A 3QKRA 5JMTA 2IYYA 2ZEJA 3QJYA 4Q1BA 5A0FA 1M34E 1NIJA 2H92A 3AVQA 3VR5A 3KX2A 3HYTA 5BW8A 3IO5A 4H9GA 4PSVA 3REGA 1PUJA 2WWWA 2OV2A 2A5GA 3SDZA 3PUWA 1KI2A 4Q47A 4KITB 5JZVA 1Q21A 3K0AA 2BCJQ 2RGXA 4RSGA 3W5HA 2BN4A 1Z3IX 1TUIA 4FWTA 3A4MA 4LV6A 3DM9B 3I3SR 4L5BA 3W5JA 4E5UA 4KXFB 4PHHA 5L3SB 2XOKD 4Q1DA 4OKSA 4LCBA 1T91A 4HDQB 3R8CA 2IWRA 1G3RA 1GM5A 1OSNA 2VF7A 2FMXA 5TXGA 4HZIA 1NVVR 3VTKA 1EFTA 4PZZA 3K9LA 3CX8A 4M9QA 4YQFA 1OH7A 4P4SB 1CXZA 1VG0B 3EIEA 3IEUA 1X3SA 3KJHA 2A5FA 1YZQA 4V0LA 3LX5A 4DLRA 1MR3F 1W4RA 1A2KC 3NHAA 3T12A 1G64A 4A2PA 3FJOA 1AKYA 1AN0A 1Z0FA 3CCEB 4XWKA 4RKFA 4BE7B 5CK4A 5GJCA 1JQLB 1KSHA 1KK3A 1R6BX 3RC3A 2EU8A 2WJGA 2GA8A 2BDTA 3B1VA 3BD9A 2NIPA 3CXCB 1N8RD 2B6HA 3DOEA 3RNLA 2HT6A 3KFXA 2DETA 1XF9A 4HLDA 5EUQB 4KV9A 4RZXA 2QMHA 4A4DA 1IHUA 2PX3A 4BFYA 1G21E 1CULC 1VCIA 3G4SB 2ZJYA 4AKGA 3MG9A 1FNMA 3NBZC 1KSFX 3CPWB 2C98A 3BRWD 4BLOA 3QE2A 2QTFA 4N3GA 1TEXA 1N6NA 1TF7A 1W2HA 3AP3A 3L82B 3LW8A 5A5GA 3SJCA 1M74A 4RZUA 1E9CA 2JJ1D 2XOKA 2EW1A 1Q57A 1P73A 3THXA 3G5UA 4HB4A 1HTWA 1S0UA 3RWOA 3MFYA 5KOYA 1KHTA 3JZAA 4LBWA 3KL4A 4WAUA 1CR4A 4GRAA 1HUQA 2HF9A 3SOPA 5BWMA 2ZRCA 3BBPA 5KDDA 1W4CA 1RIFA 1W36D 2EFGA 3SN6A 1G5RA 2GPJA 4PR0A 2C9CA 3U3JA 3K0CC 4Z8YA 4BZQA 2OE2A 1P72A 3NXSA 4ZV4A 2AD5A 3IBYA 1QGYA 4RD1A 3AVWA 2A3RA 4TTRA 3ZZUA 1VKJA 1EWYA 4HI0E 1B2RA 2ZRMA 3ONWA 1M1YE 5EE0A 1G18A 1E2IA 1XX6A 1K5GA 4IOKA 2O8EA 2IF0A 4EPXA 4EPVA 5KO2A 3RS4A 1E2MA 2G9NA 3ADBA 2GEUA 1BX1A 1US8A 2Z43A 2BHRA 5KHOC 3GLIB 4R2HA 3W5UA 1UM8A 3SJBA 2DYKA 3IQWA 2RB4A 3BAFA 1P61B 5B2ZA 4MYUA 4DLXA 2J87A 1CJTC 4MDFA 3W9YA 3CR7A 3H2YA 2WZQA 1VMAA 4LJ8A 1Z0JA 2ANBA 2FGKA 4PPNA 4HE6A 2Z6VA 3PEWA 3FMFA 3PUVA 5FPTA 1NF3A 1VCMA 3JQPA 5DYIA 4EPWA 2JJ1A 2Q21A 1XPRA 2H1LA 2HLDA 3A58B 3CCMB 3C41J 3MWYW 3QKTA 1E9AA 3VU9B 1HQCA 4KFTA 4IVRA 1FZQA 3I72A 1K8AD 4LSGA 2O52A 5FTKA 4AWXA 2PMDA 2ZJ5A 3WYGA 2AK3A 2IS2A 3B1XA 1G3UA 5HPYB 3T35A 1ZW6A 4TMZA 4G01B 3U4QB 2IYRA 2OEPA 2H5EA 4M1SA 1F2UB 1A4RA 5FL7D 1KJZA 1E1QA 2XTMA 5FH9A 4FXPA 4IKEA 4XJXA 4QJ5A 4QGAA 3GLFB 2AFHE 3CC7B 3HU3A 1D2MA 4PQYA 1XMSA 4XD7D 1W2GA 4XVUA 2B92A 2LKDA 1RVDA 2J59A 4OI2A 4JLKA 2XJ4A 5BXQC 3B2EA 5TV2A 1JAIA 2QBYA 5JHHB 4JYBA 2NGRA 2XX3A 4WOPA 1KDPA 1GUAA 1JA1A 4DLVA 1T8TA 2B8TA 1OPXA 4YALA 1QHNA 4A0HA 2QT1A 2F55A 4TYQA 1IN5A 3RS3A 1GKIA 2Q9CA 2W2TA 4FWIB 4PZLA 1VIAA 4M1YA 1C9KA 2BMEA 3R7WA 3VFDA 1OT3A 2GCPA 3AEZA 3ADDA 4CF7A 3FMIA 3QF4B 4KSCA 2ZE6A 3QXXA 1LW7A 3G71B 1GIAA 2OBNA 3E5HA 3OJWA 2OFOA 4ZO4A 3W6NA 3SBEA 1IXRC 4QBIA 1KIMA 1UBGA 4B3FX 1Q7YD 2VO1A 5JI2E 2PBRA 2VP9A 4R9UC 1T8UA 1ZNZA 4K8OA 2F43B 1D1NA 3QIAA 1Q0UA 5HZKA 3U3OA 5DHFA 3GFPA 1IONA 3ADKA 2IYSA 1J70A 4JVNA 4CGZA 5EMNA 3UIEA 1X1RA 5FL7A 2QQEA 3TQCA 4JLNA 4LYJA 4LUCA 4C0JA 3BFKA 2F6RA 3NHBA 5IHPA 4PPFA 1KDRA 3KXLA 3X1YA 4EPYA 3AVXA 3GPLA 4AI6A 4Q4JA 4OI0A 4M1TA 3DZ8A 4TL7A 1J9ZA 4YMWA 1FMLA 2ZI6A 5FOWA 4Z54A 3CPEA 3LO5A 1ZD1A 1DBSA 3THWA 5G3ZA 3PEUA 3LVRE 4TLBA 1EFRD 1NLZA 3WY9A 3F5FA 3PVSA 4LDJA 1KGDA 3U2QA 1NG1A 3GJ7A 3I8XA 4EJSA 4GDFA 4IEEA 4X8LA 1R10A 1ZD8A 1E4VA 5TARA 1N6IA 1YI2B 1NJGA 2HDNB 4BWYA 5G40A 1XB2A 4M21A 2W6ID 1YHNA 2XXAB 1P2UA 1TTTA 2QSZA 5EJEA 1COWA 4B2LA 3QBTA 5EE9A 2DY1A 1OB5A 4ZIRB 4HLUC 2XNJA 1C4OA 2XZOA 3ZLJA 3HPRA 3H84A 4BFUA 4Q19A 4PAOA 2BF4A 2NMVA 3ZDQA 2C95A 1R0XA 3DHWC 1Z22A 4A9AA 1G1MA 1XTJA 1B23P 1UDWA 3ETLA 4GZLA 1Z2CA 1G5PA 1LFDB 2MMCA 2ZIAA 2O0HA 1R4AA 3DMDA 3NIBA 1JPNA 4D4KA 4B43A 2KB0A 1KMHA 1CJVC 2GWHA 1SULA 2HMAA 2ODEA 1KD1D 2Z0MA 5EZ5A 1F5NA 3TUIC 3B5JA 1JBKA 1V43A 2FG5A 4QM6A 5JI3E 2GJ8A 2FX3A 1WP9A 3QF7A 3KJGA 3QPWA 5L3QB 1ZNWA 2IYZA 1ZIPA 1EFRA 2V6JA 3L2OB 4RKEA 4X8MA 4P33A 1G9XA 2QQ0A 2VP0A 3VR1A 4DB4A 2IBMA 4HZUB 2V6IA 2HCJB 4V0NA 1EWQA 2ORVA 2FPKA 4N1AA 2KI5A 2ZJ2A 4PO1A 4A8JA 3JVUA 3IBGA 2HT1A 3KKOA 2UZ3A 2KJQA 4PPQA 3O8BA 1QX4A 3QXSA 2YWHA 2W6IA 2BMDA 3QE0A 1G8FA 1GRQA 1KNXA 1XMVA 3QKSB 3K0EA 4CIDA 4DCVA 2WHXA 1E2DA 3QXCA 4Q7KA 2VH5R 2JJ8A 3B6EA 1OB2A 4OK5A 3B78A 1JI0A 3SFZA 1NSTA 3LRPA 4D4JA 2VP6A 5JWRA 1AA9A 2IA5A 2I3BA 2WSMA 2HJVA 2V1XA 3OIYA 4OQXA 1P9RA 2GZDA 1SXJD 5E7MA 2F9LA 5FBLB 3ZYCA 4HATA 4F7DA 1Q12A 2GJ9A 4NYMQ 4M9XA 2W58A 3AUYA 3N2IA 4LHXA 4FMCF 4DJTA 1XZPA 1RZ3A 4XH9B 2VP4A 5H1YA 1UJ2A 2QENA 2BEKA 1HQYE 3B9PA 1QHHB 1T4GA 1FUKA 2RGDA 1U99A 3QEJA 4TYWA 1ZUNB 4G3XA 1W49A 1NMZA 2CHGA 2WKQA 3D31A 1VHLA 1KI1A 3SC3A 2OUKA 5FPKA 4HDOB 4Z1MD 4EFMA 1KZ7B 4Z8XA 1CF4A 1DAHA 1G7RA 4CEIB 2XSZD 3P26A 1NLFA 1J7KA 1GNQA 1KKMA 1NDHA 4UNQA 5KPDA 4JSYA 1NKSA 1FW6A 3K0CA 4UNPA 5KYKA 1E4YA 4MRNA 3SHFA 2VA8A 1M90D 2X2EA 2Q3FA 4I81A 4MYHA 2GCOA 5D3QA 1MO4A 2OCPA 1Q22A 4Y7CA 2WAYA 1UDXA 3KKPA 3OAAD 3I5YA 4FMCB 3I56B 2HYIC 1CIPA 1OKKD 3W90A 1VDZA 4F4JA 4G5OA 1KQSB 4N0DA 2VNKA 1Z6TA 1XD8A 1VQ5B 4R7ZA 4A0FA 2JLXA 3NBYC 1SVLA 4DLYA 3R9IA 1CJMA 3LBIA 2G1KA 4RD6A 4TYYA 4PHTA 4TWZA 3ZVNA 3AH8A 3E2IA 1TQ4A 1SXJA 2LKCA 2QI9C 4ZCLA 3EXAA 5KSYA 1TUEA 3A37A 4L16A 1VQ9B 2VPPA 1NG9A 1II9A 4BRWA 2DR3A 3KB1A 3ZVLA 2VIIA 3OESA 4OI1A 3VKGA 4EH1A 2IC5A 3IPXA 2PJRA 3PENA 2IYLD 3JVVA 4MA4A 2QMEA 2C04A 4Q01A 3QFTA 3AKCA 5KDLA 4LBZA 2VL7A 2XZPA 4L9SA 1DAMA 1XDBA 2H16A 4P0TA 2FF7A 3CF6R 2MSEB 4I1SA 4Z1MA 2ASEA 4DQKA 3U7EB 5KSOA 1Z5ZA 5AUOB 4QL3A 2Z83A 4C7OB 1QHXA 1ZIOA 2XSZA 1U98A 2ZI4A 3CF0A 2ZS8A 3TR5A 4DEYA 2J7PD 1KNQA 4B3XA 1NNEA 3EPHA 2ECKA 2WKPA 1II8A 1UKVY 5EP3A 2ZYVX 3OFNA 2ZVPX 1GRRA 1KAOA 1YJWB 4OJKA 1NSFA 3T15A 3WMFA 1F6BA 4DLTA 3I4LA 4QJ3A 2BBOA 4IDOA 4JKIA 2PZFA 4YAUA 2BBTA 2F1JA 4UXJA 3KQUA 1RJ9A 2O5VA 2ZYTX 2ZYWX 3OAAA 5EE1A 3SE0A 3CIOA 3KQHA 3GLGA 3SQXA 1E2EA 1OYYA 3IKJA 1W2BB 1XCGB 2P3SA 1OKKA 2OSBA 2ZROA 1SVWA 4PPGA 3DM5A 3FPKA 4ILEA 4K1XA 1DOAA 3AV0B 3R8FA 4OL0A 2CNDA 2GESA 4NP6A 1QFZA 1M7GA 2AXPA 2C8VA 4MQBA 1KYIA 1KI7A 5H59A 2PJZA 1KDTA 4RFSB 3U44A 3E1SA 1AZSC 1MABB 4LI0A 2IL1A 1XXHB 4B33A 4AKEA 4K81B 1S8FA 4MGZR 3PV0A 3CC4B 2QAJA 3QVUA 5DISB 2YC2C 2FDCA 1GNPA 1UAAA 4ESVA 1Z63A 4HLQB 2VEDA 4DEXA 3LVQE 1ZUHA 4P32A 2FSGA 1NKTA 4ZDKA 3R9WA 1F2TA 3EZ2A 3I73A 1AJEA 1DADA 1T0JB 4Q1CA 4JKYA 4F93B 4TL8A 3VQTA 2QGZA 3REFA 1K73D 2J7PA 1P3JA 4GZMA 5ANRB 1E2GA 3AQ4A 4KO8A 4WIAA 1RRCA 3CCLB 4LJ6A 1HE1C 1U0JA 2EYQA 4HB2A 3H0KA 2CL0X 4YXWA 2JLZA 2BWJA 4G5RA 2OXCA 5DI3B 4IXNA 5TMPA 2OLKA 4B3DA 4B35A 3AM1A 2IYUA 1W4AA 4QM7A 4P31A 2RHDA 2YZ2A 1SKYE 1WB9A 1KI8A 1WE2A 5BN4A 4NKRA 2GJSA 2FGJA 4OI4A 1N2CE 3H4MA 4JYCA 1VQKB 4FI3C 2F7SA 5CB6A 5L3VA 2IS4A 2CCGA 1KK2A 2ZRFA 2ZR0A 1P6XA 4LV8B 2JGNA 5C4GB 4LBYA 1YR9A 3GJ8A 4IOLA 4MUAA 1G3IA 2MMGA 2PEZA 1R5BA 1WRBA 4QBGB 4RD3A 2GVZC 3TNFA 2XGJA 1E2KA 2OM2A 3ZJYA 3T5GA 4Q4AB 2HUPA 3EARA 5AJZA 5FI1B 4B74A 2IUTA 2E87A 1N6KA 1IY2A 4Q5IA 1G291 4HLUA 1DE0A 2ZE5A 2K5UA 4RZ2A 1N6RA 3Q5EA 4GT1A 4WXPA 2VQSA 1OXUA 1NJFA 1G8GA 4Q48A 3UG7A 4WZBE 3W8RA 1XEWX 2QEXB 3AVVA 1ZC4A 4CYMA 3EZ7A 1WCV1 2OAP1 4QKQA 2GJKA 4O2RA 3GJ4A 2ZRKA 5BYJA 1P2SA 1QUFA 1E2NA 4DC9A 1DAFA 4M1OA 3TK1A 1H85A 1A7JA 1BOFA 2YINC 2QUZA 2ZRAA 4D4MA 1RYFA 4KODA 4S35A 2XNCA 4OQMA 2ZPTX 3LQRA 4TLEA 2ZRGA 4PFSA 2YYZA 5FOXA 3CCQB 2G83A 2RKOA 4FCWA 1S72B 3HDTA 2DFTA 4LK2A 2VSFA 1W7AA 3L8YA 4IW3B 5KSPA 4YDSA 3SU8A 2NPFA 1QBKC 3RRNA 1Z6AA 1I4TD 2O8FA 4Q18A 3C7KA 2AD1A 3U3MA 4UKDA 4FK8A 3FTQA 1N5LA 2XJ9A 3BXZA 1YZNA 3RC8A 1HY3A 5EP1A 3RS0A 2XXAA 4DDWA 3EZ9A 2X1VA 1MO6A 1ZNYA 3DKVA 2ONJA 1G20E 4OQLA 1JR6A 2Z5FA 4B75A 3QI2A 2R6HA 3MUFA 1QHGA 1G7CA 3CZQA 3SHWA 3VNVA 3CH4B 4AYWA 5JHGB 2FNAA 3QFRA 3ZC3A 1QFYA 2GBLC 1NLYA 4BZPA 4XVQA 4Q00A 3SJAA 4AG6A 3TUZC 1SXJE 5CDFE 4DVGA 3MD0A 1KK1A 1ZNXA 1EK0A 5JFGA 3AVUA 2KWIA 4ZDJA 1N3BA 1X8KA 4M53A 3OIUA 4ZI3A 2A7QA 4MKIA 4XVRA 2PLFA 3CRQA 1SKYB 2H17A 4DLUA 1K6MA 1SVIA 3LX8A 5TDHA 5K8UA 4CEHA 3VR3A 4EAQA 1J8YF 4IHQA 1MV5A 2W2VA 4C0AC 4M4SA 3EG5A 3LXRA 4BFXA 5DIFA 2ORIA 2BCGY 1XP8A 4V0MA 5IK2D 1MH1A 2REOA 4LYAA 2IUSA 4QBHA 3V9PA 1GOTA 2WWFA 3ZZTA 2ZRPA 1HV8A 4D4LA 2A78A 2W6JD 2JA1A 3DPUA 3WNBA 3A4NA 3THOA 3K0FB 2RMKA 2OK7A 1Z28A 2FSFA 4UXHA 1YQTA 4KFSA 2WMNB 1JJ7A 4GL2A 2ODNA 2J0UA 2NO7A 1AS2A 3GJ3A 4NYJR 3ICQB 1MT0A 2AR7A 2AX4A 5FOSA 3ZIAD 2CVHA 3MWKA 4JL5A 3GLGE 3VNUA 3NDPA 3TIFA 2A9KA 4IVQA 1E9FA 3P4YA 4W5HA 4ZPXA 1OJLA 4RD4A 1IB0A 1FNDA 4G0NA 4PANA 2LWIA 2J0SA 2EWWA 4HAXA 2EFEB 4RVCA 3VMFA 1BYIA 1NL3A 4O2LA 1KSJA 3OHMA 3THYA 2G88A 4YONB 3RLFA 5AJYA 1I4LD 5HE8A 1ZJ6A 4II7A 3QPUA 4A8JC 4MYTA 1DS6A 2XZLA 1XJCA 1XTSA 4N3NA 1JAHA 2ZSFA 1E62A 3OEEA 4AD8A 3EX7C 1IM2A 2O8BA 1XTRA 1N25A 2CE2X 1XE1A 4DHEA 2PIAA 2X2FA 4GBMA 5IK2A 3KTAB 1QG2A 3H1TA 2PEYA 2OBLA 4DZZA 2QAGB 5H68A 1KI6A 2C5LA 1H65A 2IF2A 4D80A 4YMVA 4NONA 5JCPA 4PAQA 2W6JA 3UPUA 3DDCA 3A6PC 4OHXA 4HLCA 1IN6A 1R8SA 3FE2A 3W3ZB 4D26A 1Z0KA 3BOSA 1JALA 2FWRA 2QTVB 3FWYA 3KJEA 4UQOA 2WJIA 2ZRHA 5FTLA 4A2WA 3SFVA 3I61A 1PLLA 2CLDX 2D2EA 1GR1A 2IYQA 1VYUA 2EVWX 3X2SA 3V4RA 4KVGA 3ND9A 2HXSA 2ZVQX 4ASUD 3NDBB 3LBHA 1W34A 2DBYA 3ZIAA 3HWSA 4HUQB 4A0RA 1FPMA 2H8KA 4JJKA 3IGFA 4M2LA 2D2FA 4LYFA 1CBUA 2ERYA 4PC1A 2P6NA 3BH7A 3CF2A 1OYWA 4AKHA 5IF9A 1DG1G 3SZRA 3W8NA 4AF7A 3AVTA 1FL9A 1JEDA 4FD2A 3K70B 2JEOA 1TADA 3ZZ0A 4MUBA 3WMGA 4CRWB 1JXMA 2NTYC 1OXSC 1KMQA 3VO2A 2R9VA 2A2ZA 3AUXA 3RSLA 5J4HA 3U7FB 2QM8A 2XITA 3H86A 4LJ4A 1AIPA 1AQYA 3UMRA 1DEKA 1FP7A 4OK3A 2D06A 3TAUA 3FGNA 1P62B 4QG7A 1KO4A 4DSNA 1UKYA 1P9WA 1ONBA 4A1FA 4EDHA 2PMKA 1GSIA 3BC1A 2OESA 1Q1BA 2QE7D 3X1DA 1DAKA 1G16A 4NMMA 2J46A 1OLOA 2BKEA 1AM4D 1NMXA 4UAJA 3Q85A 5DO9A 5H70A 4QJ4A 3VR6A 4DCSA 3V4FA 1X1SA 2ZJ8A 1SXJC 3MRSA 1XEXB 5LD2B 5H5JA 3JZMA 2B7BA 1XEWY 1RPZA 1QHSA 1DDIA 3EPKA 2AWNA 2H57A 4NTZA 1Q3HA 2XAUA 3ZVRA 1LNZA 1EP2B 1XD2B 3CC2B 2DHRA 4IJMA 1VCOA 4D6PA 1ESNA 3CX7A 3Q8XB 4ASUA 1W87A 2F3TA 3EW9A 4ARZB 1NVUQ 1LS6A 4QNMA 3DOFA 2O8CA 2X77A 4F91B 1YJ5A 4C0KA 4ZCMA 5CYOA 2FH5B 1W5SA 2JLQA 2RH5A 2AK2A 3M1IA 3IIJA 1V5WA 4E09A 2L0XA 1IN4A 2JDID 2CE7A 2YOFA 3W2EA 1FQKA 1HE8B 3RHFA 3CR8A 1CP2A 2G6BA 2CXXA 3A4LA 1KAGA 4BFVA 3MLEA 3I62A 1RRFA 4C0BA 1AZTA 3KJIA 2BKUA 3GJ5A 3TW4A 3TH5A 4L9WA 4V0KA 1ESMA 1JB9A 5IRCD 2GAAA 3EZFA 3CD6B 2YC4C 4MGKR 5KUTA 1CNFA 4F4IA 2QE7A 3BGWA 4Q1AA 1G8PA 2XEXA 4RFVA 5UKDA 1W0JD 3CH5A 4PGOA 2IYVA 5JS7A 3LLUA 3VAAA 2AN9A 2NZ8A 4TZ0A 5KSWB 3W2FA 2RGAA 3ZGXA 4A82A 4DDVA 5H8WA 3T34A 2F1IA 2QORA 1OE0A 2NQ2C 1T3LA 1Y3AA 1RRGA 2YKGA 2C03A 4PAMA 1QRAA 1G41A 1TU4A 5HZHA 2BJVA 1Q86D 4TMVA 5F9HA 1GKUB 3U5ZB 2YOGA 3AGQA 2ZREA 5EXTA 2NG1A 1ZM4A 1QVRA 3OF5A 3CLVA 4NBSA 1EGAA 4MKGA 5D3MA 3BH6A 3TE6A 2IX3A 4V0ME 2GEVA 1SZPA 3KXIA 3O8RA 1G17A 1ZU5A 3WNCA 2C2HA 3VR4A 2OFXA 2X8AA 3IIKA 3NEJA 4NDZA 5J4YA 2ONKA 5FUVA 3I8SA 3QNUA 5FTNA 1E79D 3QY0A 5J4VA 2CLSA 1EP3B 2JDIA 5E7JA 5JLJA 1Z0DA 2BIFA 4D82A 5GV8A 1KTVA 2A5YB 1N0UA 4C2UA 4IDNA 1U81A 3F8TA 3AF1A 2JIZD 4BPBA 2GHIA 1XWIA 4XD7A 1U8AA 1YKSA 3I1FA 2DFKB 4LZZA 4CEJB 4PXAA 4JBYA 2GBLA 4Q21A 5EXPA 1YRAA 3CPHA 1DARA 1XTQA 1ZU4A 3TVDA 721PA 4NYIQ 4XWOA 1W5TA 1ZAKA 2QGNA 3BFXA 1Z47A 4TTPA 3LAWA 2O8DA 2FFHA 5J40A 4B71A 3ICEA 1O87A 2YWEA 2GK7A 2JATA 5TR9A 2LCFA 3ASYA 4BZXA 4NE2A 2ZJBA 1RC8A 2WJYA 2P67A 1G5TA 1NJID 3O8DA 2AKAB 4Q4HB 4IDPA 5FPSA 2R8RA 3RRZA 1M2OB 2YWFA 1FUUA 2ZAOA 3TRFA 2RC5A 5AN9A 5L3RA 4PC2A 3UKDA 3CKLA 1PVOA 1TF2A 1FX0A 1NN1A 1KOFA 3KQLA 3WXMA 3ZD6A 1S4QA 4X8HA 2J1LA 2R44A 4IVPA 5E3HA 4OHVA 2F9MA 3TBKA 4V03A 3O8CA 3GP8A 2ZQ5A 4DSUA 2IXGA 1E79A 1UF9A 1HH4A 1M6NA 3B85A 2ZUDA 2QTZA 2QL6A 4I4LA 1EX6A 3A1VA 4B2PA 4C9BA 5HTKA 2QTLA 1HA3A 1E9EA 2FFQA 4LJYA 4YMSA 1QGZA 3CW2A 2JIZA 4NHOA 1NVXQ 2IWHA 5DN6D 3GLHA 1IY1A 1IXSB 2I4IA 4UNNA 3IIMA 4KFUA 4PX9A 5E7IA 2QA4B 3CM0A 1L4YA 2IK8A 5SZKB 1VECA 3U7HB 4RY2A 1S9DA 3CMEB 2UVQA 3AVOA 3ZH9B 2VBCA 1YZKA 3U3RA 1N6LA 3RS2A 1AGRA 3EC1A 4V0OA 3S1AA 1D2NA 5CB8A 2EQBA 1DDGA 4IXMA 2VNIA 4LHVA 5JRZA 5DHAA 1G4AE 2CJWB 2J0VA 4UJ5A 1MO5A 1VQ4B 1DVRA 4POAA 2ZJOA 4D25A 3QKRB 4HAUA 3T5DA 4MDEA 4Y9UA 1ZM3A 1HT1E 3OZWA 2R62A 1OV4A 1XPUA 1S96A 3WHLA 3UWOA 4PHFA 1YJNB 1VHTA 4IOJA 2AL7A 1VYTA 4MRVA 4B2IA 1WXQA 1YITB 3K8YA 4M1WA 2BV3A 3K0AB 5CITA 4BPRA 3EASA 2PZEA 4EPRA 3BE4A 4ZDIA 4Q7MB 3K09A 1I2DA 2ZE7A 1LTQA 4TYPA 4D0GA 2ODWA 2OG2A 2WPDD 3DEFA 4A92A 1YZLA 1W35A 5L3SA 3WNDA 4MKHA 2MSDB 1GVNB 1G8YA 2ZR9A 2GZAA 1UPTA 1TNDA 5DN6A 5GVRA 2ZUBA 1UKEA 1OGIA 5LB2A 2VHUA 1OH8A 2BGJA 4KJZA 4QBFA 4XWAA 1K8RA 3HU1A 4P4SA 1Y63A 621PA 1EG7A 5KDOA 4HB0A 1GKYA 1OFIA 3CRMA 1JXOA 2QT0A 4DIDA 2MSCB 4RD2A 3W2GA 3BB4A 1S2MA 3L0OA 3RANA 1Z0IA 4PC6A 4GFDA 1GP2A 1EFHA 4IRUB 2OCAA 1NY5A 1NIPA 4B48A 1BIFA 1TX4B 1BKDR 1NMYA 3UWKA 2JCSA 2AHOA 2VNJA 2VZLA 1U90A 4QGHA 4E07A 2ANCA 5K8LA 4D81A 2QY9A 2GXQA 2FSIA 1UFQA 3W5IA 1NBMD 2WICA 4DSOA 2P0EA 1JB1A 2ZU6A 3IUYA 3C8UA 2I1QA 5KNCA 2QZ4A 4U9UA 5GJWC 4IFEA 1QVAA 1CJUC 4TZ6A 1L4UA 2YHSA 4AC9A 1Q1QA 3THXB 2QU8A 2V9PA 8OHMA 5E4FA 2VNHA 4Y0VA 2QRNA 3TSWA 2FZLA 3P27A 4MRRA 2WWIA 3SBDA 4URVR 4Q66C 4IFBA 4FIDA 1P7CA 1F20A 1G7TA 1OFTA 4G1UC 1EESA 1XJ0A 3PQCA 3QFSA 4O0MA 3I5XA 4MKFA 5G3YA 4V02A 2ZSBA 1VQOB 1KC8D 3ASZA 3CBQA 1YR8A 4JVMA 3N70A 4QHSA 1IOZA 3PXGA 4TSFD 4B6FA 3NC1C 1DELA 1T5LA 4QC2A 1R0YA 3GMTA 3VX4A 5C18A 3EPLA 1VQPB 4KU4A 1JA0A 1E9DA 2IYWA 1JJ2B 1BYUA 3DO6A 4NYMR 4TQ9A 5FOVA 2O8EB 2YVUA 1MRNA 5CYPA 4OQNA 5EXXA 1C1YA 1XU4A 4OHYA 3CCVB 4AKIA 2NO6A 1IN8A 1US8B 3HPQA 3NBFA 1R0WA 3WRXC 1CQXA 2G3YA 4E22A 1JECA 1M7HA 3GLIA 5JWOA 1UKZA 1NBMA 2J41A 1D2EA 2JJ2D 2FPMA 3FDIA 1UEJA 1Q1EA 2WSSD 3W3AA 1P4SA 3UANA 1S3GA 4NPHA 2RGEA 1QUEA 4JLPA 2BGIA 5JBQA 3BORA 2ZRJA 4JBWA 1OXVA 3LA6A 2GEDA 4UXIA 2YWGA 4LV5B 2IS1A 3TJZA 3KKQA 3LW7A 1FOEB 3UXMA 3CRRA 3GJ0A 3TSZA 2G0NA 3U3KA 4M8NE 3LD9A 1VQ6B 4XOIA 2ERXA 3VU9A 3OW2B 1N5IA 2ZE8A 1W36B 1QGAA 2QP9X 2B7CA 3CRZA 5DGXA 3HR7A 3P20A 5FUYA 4ZGNB 3RS5A 3C5CA 3U4QA 1Z2AA 3KFVA 1F2UA 1R2QA 1D8TA 5KSZA 3GFOA 3JQRA 1OHHD 2WJVA 1U2RA 4TSFA 4KYIB 4LJ7A 5F9FA 2GF9A 1IQPA 2BSAA 3GLFA 2G77B 3L43A 2ZXUA 4C3ZA 1GNRA 2GILA 4LHWA 2GK6A 1K5DA 1PJRA 2WJJA 4GNKA 4B73A 2RGBA 4TLAA 2C78A 4Q1EA 2QBYB 3P1JA 3L0IB 1QH0A 3GLHE 4JZKA 5FR2A 4JBXA 2Q6TA 5KNDA 3J81k 4OK6A 2G0TA 2ZRBA 4DRZA 3PEVA 2EFCB 2ODBA 1FFHA 3BH0A 2QDXA 2GF0A 2CHVA 1PLKA 2JJ2A 4F38A 1Q3TA 4KCGA 2ZSDA 1MOZA 3R7WB 3X1WA 4I1UA 4KI0A 4ZDWA 4DDUA 3OE7D 2V8OA 4DIEA 3OZXA 4HAWA 1GL7A 5JSZB 3CO5A 3QF4A 5G53C 1OIWA 2BM1A 2P6UA 3PR1A 4GP7A 2SHKA 4WA7A 4XSGA 1CNEA 1ZYUA 5AUPB 1RKBA 1RRPA 4PQFA 4YHBA 4D0NA 3HJNA 3PUZA 2IT1A 2AFIE 3LXXA 5CM8B 4BLQA 4I99A 3UMSA 1XD9A 2FPLA 2F43A 1HT2E 1IJEA 2XTZA 1F48A 2QPOA 2CDNA 5FUXA 3D7MA 4HE5A 4QOSA 1FTSA 1OHHA 2RGGA 5GADl 1AK2A 2IW3A 3VO1A 1QF9A 3K53A 3HU2A 1OF1A 5FA6A 2ZM5A 3GJ6A 1A8PA 1KO8A 2C99A 2CEAA 3W6PA 1S3SA 1XTKA 3THWB 2A30A 3MJHA 1OH6A 1ZD9A 1OFHA 3AKYA 2PCJA 4QRHA 1SVMA 4O3MA 4EJSB 1SGWA 4BLPA 2VYFA 1XFAA 1UBFA 1JR3D 1N5KA 2OHFA 2P65A 3AVYA 3AVPA 2CMKA 1IY0A 3LY5A 4GOKA 4NCHA 3RS7A 1M1KD 4URZR 4C4PA 1NVVQ 5HR5A 3NH9A 4Q9HA 5FI0B 2C77A 3BIFA 5C4MA 4A36A 4QGGA 1FDRA 1S9HA 2VP5A 4FMDF 1CKEA 3OE7A 3CB4A 3KUCA 5CK5A 1FTNA 5CIQA 1E32A 3QVVA 3SEAA 1E9BA 3W5VA 3CCRB 1U8ZA 1CJKC 2H18A 2V54A 4KBFA 4M9SA 1JNYA 2GDJA 4U00A 4TQUS 5C1BA 4US2R 4AY2A 3VHXA 5B57C 1UMKA 1GAQA 1XCMA 3A1SA 4ZIRA 1JQJC 4URYR 1E3MA 2KBEA 4BFZA 4DLSA 1KRHA 4GOXA 2Q3MA 2GRJA 2B8WA 4HAVA 4X8OA 4M22A 4U02A 4QHTA 1KY2A 2GXSA 1KMHB 3I55B 2DWQA 2AWOA 1NRJB 4QHYA 4KHZA 3CNNA 5P21A 3RVBA 1GRNA 3AB3A 3RRYA 4C0HA 1IJFA 2HXYA 2BJWA 2GTPA 2ATVA 4HUTA 3IEVA 4HSEA 5FUWA 1GILA 1SVOA 3NWJA 2Q9BA 4P4UA 2F1HA 4XSHA 4FINA 3ZBUA 2B5OA 4Q9LA 5J5CA 1XTIA 4BLTA 3JQQA 3VKWA 5L3QA 1FMJA 1H8ED 4ERNA 1U0LA 1JR3A 3ADCA 5CLLA 3CUEF 4HZUA 2H7VA 2NO9A 1G7SA 521PA 1CLUA 3QBVA 5FR1A 2J45A 1CU1A 5B64A 3QKSA 1GTVA 3BB1A 4GOJA 3IQXA 1FNNA 2FSHA 3PUYA 2REXB 1CTQA 2ZSEA 2ZS7A 4JIMA 5LB4A 4CZ2A 4M1KA 1YR7A 4UNSA 1F60A 1Q1ZA 2OFWA 1QG4A 3IHLA 1H42A 4LRWA 3CNOA 3KXKA 2O0JA 2PT7A 3NVAA 3PIRA 5HCNA 5DH9A 4WBSA 1E94E 1E1RD 1G4UR 3TSOA 2ZJZA 3GD7A 2VTKA 2HJGA 2V55B 4XTCS 3GLIE 1NBME 1TMKA 3OZVA 2QA5A 1PZNA 2C9YA 3PFIA 2GAOA 1FNBA 3CCUB 4P6VF 2HYDA 1QHHA 1Z08A 4NCKA 1RYHA 2QEQA 4Q9JA 2ZS9A 3SI7A 4QFMA 2GXAA 4PSKA 4BFSA 4EQ6B 2UZIR 3BJIC 1HYQA 1BJKA 3U6BA 2F1RA 3EAQA 2DEUA 4CEIA 1SHZA 1XPOA 2WWHA 1IN7A 2PL3A 2GXUA 2GKSA 2W0MA 4NCNA 3TW8B 3B82A 1H8EA 1NY6A 2FE4A 3MCAA 2DCUA 3Q3JB 1R5OA 3U60B 1E69A 2GCOB 4IDQA 4KSBA 4CDGA 2WMOB 2OXRA 5LDDC 3K09C 1Z6YA 2CL7X 1U0HC 4JLMA 4UJ3A 3VX3A 1Q81D 1QVFB 3CMAB 1XRJA 2QMOA 3QXHA 2CL6X 1ZM2A 1SHKA 3KB2A 3QENA 4WZAE 4TQAA 3TR0A 4DLZA 3GLFE 4JVSB 2D3WA 2A5DA 1YZTA 1YU9A 2ZI5A 1SXJB 2E9SA 2VYQA 2ZJAA 4M9ZA 1P2TA 4ZGQB 3NEYA 3NH6A 3W34A 3WP1B 3EWSA 3TUJC 3ZS8A 3DZDA 1N6HA 3W2IA 2P2LA 1E1RA 2DFNA 3EA5A 4JS0A 2HCBA 1W1WA 5AR1A 3P4XA 3EC2A 4FCTA 4ON9A 1BO6A 1LS1A 3RABA 4DT1B 3L8ZA 5EXSA 5HXBA 3QXJA 1M7BA 2HLDD 5SZJA 5KPJA 1KO7A 4DBLC 5CLQA 4J0QA 1YHQB 1E63A 4ACBA 2EFHB 4H1VA 3X1XA 1J99A 1AS0A 5FBQB 4GMXA 1OIVA 2R6CA 4L15A 5FL3A 1R0ZA 1VCNA 1XNJA 3UMFA 3ZD7A 4PO9A 2PLRA 2CCJA 1II8B 2EIXA 4C7OA 1MKYA 1UBEA 2C96A 4YAFA 1U9IA 1E0SA 4LPSA 2EYUA 1GVHA 2QAGC 3HR8A 3HYRA 4B3CA 3G6EB 2ZRIA 1YR6A 4TTQA 1KSGA 1QDEA 4JLOA 3O47A 1E1QD 5GVSA 1X8JA 1KO5A 1W46A 1Z06A 2ZUCA 6Q21A 1RJ9B 5L8VA 1XMIA 3ZVMA 2ZRDA 3B13B 3LH5A 4LY6A 2R6DA 4URWR 1D6JA 2WOJA 3IDQA 4B3BA 3GLGB 4YC7A 3UK6A 2FFAA 2J5XA 4KYUA 4YLGA 3R9XA 1ETUA 3FVQA 1TAGA 1TPZA 2OAQ1 1YZGA 3WBKA 4CW7A 3WRYC 5EUMA 2QMUA 2WWGA 4C43A 3CWZA 3OEHD 4PZYA 1CRQA 3WYFA 2TMKA 4US1R 4W5JA 2WWXA 5J47A 1AQUA 2DB3A 1W47A 5JJIA 4RJLA 3U44B 3P32A 2RGNC 3L0PA 2EFDB 1KJYA 2IYXA 3K70C 4RFSA 4WXRA 5FBWB 3BB3A 4XIGS 1MABA 2ZR7A 1A5TA 4JL8A 1XXHA 4A0GA 1ZC3A 2RGCA 3Q9LA 4HEJA 1GITA 3LLMA 3WP0A 1TLLA 2VHTA 2WVJA 1F2TB 4RZ3A 5CM9C 3T1TA 5FTMA 5M04A 3CRW1 4TYNA 3Q7QA 3DVLA 2D4HA 3FPAA 4F4CA 1KKLA 1GL9B 1BX0A 2R6AA 2IHBA 3N5CA 2BBWA 3KKNA 4BLSA 2N46A 1WDTA 2IEZA 4LX0A 2QRZA 5BN3A 1W48A 4YDHB 3U7GA 421PA 1N0WA 5GV7A 3DKPA 4PHGA 3VHLB 2DWPA 5SZHB 4AYXA 3CONA 2CBZA 1VG9B 4F92B 5LD2C 5B30A 3PCRB 2PZGA 3QFCA 3IHWA 1G3MA 4PC3A 1FP6A 3KDSE 5JRJA 3B1WA 4TLDA 5JS8A 5THXA 1VQ7B 4TL9A 1A2BA 5DI3A 4KLNA 3PEYA 3NG1A 4Q7LA 1R5NA 3TMKA 2ZTSA 2OILA 2BEJA 2V3CC 4P3YA 4LC1A 1YJ9B 4URXR 3TLXA 2Q9AA 5GJVC 1E96A 3OEHA 3VR2A 4NU0A 1SQ5A 2QPAA 3M6AA 4NH0A 3C15C 1DAIA 4YMTA 5J4LA 4JT4A 4GPTA 3R20A 2CNWD 2WOOA 4Y0AA 1JR3E 4Q9KA 5F98A 4W5WA 4Q4LA 1Z29A 1BS1A 3BS4A 2D74A 3C5HA 1COWD 1LF5A 4LWZA 4DCNA 4XTRA 3QSYA 1VYVA 3F3YA 4ESHA 3M0EA 1T5IA 2VHQA 4Q4AA 5EP2A 5AUNB 1TU3A 2QP4A 1J8MF 2WIBA 5JSZA 5F3WB 3K1JA 2OTJB 3D8BA 2D7DA 1D5CA 1WA5A 2V4ZA 2W83A 1GAWA 3C16C 1L7VC 1KI4A 3E1YE 1UBCA 2RHMA 3C14C 5FPHA 3AF2A 4JLAA 1ZVQA 4KVAA 1W0JA 4KLZA 3KUDA 2R6FA 1ODFA 2IUUA 1TVCA 4CVNA 5DE3A 5JJLA 1FNCA 5C2JB 4JSTA 2YV5A 4JLJA 5JECA 3OIVA 2C9OA 1E6CA 2JLSA 5FFMA 821PA 1QHYA 4LPKA 3ZQJA 5KU1A 3A1TA 1ZMXA 2QNRA 4ITRC 3EA0A 2ZANA 2HV8A 5ELXA 5FOUA 1YE8A 5A4JA 2XNDD 1Q20A 3GEHA 3TGPA 5BYKA 1YIJB 2Q3HA 5HKKD 2QM7A 4G1VA 1CR0A 1OXXK 3FOZA 3E70C 3SYLA 1CR2A 3AF0A 2O8FB 3W6OA 2YJTD 1KO1A 1RW4A 3FB4A 3NKVA 1LB1B 4BECA 1TQ6A 1WMSA 2EWVA 3K0SA 2DWOA 2CNWA 2GJAA 3Q7PA 4D2IA 1GZSA 3B1YA 4UNRA 3QG5A 4DWJA 2BMFA 2JLVA 3QUSA 2GZHA 3FFBA 1XEFA 1Z8FA 4M1MA 2OTLB 1Z07A 4NCIA 4N0EA 4Z51A
chains in the Genus database with same CATH superfamily
4J0IA 4O29A 5I8ZA 4A8HA 1DIHA 4BL5A 2BHLA 4NJMB 4WZ6A 5KVCA 2X19A 3Q39A 2ID9A 1CUEA 2KBFA 4PLYA 3ND6A 2FDXA 2OHHA 4GM0A 2NZJA 3R24A 4RYLA 1JZQA 2CHQA 3NBQA 4W9NC 3TPCA 3PG5A 5DLPA 1P60A 1CS4C 1I0LA 3BFVA 4KAAA 4P3NA 3RSSA 3GVPA 2EGGA 4OBEA 1ABBA 2QSJA 1C30B 1WSDA 4ZOCA 2E89A 4CIXA 1ODIA 4YJHA 2ACVA 3AGPA 1RJFA 2XIJA 1ARZA 4YO8A 3HYCA 3L0SA 4QQKA 2P5SA 1ZSVA 1OIXA 4C4AA 3H2GA 1Y7TA 1QV6A 4C89A 4U5XA 2C7GA 2G82A 2XNDA 2IPLA 1H3FA 3GN2A 1JIVA 4DLWA 4H7KA 5H4GA 5HM8A 2I66A 3QIVA 4R5HA 1Y6QA 1KI3A 1VMDA 1XN1A 2A5JA 2Z2ZA 3B53X 3DD5A 3GJTA 3OT4A 1E99A 3UXEA 3WAGA 4K2HA 4MW0A 1D2GA 1PV1A 2VTVA 2R2AA 4NARA 4F11A 3UATA 1W5BA 1P1KA 2BBSA 2PZKA 1CY6A 3K0FA 2FPWA 3LLCA 4D3FA 3QBJA 4L5YA 1C0LA 1UPBA 4CM8A 3PP8A 2OM6A 3U09A 3AKDA 1BN6A 3E20A 3DTVA 4B4UA 1UBTS 1QG0A 2AN1A 1YC5A 3Q3CA 2VDWB 1H93A 3QOYA 4PNPA 4R83A 3DE3X 3FFAA 4HYYA 4MRPA 5GY7A 1VL6A 3F4BA 4C7BA 1DEHA 2F64A 2AXNA 3D6TB 4PY2A 2ZDHA 4JJ4A 3TM5A 5EE5B 4EEXA 3MS7A 4L4RA 1CZNA 1EBFA 1T5SA 1GCGA 1IDOA 3BILA 4R81A 4ZT5A 2FRVA 5T8KC 1TK9A 4R1MA 3DDUA 3NDIA 3O73A 4JWKA 3S5UA 4D9NA 4YR7A 4MIEA 3UG6A 1CZUA 3DMTC 5LA6B 1NLMA 5EMJA 4L4UA 4XLEA 5DHTA 3TI9A 1NI4A 1NYLA 4RMJA 1N4DA 4TMTA 2H4ZA 2ZRLA 4HCJA 4UULA 3MSXA 2GN1A 3MS2A 4Z4WA 4MK4A 1KZ4A 3STVA 4AKGA 4BV2A 2DBQA 4DABA 2GI4A 3T5TA 3OCZA 1XZQA 4NFYA 4LTMA 1ID8A 1OFUX 3RTAA 2WABA 1VFNA 1UJNA 4ZOAA 2WBLC 3FJ1A 2PH3A 3TL3A 2R8OA 1C41A 1FYFA 2AR0A 2IY8A 3ACCA 1OX6A 1E1NA 2BSXA 4GBED 1SURA 4G25A 2XUHA 3LQQA 1GR0A 1XAHA 4YLEA 4PAWA 3ORQA 1E2HA 1EWRA 4Q3EA 3AONB 2WHEA 4OAPA 1A27A 1GGJA 1ZL2A 2PH1A 1PX2A 3D02A 4TMKA 1QZUA 4E5KA 3GJXC 4G0YA 1A7AA 2QSYA 2I7VA 4R98A 4D8VA 2OZEA 5LZ2A 1SNYA 1J7JA 1BMFA 2R7LA 1E7WA 1UQRA 4JAVC 5IDVA 3KSAC 2JAQA 1OGYA 2CZCA 1IHXA 1I01A 5EN4A 4TMWA 4P25A 3UYLA 4KQ2A 4MPPA 2WPDA 4HVAA 5G1PA 3SZ3A 4LF5B 2H65A 4RPKA 3FDJA 1F14A 3WRYA 1I9GA 2QRVB 4TXHA 4TT3A 1UBSB 5EZ6B 2X5KO 3AR3A 4K9KA 3NTQA 1E0JA 1K9MD 2XNHA 1XVIA 5DCUA 3GQBA 5IYRA 3T7EA 5JMOA 2CLCX 3I6BA 1VE1A 1W44A 2IVFA 3ZQ6A 3GB9A 1E0KA 4P4GA 1L3BA 5JANA 4C1NA 1UZMA 2I6QA 4EJ2A 4CT4B 3QPVA 1J23A 1ZK2A 4QVJA 1Z16A 2RGRA 3KT8A 2RG7A 1H2ZA 4MQUA 2UU9B 3B1ZA 1K3UB 1VQMB 1EK6A 2PKQO 1FQJA 1U4SA 2EGUA 1U2TA 5CVTA 1AG9A 4XKWA 2WKRA 1MZVA 3SYKA 3FKSD 4HAZA 4KC0A 3IO3A 4BQRA 4B1FA 4JELA 1PRYA 4BNNA 1TCVA 1GFIA 4EO9A 1ZRSA 2ATXA 2BUAA 4HAYA 5JROA 4GMKA 4NF2A 1X6VA 4EB6B 1ODLA 1ZN8A 1HNXB 3SYNA 4A6XA 3TRJA 4DXDA 4DMFA 1N78A 1BMDA 1N2JA 2Q3DA 1CHNA 3EGDB 1H4VB 1FIUA 4CMEA 3R6DA 1H2FA 1DDOA 1M10A 3EWAA 3U61B 4K3VA 1U2DA 1N8SA 3D1LA 1QZXA 1P1JA 5BY2A 2FCRA 3OHSX 4REMA 1J07A 2HF8A 1ML4A 5HKBA 1DO2A 2WFMA 1X87A 3RU2A 1X39A 4YAOA 1XD2A 2YJGA 2Y76A 3DEIA 3HB0A 3LUKA 3ORSA 1QANA 3TOXA 3WHKA 1DBQA 1FX1A 4S24A 3HDGA 1OH5A 4XEHA 2XHZA 1RKXA 2O8CB 3CWQA 3MTDA 1ZCAA 3JVEA 1FRNA 1BZYA 1TQ2A 2V0NA 3KVRA 4DG9A 3QLTA 5DNYB 4GNRA 1PCXA 2P4EA 4EMSA 5I7HA 2Y8EA 4ALMA 2CLHB 1RYYA 1V3TA 4W7SA 4JI6B 3W6ZA 2QN6A 2NOAA 3GZJA 4CV2A 1D2RA 1FXSA 5DX8A 1I10A 3UF0A 2VLIA 4JL6A 2X42A 3T99A 5LP6B 4PLCA 1PJ3A 3GNSA 1ZK3A 4FLEA 2VEOA 2XI4A 4QSHA 2C3OA 4PC7A 1T9DA 5JVDA 3A3GA 2PMBA 3IILA 4CMKA 2EX0A 3QPDA 3AUTA 2W00A 4O02B 4X62B 1NN0A 2H0QA 3C1UA 2QTHA 1VPLA 3H2ZA 3HCFA 5FQNA 4EPTA 1Z83A 3LWNA 5EE3A 1QP0A 2F00A 3FIJA 4D8TA 5T4BA 4B7UA 2YY5A 3SNHA 2A14A 2ADMA 1B26A 3FHOA 2NTVA 1Z6XA 3DL0A 3NJ8A 4OG2A 3OJXA 1A9RA 2W42A 4MYCA 2QQGA 5DYGA 1G19A 2BI8A 2XB2A 5LBUA 3SQWA 3GT7A 4FW9A 5TRTA 3OIWA 3LUAA 2QJFA 3OPXA 4YAWA 1HMPA 2RH4A 5I8PA 2H1RA 3OQNA 2BVNA 5CJ2A 2WSSA 1CLEA 3FSGA 4MROA 1J5EB 1KQOA 3QYAA 4DR1B 2Z09A 2ZBUA 2XUKA 4IL5A 1T4CB 3RVKA 3Q4GA 1PD1A 2V1UA 1ZINA 2J3LA 2XD9A 3OU7A 1BTOA 1EFCA 1BSVA 1E3WB 1KAEA 4MH0R 1V2GA 4WK6A 4WV3A 3BTSA 5D3MB 4CCYB 2CKMA 3FYDA 5FBVB 3QEBZ 1LVGA 2IEBA 3Q0EA 2O8NA 1E6UA 2GETA 4TL6A 3EZ6A 4MQFB 1NJ6A 4G0UA 1CRPA 2FN4A 2PFKA 2X0DA 4P0PB 3K9GA 1ZBDA 3TAHA 4LW8A 1ZM7A 5IBPA 3V00A 3PPWA 4B82A 4BLRA 4M36A 3TGLA 4CL8A 1S1MA 5E6UA 1DO0A 3M4JA 1X2EA 2Y77A 1L6RA 1I2BA 2OO5A 1TZBA 1IWOA 5G4KA 1W36C 3G7NA 5B1SA 5U1PA 3T0IA 2A86A 4EFNA 2H07A 4DCJA 2FMTA 4BQPA 2UYCA 1R9GA 5FWYA 4OH1A 5KS2A 5BN5A 3K5PA 1KL7A 2HQ1A 4KIFA 5I7SA 3ES9A 2RHOA 3AHIA 1M1YA 2VHJA 4ZOLA 2DFLA 4OXXA 1NN3A 2AOUB 4NULA 1FC0A 4RS4A 4WRRA 1B93A 1KAQA 2GVNA 3T9CA 3K6RA 3KUUA 4QVIA 2XZTA 3PQ2A 4JC8A 3LFUA 4QVGA 3QOFA 4UARA 4QTUB 2CK3D 1IJBA 3O90A 4FS8A 4ZCIA 3OTQA 1OXTA 2J07A 4QASA 2AG5A 4RLQA 4UVHA 5ARCA 3T1QA 2FFBA 2BFFA 2HLNA 4H18A 4H3VA 5M5BA 5CVDA 2FOLA 1T9HA 1TF5A 4OYYA 3G82C 3SKBA 4FM9A 4LSMA 2ACEA 3N53A 5DCWA 1EXMA 1W88B 2QD1A 5DSZA 2C7QA 2E18A 4L0QA 4YRCA 1X8LA 3E9ZA 4YWJA 1YI8A 2D0PB 4GYJA 4RIHA 4J7CA 4XRGA 1U3DA 1UK8A 2WW8A 5E0OA 2NO1A 2J8ZA 3R4CA 2WM9B 3MWJA 2HUNA 3IT1A 3LLSA 4LJLA 1O94A 4DBLE 4EB0A 1NNUA 2WD7B 1S8NA 4LK3A 2JGJA 2ZATA 3B7GA 4GI3A 2A4MA 1C9DB 2HBRA 4NMLA 3U16A 1XN4A 3ESYA 1CY4A 2P79A 1Y82A 1ZK4A 3D3QA 3M7IA 3NATA 3VPAA 3HXQA 2ZB7A 3LE8A 1R6TA 1C4KA 4PVCA 3DEKA 4RF5A 1E98A 5IN5A 3ZS9A 2JASA 3ZHXA 4J6EA 1VTKA 3MCZA 2J0EA 3FLBA 2OYRA 5ADWA 4M0PA 1FU7A 2QVCA 2XUZA 5K8TA 4HR7A 5BSYA 1MO3A 4MQMA 4NQZA 3I0ZA 3MILA 4H1UA 5AI9A 1DIAA 2AQIA 2Q5CA 3U6KA 2GHQA 1I4DD 3L4SO 4IH9A 1A5ZA 1PFQA 4JLDA 2K4MA 2NU7B 1E3ZA 5F5NA 1PJAA 2REQA 1Z0ZA 4B4DA 3OZFA 4BO7A 3OURA 4RD0A 3GFBA 2BM0A 3B9RA 1C5KA 3G8BA 2H51A 2VT3A 3V4PB 5J4YA 4YJGB 2PX0A 1Z8HA 1QVWA 3L6UA 3SM9A 3B89A 1U4NA 3DYVA 1ISPA 3P0EA 1Z9BA 3WGTA 1KDZA 3TLGB 4L95C 4EJSC 3S1SA 3IH5A 1SUDA 4YDRA 1XG5A 1LV7A 3VAZA 1NT4A 1UC5B 2PXXA 1CUIA 4RMNA 3OPYI 4Q7JB 1WQ1R 3WKBA 1U02A 1UWKA 1X8XA 1Y81A 2EBHX 1SG9A 2A0UA 3DTYA 4J16C 4JI4B 2FA9A 3HS3A 3UAXA 4BMVA 5BOSB 3AXSA 1Q7GA 1V45E 4Q6BA 2CJWA 3E3MA 1PTJA 3MTIA 1SC3A 4YCAA 3M9WA 2AXQA 5JRDS 4OHZA 1K6XA 3QKRA 4GU5A 2D5IA 5JMTA 3R6TA 5ALUA 5A05A 4MRAA 4L74A 1KE2A 3JR7A 4W63A 1Y1TA 2MYTA 2WD9A 3HG7A 3SGLA 1DINA 3TCXB 3IO5A 1CC1S 3REGA 1JF8A 4RGBA 2WWWA 3NRJA 1C0PA 5T4FA 3LT1A 2A5GA 5BWNA 2AI3A 3RSGA 1FFEA 3SKYA 4BCDA 3GRFA 4KITB 5COQA 1SHUX 5JZVA 1QK4A 2H1CA 4RSGA 2CFOA 4LV6A 1DQYA 3QMVA 3HCAA 4NS1A 4BMOB 4GWLA 4LYYA 3A70A 4PHHA 3DEHA 4G5FA 4UPEA 3SZMA 2P9QA 4Q1DA 1B74A 1HC7A 1LV8A 1Z7WA 4Q3AA 5TF4A 1IY9A 2IWRA 5C8VA 1PL7A 1RHJA 4RCVA 3V3TA 2Z58A 2VF7A 2FMXA 2GBCA 2WFLA 3LSTA 3QGMA 3R3YA 2H08A 4HZIA 1RR6A 1XP5A 1EVZA 4PZZA 4XPIA 5DGHA 2I4MA 4K9QA 4M9QA 1IC6A 4JU8A 4MLPA 4XA8A 4B7AA 1G2IA 1JG1A 4EI2A 3H18A 2QUHA 3PFCA 3KJHA 1RABA 4R84A 1YZQA 2O2GA 3H5RA 2OHOA 1H5UA 3O91A 4LQLA 4J7AA 3PLNA 1XQXA 4LE2A 3WV5A 3NHPA 1NUAA 3D0KA 1LD3A 4L4ZA 2FPUA 3L7CA 3ZHOA 1G64A 4EF6A 3IP6A 2YIDA 3TD9A 4XWKA 1VE9A 1Y8QA 4RKFA 4BO6A 5CK4A 3GAFA 1KIFA 2Z8XA 1H0HA 2ZB2A 2NAFA 4FUQA 3FBGA 1M2EA 1JN0A 1RQ7A 3RC3A 1QGED 4V0RA 2WJGA 2Z04A 5IH7A 3CXCB 3VTAA 1H2HA 5DNAA 4QYMA 4F1WA 1RXYA 1Z4PX 3RNLA 1HTBA 2VWPA 3AM5A 3NV7A 4RPGA 4C6HA 3KFXA 5A06A 1O54A 2DETA 1Z56C 4FDTA 4HDRB 3AHEA 1W6UA 2FQWA 1UD8A 1EK5A 4Y6RA 1TD9A 2A8YA 3WHPA 4HRAA 5FYQA 1PR0A 3LY7A 3BTUA 4E33A 4IMRA 5D3KA 3G4SB 5BVGB 3LXUX 3NVMB 3JPYA 2AOXA 1FQOA 3ECCA 3MG9A 4MMYB 3RTBA 2C98A 2RKWA 4PABA 2IPOA 1FTWA 2OV1A 1OMOA 3A6DA 1TEXA 5A9SA 1W2HA 3LW8A 4B9EA 1JAXA 4R8LA 2H0RA 3SJCA 3VC2A 4RZUA 1L5VA 3E8SA 3MAGA 4D74A 3L0CA 1Q57A 3RIGA 4RQAA 3THXA 5IAAA 3RWOA 1KHTA 4N3CA 5U4QA 3D6VA 4WAUA 1CR4A 4DV4B 3CO0S 3U4HA 2AFRA 5BWMA 3CB2A 3LECA 3KKEA 1SOVA 1VBMA 2Z2YA 3LHSA 1Q83A 1SCJA 4Z9XA 1LI4A 3SN6A 5BV0A 1OZGA 2GPJA 3I4FA 3RSHA 4Z8YA 3GBPA 1ZN9A 5C8YB 3VOAA 2EC5A 2OE2A 2IOFK 1L8OA 1WMBA 3N2KA 3ROKA 4EWLA 1KFJB 4ZV4A 2ZW9A 3PWZA 5K2OA 1XVVA 2W6OA 2A3RA 2AEEA 4TMFA 4TTRA 1XR3A 1TB4A 3V4LA 3GEPA 2YN4A 3MTQA 3ZZUA 5AI8A 4H7JA 4G5HA 3LZCA 1M1YE 1I33A 4E4YA 2VFAA 5K4AA 4N3AA 1U2QA 1DKMA 2E1PA 4IOKA 2IF0A 4L2IA 2O8EA 4EPVA 1OWNA 1IQUA 1DZ3A 2GEUA 2YVAA 2PDAA 4BJ1A 4RK0A 4PXYA 3UPTA 3GLIB 3ZE6A 5JVDF 1G9TA 1NM5A 1NBHA 1T0PA 3IQWA 3ORRA 3FOAA 3PQFA 4RAOA 5B2ZA 4L5JA 3EVCA 4FEAA 2J87A 1I6MA 1MOPA 1NXWA 1VJGA 1FSSA 2WZQA 2FGKA 3BRWA 2ZTNA 1WZCA 4Z4RA 3ONNA 1NF3A 3ZW7A 4OL9A 1U3CA 2EOAA 4KGXA 4HDSA 5DYIA 3TQTA 1RKQA 2JJ1A 1V1JA 3IE0A 2H1LA 2NZYA 1XPRA 2HLDA 4GG1A 3CCMB 1CZLA 1C1XA 1DFHA 2YFKA 3QKTA 1E9AA 4X71A 3RW9A 3VU9B 1M76A 3Q6MA 5LSAA 4AWXA 4LSGA 4YP7A 4Z4IA 1MLDA 1TGVA 2XA1A 5K01A 4JBIA 1G3UA 4CKCA 3T35A 1JKXA 1AKMA 4X7MA 4G01B 4JJAA 3U4QB 3P9YA 4ALIA 3D7NA 1QH9A 3HNPA 3D8HA 4YRZA 8GPBA 2A35A 4FGLA 4F9GA 1P0IA 1USWA 2C9BA 5C7LO 1LPAB 5FH9A 4FXPA 3DZKA 1CUFA 4CMEC 4XLFA 5F4OA 3GLFB 2AFHE 3CEMA 1ZGHA 3DGFC 1SU8A 3PYLA 1JQKA 1U2DC 3N0WA 4HXYA 2QNIA 4WKNA 2C42A 3T41A 4XD7D 5BMVA 3UMYA 2VRBA 4OMFG 4ZO6A 3T56B 2B92A 2LKDA 4TXJA 4OI2A 3P2EA 2NYAA 4JLKA 1NB9A 4TSKA 5AXCA 3B2EA 3STHA 1XZNA 3FY4A 1LSSA 5FKJA 1JAIA 4YRQA 3A10A 1E1LA 3GAZA 2NGRA 4AUEA 4DGQA 5KOIA 2QBYA 4Z7JA 3FYTA 4YALA 3D5EA 3O75A 3G2QA 3PC6A 4JQZA 4XM0A 3FYUA 2OXIA 5ALJA 3DDYA 2NUAB 5KYXB 4TYQA 1I5RA 3WLTA 5JNTA 2F55A 3KJQA 3GY0A 4FWIB 3E5MA 3L1IA 1FDWA 3PSHA 4PZLA 2D4AA 3DLTA 4OB7A 1SBIA 4RPLA 4Z9BA 1B6GA 4DCCA 3R7WA 2F2TA 4M99A 3AU8A 4MMZB 1U5BA 3AEZA 3QH4A 3H3JA 3VFDA 1IULA 3ADDA 3NJ4A 1F4PA 1NE7A 2NLOA 4DNRB 1QE5A 4P9SA 3QF4B 5ALEA 3QXXA 5JARA 1T25A 3G71B 1ZFNA 3O0TA 5HJ2A 4DQUA 1GIAA 5AMXA 1R3DA 3HUUA 4OKIA 2OFOA 5AK5A 3BCFA 1IOLA 2Z57A 3SBEA 1IXRC 1DJNA 4QBIA 1GARA 1Q0PA 1KIMA 4FDVA 4XONA 4B3FX 2ECOA 3DULA 2NTJA 1K28D 3M81A 3TLZA 4G9GA 2YV4A 2AH5A 1DO8A 3C45A 1N1DA 3WWDA 4XQGA 4O08A 3Q8WA 1YULA 2GN6A 5TNXA 1IONA 4PCAA 2IYSA 1J70A 1NPDA 2XUJA 4JVNA 5TVGA 5REQB 4CGZA 4AIRA 3JQAB 5FL7A 3I9KA 2VBIA 3TQCA 3BZBA 3R9KA 2YJ6A 4JLNA 4LYJA 5BNZA 2XMZA 2F6RA 1QR2A 3PZBA 1TT5A 3I30X 1BA2A 2ZSIA 4PPFA 1T8PA 4XM2A 4Y2HA 2AMJA 1VB3A 2GAJA 1EB8A 1UBHS 4OI0A 2ETVA 1Q6ZA 4CJXA 4M1TA 2QD4A 4KKUA 1U2PA 5THQA 1BHSA 3C2QA 2MJLA 3WFJA 4FR5A 2VRCA 1R4NA 4ID9A 3LVRE 5DF1A 1QYIA 4DTIA 3PVSA 4LDJA 1KGDA 2IV2X 1EMDA 2ZQYA 1JDTA 2EFYA 4XGIA 4DR7B 1R6VA 3AL0C 1Y89A 2JFNA 4IEEA 4QPCA 5IS2A 3EFOB 1E4VA 1MC8A 2KLHA 2Z1NA 1RNLA 4AZWA 3L3BA 4BWYA 2JCXA 1XB2A 1RLJA 2W6ID 3HV0A 3UMRA 3VOBA 5ER9A 2QSZA 1FSPA 3MOSA 1HGXA 3O2JA 4P0QB 4B2LA 1RCFA 2WIGA 2OAEA 3GP5A 3VHXB 5KCMA 2DY1A 4D3ZA 3FOBA 1RLIA 5GOZA 3A26A 2XNJA 4E21A 3A6JA 4EO4A 5BWLA 2EBUA 4BFUA 2PE3A 3HXKA 4PAOA 1IM8A 4UOQA 2VYVA 4RV5A 3DLHA 3AHCA 3QU4A 2VJJA 1R0XA 1LBQA 3FPCA 4Y8VA 5E8JA 2GCIA 4BMDA 2CBGA 1B23P 1G59A 2GN2A 1X0XA 1Z2CA 2I78A 1KAHA 4R6XA 2XAAA 3P9NA 2B4YA 3GX1A 4KWCA 5CLGA 4UTVA 3N7AA 2AQKA 2JFVA 5CB4B 2HMSA 5DW0A 2GYWA 3H0EA 3IVCA 5AVVA 5H16A 1N1GA 2FPGB 2H1HA 1P29A 3NIBA 4KDRA 3CJTA 2KB0A 4NI5A 5HEKA 2WTNA 3OX2A 4W82A 5DLDA 1TO6A 1MEOA 1GZHB 5FULA 4BB6A 3JZDA 1SULA 3MXTA 3KV1A 2XCRB 1N2CA 5EZ5A 2OVBA 1O94C 5LYJA 4QM6A 4B3SB 3EJ6A 3PHIA 1XQVA 1VLJA 4KI7A 2FX3A 3QF7A 3ENKA 3QPWA 1Y5NA 4DSAA 1ZNWA 3VVLA 1U3TA 3IE1A 1EFRA 4X8MA 2FEWB 3LUJA 1G9XA 2QQ0A 3G85A 3O1LA 1EVLA 3WA6A 3WWZA 2V6IA 4LKRA 1ABEA 3L4BA 2P9HA 2WT8A 4ZYYA 2KI5A 1K7EB 1VLZA 2BFDA 4MI9A 4PO1A 4L28A 4X63A 1TE2A 3W79A 3F46A 3ME5A 1CQJA 3WS7A 4A8JA 4IMJB 2KJQA 2HT1A 3O03A 2ZUEA 5FT9A 4FCCA 3QXSA 4QATA 3QKSB 1G8FA 3LHKA 2YN2A 2V6FA 4CIDA 5A2QA 1SO8A 2YFQA 1DUVG 2MR6A 3V32A 3B6EA 4RADA 1YS1X 1OB2A 3CF4A 1CT9A 4KR6A 5K20A 1NSTA 1WHTA 3LRPA 2VP6A 3N58A 3SX4A 1IWBB 2IA5A 3WGGA 4WZBA 4EG4A 4OQXA 5A04A 1ZGJA 5E1OA 3UW3A 1P9RA 2GZDA 5FBLB 1A7KA 4MR8A 4BLUA 3OSUA 3U39A 3HUTA 3ZYCA 2VJKA 1XXLA 1GZDA 4JQCA 4M9XA 5F4BA 1WJGA 3RK0A 4A3SA 5AW4A 2DP4E 5IASA 5KJCA 4B80A 3GDWA 1JJBA 4FMCF 4Z4SA 2C7BA 4W6ZA 1GA6A 3ETNA 3ZLUA 1UD3A 1EUDA 2BEKA 5C3MA 1T36B 1BDHA 5IKMA 1EUCA 2GN9A 5FWXB 2I7TA 1V48A 1W49A 1HTTA 1GGHA 2OD9A 2WKQA 1X13A 3SC3A 1QQ6A 2JLCA 2X3FA 4Z53A 4GKJB 4QXPA 2NP6A 1FPQA 1XDZA 4EKNB 3OQMA 5FX2A 2BE7A 5HIMA 3FWNA 3P26A 2ZIGA 4DYVA 3MELA 4L8WB 3L02A 1T2AA 3CUYA 4AJKA 1LI5A 5F4MA 2HA3A 3I2IA 3RTGA 4HGQA 1NKSA 1GZ4A 4HNAB 1Q9SA 3E9DA 3Q88A 5HS4A 2RHBA 2XMRA 4P86A 3JWPA 1N9ZA 3ZXXA 3DOIA 2V7XA 1HL3A 1UJCA 5DTMA 2QRKA 4I81A 5FA8A 2GCOA 5FWNA 1FLVA 2GM3A 1I1HA 2JVIA 4P53A 4JH0A 4RJTA 1T9KA 1UDXA 3K7EA 3KXDA 4D6YA 4FMCB 3DBLA 4AY3A 2IZZA 2XXBA 1QGUA 1C7ZA 4PQGA 1IQ0A 3L8MA 3ASQA 5AW9A 1ZN2A 2FP4A 1KQSB 4W7IA 2VNKA 4R7ZA 4UAUA 1SVLA 1NDQA 2UYYA 4YK7A 2HDOA 3TD2A 2HRBA 1MAWA 4M54A 4BNFA 1VE7A 5I9TA 1H6CA 1ZMTA 3AH8A 4X94A 1TQ4A 1Y6JA 3GGJA 4ENWA 4Z1OA 2QI9C 4XQ0A 5KSYA 4RF3A 1CUUA 4L16A 4L50A 4W8HA 4J7UA 2GZSA 2X6RA 2VPPA 3W1WA 1II9A 1NYTA 3LKBA 3VYUB 3FAZA 1QOQB 4BRWA 1MAUA 2DR3A 2VIIA 1AUPA 3VKGA 1YFZA 1E7QA 2PR2A 1F12A 3IPXA 5HF9A 3OZGA 4U39A 4B3TB 3H6KA 3JVVA 1QO0A 3OPVA 3URMA 4B4WA 3QE9Y 4XGNA 1T2EA 1U7ZA 2CFCA 4LXIA 3AKCA 4LBZA 2XZPA 4B85A 3L49A 1UDAA 1X92A 3CF6R 4G0VA 3PGJA 4DQKA 4Y1EA 5KSOA 1Z5ZA 4TV8B 4QL3A 1L8XA 1RBYA 2TYSB 3EUWA 3IRVA 1ZIOA 2XSZA 2ZI4A 1E18A 3KS9A 3Q3VA 3F47A 5KAPA 5GM1A 4M1ZA 1NNEA 2ECKA 4RDLA 3H7IA 1II8A 2FPOA 3K72B 4WDRA 3Q38A 3A1DA 3OFNA 3D7LA 4H0FA 5DSXA 3UB3A 1KAOA 2EZ9A 1YJWB 2IHUA 4LVCA 4OJKA 4LOIA 1GPYA 4UW9A 5AKJA 3JQBA 4DLTA 3AKZA 1ZDMA 3H8SA 3NPAA 4JB3A 4IDOA 2PZFA 4YYEA 2WM2A 4G41A 2CV2A 1ZRMA 3D0QA 3TG2A 3HJBA 1RJ9A 3WGUA 2IH2A 3OAAA 3SIPA 1NFQA 4U7FA 4XCXA 2MT9A 5EE1A 3SHQA 4ZJZA 4YUZA 2VJQA 3DMPA 5HTOA 3OA0A 3KQHA 4RF4A 3ZGOA 2M5SA 1JWBB 2DE0X 2WJ3A 4FGUA 3ZY4A 3VNSA 3OCJA 3KD2A 3HO6A 1U2GA 2P69A 2VZ0A 3DNPA 3KLMX 4K1XA 1PDWA 1GGNA 4ILEA 4Y1FA 4ZAXA 4UOZA 2CNDA 4RYDA 4Z3OA 3R8FA 1QHEA 4LJRA 4OXKA 1MXFA 2IVZA 3DXFA 1STOA 1T8SA 4A6EA 2XUFA 3CW8X 1KI7A 2XD4A 2KW5A 4KQ1A 4YJ3F 3O4HA 4UVDA 3X1MA 1THZA 5CW2A 3U44A 4XLAA 3KTDA 1DWQA 4OHUA 2P1ZA 4UM5A 1T3TA 3R7DA 5JDIA 3MS4A 1LC0A 3C5WP 3T1NA 3SVZA 1NXTA 3EQ2A 3QPCA 2QAJA 4IGKA 5DISB 4BE4A 2YC2C 4CT0A 1GNPA 4EG0A 4ESVA 2ATIA 3FX2A 2VEDA 3N0VA 3CXUA 4QOJA 1EUQA 1ZIYA 2FSGA 2IHVA 2Q5EA 4KE6A 1JBEA 1DIGA 2BUBA 3BCHA 4N5MA 3EZ2A 5C9ZA 1AJEA 1DADA 1T0JB 1O9HA 4FZJA 1IIBA 1RWNA 2WI8A 4NFHA 1HZZC 4ONEA 3MBIA 4Q1CA 2C4HA 4LDRA 4CU5A 1FFAA 4D44A 2FJ0A 3JD4A 4KQWA 1QF6A 1EVEA 4DV6B 2XE8A 2I55A 3Q7IA 4GQAA 3VYTB 4UVEA 4YJDA 2WM3A 4R1OA 1QQ7A 3ROZA 1JFSA 3P9QA 3OJ0A 1N7HA 5BT9A 3ZWBA 4P82A 1QYXA 2BWJA 5K09A 2WJ6A 4JMQA 3OC0A 3UBMA 3V55A 4ZZIA 2IYUA 4WX2B 3SK0A 3BL6A 2INGX 3O4RA 3AM1A 4M8KA 4YN3A 4NATA 1NXXA 2ZXIA 5AKKA 1WE2A 3D6NB 5BN4A 1X1EA 2HRZA 3JTEA 1CJCA 5DW3A 1N2CE 3HJRA 4FQ8A 5ALQA 3QEMB 4LFCB 3A35A 2QB5A 4FI3C 2F7SA 5L3VA 3EHEA 1VKOA 3LKZA 5H81A 1KK2A 4JD5A 4HAOA 1ST3A 5H9VA 4EY4A 3WB2A 3GJ8A 1RI5A 2JIOA 1R3UA 3N0RA 1AE1A 4UEWA 1LX6A 4PS1A 1KBQA 1E2KA 1Q7BA 1F9AA 2OM2A 3OF2A 3OG9A 4MW9A 5DTQA 4Q4AB 2HUPA 1KMCA 2AJCA 5IX8A 3FPSA 3OI7A 4K28A 4L75A 3WKEA 2OD2A 2DLCX 1BGVA 3F9CA 4IQ4A 2VPIA 1Z5WA 1QTQA 2L42A 4L3WA 1WSRA 1O57A 2HU7A 1MB3A 3FPJA 1E1MA 2ZE5A 3AR8A 1E1DA 4E3WA 1EA7A 1EIZA 1YDFA 2YX1A 2TMYA 3TZHA 1Z12A 2LZ0A 1VRWA 2H4XA 4D92A 4Q48A 4K03A 3T7CA 3UG7A 5B4UA 5KC9A 4WZBE 1CE8A 3S7TA 1XEWX 3K73O 4JK3A 3BREA 1ZC4A 3EZ7A 1K9SA 1XJ5A 4J49A 3O7MA 2OAP1 1P19A 3RF7A 4O2RA 3ANXA 5K9ZA 4BKPA 3PGMA 1C2YA 3UBTA 1GTZA 1Z4JA 2Z5VA 4DC9A 1CEXA 4NU8X 2ZBVA 2BF7A 1H85A 1A7JA 3B3JA 3A8IA 2ZRAA 1LC3A 1SVUA 2HU5A 4NNPA 3LGSA 3RUFA 2YQZA 2Y66A 3LQRA 4FOOA 4IDBA 1GQSA 4IRXA 2HSGA 4J0EA 2D7JA 2VPTA 1H1TA 3HJGA 3ORYA 3P0JA 3RG8A 4CQLB 4CL3A 2RKOA 5A7FA 1RXUA 2R48A 4OGGA 2WIKA 1HT3A 5EGSA 5L6LB 1BAPA 1V95A 2VSFA 1HDOA 2AG1A 4NX2A 3HZHA 4D8UA 1E61A 2NPFA 5ESRA 3RRNA 1Z6AA 4E5YA 2C7OA 2JZNA 2NYVA 2OCIA 4HL6A 2GKGA 3QE4A 2Z3ZA 4Q18A 4WT7A 2AD1A 3AUJB 2P9CA 4OJTA 4RE6A 5ICEA 3FTQA 3AIOA 4XOPA 1YZNA 3BXZA 3EGCA 4GW3A 3RS0A 1SVNA 1MU0A 3SLNA 1SUBA 3GROA 4QT4A 6CHYA 4IHAA 1B00A 4XPZA 2IH4A 4DY4A 2HKIA 4Q3NA 1ZNYA 2FXIA 2RIPA 3M3PA 1SUSA 3RFXA 5KVAA 1Z45A 2F17A 1JWLA 3EVGA 4EJMA 1KC1A 2PT6A 2E21A 1NVBA 4B75A 1X9GA 3VNAA 3SHWA 4AMYA 1QHGA 1G7CA 1Y0BA 3CZQA 5D5QA 5DZSA 4ZCQA 4RVHA 1XTBA 2YCBA 4HMOA 4D0RA 3ZC3A 4MR7A 4C05A 4CE6A 3K15A 3I9JA 3NTLA 4XVQA 3HCNA 4I50A 1JFLA 4GM1A 1Q5PA 1L5YA 3AR7A 1J39A 4O5OA 2HHCA 4P7BA 4PN3A 5HVNA 4LOKA 1OT5A 4XVRA 1K6MA 3LX8A 4G1FA 3VR3A 1N4AA 4OIFA 1MV5A 1SWWA 3H75A 1P44A 2FP3A 4C0AC 2DBRA 2VS1A 5DIFA 5KYTA 3WLAA 3AILA 2IODA 4RK6A 4IMPA 3EXFB 4OD0A 3TEJA 4C22A 4GOLD 4PRZA 2A59A 5CLJA 3HABA 2JA1A 4DDKA 2X5XA 2H3HA 2VWHA 1R0BA 3F3MA 5AI5A 4P3IA 2PGIA 1YAHA 2D1QA 2FSFA 2X7XA 3LUFA 5PNTA 3SSMA 2QRPA 1Z4LA 3RVPA 5CEEA 1GU0A 4CLOA 3H9QA 3LNTA 2P9JA 5IJWA 1PQWA 2FPRA 4GL2A 2J0UA 2ONZA <