3QT9A

Analysis of a new family of widely distributed metal-independent alpha mannosidases provides unique insight into the processing of n-linked glycans, clostridium perfringens cpe0426 complexed with alpha-1,6-linked 1-thio-alpha-mannobiose
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
424
structure length
424
Chain Sequence
b'LSTNELKEIVRKIGKDLSGKIEDKKLQELFYNCFINTMDTTVEVSEGDAFVITGDIPAMWLRDSTSQVEHYLPFVKEYPELKAIFTGLINRQVKCIFIDPYANAFNKEPNGQKWDNDITKDSPWVWERKYEIDSLCYPVRLIHKYWKESGDETFFNYDIKKAFNMIIDLWRVEQYHREKSDYSFQRLNCSVTDTLSHEGLGTPVTYTGMTWSGFRPSDDACEYGYLIPANMFAVVALRYISEIAEKVYKDEELKEKADSLREEIDNAIEKHGKVYKEGFGEVYAYETDGMGNYNFMDDANVPSLLSIPYLEYKGIEDEVYQNTRKFILSKNNRFFFEGKAAKGIGSPHTPDQYIWHIALSMQGLTTNNQEEIDQLIKLLKETDAGTGYMHEGFHVDDPTKFTRDWFAWSNSLFSHFIYEKVINK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein CPE0426
publication title Analysis of a New Family of Widely Distributed Metal-independent {alpha}-Mannosidases Provides Unique Insight into the Processing of N-Linked Glycans.
pubmed doi rcsb
source organism Clostridium perfringens
molecule tags Hydrolase
total genus 162
structure length 424
sequence length 424
ec nomenclature
pdb deposition date 2011-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06824 Glyco_hydro_125 Metal-independent alpha-mannosidase (GH125)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.10 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 3qt9A01
3WKFA 1HCUA 4J5TA 3WIQA 2VN7A 1KREA 1NXCA 4WVCA 4CJ0A 1FO2A 1IA6A 2VN4A 3E73A 5CZLA 2JG0A 4DOEA 5E2JA 1VD5A 2GH4A 3ACSA 4Q2BA 1DL2A 1G9JA 2EACA 3ANIA 1UT9A 2FV1A 4Z4JA 2JJBA 1G9GA 2NVPA 1V5CA 3S4DA 2FV0A 5M7YA 3VXDA 1K72A 1KKTA 2RGKA 1H54A 5MEHA 1DOGA 1ULVA 2RI9A 3RX5A 1FAEA 5CA3A 3W7SA 2FUZA 1WZZA 2DROA 2AHGA 4AYOA 1RQ5A 2D8LA 4Z4LA 4WU0A 3QFYA 1LF6A 1KWFA 4KTPA 1F9OA 2A8ZA 3W7WA 2DRSA 3WUXA 3W7UA 2XFGA 1V7VA 2DRRA 3QFZA 1JS4A 4FUSA 1G87A 1GA2A 2AFAA 4AYPA 1CEMA 4Q88A 4CJ1A 3CIHA 3GT5A 5DGRA 1KSDA 1FP3A 3W5NA 1GLMA 3H2WA 1WU5A 1G6IA 3QXQA 1GAHA 2AHFA 1XWQA 2DRQA 4TF4A 1H13A 2F6DA 3WKIA 1LF9A 1GAIA 2FBAA 4AYQA 4DODA 2D5JA 2Z07A 1KRFA 1V7XA 2GZ6A 4KTRA 2OKXA 1FCEA 3RSYA 3TF4A 3QT3A 1XW2A 3GLYA 2JF4A 1F9DA 2CQSA 1X9DA 4ZH5A 3H7LA 2B4FA 3QRYA 3QWTA 3W7TA 3QSPA 1FBWA 3VW5A 1CLCA 4TXTA 3H3KA 3S4BA 3QPFA 1KSCA 1FO3A 2WYNA 3EQAA 3WKGA 3ON6A 4L0GA 2ZZRA 5KKBA 4JJJA 5GW7A 1UG9A 3T33A 3E6UA 4CE7A 4ZG8A 4AYRA 1V7WA 2QNOA 1TF4A 2RI8A 1H12A 3GZKA 1FMIA 1H14A 3QG0A 1WU4A 4L6XA 1AYXA 3RX8A 3QDEA 1IS9A 1KFGA 3WKHA 3QT9A 3W5MA 3WIRA 2ZBLA 3RX7A 2EAEA 2CQTA 3EZ8A 3WIWA 3K11A 4WVBA 5DGQA 1V5DA 2P0VA 3RENA 3D3IA 2EADA 3X17A 4EL8A 2EABA 3ANJA 4XUVA 5GY3A 5M7IA 3S4AA 3PMMA 3RRSA 3A3VA 3AFJA 3W7XA 1FBOA 1IA7A 1WU6A 3WC3A 1NC5A 3ACTA 5CD2A 1L2AA 1KS8A 1L1YA 3QXFA 1XWTA 3P2CA 3ANKA 1AGMA 2YIKA 3S4CA 4WVAA
chains in the Genus database with same CATH superfamily
1TNOB 1LTXB 4MMIA 1J0MA 2VN7A 1NXCA 1TN8B 4GL3A 4WVCA 1N7OA 4FXGB 2H6HB 3E37B 4D4BA 3ANIA 1G9JA 2I07B 1OJNA 2E24A 2JJBA 1H35A 5ILKA 3M7EA 3S4DA 4FNVA 3VXDA 3S9VA 1N21A 5MEHA 1HMWA 3RX5A 1JCSB 4KKIA 2G02A 4WU0A 4KKJA 1LF6A 1KWFA 4KTPA 1F9OA 2X03A 2J5CA 2XFGA 2WINB 1V7VA 2DRRA 1GSZA 1N4SB 1OJPA 1CEMA 3CIHA 3GT5A 5GZKA 1KSDA 4GTOB 3W5NA 1O1RB 4OK4A 2WIIB 4ZRPA 2XQWA 1WU5A 2B39A 1XWQA 4TF4A 4AYQA 1H13A 2F6DA 4ZRQA 1LF9A 1N24A 4ONTA 1W6KA 1V7XA 1S63B 5JPNB 3GLYA 1F9DA 1W3YA 3Q7AB 1I8QA 1OJOA 3PZ4B 3H7LA 3QRYA 1C3DA 3EUVB 4F13A 1RWGA 3SAEA 3DRAB 5ILDA 1D8DB 2BRVX 3HXEB 2PN5A 3WKGA 2ONGA 2ZZRA 5IK6A 1X1JA 1V7WA 1H37A 1TF4A 1H12A 1N1BA 3GZKA 2Q1FA 1WU4A 3QDEA 3SDRA 3VSNA 1HV6A 3W5MA 3WIRA 2ZBLA 4OZWA 2CQTA 1QSJA 3PZ1B 3K11A 1V5DA 2EADA 3Q7FB 5ILHA 4XUVA 3Q79B 4C1SA 2H6FB 4LNVA 1NC5A 1KS8A 1UMPA 5JMFA 1HM3A 1XWTA 3G4DA 1X81B 1N23A 5JPMB 4WVAA 1LD7B 1SA5B 1LXMA 1KREA 5EATA 1FO2A 4OK2A 2VN4A 5CZLA 5IKAA 4DOEA 5E2JA 3M75A 1NI1B 2GOXA 4Q2BA 3HXBB 3M00A 3E30B 2EACA 3PZ3B 1UT9A 2WY7A 1LOHA 3SQCA 3KLSA 3Q75B 1RW9A 5M7YA 1KKTA 2RGKA 5IM1A 3DPYB 1DOGA 1ULVA 2XWJB 1EGUA 3W7SA 2BRPA 1WZZA 2WDAA 1MZCB 2ONHA 1RQ5A 3EU5B 4GTQB 2A8ZA 1TN6B 4FUSA 4EHMB 4CJ1A 3OXUA 1N20A 4GTPB 3DSTB 3CU7A 1JCRB 1G6IA 3M74A 2AHFA 3WKIA 1N7NA 2FBAA 4DODA 2D5JA 3OEDA 1KRFA 4KTRA 2OKXA 4GTTB 3RSYA 3TF4A 1N9AB 1X1HA 4E1YA 3Q73B 4MMHA 2WY8A 1J0NA 3N0FA 1X9DA 3KSQB 4ZH5A 5C05A 2B4FA 4YDEB 1S64B 3W7TA 2FUTA 1LD8B 1F9GA 1JCQB 3H3KA 3RJ3A 1KSCA 5GW7A 2H6IB 1UG9A 3P5RA 4ZG8A 1O79A 4L6XA 2G0DA 1FMIA 1H14A 2BEDB 1NL4B 1IS9A 1KFGA 3WKHA 3HXDB 4OJZA 4NEIA 3RX7A 3AFLA 2EAEA 3EZ8A 3A0OA 3WIWA 4WVBA 1RWFA 3RENA 2BB5A 3SDQA 2EABA 5GY3A 1H3CA 4QT9A 3RRSA 3A3VA 3M02A 1FBOA 1IA7A 5IK9A 3WC3A 4OZVA 2IEJB 3PZ2B 3P2CA 3M76A 4FJQA 3PYBA 1W6JA 1O6QA 4GTVB 3WIQA 1IA6A 4DI5A 1VD5A 3NFVA 1N4PB 3E34B 1DL2A 1GXMA 1HXCA 1RWCA 4BOJA 1G9GA 1O5MB 1V5CA 3E32B 5ILIA 3M72A 1QQFA 1H54A 1SQCA 5CA3A 1FAEA 1H39A 3HXFB 2AHGA 4AYOA 4D4CA 1O1SB 4Z4LA 1N94B 1N1ZA 3W7WA 2DRSA 3WUXA 3M7BA 4LIXA 5ILYA 1JS4A 4AYPA 1R76A 3M7CA 3LZ9A 2R2LB 3SFXB 3H2WA 2A73B 2BBCA 5EAUA 3QXQA 3NNBA 2DRQA 4V1RA 2NOJA 3P5PA 3SDUA 1KZPB 3C72B 3E33B 2GZ6A 1O6RA 1N22A 1HM2A 1N7PA 3SDVA 3KQ4A 1XW2A 1TNYB 2CQSA 4M76A 1DCEB 2V8JA 4GTSB 3M71A 3QWTA 2E22A 4MBGB 5FOBB 1FBWA 1CLCA 4TXTA 2BB6A 5IK0A 3QPFA 1FPPB 1X1IA 1H3BA 5KKBA 3PYAA 4JJJA 3T33A 3D5RA 3DSVB 3G6JB 4AYRA 2RI8A 1AYXA 1N4RB 5FO9B 1QAZA 5ILZA 5DGQA 3E80A 1KZOB 2P0VA 5FO8B 2V3PA 3D3IA 1O1TB 3X17A 3SDTA 3ANJA 1H36A 3PMMA 4FXKB 3AFJA 4YDOB 5DHIA 1WU6A 5DHKA 3G4FA 3ACTA 1L2AA 3HXCB 1TN7B 3VSMA 1AGMA 2YIKA 5JMDA 1HXGA 3WKFA 1HCUA 1F1SA 4J5TA 4D94A 4CJ0A 2H6GB 3E73A 2JG0A 1OJMA 2FUQA 3M01A 1QBQB 2GH4A 4F10A 3ACSA 2XWBB 2FV1A 4ZH1A 1FT2B 1C82A 5FO7B 2BRWA 4Z4JA 2NVPA 3Q78B 5AGDA 4D4AA 3M73A 2FV0A 3DSWB 1K72A 2RI9A 4MU9A 3E7JA 2FUZA 2DROA 1GXNA 3EU8A 2D8LA 4LNGB 2WCOA 1O6HA 3QFYA 3DSUB 3W7UA 3DSXB 1LXKA 3QFZA 1G87A 1GA2A 2AFAA 4Q88A 1D8EB 1N7RA 5DGRA 2V8KA 1FP3A 1TNBB 5EASA 1GLMA 1N7QA 1HXAA 4V1SA 1GAHA 4YCRA 1GAIA 2Z07A 5IL8A 1FCEA 3QT3A 3DSSB 2JF4A 2PMVA 1TNUB 1GHQA 2V8IA 2V3NA 3K7XA 3QSPA 3VW5A 4D4DA 1HMUA 4GTRB 1RWAA 3N0GA 1HX9A 3S4BA 1FO3A 2WYNA 3EQAA 1CB8A 1GXOA 4BOKA 3ON6A 4L0GA 3SFYB 1N95B 5IL3A 1HN0A 4CE7A 3E6UA 1FT1B 2QNOA 3KSLB 3M7LA 3QG0A 3M78A 4GAXA 3RX8A 2F0YB 1H3AA 1TNZB 3M77A 3QT9A 5ILJA 1SA4B 4RNQA 1HZFA 1N4QB 4EL8A 2SQCA 5IKHA 5M7IA 3D5SA 3S4AA 4L9PB 2ZISB 3W7XA 1RWHA 5CD2A 4GTMB 2ZIRB 1L1YA 3QXFA 3ANKA 3S4CA 4LNBB
chains in the Genus database with same CATH topology
1TNOB 1LTXB 2VN7A 1NXCA 1TN8B 4GL3A 4WVCA 4FXGB 2H6HB 3E37B 4D4BA 3ANIA 1G9JA 2I07B 2JJBA 1H35A 3M7EA 3S4DA 3VXDA 3S9VA 5MEHA 3RX5A 1JCSB 4KKIA 2G02A 4WU0A 4KKJA 1LF6A 1KWFA 4KTPA 1F9OA 2XFGA 2WINB 1V7VA 2DRRA 1GSZA 1N4SB 1CEMA 3CIHA 3GT5A 5GZKA 1KSDA 4GTOB 3W5NA 1O1RB 2WIIB 4ZRPA 2XQWA 1WU5A 2B39A 1XWQA 4TF4A 4AYQA 1H13A 2F6DA 4ZRQA 1LF9A 4ONTA 1W6KA 1V7XA 1S63B 5JPNB 3GLYA 3Q7AB 1F9DA 3PZ4B 3H7LA 3QRYA 1C3DA 3EUVB 3SAEA 3DRAB 1D8DB 3HXEB 2PN5A 3WKGA 2ZZRA 1V7WA 1H37A 1TF4A 3GZKA 1H12A 1WU4A 3QDEA 3SDRA 3W5MA 3WIRA 2ZBLA 2CQTA 1QSJA 3PZ1B 3K11A 1V5DA 2EADA 3Q7FB 4XUVA 3Q79B 4C1SA 2H6FB 4LNVA 1NC5A 1KS8A 1UMPA 1XWTA 1X81B 5JPMB 4WVAA 1LD7B 1SA5B 1KREA 1FO2A 2VN4A 5CZLA 4DOEA 5E2JA 3M75A 1NI1B 2GOXA 4Q2BA 3HXBB 3PZ3B 3E30B 2EACA 1UT9A 2WY7A 3SQCA 3KLSA 3Q75B 5M7YA 1KKTA 2RGKA 3DPYB 1DOGA 1ULVA 2XWJB 3W7SA 1WZZA 1MZCB 1RQ5A 3EU5B 4GTQB 2A8ZA 1TN6B 4FUSA 4EHMB 4CJ1A 3OXUA 4GTPB 3DSTB 3CU7A 1JCRB 1G6IA 3M74A 2AHFA 3WKIA 2FBAA 4DODA 2D5JA 3OEDA 1KRFA 4KTRA 2OKXA 4GTTB 3RSYA 3TF4A 1N9AB 3Q73B 2WY8A 1X9DA 3KSQB 4ZH5A 2B4FA 4YDEB 1S64B 3W7TA 1LD8B 1JCQB 3H3KA 3RJ3A 1KSCA 5GW7A 2H6IB 1UG9A 3P5RA 4ZG8A 1O79A 4L6XA 2G0DA 1FMIA 1H14A 2BEDB 1NL4B 1IS9A 1KFGA 3WKHA 3HXDB 3RX7A 2EAEA 3EZ8A 3WIWA 4WVBA 3RENA 2BB5A 3SDQA 2EABA 5GY3A 1H3CA 4QT9A 3RRSA 3A3VA 1FBOA 1IA7A 3WC3A 2IEJB 3PZ2B 3P2CA 3M76A 3PYBA 1W6JA 1O6QA 4GTVB 3WIQA 1IA6A 1VD5A 1N4PB 3E34B 1DL2A 1GXMA 4BOJA 1G9GA 1O5MB 1V5CA 3E32B 3M72A 1QQFA 1H54A 1SQCA 5CA3A 1FAEA 1H39A 3HXFB 2AHGA 4AYOA 4D4CA 1O1SB 4Z4LA 1N94B 3W7WA 2DRSA 3WUXA 3M7BA 4LIXA 1JS4A 4AYPA 1R76A 3M7CA 2R2LB 3SFXB 3H2WA 2A73B 2BBCA 3QXQA 2DRQA 4V1RA 2NOJA 3P5PA 3SDUA 1KZPB 3C72B 3E33B 2GZ6A 1O6RA 3SDVA 3KQ4A 1XW2A 1TNYB 2CQSA 4M76A 1DCEB 2V8JA 4GTSB 3M71A 3QWTA 4MBGB 5FOBB 1FBWA 1CLCA 4TXTA 2BB6A 3QPFA 1FPPB 1H3BA 5KKBA 3PYAA 4JJJA 3T33A 3D5RA 3DSVB 3G6JB 4AYRA 2RI8A 1AYXA 1N4RB 5FO9B 5DGQA 1KZOB 2P0VA 5FO8B 2V3PA 3D3IA 1O1TB 3X17A 3SDTA 3ANJA 1H36A 3PMMA 4FXKB 3AFJA 4YDOB 1WU6A 3ACTA 1L2AA 3HXCB 1TN7B 1AGMA 2YIKA 3WKFA 1HCUA 4J5TA 4D94A 4CJ0A 2H6GB 3E73A 2JG0A 1QBQB 2GH4A 3ACSA 2XWBB 2FV1A 4ZH1A 1FT2B 5FO7B 4Z4JA 2NVPA 3Q78B 5AGDA 4D4AA 3M73A 2FV0A 3DSWB 1K72A 2RI9A 4MU9A 2FUZA 2DROA 1GXNA 3EU8A 2D8LA 4LNGB 1O6HA 3QFYA 3DSUB 3W7UA 3DSXB 3QFZA 1G87A 1GA2A 2AFAA 4Q88A 1D8EB 5DGRA 2V8KA 1FP3A 1TNBB 1GLMA 4V1SA 1GAHA 4YCRA 1GAIA 2Z07A 1FCEA 3QT3A 3DSSB 2JF4A 2PMVA 1TNUB 1GHQA 2V8IA 2V3NA 3K7XA 3QSPA 3VW5A 4D4DA 4GTRB 3S4BA 1FO3A 2WYNA 3EQAA 4BOKA 1GXOA 3ON6A 4L0GA 3SFYB 1N95B 4CE7A 3E6UA 1FT1B 2QNOA 3KSLB 3M7LA 3QG0A 3M78A 3RX8A 2F0YB 1H3AA 1TNZB 3M77A 3QT9A 1SA4B 1HZFA 1N4QB 4EL8A 2SQCA 5M7IA 3D5SA 3S4AA 4L9PB 2ZISB 3W7XA 5CD2A 4GTMB 2ZIRB 1L1YA 3QXFA 3ANKA 3S4CA 4LNBB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WKF A;  1HCU A;  4J5T A;  3WIQ A;  2VN7 A;  1KRE A;  1NXC A;  4WVC A;  4CJ0 A;  1FO2 A;  1IA6 A;  2VN4 A;  3E73 A;  5CZL A;  2JG0 A;  4DOE A;  5E2J A;  1VD5 A;  2GH4 A;  3ACS A;  4Q2B A;  1DL2 A;  1G9J A;  2EAC A;  3ANI A;  1UT9 A;  2FV1 A;  4Z4J A;  2JJB A;  1G9G A;  2NVP A;  1V5C A;  3S4D A;  2FV0 A;  5M7Y A;  3VXD A;  1K72 A;  1KKT A;  2RGK A;  1H54 A;  5MEH A;  1DOG A;  1ULV A;  2RI9 A;  3RX5 A;  1FAE A;  5CA3 A;  3W7S A;  2FUZ A;  1WZZ A;  2DRO A;  2AHG A;  4AYO A;  1RQ5 A;  2D8L A;  4Z4L A;  4WU0 A;  3QFY A;  1LF6 A;  1KWF A;  4KTP A;  1F9O A;  2A8Z A;  3W7W A;  2DRS A;  3WUX A;  3W7U A;  2XFG A;  1V7V A;  2DRR A;  3QFZ A;  1JS4 A;  4FUS A;  1G87 A;  1GA2 A;  2AFA A;  4AYP A;  1CEM A;  4Q88 A;  4CJ1 A;  3CIH A;  3GT5 A;  5DGR A;  1KSD A;  1FP3 A;  3W5N A;  1GLM A;  3H2W A;  1WU5 A;  1G6I A;  3QXQ A;  1GAH A;  2AHF A;  1XWQ A;  2DRQ A;  4TF4 A;  1H13 A;  2F6D A;  3WKI A;  1LF9 A;  1GAI A;  2FBA A;  4AYQ A;  4DOD A;  2D5J A;  2Z07 A;  1KRF A;  1V7X A;  2GZ6 A;  4KTR A;  2OKX A;  1FCE A;  3RSY A;  3TF4 A;  3QT3 A;  1XW2 A;  3GLY A;  2JF4 A;  1F9D A;  2CQS A;  1X9D A;  4ZH5 A;  3H7L A;  2B4F A;  3QRY A;  3QWT A;  3W7T A;  3QSP A;  1FBW A;  3VW5 A;  1CLC A;  4TXT A;  3H3K A;  3S4B A;  3QPF A;  1KSC A;  1FO3 A;  2WYN A;  3EQA A;  3WKG A;  3ON6 A;  4L0G A;  2ZZR A;  5KKB A;  4JJJ A;  5GW7 A;  1UG9 A;  3T33 A;  3E6U A;  4CE7 A;  4ZG8 A;  4AYR A;  1V7W A;  2QNO A;  1TF4 A;  2RI8 A;  1H12 A;  3GZK A;  1FMI A;  1H14 A;  3QG0 A;  1WU4 A;  4L6X A;  1AYX A;  3RX8 A;  3QDE A;  1IS9 A;  1KFG A;  3WKH A;  3QT9 A;  3W5M A;  3WIR A;  2ZBL A;  3RX7 A;  2EAE A;  2CQT A;  3EZ8 A;  3WIW A;  3K11 A;  4WVB A;  5DGQ A;  1V5D A;  2P0V A;  3REN A;  3D3I A;  2EAD A;  3X17 A;  4EL8 A;  2EAB A;  3ANJ A;  4XUV A;  5GY3 A;  5M7I A;  3S4A A;  3PMM A;  3RRS A;  3A3V A;  3AFJ A;  3W7X A;  1FBO A;  1IA7 A;  1WU6 A;  3WC3 A;  1NC5 A;  3ACT A;  5CD2 A;  1L2A A;  1KS8 A;  1L1Y A;  3QXF A;  1XWT A;  3P2C A;  3ANK A;  1AGM A;  2YIK A;  3S4C A;  4WVA A; 
#chains in the Genus database with same CATH topology
 1TNO B;  1LTX B;  4MMI A;  1J0M A;  2VN7 A;  1NXC A;  1TN8 B;  4GL3 A;  4WVC A;  1N7O A;  4FXG B;  2H6H B;  3E37 B;  4D4B A;  3ANI A;  1G9J A;  2I07 B;  1OJN A;  2E24 A;  2JJB A;  1H35 A;  5ILK A;  3M7E A;  3S4D A;  4FNV A;  3VXD A;  3S9V A;  1N21 A;  5MEH A;  1HMW A;  3RX5 A;  1JCS B;  4KKI A;  2G02 A;  4WU0 A;  4KKJ A;  1LF6 A;  1KWF A;  4KTP A;  1F9O A;  2X03 A;  2J5C A;  2XFG A;  2WIN B;  1V7V A;  2DRR A;  1GSZ A;  1N4S B;  1OJP A;  1CEM A;  3CIH A;  3GT5 A;  5GZK A;  1KSD A;  4GTO B;  3W5N A;  1O1R B;  4OK4 A;  2WII B;  4ZRP A;  2XQW A;  1WU5 A;  2B39 A;  1XWQ A;  4TF4 A;  4AYQ A;  1H13 A;  2F6D A;  4ZRQ A;  1LF9 A;  1N24 A;  4ONT A;  1W6K A;  1V7X A;  1S63 B;  5JPN B;  3GLY A;  1F9D A;  1W3Y A;  3Q7A B;  1I8Q A;  1OJO A;  3PZ4 B;  3H7L A;  3QRY A;  1C3D A;  3EUV B;  4F13 A;  1RWG A;  3SAE A;  3DRA B;  5ILD A;  1D8D B;  2BRV X;  3HXE B;  2PN5 A;  3WKG A;  2ONG A;  2ZZR A;  5IK6 A;  1X1J A;  1V7W A;  1H37 A;  1TF4 A;  1H12 A;  1N1B A;  3GZK A;  2Q1F A;  1WU4 A;  3QDE A;  3SDR A;  3VSN A;  1HV6 A;  3W5M A;  3WIR A;  2ZBL A;  4OZW A;  2CQT A;  1QSJ A;  3PZ1 B;  3K11 A;  1V5D A;  2EAD A;  3Q7F B;  5ILH A;  4XUV A;  3Q79 B;  4C1S A;  2H6F B;  4LNV A;  1NC5 A;  1KS8 A;  1UMP A;  5JMF A;  1HM3 A;  1XWT A;  3G4D A;  1X81 B;  1N23 A;  5JPM B;  4WVA A;  1LD7 B;  1SA5 B;  1LXM A;  1KRE A;  5EAT A;  1FO2 A;  4OK2 A;  2VN4 A;  5CZL A;  5IKA A;  4DOE A;  5E2J A;  3M75 A;  1NI1 B;  2GOX A;  4Q2B A;  3HXB B;  3M00 A;  3E30 B;  2EAC A;  3PZ3 B;  1UT9 A;  2WY7 A;  1LOH A;  3SQC A;  3KLS A;  3Q75 B;  1RW9 A;  5M7Y A;  1KKT A;  2RGK A;  5IM1 A;  3DPY B;  1DOG A;  1ULV A;  2XWJ B;  1EGU A;  3W7S A;  2BRP A;  1WZZ A;  2WDA A;  1MZC B;  2ONH A;  1RQ5 A;  3EU5 B;  4GTQ B;  2A8Z A;  1TN6 B;  4FUS A;  4EHM B;  4CJ1 A;  3OXU A;  1N20 A;  4GTP B;  3DST B;  3CU7 A;  1JCR B;  1G6I A;  3M74 A;  2AHF A;  3WKI A;  1N7N A;  2FBA A;  4DOD A;  2D5J A;  3OED A;  1KRF A;  4KTR A;  2OKX A;  4GTT B;  3RSY A;  3TF4 A;  1N9A B;  1X1H A;  4E1Y A;  3Q73 B;  4MMH A;  2WY8 A;  1J0N A;  3N0F A;  1X9D A;  3KSQ B;  4ZH5 A;  5C05 A;  2B4F A;  4YDE B;  1S64 B;  3W7T A;  2FUT A;  1LD8 B;  1F9G A;  1JCQ B;  3H3K A;  3RJ3 A;  1KSC A;  5GW7 A;  2H6I B;  1UG9 A;  3P5R A;  4ZG8 A;  1O79 A;  4L6X A;  2G0D A;  1FMI A;  1H14 A;  2BED B;  1NL4 B;  1IS9 A;  1KFG A;  3WKH A;  3HXD B;  4OJZ A;  4NEI A;  3RX7 A;  3AFL A;  2EAE A;  3EZ8 A;  3A0O A;  3WIW A;  4WVB A;  1RWF A;  3REN A;  2BB5 A;  3SDQ A;  2EAB A;  5GY3 A;  1H3C A;  4QT9 A;  3RRS A;  3A3V A;  3M02 A;  1FBO A;  1IA7 A;  5IK9 A;  3WC3 A;  4OZV A;  2IEJ B;  3PZ2 B;  3P2C A;  3M76 A;  4FJQ A;  3PYB A;  1W6J A;  1O6Q A;  4GTV B;  3WIQ A;  1IA6 A;  4DI5 A;  1VD5 A;  3NFV A;  1N4P B;  3E34 B;  1DL2 A;  1GXM A;  1HXC A;  1RWC A;  4BOJ A;  1G9G A;  1O5M B;  1V5C A;  3E32 B;  5ILI A;  3M72 A;  1QQF A;  1H54 A;  1SQC A;  5CA3 A;  1FAE A;  1H39 A;  3HXF B;  2AHG A;  4AYO A;  4D4C A;  1O1S B;  4Z4L A;  1N94 B;  1N1Z A;  3W7W A;  2DRS A;  3WUX A;  3M7B A;  4LIX A;  5ILY A;  1JS4 A;  4AYP A;  1R76 A;  3M7C A;  3LZ9 A;  2R2L B;  3SFX B;  3H2W A;  2A73 B;  2BBC A;  5EAU A;  3QXQ A;  3NNB A;  2DRQ A;  4V1R A;  2NOJ A;  3P5P A;  3SDU A;  1KZP B;  3C72 B;  3E33 B;  2GZ6 A;  1O6R A;  1N22 A;  1HM2 A;  1N7P A;  3SDV A;  3KQ4 A;  1XW2 A;  1TNY B;  2CQS A;  4M76 A;  1DCE B;  2V8J A;  4GTS B;  3M71 A;  3QWT A;  2E22 A;  4MBG B;  5FOB B;  1FBW A;  1CLC A;  4TXT A;  2BB6 A;  5IK0 A;  3QPF A;  1FPP B;  1X1I A;  1H3B A;  5KKB A;  3PYA A;  4JJJ A;  3T33 A;  3D5R A;  3DSV B;  3G6J B;  4AYR A;  2RI8 A;  1AYX A;  1N4R B;  5FO9 B;  1QAZ A;  5ILZ A;  5DGQ A;  3E80 A;  1KZO B;  2P0V A;  5FO8 B;  2V3P A;  3D3I A;  1O1T B;  3X17 A;  3SDT A;  3ANJ A;  1H36 A;  3PMM A;  4FXK B;  3AFJ A;  4YDO B;  5DHI A;  1WU6 A;  5DHK A;  3G4F A;  3ACT A;  1L2A A;  3HXC B;  1TN7 B;  3VSM A;  1AGM A;  2YIK A;  5JMD A;  1HXG A;  3WKF A;  1HCU A;  1F1S A;  4J5T A;  4D94 A;  4CJ0 A;  2H6G B;  3E73 A;  2JG0 A;  1OJM A;  2FUQ A;  3M01 A;  1QBQ B;  2GH4 A;  4F10 A;  3ACS A;  2XWB B;  2FV1 A;  4ZH1 A;  1FT2 B;  1C82 A;  5FO7 B;  2BRW A;  4Z4J A;  2NVP A;  3Q78 B;  5AGD A;  4D4A A;  3M73 A;  2FV0 A;  3DSW B;  1K72 A;  2RI9 A;  4MU9 A;  3E7J A;  2FUZ A;  2DRO A;  1GXN A;  3EU8 A;  2D8L A;  4LNG B;  2WCO A;  1O6H A;  3QFY A;  3DSU B;  3W7U A;  3DSX B;  1LXK A;  3QFZ A;  1G87 A;  1GA2 A;  2AFA A;  4Q88 A;  1D8E B;  1N7R A;  5DGR A;  2V8K A;  1FP3 A;  1TNB B;  5EAS A;  1GLM A;  1N7Q A;  1HXA A;  4V1S A;  1GAH A;  4YCR A;  1GAI A;  2Z07 A;  5IL8 A;  1FCE A;  3QT3 A;  3DSS B;  2JF4 A;  2PMV A;  1TNU B;  1GHQ A;  2V8I A;  2V3N A;  3K7X A;  3QSP A;  3VW5 A;  4D4D A;  1HMU A;  4GTR B;  1RWA A;  3N0G A;  1HX9 A;  3S4B A;  1FO3 A;  2WYN A;  3EQA A;  1CB8 A;  1GXO A;  4BOK A;  3ON6 A;  4L0G A;  3SFY B;  1N95 B;  5IL3 A;  1HN0 A;  4CE7 A;  3E6U A;  1FT1 B;  2QNO A;  3KSL B;  3M7L A;  3QG0 A;  3M78 A;  4GAX A;  3RX8 A;  2F0Y B;  1H3A A;  1TNZ B;  3M77 A;  3QT9 A;  5ILJ A;  1SA4 B;  4RNQ A;  1HZF A;  1N4Q B;  4EL8 A;  2SQC A;  5IKH A;  5M7I A;  3D5S A;  3S4A A;  4L9P B;  2ZIS B;  3W7X A;  1RWH A;  5CD2 A;  4GTM B;  2ZIR B;  1L1Y A;  3QXF A;  3ANK A;  3S4C A;  4LNB B; 
#chains in the Genus database with same CATH homology
 1TNO B;  1LTX B;  2VN7 A;  1NXC A;  1TN8 B;  4GL3 A;  4WVC A;  4FXG B;  2H6H B;  3E37 B;  4D4B A;  3ANI A;  1G9J A;  2I07 B;  2JJB A;  1H35 A;  3M7E A;  3S4D A;  3VXD A;  3S9V A;  5MEH A;  3RX5 A;  1JCS B;  4KKI A;  2G02 A;  4WU0 A;  4KKJ A;  1LF6 A;  1KWF A;  4KTP A;  1F9O A;  2XFG A;  2WIN B;  1V7V A;  2DRR A;  1GSZ A;  1N4S B;  1CEM A;  3CIH A;  3GT5 A;  5GZK A;  1KSD A;  4GTO B;  3W5N A;  1O1R B;  2WII B;  4ZRP A;  2XQW A;  1WU5 A;  2B39 A;  1XWQ A;  4TF4 A;  4AYQ A;  1H13 A;  2F6D A;  4ZRQ A;  1LF9 A;  4ONT A;  1W6K A;  1V7X A;  1S63 B;  5JPN B;  3GLY A;  3Q7A B;  1F9D A;  3PZ4 B;  3H7L A;  3QRY A;  1C3D A;  3EUV B;  3SAE A;  3DRA B;  1D8D B;  3HXE B;  2PN5 A;  3WKG A;  2ZZR A;  1V7W A;  1H37 A;  1TF4 A;  3GZK A;  1H12 A;  1WU4 A;  3QDE A;  3SDR A;  3W5M A;  3WIR A;  2ZBL A;  2CQT A;  1QSJ A;  3PZ1 B;  3K11 A;  1V5D A;  2EAD A;  3Q7F B;  4XUV A;  3Q79 B;  4C1S A;  2H6F B;  4LNV A;  1NC5 A;  1KS8 A;  1UMP A;  1XWT A;  1X81 B;  5JPM B;  4WVA A;  1LD7 B;  1SA5 B;  1KRE A;  1FO2 A;  2VN4 A;  5CZL A;  4DOE A;  5E2J A;  3M75 A;  1NI1 B;  2GOX A;  4Q2B A;  3HXB B;  3PZ3 B;  3E30 B;  2EAC A;  1UT9 A;  2WY7 A;  3SQC A;  3KLS A;  3Q75 B;  5M7Y A;  1KKT A;  2RGK A;  3DPY B;  1DOG A;  1ULV A;  2XWJ B;  3W7S A;  1WZZ A;  1MZC B;  1RQ5 A;  3EU5 B;  4GTQ B;  2A8Z A;  1TN6 B;  4FUS A;  4EHM B;  4CJ1 A;  3OXU A;  4GTP B;  3DST B;  3CU7 A;  1JCR B;  1G6I A;  3M74 A;  2AHF A;  3WKI A;  2FBA A;  4DOD A;  2D5J A;  3OED A;  1KRF A;  4KTR A;  2OKX A;  4GTT B;  3RSY A;  3TF4 A;  1N9A B;  3Q73 B;  2WY8 A;  1X9D A;  3KSQ B;  4ZH5 A;  2B4F A;  4YDE B;  1S64 B;  3W7T A;  1LD8 B;  1JCQ B;  3H3K A;  3RJ3 A;  1KSC A;  5GW7 A;  2H6I B;  1UG9 A;  3P5R A;  4ZG8 A;  1O79 A;  4L6X A;  2G0D A;  1FMI A;  1H14 A;  2BED B;  1NL4 B;  1IS9 A;  1KFG A;  3WKH A;  3HXD B;  3RX7 A;  2EAE A;  3EZ8 A;  3WIW A;  4WVB A;  3REN A;  2BB5 A;  3SDQ A;  2EAB A;  5GY3 A;  1H3C A;  4QT9 A;  3RRS A;  3A3V A;  1FBO A;  1IA7 A;  3WC3 A;  2IEJ B;  3PZ2 B;  3P2C A;  3M76 A;  3PYB A;  1W6J A;  1O6Q A;  4GTV B;  3WIQ A;  1IA6 A;  1VD5 A;  1N4P B;  3E34 B;  1DL2 A;  1GXM A;  4BOJ A;  1G9G A;  1O5M B;  1V5C A;  3E32 B;  3M72 A;  1QQF A;  1H54 A;  1SQC A;  5CA3 A;  1FAE A;  1H39 A;  3HXF B;  2AHG A;  4AYO A;  4D4C A;  1O1S B;  4Z4L A;  1N94 B;  3W7W A;  2DRS A;  3WUX A;  3M7B A;  4LIX A;  1JS4 A;  4AYP A;  1R76 A;  3M7C A;  2R2L B;  3SFX B;  3H2W A;  2A73 B;  2BBC A;  3QXQ A;  2DRQ A;  4V1R A;  2NOJ A;  3P5P A;  3SDU A;  1KZP B;  3C72 B;  3E33 B;  2GZ6 A;  1O6R A;  3SDV A;  3KQ4 A;  1XW2 A;  1TNY B;  2CQS A;  4M76 A;  1DCE B;  2V8J A;  4GTS B;  3M71 A;  3QWT A;  4MBG B;  5FOB B;  1FBW A;  1CLC A;  4TXT A;  2BB6 A;  3QPF A;  1FPP B;  1H3B A;  5KKB A;  3PYA A;  4JJJ A;  3T33 A;  3D5R A;  3DSV B;  3G6J B;  4AYR A;  2RI8 A;  1AYX A;  1N4R B;  5FO9 B;  5DGQ A;  1KZO B;  2P0V A;  5FO8 B;  2V3P A;  3D3I A;  1O1T B;  3X17 A;  3SDT A;  3ANJ A;  1H36 A;  3PMM A;  4FXK B;  3AFJ A;  4YDO B;  1WU6 A;  3ACT A;  1L2A A;  3HXC B;  1TN7 B;  1AGM A;  2YIK A;  3WKF A;  1HCU A;  4J5T A;  4D94 A;  4CJ0 A;  2H6G B;  3E73 A;  2JG0 A;  1QBQ B;  2GH4 A;  3ACS A;  2XWB B;  2FV1 A;  4ZH1 A;  1FT2 B;  5FO7 B;  4Z4J A;  2NVP A;  3Q78 B;  5AGD A;  4D4A A;  3M73 A;  2FV0 A;  3DSW B;  1K72 A;  2RI9 A;  4MU9 A;  2FUZ A;  2DRO A;  1GXN A;  3EU8 A;  2D8L A;  4LNG B;  1O6H A;  3QFY A;  3DSU B;  3W7U A;  3DSX B;  3QFZ A;  1G87 A;  1GA2 A;  2AFA A;  4Q88 A;  1D8E B;  5DGR A;  2V8K A;  1FP3 A;  1TNB B;  1GLM A;  4V1S A;  1GAH A;  4YCR A;  1GAI A;  2Z07 A;  1FCE A;  3QT3 A;  3DSS B;  2JF4 A;  2PMV A;  1TNU B;  1GHQ A;  2V8I A;  2V3N A;  3K7X A;  3QSP A;  3VW5 A;  4D4D A;  4GTR B;  3S4B A;  1FO3 A;  2WYN A;  3EQA A;  4BOK A;  1GXO A;  3ON6 A;  4L0G A;  3SFY B;  1N95 B;  4CE7 A;  3E6U A;  1FT1 B;  2QNO A;  3KSL B;  3M7L A;  3QG0 A;  3M78 A;  3RX8 A;  2F0Y B;  1H3A A;  1TNZ B;  3M77 A;  3QT9 A;  1SA4 B;  1HZF A;  1N4Q B;  4EL8 A;  2SQC A;  5M7I A;  3D5S A;  3S4A A;  4L9P B;  2ZIS B;  3W7X A;  5CD2 A;  4GTM B;  2ZIR B;  1L1Y A;  3QXF A;  3ANK A;  3S4C A;  4LNB B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...