3QT9A

Analysis of a new family of widely distributed metal-independent alpha mannosidases provides unique insight into the processing of n-linked glycans, clostridium perfringens cpe0426 complexed with alpha-1,6-linked 1-thio-alpha-mannobiose
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
424
structure length
424
Chain Sequence
LSTNELKEIVRKIGKDLSGKIEDKKLQELFYNCFINTMDTTVEVSEGDAFVITGDIPAMWLRDSTSQVEHYLPFVKEYPELKAIFTGLINRQVKCIFIDPYANAFNKEPNGQKWDNDITKDSPWVWERKYEIDSLCYPVRLIHKYWKESGDETFFNYDIKKAFNMIIDLWRVEQYHREKSDYSFQRLNCSVTDTLSHEGLGTPVTYTGMTWSGFRPSDDACEYGYLIPANMFAVVALRYISEIAEKVYKDEELKEKADSLREEIDNAIEKHGKVYKEGFGEVYAYETDGMGNYNFMDDANVPSLLSIPYLEYKGIEDEVYQNTRKFILSKNNRFFFEGKAAKGIGSPHTPDQYIWHIALSMQGLTTNNQEEIDQLIKLLKETDAGTGYMHEGFHVDDPTKFTRDWFAWSNSLFSHFIYEKVINK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein CPE0426
publication title Analysis of a New Family of Widely Distributed Metal-independent {alpha}-Mannosidases Provides Unique Insight into the Processing of N-Linked Glycans.
pubmed doi rcsb
source organism Clostridium perfringens
molecule tags Hydrolase
total genus 162
structure length 424
sequence length 424
ec nomenclature
pdb deposition date 2011-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06824 Glyco_hydro_125 Metal-independent alpha-mannosidase (GH125)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.10 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 3qt9A01
1GA2A 3QG0A 3RENA 3S4BA 4AYPA 5MEHA 1IA6A 3RSYA 2AFAA 1KKTA 4AYRA 2DRSA 2DROA 3X17A 2QNOA 2JG0A 3WIWA 1WU5A 5GY3A 2OKXA 3ACTA 3W5MA 3WIQA 3E73A 3WKFA 1XW2A 3S4CA 4DODA 4XUVA 3W7SA 3QFYA 1DOGA 4L6XA 2EADA 3P2CA 4Q2BA 2FBAA 1H13A 4L0GA 5CD2A 1FCEA 3H2WA 1CEMA 1G87A 1FBWA 3RX8A 3W7TA 1KREA 4CE7A 1CLCA 4Q88A 3CIHA 2XFGA 1F9OA 4TXTA 1KSDA 5GW7A 3QFZA 3WKGA 4AYQA 1G6IA 1XWTA 1DL2A 5DGRA 1KRFA 3E6UA 1KFGA 3ACSA 2DRQA 4JJJA 1XWQA 2AHFA 1KWFA 1FO3A 5M7YA 3EZ8A 1WZZA 2JF4A 3ANIA 5CA3A 2GH4A 1KSCA 1LF6A 1UT9A 1NC5A 2P0VA 1FP3A 1L2AA 4AYOA 4WVAA 5CZLA 1L1YA 2EABA 3VW5A 4KTRA 1FO2A 3GLYA 2Z07A 1FBOA 2DRRA 3GZKA 3S4DA 3RRSA 3PMMA 2EACA 3D3IA 2NVPA 2VN7A 3QWTA 4WVBA 1ULVA 2GZ6A 3EQAA 1GAIA 4TF4A 3AFJA 3QXFA 3WUXA 3A3VA 1GLMA 3S4AA 1AYXA 3WKHA 2D8LA 3T33A 1V7WA 5DGQA 3QXQA 1FAEA 1FMIA 2F6DA 5KKBA 3H7LA 3VXDA 3WC3A 4FUSA 4J5TA 1F9DA 2CQSA 3QDEA 3W5NA 1LF9A 1KS8A 1V7VA 1V5DA 3H3KA 1V5CA 3W7XA 1H12A 2ZBLA 2EAEA 1G9GA 3ANKA 3QSPA 4CJ1A 3QRYA 2A8ZA 2VN4A 1H54A 2JJBA 4WVCA 1GAHA 1JS4A 3QT9A 2RGKA 2FV0A 2ZZRA 2FV1A 2RI9A 3QPFA 1WU4A 2B4FA 1UG9A 1K72A 2WYNA 5M7IA 2CQTA 4DOEA 4CJ0A 2FUZA 1NXCA 2RI8A 3WKIA 1V7XA 1IA7A 3GT5A 3QT3A 4WU0A 3ANJA 1X9DA 4Z4LA 4ZH5A 4KTPA 1G9JA 1HCUA 1WU6A 3RX7A 2AHGA 3WIRA 5E2JA 3ON6A 3W7UA 4Z4JA 3W7WA 1IS9A 3RX5A 2YIKA 4ZG8A 1RQ5A 1TF4A 1AGMA 1H14A 2D5JA 4EL8A 3K11A 3TF4A 1VD5A
chains in the Genus database with same CATH superfamily
3QG0A 3RENA 3S4BA 3DRAB 2AFAA 2DRSA 2DROA 3DSSB 1O1RB 3RJ3A 1X1JA 5EASA 5GY3A 5IL3A 1N7PA 3WKFA 3S4CA 4XUVA 3QFYA 5IL8A 1HV6A 2WINB 5CD2A 3H2WA 4ONTA 1CEMA 2ONHA 1CLCA 5ILIA 2XFGA 1GHQA 4TXTA 4GL3A 3PZ3B 1XWTA 1N7QA 5EATA 1KRFA 5AGDA 3Q73B 4FJQA 1FT1B 1OJPA 2V3PA 4JJJA 1XWQA 1LTXB 1QAZA 1FO3A 1LOHA 1W6JA 1WZZA 4LNVA 1KSCA 2WIIB 1H36A 1TNYB 1QBQB 1O6RA 2EABA 1N7RA 2H6HB 4GTOB 4ZRPA 3VSMA 3AFLA 2Q1FA 3GZKA 2WY7A 5IKAA 3E7JA 4E1YA 2EACA 3OXUA 3QWTA 2ZISB 4LIXA 1ULVA 3EQAA 1N4SB 2GZ6A 1GAIA 3A0OA 3LZ9A 3AFJA 4QT9A 1GLMA 2V8JA 2PN5A 3T33A 1RWHA 3G4DA 3P5PA 3DSTB 2ZIRB 3DSWB 1H37A 1KZOB 4DI5A 3HXEB 3PZ4B 1FPPB 4J5TA 1F9DA 1N9AB 2CQSA 3W5NA 1LXKA 3SQCA 5ILJA 1RWFA 4GTPB 3P5RA 3M76A 3QRYA 4D4AA 3KSQB 3QT9A 2ZZRA 3QPFA 2X03A 1UG9A 3EU5B 1HXCA 4FXGB 3SFXB 1NL4B 2FUZA 1V7XA 3QT3A 3D5RA 4WU0A 3M02A 3SDUA 1X9DA 3K7XA 4Z4LA 1RWGA 1LD7B 4KTPA 5ILHA 2AHGA 4F13A 2YIKA 1OJMA 3TF4A 3HXDB 2F6DA 1VD5A 1N23A 3Q78B 1QQFA 4MMHA 5FO7B 2E24A 5GZKA 1GXMA 1UMPA 3WIWA 1WU5A 1SQCA 3W5MA 3WIQA 4DODA 1H35A 1N1BA 3P2CA 3M01A 4Q2BA 3E80A 2FBAA 1H13A 3M7CA 3M77A 5ILKA 1TN7B 3W7TA 4CE7A 3CIHA 1KSDA 2H6IB 1KZPB 1MZCB 3QFZA 1TN6B 1DCEB 3N0GA 1DL2A 3EUVB 3M7BA 1O6QA 2DRQA 1KWFA 5EAUA 5M7YA 5ILYA 4M76A 4OZWA 4V1RA 2G02A 1N94B 4GTVB 3VSNA 2WDAA 1HX9A 3M75A 2P0VA 4RNQA 2I07B 1N95B 3VW5A 1FO2A 3D5SA 3E32B 3SDVA 3M72A 5C05A 2NVPA 4WVBA 4GTQB 1F1SA 2E22A 4TF4A 1D8DB 1RWAA 3Q79B 3Q75B 3A3VA 2R2LB 3PZ2B 4FNVA 4ZH1A 2V8KA 3KLSA 3NNBA 1V7WA 4F10A 1HN0A 1JCSB 1TNZB 5KKBA 1O1TB 3HXFB 4FUSA 3M73A 1KS8A 2G0DA 3H3KA 3HXBB 1O6HA 3W7XA 2ZBLA 2EAEA 3ANKA 2GOXA 4WVCA 3M71A 1JCQB 1WU4A 1N1ZA 2WYNA 2XWBB 2CQTA 4DOEA 3CU7A 4ZRQA 3G6JB 4CJ0A 1NXCA 4V1SA 1H39A 1IA7A 3GT5A 4BOJA 5DHIA 1D8EB 4NEIA 1N24A 1NI1B 3N0FA 1G9JA 1WU6A 1N4QB 3M74A 3ON6A 1J0NA 5DHKA 3W7WA 4ZG8A 1TF4A 2D5JA 1W6KA 1GA2A 4AYPA 1X1HA 1N4PB 5JMFA 1KKTA 4AYRA 3HXCB 3X17A 4LNGB 2QNOA 2JG0A 3M7LA 2OKXA 3ACTA 5IK6A 3E73A 1XW2A 4GTSB 3PYBA 3DPYB 1TNBB 4OZVA 4L6XA 2EADA 2H6GB 1O79A 2BRVX 2FUTA 2XQWA 1C82A 1HZFA 5JMDA 2SQCA 1N21A 2V3NA 1N4RB 5GW7A 4AYQA 1G6IA 1S63B 1KFGA 3ACSA 3C72B 2BBCA 2WCOA 2BB6A 1O1SB 4LNBB 5IK9A 2GH4A 1LF6A 4MBGB 4D94A 1UT9A 1O5MB 1NC5A 5ILZA 4WVAA 5CZLA 4GTMB 1X81B 1L1YA 4KTRA 1J0MA 2WY8A 2XWJB 3GLYA 1FBOA 2DRRA 3NFVA 5ILDA 1TNOB 3RRSA 3PMMA 1X1IA 3G4FA 3D3IA 1TN8B 1HMWA 1OJNA 3S4AA 3PYAA 3WKHA 4L9PB 2D8LA 1JCRB 4BOKA 5DGQA 1S64B 3Q7AB 3VXDA 3WC3A 5JPMB 2NOJA 2FUQA 4EHMB 5IK0A 1LF9A 1CB8A 1V7VA 1V5DA 3EU8A 3M00A 1H12A 5IKHA 1G9GA 4MMIA 3QSPA 4CJ1A 2VN4A 1H54A 1EGUA 1HXAA 2FV0A 2FV1A 2B4FA 2BRPA 2BB5A 3SDQA 1H3AA 2H6FB 3PZ1B 4YDEB 3WKIA 1HM2A 2A73B 2IEJB 1HCUA 3RX7A 3WIRA 4D4BA 1RQ5A 1H14A 2BEDB 4D4DA 4D4CA 5MEHA 1IA6A 3RSYA 4YDOB 3E34B 1SA5B 4GTRB 4FXKB 4OK2A 3KSLB 4MU9A 5JPNB 3OEDA 3W7SA 1GSZA 1DOGA 5FO9B 4L0GA 1N22A 1FCEA 1G87A 1FBWA 3RX8A 4KKJA 1RW9A 5FO8B 1KREA 3Q7FB 4Q88A 1F9OA 4GAXA 3WKGA 2J5CA 1I8QA 5DGRA 3E6UA 1W3YA 3E37B 4YCRA 1SA4B 3M78A 3DSVB 2AHFA 3EZ8A 2JF4A 3ANIA 4KKIA 5CA3A 2F0YB 1R76A 1N7OA 1FP3A 1LD8B 1L2AA 4AYOA 1N7NA 3DSUB 2V8IA 4OJZA 2Z07A 3M7EA 4GTTB 3S4DA 1OJOA 2VN7A 1TNUB 5IM1A 1H3BA 1C3DA 3QXFA 3WUXA 1H3CA 4OK4A 1AYXA 3SFYB 3E30B 3SDTA 3QXQA 1FAEA 1FMIA 3H7LA 1F9GA 2BRWA 1GXNA 3QDEA 1LXMA 1V5CA 1QSJA 1FT2B 2A8ZA 2JJBA 4C1SA 1GAHA 1JS4A 2RGKA 2B39A 2RI9A 1RWCA 1K72A 1HM3A 2ONGA 3S9VA 5M7IA 3E33B 2RI8A 1HMUA 3KQ4A 3ANJA 3SDRA 4ZH5A 2PMVA 5FOBB 1GXOA 1N20A 5E2JA 3W7UA 1HXGA 3DSXB 4Z4JA 1IS9A 3RX5A 3SAEA 1AGMA 4EL8A 3K11A
chains in the Genus database with same CATH topology
3QG0A 3RENA 3S4BA 3DRAB 2AFAA 2DRSA 2DROA 3DSSB 1O1RB 3RJ3A 5GY3A 3WKFA 3S4CA 4XUVA 3QFYA 2WINB 5CD2A 3H2WA 4ONTA 1CEMA 1CLCA 2XFGA 1GHQA 4TXTA 4GL3A 3PZ3B 1XWTA 1KRFA 5AGDA 3Q73B 1FT1B 2V3PA 4JJJA 1XWQA 1LTXB 1FO3A 1W6JA 1WZZA 4LNVA 1KSCA 2WIIB 1H36A 1TNYB 1QBQB 1O6RA 2EABA 2H6HB 4GTOB 4ZRPA 3GZKA 2WY7A 2EACA 3OXUA 3QWTA 2ZISB 4LIXA 1ULVA 1N4SB 2GZ6A 3EQAA 1GAIA 4QT9A 3AFJA 1GLMA 2V8JA 2PN5A 3T33A 3P5PA 3DSTB 2ZIRB 3DSWB 1H37A 1KZOB 3HXEB 3PZ4B 1FPPB 4J5TA 1F9DA 1N9AB 2CQSA 3W5NA 3SQCA 4GTPB 3P5RA 3M76A 3QRYA 4D4AA 3QT9A 3KSQB 2ZZRA 3QPFA 1UG9A 3EU5B 4FXGB 3SFXB 1NL4B 2FUZA 1V7XA 3QT3A 3D5RA 4WU0A 3SDUA 1X9DA 3K7XA 4Z4LA 1LD7B 4KTPA 2AHGA 2YIKA 3TF4A 3HXDB 2F6DA 1VD5A 3Q78B 1QQFA 5FO7B 5GZKA 1GXMA 1UMPA 3WIWA 1WU5A 1SQCA 3W5MA 3WIQA 4DODA 1H35A 3P2CA 4Q2BA 2FBAA 1H13A 3M7CA 3M77A 1TN7B 3W7TA 4CE7A 3CIHA 1KSDA 2H6IB 1KZPB 1MZCB 3QFZA 1TN6B 1DCEB 1DL2A 3EUVB 3M7BA 1O6QA 2DRQA 1KWFA 5M7YA 4M76A 4V1RA 2G02A 1N94B 4GTVB 3M75A 2P0VA 2I07B 1N95B 3VW5A 1FO2A 3D5SA 3E32B 3SDVA 3M72A 2NVPA 4WVBA 4GTQB 4TF4A 1D8DB 3Q79B 3Q75B 3A3VA 2R2LB 3PZ2B 4ZH1A 2V8KA 3KLSA 1V7WA 1JCSB 1TNZB 5KKBA 1O1TB 3HXFB 4FUSA 3M73A 1KS8A 2G0DA 3H3KA 3HXBB 1O6HA 3W7XA 2ZBLA 2EAEA 3ANKA 2GOXA 4WVCA 3M71A 1JCQB 1WU4A 2WYNA 2XWBB 2CQTA 4DOEA 3CU7A 4ZRQA 3G6JB 4CJ0A 1NXCA 4V1SA 1H39A 1IA7A 3GT5A 4BOJA 1D8EB 1NI1B 1G9JA 1WU6A 1N4QB 3M74A 3ON6A 3W7WA 4ZG8A 1TF4A 2D5JA 1W6KA 1GA2A 4AYPA 1N4PB 1KKTA 4AYRA 3HXCB 3X17A 4LNGB 2QNOA 2JG0A 3M7LA 2OKXA 3ACTA 3E73A 1XW2A 4GTSB 3PYBA 3DPYB 1TNBB 4L6XA 2EADA 2H6GB 1O79A 2XQWA 1HZFA 2SQCA 2V3NA 1N4RB 5GW7A 4AYQA 1G6IA 1S63B 1KFGA 3ACSA 3C72B 2BBCA 2BB6A 1O1SB 4LNBB 2GH4A 1LF6A 4MBGB 4D94A 1UT9A 1O5MB 1NC5A 4WVAA 5CZLA 4GTMB 1X81B 1L1YA 4KTRA 2WY8A 2XWJB 3GLYA 1FBOA 2DRRA 1TNOB 3RRSA 3PMMA 3D3IA 1TN8B 3S4AA 3PYAA 3WKHA 4L9PB 2D8LA 1JCRB 4BOKA 5DGQA 1S64B 3Q7AB 3VXDA 3WC3A 5JPMB 2NOJA 4EHMB 1LF9A 1V7VA 1V5DA 3EU8A 1H12A 1G9GA 3QSPA 4CJ1A 2VN4A 1H54A 2FV0A 2FV1A 2B4FA 2BB5A 3SDQA 1H3AA 2H6FB 3PZ1B 4YDEB 3WKIA 2A73B 2IEJB 1HCUA 3RX7A 3WIRA 4D4BA 1RQ5A 1H14A 2BEDB 4D4DA 4D4CA 5MEHA 1IA6A 3RSYA 4YDOB 3E34B 1SA5B 4GTRB 4FXKB 3KSLB 4MU9A 5JPNB 3OEDA 3W7SA 1GSZA 1DOGA 5FO9B 4L0GA 1FCEA 1G87A 1FBWA 3RX8A 4KKJA 5FO8B 1KREA 3Q7FB 4Q88A 1F9OA 3WKGA 5DGRA 3E6UA 3E37B 4YCRA 1SA4B 3M78A 3DSVB 2AHFA 3EZ8A 2JF4A 3ANIA 4KKIA 5CA3A 2F0YB 1R76A 1FP3A 1LD8B 1L2AA 4AYOA 3DSUB 2V8IA 2Z07A 3M7EA 4GTTB 3S4DA 2VN7A 1TNUB 1H3BA 1C3DA 3QXFA 3WUXA 1H3CA 1AYXA 3SFYB 3E30B 3SDTA 3QXQA 1FAEA 1FMIA 3H7LA 1GXNA 3QDEA 1V5CA 1QSJA 1FT2B 2A8ZA 2JJBA 4C1SA 1GAHA 1JS4A 2RGKA 2B39A 2RI9A 1K72A 3S9VA 5M7IA 3E33B 2RI8A 3KQ4A 3ANJA 3SDRA 4ZH5A 2PMVA 5FOBB 1GXOA 5E2JA 3W7UA 3DSXB 4Z4JA 1IS9A 3RX5A 3SAEA 1AGMA 4EL8A 3K11A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GA2 A;  3QG0 A;  3REN A;  3S4B A;  4AYP A;  5MEH A;  1IA6 A;  3RSY A;  2AFA A;  1KKT A;  4AYR A;  2DRS A;  2DRO A;  3X17 A;  2QNO A;  2JG0 A;  3WIW A;  1WU5 A;  5GY3 A;  2OKX A;  3ACT A;  3W5M A;  3WIQ A;  3E73 A;  3WKF A;  1XW2 A;  3S4C A;  4DOD A;  4XUV A;  3W7S A;  3QFY A;  1DOG A;  4L6X A;  2EAD A;  3P2C A;  4Q2B A;  2FBA A;  1H13 A;  4L0G A;  5CD2 A;  1FCE A;  3H2W A;  1CEM A;  1G87 A;  1FBW A;  3RX8 A;  3W7T A;  1KRE A;  4CE7 A;  1CLC A;  4Q88 A;  3CIH A;  2XFG A;  1F9O A;  4TXT A;  1KSD A;  5GW7 A;  3QFZ A;  3WKG A;  4AYQ A;  1G6I A;  1XWT A;  1DL2 A;  5DGR A;  1KRF A;  3E6U A;  1KFG A;  3ACS A;  2DRQ A;  4JJJ A;  1XWQ A;  2AHF A;  1KWF A;  1FO3 A;  5M7Y A;  3EZ8 A;  1WZZ A;  2JF4 A;  3ANI A;  5CA3 A;  2GH4 A;  1KSC A;  1LF6 A;  1UT9 A;  1NC5 A;  2P0V A;  1FP3 A;  1L2A A;  4AYO A;  4WVA A;  5CZL A;  1L1Y A;  2EAB A;  3VW5 A;  4KTR A;  1FO2 A;  3GLY A;  2Z07 A;  1FBO A;  2DRR A;  3GZK A;  3S4D A;  3RRS A;  3PMM A;  2EAC A;  3D3I A;  2NVP A;  2VN7 A;  3QWT A;  4WVB A;  1ULV A;  2GZ6 A;  3EQA A;  1GAI A;  4TF4 A;  3AFJ A;  3QXF A;  3WUX A;  3A3V A;  1GLM A;  3S4A A;  1AYX A;  3WKH A;  2D8L A;  3T33 A;  1V7W A;  5DGQ A;  3QXQ A;  1FAE A;  1FMI A;  2F6D A;  5KKB A;  3H7L A;  3VXD A;  3WC3 A;  4FUS A;  4J5T A;  1F9D A;  2CQS A;  3QDE A;  3W5N A;  1LF9 A;  1KS8 A;  1V7V A;  1V5D A;  3H3K A;  1V5C A;  3W7X A;  1H12 A;  2ZBL A;  2EAE A;  1G9G A;  3ANK A;  3QSP A;  4CJ1 A;  3QRY A;  2A8Z A;  2VN4 A;  1H54 A;  2JJB A;  4WVC A;  1GAH A;  1JS4 A;  3QT9 A;  2RGK A;  2FV0 A;  2ZZR A;  2FV1 A;  2RI9 A;  3QPF A;  1WU4 A;  2B4F A;  1UG9 A;  1K72 A;  2WYN A;  5M7I A;  2CQT A;  4DOE A;  4CJ0 A;  2FUZ A;  1NXC A;  2RI8 A;  3WKI A;  1V7X A;  1IA7 A;  3GT5 A;  3QT3 A;  4WU0 A;  3ANJ A;  1X9D A;  4Z4L A;  4ZH5 A;  4KTP A;  1G9J A;  1HCU A;  1WU6 A;  3RX7 A;  2AHG A;  3WIR A;  5E2J A;  3ON6 A;  3W7U A;  4Z4J A;  3W7W A;  1IS9 A;  3RX5 A;  2YIK A;  4ZG8 A;  1RQ5 A;  1TF4 A;  1AGM A;  1H14 A;  2D5J A;  4EL8 A;  3K11 A;  3TF4 A;  1VD5 A; 
#chains in the Genus database with same CATH topology
 3QG0 A;  3REN A;  3S4B A;  3DRA B;  2AFA A;  2DRS A;  2DRO A;  3DSS B;  1O1R B;  3RJ3 A;  1X1J A;  5EAS A;  5GY3 A;  5IL3 A;  1N7P A;  3WKF A;  3S4C A;  4XUV A;  3QFY A;  5IL8 A;  1HV6 A;  2WIN B;  5CD2 A;  3H2W A;  4ONT A;  1CEM A;  2ONH A;  1CLC A;  5ILI A;  2XFG A;  1GHQ A;  4TXT A;  4GL3 A;  3PZ3 B;  1XWT A;  1N7Q A;  5EAT A;  1KRF A;  5AGD A;  3Q73 B;  4FJQ A;  1FT1 B;  1OJP A;  2V3P A;  4JJJ A;  1XWQ A;  1LTX B;  1QAZ A;  1FO3 A;  1LOH A;  1W6J A;  1WZZ A;  4LNV A;  1KSC A;  2WII B;  1H36 A;  1TNY B;  1QBQ B;  1O6R A;  2EAB A;  1N7R A;  2H6H B;  4GTO B;  4ZRP A;  3VSM A;  3AFL A;  2Q1F A;  3GZK A;  2WY7 A;  5IKA A;  3E7J A;  4E1Y A;  2EAC A;  3OXU A;  3QWT A;  2ZIS B;  4LIX A;  1ULV A;  3EQA A;  1N4S B;  2GZ6 A;  1GAI A;  3A0O A;  3LZ9 A;  3AFJ A;  4QT9 A;  1GLM A;  2V8J A;  2PN5 A;  3T33 A;  1RWH A;  3G4D A;  3P5P A;  3DST B;  2ZIR B;  3DSW B;  1H37 A;  1KZO B;  4DI5 A;  3HXE B;  3PZ4 B;  1FPP B;  4J5T A;  1F9D A;  1N9A B;  2CQS A;  3W5N A;  1LXK A;  3SQC A;  5ILJ A;  1RWF A;  4GTP B;  3P5R A;  3M76 A;  3QRY A;  4D4A A;  3KSQ B;  3QT9 A;  2ZZR A;  3QPF A;  2X03 A;  1UG9 A;  3EU5 B;  1HXC A;  4FXG B;  3SFX B;  1NL4 B;  2FUZ A;  1V7X A;  3QT3 A;  3D5R A;  4WU0 A;  3M02 A;  3SDU A;  1X9D A;  3K7X A;  4Z4L A;  1RWG A;  1LD7 B;  4KTP A;  5ILH A;  2AHG A;  4F13 A;  2YIK A;  1OJM A;  3TF4 A;  3HXD B;  2F6D A;  1VD5 A;  1N23 A;  3Q78 B;  1QQF A;  4MMH A;  5FO7 B;  2E24 A;  5GZK A;  1GXM A;  1UMP A;  3WIW A;  1WU5 A;  1SQC A;  3W5M A;  3WIQ A;  4DOD A;  1H35 A;  1N1B A;  3P2C A;  3M01 A;  4Q2B A;  3E80 A;  2FBA A;  1H13 A;  3M7C A;  3M77 A;  5ILK A;  1TN7 B;  3W7T A;  4CE7 A;  3CIH A;  1KSD A;  2H6I B;  1KZP B;  1MZC B;  3QFZ A;  1TN6 B;  1DCE B;  3N0G A;  1DL2 A;  3EUV B;  3M7B A;  1O6Q A;  2DRQ A;  1KWF A;  5EAU A;  5M7Y A;  5ILY A;  4M76 A;  4OZW A;  4V1R A;  2G02 A;  1N94 B;  4GTV B;  3VSN A;  2WDA A;  1HX9 A;  3M75 A;  2P0V A;  4RNQ A;  2I07 B;  1N95 B;  3VW5 A;  1FO2 A;  3D5S A;  3E32 B;  3SDV A;  3M72 A;  5C05 A;  2NVP A;  4WVB A;  4GTQ B;  1F1S A;  2E22 A;  4TF4 A;  1D8D B;  1RWA A;  3Q79 B;  3Q75 B;  3A3V A;  2R2L B;  3PZ2 B;  4FNV A;  4ZH1 A;  2V8K A;  3KLS A;  3NNB A;  1V7W A;  4F10 A;  1HN0 A;  1JCS B;  1TNZ B;  5KKB A;  1O1T B;  3HXF B;  4FUS A;  3M73 A;  1KS8 A;  2G0D A;  3H3K A;  3HXB B;  1O6H A;  3W7X A;  2ZBL A;  2EAE A;  3ANK A;  2GOX A;  4WVC A;  3M71 A;  1JCQ B;  1WU4 A;  1N1Z A;  2WYN A;  2XWB B;  2CQT A;  4DOE A;  3CU7 A;  4ZRQ A;  3G6J B;  4CJ0 A;  1NXC A;  4V1S A;  1H39 A;  1IA7 A;  3GT5 A;  4BOJ A;  5DHI A;  1D8E B;  4NEI A;  1N24 A;  1NI1 B;  3N0F A;  1G9J A;  1WU6 A;  1N4Q B;  3M74 A;  3ON6 A;  1J0N A;  5DHK A;  3W7W A;  4ZG8 A;  1TF4 A;  2D5J A;  1W6K A;  1GA2 A;  4AYP A;  1X1H A;  1N4P B;  5JMF A;  1KKT A;  4AYR A;  3HXC B;  3X17 A;  4LNG B;  2QNO A;  2JG0 A;  3M7L A;  2OKX A;  3ACT A;  5IK6 A;  3E73 A;  1XW2 A;  4GTS B;  3PYB A;  3DPY B;  1TNB B;  4OZV A;  4L6X A;  2EAD A;  2H6G B;  1O79 A;  2BRV X;  2FUT A;  2XQW A;  1C82 A;  1HZF A;  5JMD A;  2SQC A;  1N21 A;  2V3N A;  1N4R B;  5GW7 A;  4AYQ A;  1G6I A;  1S63 B;  1KFG A;  3ACS A;  3C72 B;  2BBC A;  2WCO A;  2BB6 A;  1O1S B;  4LNB B;  5IK9 A;  2GH4 A;  1LF6 A;  4MBG B;  4D94 A;  1UT9 A;  1O5M B;  1NC5 A;  5ILZ A;  4WVA A;  5CZL A;  4GTM B;  1X81 B;  1L1Y A;  4KTR A;  1J0M A;  2WY8 A;  2XWJ B;  3GLY A;  1FBO A;  2DRR A;  3NFV A;  5ILD A;  1TNO B;  3RRS A;  3PMM A;  1X1I A;  3G4F A;  3D3I A;  1TN8 B;  1HMW A;  1OJN A;  3S4A A;  3PYA A;  3WKH A;  4L9P B;  2D8L A;  1JCR B;  4BOK A;  5DGQ A;  1S64 B;  3Q7A B;  3VXD A;  3WC3 A;  5JPM B;  2NOJ A;  2FUQ A;  4EHM B;  5IK0 A;  1LF9 A;  1CB8 A;  1V7V A;  1V5D A;  3EU8 A;  3M00 A;  1H12 A;  5IKH A;  1G9G A;  4MMI A;  3QSP A;  4CJ1 A;  2VN4 A;  1H54 A;  1EGU A;  1HXA A;  2FV0 A;  2FV1 A;  2B4F A;  2BRP A;  2BB5 A;  3SDQ A;  1H3A A;  2H6F B;  3PZ1 B;  4YDE B;  3WKI A;  1HM2 A;  2A73 B;  2IEJ B;  1HCU A;  3RX7 A;  3WIR A;  4D4B A;  1RQ5 A;  1H14 A;  2BED B;  4D4D A;  4D4C A;  5MEH A;  1IA6 A;  3RSY A;  4YDO B;  3E34 B;  1SA5 B;  4GTR B;  4FXK B;  4OK2 A;  3KSL B;  4MU9 A;  5JPN B;  3OED A;  3W7S A;  1GSZ A;  1DOG A;  5FO9 B;  4L0G A;  1N22 A;  1FCE A;  1G87 A;  1FBW A;  3RX8 A;  4KKJ A;  1RW9 A;  5FO8 B;  1KRE A;  3Q7F B;  4Q88 A;  1F9O A;  4GAX A;  3WKG A;  2J5C A;  1I8Q A;  5DGR A;  3E6U A;  1W3Y A;  3E37 B;  4YCR A;  1SA4 B;  3M78 A;  3DSV B;  2AHF A;  3EZ8 A;  2JF4 A;  3ANI A;  4KKI A;  5CA3 A;  2F0Y B;  1R76 A;  1N7O A;  1FP3 A;  1LD8 B;  1L2A A;  4AYO A;  1N7N A;  3DSU B;  2V8I A;  4OJZ A;  2Z07 A;  3M7E A;  4GTT B;  3S4D A;  1OJO A;  2VN7 A;  1TNU B;  5IM1 A;  1H3B A;  1C3D A;  3QXF A;  3WUX A;  1H3C A;  4OK4 A;  1AYX A;  3SFY B;  3E30 B;  3SDT A;  3QXQ A;  1FAE A;  1FMI A;  3H7L A;  1F9G A;  2BRW A;  1GXN A;  3QDE A;  1LXM A;  1V5C A;  1QSJ A;  1FT2 B;  2A8Z A;  2JJB A;  4C1S A;  1GAH A;  1JS4 A;  2RGK A;  2B39 A;  2RI9 A;  1RWC A;  1K72 A;  1HM3 A;  2ONG A;  3S9V A;  5M7I A;  3E33 B;  2RI8 A;  1HMU A;  3KQ4 A;  3ANJ A;  3SDR A;  4ZH5 A;  2PMV A;  5FOB B;  1GXO A;  1N20 A;  5E2J A;  3W7U A;  1HXG A;  3DSX B;  4Z4J A;  1IS9 A;  3RX5 A;  3SAE A;  1AGM A;  4EL8 A;  3K11 A; 
#chains in the Genus database with same CATH homology
 3QG0 A;  3REN A;  3S4B A;  3DRA B;  2AFA A;  2DRS A;  2DRO A;  3DSS B;  1O1R B;  3RJ3 A;  5GY3 A;  3WKF A;  3S4C A;  4XUV A;  3QFY A;  2WIN B;  5CD2 A;  3H2W A;  4ONT A;  1CEM A;  1CLC A;  2XFG A;  1GHQ A;  4TXT A;  4GL3 A;  3PZ3 B;  1XWT A;  1KRF A;  5AGD A;  3Q73 B;  1FT1 B;  2V3P A;  4JJJ A;  1XWQ A;  1LTX B;  1FO3 A;  1W6J A;  1WZZ A;  4LNV A;  1KSC A;  2WII B;  1H36 A;  1TNY B;  1QBQ B;  1O6R A;  2EAB A;  2H6H B;  4GTO B;  4ZRP A;  3GZK A;  2WY7 A;  2EAC A;  3OXU A;  3QWT A;  2ZIS B;  4LIX A;  1ULV A;  1N4S B;  2GZ6 A;  3EQA A;  1GAI A;  4QT9 A;  3AFJ A;  1GLM A;  2V8J A;  2PN5 A;  3T33 A;  3P5P A;  3DST B;  2ZIR B;  3DSW B;  1H37 A;  1KZO B;  3HXE B;  3PZ4 B;  1FPP B;  4J5T A;  1F9D A;  1N9A B;  2CQS A;  3W5N A;  3SQC A;  4GTP B;  3P5R A;  3M76 A;  3QRY A;  4D4A A;  3QT9 A;  3KSQ B;  2ZZR A;  3QPF A;  1UG9 A;  3EU5 B;  4FXG B;  3SFX B;  1NL4 B;  2FUZ A;  1V7X A;  3QT3 A;  3D5R A;  4WU0 A;  3SDU A;  1X9D A;  3K7X A;  4Z4L A;  1LD7 B;  4KTP A;  2AHG A;  2YIK A;  3TF4 A;  3HXD B;  2F6D A;  1VD5 A;  3Q78 B;  1QQF A;  5FO7 B;  5GZK A;  1GXM A;  1UMP A;  3WIW A;  1WU5 A;  1SQC A;  3W5M A;  3WIQ A;  4DOD A;  1H35 A;  3P2C A;  4Q2B A;  2FBA A;  1H13 A;  3M7C A;  3M77 A;  1TN7 B;  3W7T A;  4CE7 A;  3CIH A;  1KSD A;  2H6I B;  1KZP B;  1MZC B;  3QFZ A;  1TN6 B;  1DCE B;  1DL2 A;  3EUV B;  3M7B A;  1O6Q A;  2DRQ A;  1KWF A;  5M7Y A;  4M76 A;  4V1R A;  2G02 A;  1N94 B;  4GTV B;  3M75 A;  2P0V A;  2I07 B;  1N95 B;  3VW5 A;  1FO2 A;  3D5S A;  3E32 B;  3SDV A;  3M72 A;  2NVP A;  4WVB A;  4GTQ B;  4TF4 A;  1D8D B;  3Q79 B;  3Q75 B;  3A3V A;  2R2L B;  3PZ2 B;  4ZH1 A;  2V8K A;  3KLS A;  1V7W A;  1JCS B;  1TNZ B;  5KKB A;  1O1T B;  3HXF B;  4FUS A;  3M73 A;  1KS8 A;  2G0D A;  3H3K A;  3HXB B;  1O6H A;  3W7X A;  2ZBL A;  2EAE A;  3ANK A;  2GOX A;  4WVC A;  3M71 A;  1JCQ B;  1WU4 A;  2WYN A;  2XWB B;  2CQT A;  4DOE A;  3CU7 A;  4ZRQ A;  3G6J B;  4CJ0 A;  1NXC A;  4V1S A;  1H39 A;  1IA7 A;  3GT5 A;  4BOJ A;  1D8E B;  1NI1 B;  1G9J A;  1WU6 A;  1N4Q B;  3M74 A;  3ON6 A;  3W7W A;  4ZG8 A;  1TF4 A;  2D5J A;  1W6K A;  1GA2 A;  4AYP A;  1N4P B;  1KKT A;  4AYR A;  3HXC B;  3X17 A;  4LNG B;  2QNO A;  2JG0 A;  3M7L A;  2OKX A;  3ACT A;  3E73 A;  1XW2 A;  4GTS B;  3PYB A;  3DPY B;  1TNB B;  4L6X A;  2EAD A;  2H6G B;  1O79 A;  2XQW A;  1HZF A;  2SQC A;  2V3N A;  1N4R B;  5GW7 A;  4AYQ A;  1G6I A;  1S63 B;  1KFG A;  3ACS A;  3C72 B;  2BBC A;  2BB6 A;  1O1S B;  4LNB B;  2GH4 A;  1LF6 A;  4MBG B;  4D94 A;  1UT9 A;  1O5M B;  1NC5 A;  4WVA A;  5CZL A;  4GTM B;  1X81 B;  1L1Y A;  4KTR A;  2WY8 A;  2XWJ B;  3GLY A;  1FBO A;  2DRR A;  1TNO B;  3RRS A;  3PMM A;  3D3I A;  1TN8 B;  3S4A A;  3PYA A;  3WKH A;  4L9P B;  2D8L A;  1JCR B;  4BOK A;  5DGQ A;  1S64 B;  3Q7A B;  3VXD A;  3WC3 A;  5JPM B;  2NOJ A;  4EHM B;  1LF9 A;  1V7V A;  1V5D A;  3EU8 A;  1H12 A;  1G9G A;  3QSP A;  4CJ1 A;  2VN4 A;  1H54 A;  2FV0 A;  2FV1 A;  2B4F A;  2BB5 A;  3SDQ A;  1H3A A;  2H6F B;  3PZ1 B;  4YDE B;  3WKI A;  2A73 B;  2IEJ B;  1HCU A;  3RX7 A;  3WIR A;  4D4B A;  1RQ5 A;  1H14 A;  2BED B;  4D4D A;  4D4C A;  5MEH A;  1IA6 A;  3RSY A;  4YDO B;  3E34 B;  1SA5 B;  4GTR B;  4FXK B;  3KSL B;  4MU9 A;  5JPN B;  3OED A;  3W7S A;  1GSZ A;  1DOG A;  5FO9 B;  4L0G A;  1FCE A;  1G87 A;  1FBW A;  3RX8 A;  4KKJ A;  5FO8 B;  1KRE A;  3Q7F B;  4Q88 A;  1F9O A;  3WKG A;  5DGR A;  3E6U A;  3E37 B;  4YCR A;  1SA4 B;  3M78 A;  3DSV B;  2AHF A;  3EZ8 A;  2JF4 A;  3ANI A;  4KKI A;  5CA3 A;  2F0Y B;  1R76 A;  1FP3 A;  1LD8 B;  1L2A A;  4AYO A;  3DSU B;  2V8I A;  2Z07 A;  3M7E A;  4GTT B;  3S4D A;  2VN7 A;  1TNU B;  1H3B A;  1C3D A;  3QXF A;  3WUX A;  1H3C A;  1AYX A;  3SFY B;  3E30 B;  3SDT A;  3QXQ A;  1FAE A;  1FMI A;  3H7L A;  1GXN A;  3QDE A;  1V5C A;  1QSJ A;  1FT2 B;  2A8Z A;  2JJB A;  4C1S A;  1GAH A;  1JS4 A;  2RGK A;  2B39 A;  2RI9 A;  1K72 A;  3S9V A;  5M7I A;  3E33 B;  2RI8 A;  3KQ4 A;  3ANJ A;  3SDR A;  4ZH5 A;  2PMV A;  5FOB B;  1GXO A;  5E2J A;  3W7U A;  3DSX B;  4Z4J A;  1IS9 A;  3RX5 A;  3SAE A;  1AGM A;  4EL8 A;  3K11 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...