3QTBA

Structure of the universal stress protein from archaeoglobus fulgidus in complex with damp
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
134
structure length
125
Chain Sequence
MIYMPIVVAVDKKSDRAERVLRFAAEEARLRGVPVYVVHSLPGGGRTKDEDIIEAKETLSWAVSIIRKEGAEGEEHLLVRGKEPPDDIVDFADEVDAIAIVIGIRFGSVARDVILKANKPVICIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Structural and functional insight into the universal stress protein family.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Structural genomics, unknown function
total genus 44
structure length 125
sequence length 134
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00582 Usp Universal stress protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3qtbA00
2ZP1A 1M8PA 1EE1A 1GLNA 1OWNA 4E1AA 1JGTA 3CR8A 1H3FA 2JAXA 2ZUEA 4U7JA 4JFAA 4MULA 3RHSA 4ZCTA 3MUEA 2B7LA 4MUGA 2PZAA 1F7VA 4K0RA 1H3NA 1N2EA 1O5TA 2AZXA 4CDNA 3CVVA 1O94C 3IMEA 4UZEA 1B6TA 5DK4A 2QJOA 2HGZA 2CYCA 2CV2A 3OP1A 2CYAA 5J5AA 3GUZA 4KR7A 2PFSA 3HMQA 5H7XA 4MAFA 3COWA 3FH0A 1EXDA 1O94D 4MW1A 4KPUB 4ZCPA 2GOYA 1M83A 3CLTC 1KP3A 4MUNA 2O8VA 4QRDA 2PG3A 3SEZA 1G8GA 1WXHA 3SZGA 4EF6A 3ZUGA 1RQGA 1F9AA 4I6GA 1J1UA 2Z09A 4MUEA 2DUMA 3A04A 1NUPA 3ELBA 1XNJA 4ZT2A 1M8FA 3CLTD 2A88A 3QTBA 4UZFA 3SYTA 1J70A 3IUEA 1J20A 4KPUA 3ZJTA 3IVCA 1QRUA 4NZPA 1M8KA 2AKEA 4KR6A 1YIDA 1XJQA 2X0KA 3TZLA 5KWVA 4EG3A 3CVWA 4YMIA 1MC1A 1Q77A 1IHOA 4G6ZA 3UOWA 3FOCA 1MB9A 4MVWA 4TS1A 5FO1A 1QU2A 1XNHA 2DLCX 3E27A 1OWPA 1OD6A 1IQUA 1WKBA 3DLAA 1QU3A 3N8HA 2O5RA 3GMIA 1VBNA 1IVSA 2E18A 3U1VA 2WQ7A 2I1LA 4KR9A 3N9IA 4ND7A 2WSIA 3K32A 4YP7A 1J1ZA 1T6XA 3SP1A 3UC5A 4R2MA 1O95C 1OWOA 1PFWA 3H05A 4MWBA 1PFVA 3NBAA 3ZJUA 3CLRC 3PRHA 3H9CA 4ZCSA 2Z08A 2RE8A 1O95D 5HUJA 3UY4A 4NAHA 1PFYA 2X1LA 2CUZA 3QE4A 1H1TA 2J5BA 3INNA 2A7XA 3CLRD 3AL0C 3FG9A 4JXXA 2X1MA 4MW9A 1QRTA 1OWLA 4QBTA 4WNYA 1NYLA 3DV2A 1PFUA 3P52A 5BNZA 1OBCA 3F3MA 4ND6A 1N75A 4MQ6A 2OV4A 4K03A 4MW0A 1YUNA 1MOPA 4CQNA 2V0CA 4JXZA 1JMVA 2E89A 2OQ2A 1V47A 1YULA 2VXOA 3AIIA 2CSXA 1GPMA 5TEVA 4X0EA 3LE8A 5HG0A 3A4IA 2JANA 4L2IB 3L92A 1Q19A 1G8HA 3IVGA 2DPLA 3CA8A 1IFXA 1JIJA 1JZSA 5EKDA 3S3TA 2YWCA 1NP7A 1R6UA 1JILA 1F4LA 4MLPA 2IJGX 3AFHA 1WZ2A 2J4DA 1YUMA 2QUJA 1P7PA 1FFYA 2A1TS 3KT6A 2PIDA 1QRSA 4Q16A 2PZ8A 1EFVB 5K0TA 4L2IA 1X8XA 1IRXA 4FZJA 4EG5A 1VBKA 1YIAA 1VBMA 3RBAA 1KQNA 1M8JA 1OWMA 3AG5A 1CT9A 4G5FA 3CVXA 3MXTA 4OJMX 3K9WA 3G6KA 4J76A 1EFVA 3H99A 1NUUA 3IMCA 3IUBA 3P0HA 1WQ4A 3I05A 2WQ6A 1M1ZA 1A8HA 5FNZA 3ISJA 4HJRA 3A05A 1J09A 3HV0A 1M8GA 2Z3VA 3SZ3A 5KHAA 4DDMA 3RFFA 2BTEA 1EUYA 2IP1A 1ZUNA 2J09A 4ARIA 4G5YA 2QUKA 2A1TR 3X1KA 2J08A 2D54A 3HZRA 3MLBA 1FYDA 1U7XA 4MW5A 2R5WA 3ZXSA 1LW7A 4PBRA 2DXIA 2CFOA 3IOEA 4U8HA 3SDBA 3H97A 3TZEA 5J58A 4ZT4A 2QUHA 2TS1A 1WXEA 4P2BA 1G59A 3A2KA 4XSVA 4NAUA 3COZA 4I6EA 1NUQA 1ZH0A 2IELA 2C5SA 5TGTA 3N2YA 3ZIUA 4ZCQA 3H9BA 2GM3A 4F3RA 3NBKA 2A4MA 5JBNA 2H2AA 3HGMA 1TQ8A 2VTBB 2CT8A 3IH5A 1N2HA 3FY4A 1YI8A 3CLUC 4EG8A 3Q10A 1DNPA 2G36A 1UFVA 2YXNA 3COYA 4RPIA 1JZQA 1IQ0A 4NATA 1QTQA 2A1UB 1GZUA 5FO0A 5F23A 1KAQA 3KT8A 1N2IA 2RD2A 1K92A 1WXGA 3CLUD 4NDAA 5J59A 4DNXA 3PNYA 4DJAA 3ND7A 4WSOA 3ILVA 4PY2A 1MJHA 4MW2A 4XFDA 3UMVA 1S4MA 1QNFA 2A1UA 2XRYA 1NUSA 4YBRA 3MMXA 3HL4A 3PXUA 1LI5A 4MUHA 4MUJA 2QUIA 4XFJA 5LLTA 1O97C 3ZJVA 1N2GA 3SEQA 1F7UA 2YY5A 4H3SA 1U3CA 3KT3A 2DETA 1O0BA 1O97D 2CYBA 1D2RA 5H16A 1TFUA 3GLVA 4QREA 3Q4GA 3BL5A 1PG0A 1MBZA 1BS2A 4MVYA 3P0IA 4ZT5A 3HFJA 3JXEA 1KAMA 3FWKA 4PBTA 1EFPB 1TEZA 3CVYA 1GTSA 3G5AA 3TQIA 5DEOA 1GN8A 2D5BA 1MAWA 3FHJA 4R0NA 1KH3A 1IH8A 1XNGA 4JZYA 1ULHA 1I2DA 3AG6A 5LM3A 3FNRA 2CV0A 1Y42X 5DB4A 3FIUA 1ZH6A 1COZA 3ND5A 3AKZA 1EFPA 2DR2A 1GTRA 2X3FA 3LOQA 4CDMA 1NZJA 1KKUA 1V8FA 3VRHA 2QTRA 5HUHA 4EG4A 2QJTA 4JYZA 1KQOA 4MWEA 2ZUFA 3UK2A 3CVUA 1WXIA 3CLSC 3FETA 1N77A 1LI7A 3PNBA 2H29A 4ARCA 4R2LA 1N1DA 3D6VA 4EG7A 1U0BB 3IODA 1T9GR 1KP2A 3IOCA 1TYDE 1R6TA 4DE5A 1NSYA 3ZXIA 1WJGA 1JECA 3CLSD 1X6VA 4EFKA 2DEUA 4MVCA 2NZ2A 3D6UA 2EJCA 3N05A 1WQ3A 2DERA 4EG1A 4GU5A 1NURA 1TYAE 2A86A 3M5WA 1I6LA 3VU8A 2HMAA 3OTWA 1VLHA 1JIIA 3IOBA 1TYBE 4CT0A 4MUKA 4DDKA 1MAUA 1SURA 3DPIA 5KCMA 4BWVA 1N78A 2XRZA 1JIKA 3DO8A 4MW7A 3Q12A 2E21A 1J21A 2PXHA 4OUDB 4MWCA 4U63A 4AQ7A 1K4KA 1G8FA 3FI0A 4YP6A 1JEEA 4ZT7A 5IJXA 1R6XA 2E0IA 3IMGA 2CV1A 3IVXA 1N3LA 1N2JA 4MUIA 1IQRA 4OUDA 4MWDA 2AG6A 1WOYA 1I6KA 3PNVA 1K97A 4HK4A 1O0CA 3ND6A 3QTTA 4J75A 1T6ZA 1WXFA 3TNJA 3COVA 4F4HA 5AHWA 1QQTA 1ILEA 3LCJA 4NX2A 1EJ2A 1U7DA 1KR2A 2VTBA 3C8ZA 5IHXA 3RK1A 1ZJWA 3G59A 2WB2A 1H3EA 1JHDA 1NUTA 1Q11A 5TEWA 4YP5A 1MRZA 1I6MA 1NI5A 3L93A 4GRIA 4ZT3A 4S1OA 4RUKA 2D13A 2JA2A 1MB2A 4DDHA 4I6JA 1O6BA 1U3DA 1OBHA 3KT0A 5LFAA 4A91A 3P0JA 3RK0A 4HPWA 1KQPA 2QTNA 1KH2A 2HZ7A 4ZCRA 4MVXA 3TQOA 3RJZA 2BYTA 5DASA 3FDXA 1O96B 1N2OA 3X1MA 4MW4A 4DLPA 1T9GS 4MW6A 2NSYA 2V0GA 3TS1A 4MUFA 4AS1A 1VL2A 1KH1A 2J07A 1TYCA 1GAXA 2PZBA 3NV7A 1PG2A 1K4MA 4KKVA 4EG6A 1O96A 2YWBA 3IDFA 2QTMA 3VGJA 3ZGZA 1KORA 1Q15A 2QJFA 5K0SA 1QJCA 1N2BA 2GKSA 1WY5A 1HYBA 2A84A 3MLAA 5TS2A 4ZT6A 3X1JA 4HJXA 4EGAA 4Q93A 3KFLA 1T6YA 2EL7A 4PBSA 1EUQA 1JEDA
chains in the Genus database with same CATH superfamily
4A6EA 2KWIA 4LISA 4MPPA 1YIOA 4UHBA 3VZCA 2XMRA 4IDHA 3P9QA 1PR5A 2YIDA 4GKVA 5DBOA 3QMPA 3TNLA 1UDRA 4BQIA 1JA1A 5LD2C 3ADKA 1H3FA 3K35A 4L3OA 5C1IA 3W5IA 2VNSA 3MSCA 2JFNA 4EA8A 2ODPA 3KVNA 1TB4A 1FDVA 2G1KA 4AJKA 4CR8A 1FFSA 2XA9A 2OAQ1 2RI0A 3K09C 3TTWA 5K7SA 2MR6A 4R0VA 4FNMA 3QXHA 3SSNA 4R1LA 4OHKA 4R98A 1O5TA 2P4QA 1FXUA 2W37A 4UPVA 4WL0A 1LVGA 1RJWA 2FZVA 3OZFA 3AIMA 1FFGA 4IIJA 4YLGA 4B3DA 2W70A 3HMKA 1IXZA 1OQAA 1Q0QA 3JQ9C 1XWWA 3AYXB 2W11A 4CV1A 2RGGA 5C53B 3K71B 5FBKA 1WS6A 4XJSA 2O7SA 1AKQA 1KKMA 1A9YA 2RCNA 4FOSA 1QDUA 1G5IA 1XHFA 2ZYRA 1QE0A 1PI3A 3CFYA 3EHEA 4Y8VA 3WICA 1PLKA 2F9MA 2ZKIA 3RSOA 4PPGA 3L18A 5KX5B 4HEHA 3CLTC 4BO0A 2PO5A 4OQDA 2I3BA 5KOHB 4ZCLA 1A5BB 1MQAA 1DC5A 1UBRS 1ZSNA 2EXXA 1Z4LA 1CDZA 2QAGC 1W25A 9ABPA 3ZD6A 4PXSA 2DYKA 4COKA 4YLEA 3T5TA 3GAMA 3KD3A 3QTBA 2D1FA 4JUIA 4IS3A 5GV8A 3KEQA 4C0KA 4EY3A 5EOVA 2ZRIA 2C4WA 3DFUA 3TOXA 4BX8A 1M8KA 3CYFA 1GU0A 3CKKA 4XB1A 4BMVA 4B6RA 2YDXA 5L6LB 3EVTA 3TE6A 2XPCA 1QHHB 4MVJD 4NCKA 4BLVA 1KZ1A 4G9GA 5TQVA 1K6EA 3G82C 1OMOA 3NIFB 4G67A 3EVBA 3QPVA 1YK0A 2YVLA 2I03A 4BGUA 2OBYA 2BMWA 4FFOA 1WTCA 5E8JA 2QDKA 1JTEA 1AVTA 1NVWQ 3MWKA 1F9EA 3NHSA 1NF2A 4IVNA 5I3CA 2WAMA 2EG9A 4ND4A 1PBNA 1O77A 1OSNA 1D8TA 3EQ8A 5CX1B 5EIOA 3UWKA 1GTZA 2O1EA 4JIMA 3CUWA 4BXOB 1QU3A 3IQHX 5DNEA 3GA5A 1E2KA 1EWQA 4JK3A 4R9SA 2PMEA 4BV2A 5KCZA 3C3AA 2PGLA 1LBIA 3FNEA 3JVUA 3BFPA 1XO1A 3GGCA 3S0JA 1X77A 5HCUA 1KRWA 5KX5F 3FCYA 3L8ZA 2J7PA 4Y9UA 1KWKA 1KVSA 2X8JA 3ZWCA 3O8QB 2XXAA 2FPRA 2XBLA 1ORRA 2XI4A 2FP4B 3IJEB 2WJPA 1HF3A 1PQWA 3HA3A 3CZPA 3HH8A 1WF3A 1JWBB 2RK4A 2W0SA 9LDTA 3IHKA 2RE8A 4EGFA 5HUJA 2FWIA 1EDOA 2CJYA 2OBMA 4BNUA 1CETA 4EFLA 1H1TA 3VDXA 1RZRD 3R1IA 2J5BA 2VSFA 2Q29A 4M1YA 4C0JA 4YRTA 2CFCA 2B2XA 1S8FA 1U7HA 2FPMA 2B94A 4BC0A 3PQ7A 4PHTA 1H5NA 1UMCA 3KDSE 1V0JA 3IXQA 3OAAD 5ICEA 4XWWA 1P2UA 3F3MA 1IPEA 1GOTA 3GRFA 4KK4A 1KO7A 4P54A 1RAHA 3BFJA 5K03A 5LN1A 1ZA2A 2NVBA 4BKRA 2IZZA 2DFLA 1EUDA 2D5AA 2GJ8A 1NQUA 3DTYA 3I5YA 4ZU6X 4NZYA 3QXSA 3P9PA 1Z15A 1NW7A 1N5OX 2IZOA 2EZ9A 2KE5A 3G5UA 2CLMB 1HI9A 3ZDFA 1Q7RA 2VTKA 4AM8A 1J0DA 3L0BA 4CLRA 4JLPA 4W9RA 3GI1A 4M86A 5CHYA 5ALZA 3T34A 3LE8A 2PD3A 5GV7A 1TCAA 4V2UA 3RT9A 3UHFA 1NKTA 2YQ4A 4UXHA 3O8NA 2XTNA 1GG9A 1LQUA 4I1YA 3PHCA 3K70D 2IYAA 2W2VA 3FRHA 3HYNA 4LPKA 4PRLA 4CKCA 1DMRA 1AURA 1LDNA 5A62A 1K66A 4O1IA 3NAMA 2XRMA 4RV4A 3B1XA 4AQYB 2ZW9A 1P5HA 5GMOA 5IWAB 1TQ4A 1JYFA 2FX3A 2WUGA 1NLFA 4AZWA 1BU5A 4GX0A 5J1TB 5K0GA 2QL5A 3DAFA 1DIGA 1MVNA 1CY2A 5C37A 4GX5A 3HRKA 2ZAIA 1OXUA 2CF5A 4PZYA 4R51A 4A8JA 4F04A 4FZJA 1NJSA 4YMGA 4WNIA 5A3VA 3MXOA 1I4LD 2J9FA 2XITA 3BBLA 3TTVA 3ZHXA 3DCYA 3HS3A 1SZJG 2GJ4A 2VPWA 5BVHA 3UTDA 4YAEA 2BI7A 4QM7A 4MO2A 4HTAA 4MEBA 2XLBA 3UMMA 4MUBA 2K2WA 3LQ1A 3HUTA 2YFQA 2A59A 3SYKA 3THOA 2YS6A 3P94A 5KSPA 1CQIB 3TG2A 1G7SA 1ZAKA 1KZ9A 5EMHA 1M1ZA 5BO5A 5F3DA 2LV8A 3WLJA 2I6GA 1KI2A 3BD8A 1S7GA 2Z58A 2IYFA 3IA2A 4QOFA 3W06A 2BDTA 5DM4A 1VPTA 1WIWA 3VYSB 2WSSA 3E53A 4OV6B 4R1UA 3M1IA 1G19A 1HQDA 1W85B 1JDBC 2NUPA 2QRQA 1WZUA 4GPEA 1Y1TA 3HVIA 4A10A 4NCIA 1JNXX 1C1XB 2BGNA 4Q3LA 1DO2A 1OLUB 2FEPA 5CGZA 3UK7A 2O2JA 4KFRA 5C32A 9GPBA 1JXMA 3F96A 4G5YA 3HRIA 2QENA 1A7KA 4TSFD 5K6AA 2E3JA 1QV6A 2I1VB 4JJGA 2R2GA 5AIAA 3M6XA 1QUFA 3KSDO 4PONA 4TX1A 3SBDA 1L1RA 2PVPA 5MFPA 1YBAA 2CFOA 2R6HA 3OZEA 1C3OB 1JKIA 3ET4A 2CB9A 2WM2A 2ZRDA 1Q2UA 4FQ7A 4O2AB 3LBHA 4ZAXA 4UVEA 5JCOA 5GZ1A 2R7KA 3GJ4A 3AVWA 3FF4A 3I64A 3WNZA 2Q2WA 1WPXA 1D2MA 4FU0A 5ALXA 1RLMA 3L6BA 1DX9A 4NNPA 2FN7A 3GPDG 4KR2A 5HCNA 3LYLA 1T5HX 4AB1A 2GTHA 2GM3A 2JCSA 3T06B 3ZH9B 1J4AA 1QO7A 3FR7A 2VRWA 1H05A 4FR0A 4L3WA 4M7OA 3EYWA 3UNXA 1P3DA 4PQFA 1EBUA 2H2AA 2YY6A 4OPMA 1U0OC 4GVLA 4L22A 4TL8A 4XGQA 3ZOZA 4W99A 1YZGA 3WA6A 3VAYA 2JASA 5FBQB 1LI4A 5FQOA 2AWOA 3KTFA 5IP5A 3RIXA 1PR2A 2FZ4A 3FTNA 3K8OE 5ARCA 4AJIA 4EEXA 2JLXA 3TFOA 1OH6A 3L6UA 2G7MC 2YXLA 2H17A 5TT1A 3ZWBA 4L9AA 4KV9A 1QPGA 1CKEA 1PS8A 2Q4EA 3EG9B 1JWAB 3LUAA 1QIGA 4NDAA 4PX2A 5SZKB 2R6JA 1V5GA 4HNTA 3LDGA 1FJ2A 1R5NA 1Z7EA 5BRNA 4KX3A 4HUTA 4XFDA 4EMTA 3MLEA 5JALA 2WU0A 1NR7A 4C87A 1E96A 1I7PA 2C3YA 2Q1YA 1U3VA 1EVLA 4AUKA 5CFOA 1CJCA 3F1LA 1T1GA 1KNQA 1GNTA 2MSNA 4EHKA 2AUTA 3SX0A 4ZXPA 4HVCA 2EW8A 4MYTA 5F1OA 1GVNB 2XUPA 2HSEA 1YAJA 3KSMA 2PKYX 4O2AF 1QM5A 2ERXA 3FF1A 4MI3A 3ZTWA 4DG8A 2WTUA 4E30A 2XYPA 2VCYA 1QV9A 1XF1A 5KB3A 5KYKA 2P5TB 3R7AA 2MSWA 2XWJI 1JKJA 1N7GA 3DWEX 2CYBA 5FEUA 2O3SA 3O3OB 1FTGA 1SVWA 2I22A 5KTYA 2YYSA 1K6MA 4MWSA 4UBKA 2CBZA 4NRDA 3GCDA 3GJ0A 5EMMA 3TFWA 1B1AA 3E1KA 4RF3A 2VYNA 3ZX4A 4YUVA 2VKQA 3QSYA 2H2HA 1VL8A 2QKYA 2YZ2A 1AUQA 2R6CA 3NKVA 2W4QA 3ET5A 5FCDA 4BMSA 4UTXA 1Y3DE 1EI9A 4RVFA 2VJDA 5IJAA 2VBIA 3PPXA 3JQGA 2PH7A 4NZOA 1SUPA 4FT4A 3DD1A 4L5CA 5IJ9B 4PFKA 1M6YA 3DZ8A 1DG9A 2JIQA 2DQZA 3HDTA 3MPUA 3NGXA 3K1AA 4B46A 3F6YA 4RJIA 1K6JA 4BWYA 5I7SA 5KNCH 2AQIA 1BFUA 4QODA 4N7BA 2PL1A 4F71A 4RU1A 3B9PA 2E49A 3HJHA 1HTWA 1I8TA 3MCZA 3ZK7A 1P2VA 3IBCA 4ODIA 4RF4A 3NBZC 1YF3A 3OZRA 1N3IA 4E33A 5CDYA 3GDHA 4HNAA 3KEMA 4RZUA 4X8LA 3E7XA 5CLGA 5T4EA 2UUPA 1NN0A 2DR2A 3AVYA 1GL9B 4F4DA 1B8PA 4NBNA 1VSTA 4I1OA 1SOUA 1E2BA 2YDYA 4XYMA 4ETMA 1SOVA 2GO1A 3OX1A 1NE2A 4HBGA 5FJJA 4RCZA 2A0FA 1HDCA 2Q1WA 4R69A 5EP1A 1Z7GA 3ZD8A 5J1SB 2ISSD 2QXTA 5IABA 4CM5A 1LI7A 1R9JA 4GL2A 4C7BA 4H60A 1L5HA 3IODA 4ARAA 1A5AB 4W9NC 4LZLA 4O0MA 2CNDA 3MVEA 3TGWA 5I8WA 1QPZA 4GLFA 4H4EA 4XD7D 1QIEA 2Q9AA 3I8XA 4PSUA 3ZW9A 3EG5A 1KOGA 5JLAA 1WQ3A 1ZOPA 2Z8YM 2FPWA 3M89A 1EK1A 2II6A 2C7OA 1PHPA 5HE9A 3QYPA 5GINE 2TYSB 1EB9A 3FMFA 3VU8A 2L42A 1WABA 3GRRA 4BECA 2O8BA 4AS2A 1VLHA 2VDLB 1T2CA 3ML1A 4JC4A 2DBZA 1E3WB 1HDRA 1VGQA 2C5EA 1T0UA 1VG1A 2WILA 2HU7A 2JRCA 1ZHHA 2WFLA 3CH5A 4GP9A 4WCFB 4ARVA 2I6FA 4PR0A 4IUCS 4RFVA 1JT2A 1K9SA 3DFKA 1KI6B 2AH5A 4WERA 5H83A 4BS9A 5CFPA 1LC0A 2FR1A 1GV1A 2I4OA 3OZAA 2HLDD 3OQIB 4G9BA 4W1SA 1MIOA 5EQJB 2W2OA 2ZJ1A 3U3JA 2QR2A 1C9MA 1DINA 4IZOA 2GAOA 1LJLA 4ZO7A 4EZIA 3EVGA 1YQUA 2F3QA 4R2IA 5LIRA 1R12A 2POQX 1SAYA 1ZN7A 3P96A 3C3WA 2NZ8A 1B74A 3FUTA 1VP9A 5L95A 1I01A 3FYDA 3A9VA 2O4CA 4M1TA 4YQYA 4V0LA 3AHIA 1AOXA 3TOCA 3L0SA 3NFRA 3UKOA 3W7AA 2H54A 4K3VA 4B4UA 1U3FA 2XA2A 4N49A 4A3SA 4KMOA 1XK7A 3U7QB 1W29A 1WEHA 2CVZA 2PBLA 3O1JC 4UBNA 3VU9B 2YVAA 2EJWA 3SJUA 1HK7A 5EQFA 4E5YA 2UDPA 1OX5A 4XB2A 1QHIA 4XSGA 3SICE 1U3WA 5BSTA 1NAHA 2VOEA 3MUNA 4Q4DA 2QD3A 4WNAB 1XT6A 1NHWA 1PEYA 1ZOLA 5CMLA 1XC7A 2HKIA 4GBJA 4NZNA 3TW6A 3URKA 1V9SA 1MB3A 3RUPA 4J1TA 3WGYA 1ISMA 2EFHB 3AUAA 1UDCA 4HDKB 4HAUA 4IRUB 2HQ1A 1PVDA 1X0XA 2DFNA 4IIUA 2FLKA 2Q6LA 2R4QA 3ZHCA 4RM3A 1U94A 2AX4A 2W2TA 1LV8A 5DZSA 4WFQA 1CP2A 2D13A 4IOMA 2QTGA 3D8RA 1OJ7A 4TPKA 3TVDA 3V2GA 4BVEA 2XD9A 1NDQA 3OU2A 2QLJA 2IXFA 4C6HA 2BEWB 1N8TA 2BCEA 1NP3A 1A8SA 5ALPA 2ZUDA 2ZJOA 3H1TA 4JR2A 2QTNA 3X1DA 2O5EA 4D5EA 5KTSA 4B6QA 2O7QA 3CX4A 3AJ9A 3IAXA 4IRMA 1B2LA 3WV4A 1ZGJA 2YWDA 3QE3A 5FB3A 1NVBA 1JWLA 4MMZB 3ZH2A 4HVAA 4R1SA 3FDXA 5HP4A 1WTAA 4YDRA 3FPBA 2GCGA 2E85A 3O31A 2YJ5A 1JYEA 2CWDA 2DG2A 4DLPA 2IBMA 5F3RA 3EARA 4DCCA 3JWHA 3GD7A 4WFKA 3QKSA 2V0GA 4DAOA 1MNQA 1GQYA 1SZDA 1TC2A 2D8AA 2ZEJA 4ZI2A 4MQLA 4QICA 4BBJA 2EFEB 2PZKA 2JGEA 1HNXB 4FMPA 3BMQA 4K6MA 1NBHA 1RYZA 2E1PA 2JH8A 1TIPA 5ALGA 5KQRA 1GAXA 3ZJYA 1YR6A 3CW2A 1M67A 2PWZA 1S9HA 2ZDQA 1UBCA 1E2MA 3JYLA 3A4VA 4J9UE 5AW3A 1V5WA 3A6GA 2QX9A 5JMWA 3ZGZA 3LSTA 4KDCA 3BFVA 5BWBA 4OJNA 2QW0X 2NTNA 1HYBA 1TAQA 1GGKA 3NTQA 5BV0A 1OXXK 3D2CA 5KPJA 1FYFA 1V8BA 2H1CA 4HJXA 4FW9A 1DAFA 1DXQA 4GKBA 5ECYA 5HKBA 1T6YA 1QGZA 1CPYA 4G5SA 1BWPA 4PBSA 5IW8A 3U9TA 4Q7JB 1A5TA 1JEDA 3GHHA 4TXNA 3RRZA 4BO8A 2HSZA 1DKRA 1EE1A 3E84A 3VPAA 1UM9B 1Y3FE 4TUYB 5GIPE 2Y1XA 3DA8A 3CR8A 4D4JA 4DCVA 4L4XA 1EP1B 1Y3IA 1QPBA 3BVPA 4FDAA 3AJEA 3TZ6A 5EUBA 1QP4A 1ZD2P 3GVPA 4U4AA 2WJAA 3EF0A 4M9XA 1CLEA 4XVQA 1RZRA 2J3JA 3STHA 4CYMA 1AQYA 5B4TA 2JAPA 3THYB 1UBMS 3LVBA 4PEVA 1ZR4A 2OV8A 4LXXA 1MUUA 2ZJFA 1ISFA 3OT5A 3TKAA 3NLLA 2W6NA 3OAAA 3F0TA 1USUA 3FOBA 3K15A 3N86A 4U39A 2CXSA 1M2OB 3F67A 3X1WA 3E61A 2PA0A 5J5AA 5LU8A 5AXBA 1EHYA 1HDGO 5ALJA 1T36A 3HMQA 3VTFA 1N7HA 4GMDA 4P0TA 4Q9IA 1RQLA 4QTZA 4KQHA 4ZYWA 3H8SA 4O59O 4V0QA 3ZYCA 1ZHFA 4H16A 4NOLA 4Z9BA 2PG3A 1G3UA 3GJ6A 4M0KA 4E3ZA 1WV1A 5JAOA 5JJKA 1AZLA 4OLHA 3H8VA 3VU1A 4CIAA 3NKFA 3IQZA 2YXEA 4X6UA 2HPHA 2BE7A 1PV2A 4QYIB 4LI0A 2A88A 4X1KA 5FTWA 2JJ2D 1UMBB 1T9AA 1BQEA 4RTJA 1PWZA 2C9OA 2CFSA 3QVWA 2PSSA 1DC3A 3AK4A 2QRUA 4YTEA 3BTVA 3GOQA 3L6OO 4N3NA 2GPSA 4KPUA 4S1TA 5BSMA 4EITA 1YB5A 1KK3A 5HF6A 3HBMA 4MWZA 1NP6A 2Q5IA 1H94A 2WZCA 3JD2A 4J03A 2GF9A 1FRZA 4F4IA 1ZCFA 4WCVA 4QGAA 3DZHA 4TUYF 3RWMB 2C7BA 5ELMA 3PTLA 5FPYA 3FKSD 2AJ8A 5KWVA 2ZRLA 3E5NA 4S0ZA 3KOMA 4F97A 1WQ1R 1LS6A 3WBKA 4A2CA 2DULA 4QAJA 3ZXYA 3BTOA 3OEED 1CFJA 2W48A 3ICEA 1GNLA 1YDFA 3KPJA 3OPYA 3FJYA 3BGOS 3OT1A 4KQIA 4P58A 5T41A 4DWVA 4C22A 4PX5A 3NVAA 5AK4A 4AY5A 1G4AE 1ADFA 3E27A 1ZCAA 4J0KA 3V4LA 3WMFA 3GLHA 1IVSA 3HN7A 4X1YB 3NI2A 2C94A 4GWGA 2O06A 3CM0A 2ZVJA 5GZ6A 4BP1A 2IOFK 1WDKA 2I99A 4MKRA 2PJUA 3QNUA 2IUFA 5SYMA 1ZJ4A 2VLIA 3D7LA 3LRXA 1U3UA 3BMCA 3WRXA 4YAUA 2QTFA 1NKSA 2RHLA 2Z30A 5E4FA 2WTEA 2YMPA 4ZKDA 3KBOA 3RBZA 2GCPA 4PFQA 3PFCA 3NUGA 4KN8A 1BDHA 4IGAA 3FCCA 3W90A 4EJSB 1Y8AA 1NIPA 1Y4DE 2F67A 2OGZA 2VLBA 2X1LA 4IY1A 3CONA 2Q5QA 3T7KA 1H3EA 4MWGA 2LXNA 3FNGA 5E38A 1QB8A 3RUCA 2Z98A 2XCTB 4S1PA 3E3MA 1U5AA 5GM1A 2V58A 4C4ZA 2V5VA 5BVGA 2O19A 2Q3EA 3GPLA 4CLOB 2O2YA 1W36C 4PS1A 3DAHA 3AL2A 4C7VA 1PS9A 1I1HA 3FTDA 3I8SA 5FADA 3DE7X 1KI7A 2IV3A 4QASA 1YR2A 2QGFA 4GG1A 3DE1X 3QM1A 4HLUA 3ZI7A 2XWBF 2P6NA 1FX1A 4INAA 2P91A 4A2WA 1M5TA 2OQ2A 2VSNA 5FUYA 5BWNA 4GMKA 1E1RD 3C7AA 2QVZX 5K05A 1XZDA 3MOSA 5JNRA 1SBQA 3A3KA 5CYFA 1GRNA 1Z4MA 2PGJA 3AVXA 5DLYA 2Y4OA 4O4IA 3NUQA 1CEEA 2VHJA 4L2IB 1FMCA 4PG5A 3HXOA 4FFPA 1HE1C 1IZZA 2PKCA 1M2NA 2K6GA 1YMVA 4N47A 1JZSA 1XDDA 2WWFA 2QD1A 4XX0B 3TEFA 3AHJA 3D7RA 2DHCA 1I32A 1GUAA 3GL9A 3M3PA 5H4GA 1XVUA 4F6RA 1HPLA 1RWPA 1YUMA 1ZJYA 2PS3A 1NONA 3SZUA 1TKBA 2HQSA 1K08A 4RZQA 4II7A 2IZ6A 4UE3S 5LQKA 2V4UA 2GBPA 2ANCA 5K0TA 1PQUA 1X8JA 3UOGA 3WB1A 1X8XA 1C2TA 1L5MA 1JL3A 1CUGA 2FWNA 4HWTA 5F2EA 5EIBC 5F78A 1ISJA 2XZPA 3KXDA 5DM0A 5AOBA 3IIKA 5FPTA 1B0ZA 3BBPA 5A1JA 1HC7A 2JEZA 1GXSB 3CZRA 3Q0EA 1FTQA 1SIUA 4E0BA 4Z0NA 4JKIA 4P35A 2CKDA 3Q3JB 3UAOA 1TCBA 3W78A 2NG1A 4NBWA 2Q7OE 3RQSA 3E0QA 3EZGA 4QARA 1U3TA 5HBRA 5TPWB 1AIPA 1HEYA 3W5UA 3AETB 4P7BA 3SYNA 2JLAA 3G5TA 1CIPA 1H2ZA 3HWRA 1B23P 1EK2A 3JYNA 3NWEA 4WMLA 5K8LA 2G1PA 2JLRA 1JQ5A 1PT5A 2CVQA 3BWMA 3IP6A 1K89A 1I4OA 2R8RA 3RFFA 4LRYA 2VHZA 3HJUA 3O94A 2BEJA 1BXRB 2VIIA 3SC4A 2WIAA 4WBSA 1LSSA 3KPWA 4KB5A 2OV2A 1N5JA 3H6GA 3I61A 4YRKA 3P9YA 1V7QA 1HY3A 2I2XB 2JFPA 3GUYA 4ARIA 4LZJA 3QPWA 3OH8A 1S8NA 2G17A 4QYTA 2QUKA 5EKUA 4KOEC 1V3QE 1VB3A 4PZ0A 3HZRA 3MLBA 3T4PA 4J0HA 4ZARA 3X0DA 2F00A 5JOQA 5A71A 3FGPA 4KI0A 2R1TB 2EZUA 1OBVA 1REQB 4EHBA 2Z2YA 1PL6A 3CY6A 3OX3A 2GVDC 3H97A 2QZ9A 3F47A 5AM2A 3G79A 4MVJI 3SU8A 1ZOSA 2BRUA 1BYUA 2J0VA 4XSVA 5EHIA 4CTOA 1INLA 4I6EA 2J9XB 4HR7A 5BNIA 2YJTD 1VXRA 2W6CX 2XKBA 3HTXA 3OCJA 3F73A 4UTNA 3AFMA 3AHGA 1U8FO 1NI4A 1BX1A 2ZIAA 3I4CA 3QBEA 1P91A 1GG2A 1QIHA 4OFZA 1J9ZA 2A4MA 4R1OA 2O1WA 3IKTA 1H4TA 4N3GA 3NVKI 1FBNA 2JGAA 5K9ZA 1ONSA 2GDZA 4QTYA 1QGOA 4MVJP 2FEOA 2HF2A 2ZAYA 4ITRC 4D81A 2XVXA 4L8FA 1TL7C 4HD8A 4DFDA 3PLNA 4AZ3B 4NATA 1IQ0A 3B7PA 3F6BX 4A8HA 2FXIA 1XPOA 1E6WA 1XQVA 1K92A 3I3OA 2I66A 2CEAA 4Q7EA 1S3IA 2GT1A 1YZVA 3RBXA 2HDHA 3AUFA 1E9RA 1VSVA 1CRWG 1LSJA 3GR6A 4RGQA 3QKTA 3K09A 1D2NA 1CY0A 4CW7A 4O4LB 2Q5JA 4EDHA 2O8BB 2PRKA 2JIPA 3FUVA 1QNFA 2R85A 3I9FA 2EQAA 3BEOA 2GM9A 2WA2A 3E22B 4R2WA 2V7UA 2HMSA 3JQ9A 4U1RA 1KMHB 4D42A 1F48A 5IFLA 4IQGA 1LZLA 1SJ9A 3AHCA 3OPMA 1O54A 2EEZA 2FP4A 3FI9A 4J4HA 3TJZA 1Y3BE 4LCBA 3CJQA 3DG9A 2WJJA 2LE0A 3K0HA 4JVLA 4UOZA 2G5TA 2YV5A 2ZJYA 1DAMA 2UYYA 3L0IB 4F45A 3QE9Y 1G2IA 3PFKA 3P45A 4V03A 4XEHA 4FC6A 5EL0A 5EIFA 4MV5A 5P21A 2EBWA 4FILA 1MH9A 4I2NA 5JZBA 1KDOA 3D64A 5DLDA 1V4BA 2Q49A 1IOLA 1G98A 2NU9A 1BOOA 1E32A 4DLVA 2H4FA 4HUQB 4ENSA 1GTG1 3NUZA 3OO0A 3UAXA 4YUYA 5A4AA 3ANLA 1MAAA 8LDHA 5BSHA 4ZQGA 4BGDA 2R7AA 3EK2A 1YR8A 1XPJA 5EIXA 2DRIA 4L08A 3TD2A 3HUUA 3M4NA 2JZCA 2PXAA 3MTGA 1ETUA 4WVLA 2O6HA 4AJ1A 1EFPB 1AF7A 5ICSA 3GO4A 1X1DA 1YS6A 7MHTA 2D1SA 2H92A 2XQJA 3W79A 4FFDA 5E0KB 4QPPA 5BSEA 3HKCB 3P19A 2Z95A 1P74A 3P9NA 4DZZA 5BMVB 2VHVA 3AG6A 2CV0A 4CCYB 1C1YA 4RE5A 5JPCA 5TQ2B 3GT7A 2AOUB 3GDGA 2XMPA 2I6QA 1QG0A 3GFSA 3QV2A 4O4LF 4UD2A 3UGTA 5C5EA 4Z5XA 2FPSA 5I45A 5CB4A 4RDXA 3T9BA 2FK8A 1LNZA 4XTRA 4FMDB 2ZTUA 2XZTA 3VR6D 1BE8A 4NENA 4W6QA 3VRHA 3WMWA 1YI0A 3D8BA 4NV3A 2XT9A 3WP1B 3H83A 2QSYA 5A1TA 1GEGA 1TX4B 3DHEA 1WLSA 4R8RA 3TG8A 4KE6A 2PMCA 3G8DA 5IC4A 1ENZA 1VJDA 4MUMA 5B1IA 3TLJA 1B41A 3TPFA 2PBZA 5HKOA 5I7UA 2ODEA 3RRMA 4JI0B 1UEJA 2C9CA 4HQ6A 1C7RA 1YQWA 3K2BA 2E4YA 3TIVA 3HUFA 1XQYA 2ONZA 3L7LA 2EVWX 3E2MA 2J1LA 3KL2A 2PUGA 4R6WA 1GRVA 4M1WA 5BWMA 2PM8A 3TGPA 1V4NA 2HQBA 5F9FA 4UW9A 5KPDA 3NJRA 3IR7A 2OXCA 4LCEA 4ZOAA 3DZKA 2A86A 1TTHA 2JH3A 1PWXA 4YECA 5THQA 4R41A 2WF8A 5C8YB 2CVOA 3KNZA 5TB5A 1HFJA 3FBGA 4AW9A 3L9XA 1JIIA 3IOBA 3GFVA 3U3ZA 1ZY2A 1YFLA 2O48X 5FLEX 1LVUA 4K3UA 1XFDA 2NVWA 4AWXA 3F6EX 4O29A 3EZLA 4FFVA 3JALB 4YRBA 5BMVF 3DOJA 3B5EA 4WQMA 3F2IA 4LE0A 5EZQA 4OUDB 1P1JA 1I7LA 1WHTB 4XASA 4MLCA 4OGFA 1DBVO 1WWKA 1PGQA 3AY0A 3E3NA 3JVDA 2ONYA 3LUDA 5EY5B 4QT4A 5LP6C 4GR5A 4N48A 2PCLA 2XAAA 2I2BA 4FMDF 2EYQA 4Q24A 3ZWYA 3ZZ0A 3EWAA 4Z7QB 2HL6A 1C3OA 2Q3CA 5IASA 4AKGA 4DMHA 3RLFA 1L5KA 2OOKA 2XCUA 3CWZA 4O2RA 1ZI8A 4CVNA 2XZDA 2AN4A 2IIPA 2W8ZA 1J06A 5BQXA 2FVYA 2J3EA 5E3JA 1DB3A 4ENWA 1UJ2A 1ULZA 2BDUA 4HK4A 4WJLA 2PR7A 4D9KA 4MHOA 2ZYUX 4ZVPA 3R6WA 5SZIA 4YT8A 3GH1A 4KWIA 4YCJA 3WL4A 3S8YA 3GRUA 2P1DA 5AHWA 1RM5A 4RL6A 5C3MA 2P9CA 1F51E 4G4GA 2V9PA 1XMXA 3EXEA 1M2GA 2R66A 4LC0A 4AIRA 1L5NA 1FW8A 4QBHA 1II8A 3U09A 4IIXA 4C5CA 3WLHA 1Z26A 1IBSA 3JX9A 1W8DA 3RU3A 3W9BA 3RK1A 4B31A 3KHUA 4EAQA 4Y2GA 3UGKA 1BTOA 3DHWC 4K0KB 3ZDRA 3ROEA 2I62A 2YV1A 4UARA 5C5DA 5C8YF 5TEWA 4B7XA 3FWNA 3LDHA 1JG6A 1JN0A 1KOFA 1NKVA 1SVUA 2FZKA 2HLNA 3A11A 1KK2A 1CERA 1D2EA 1FRFS 4KQJA 3TZHA 4D4GA 5JIBA 1RXVA 2CWWA 1PNRA 3DVRX 4JP3A 2F3SA 2A30A 2P11A 4YRGA 1LNQA 1X42A 2FE1A 5FFFA 5F98A 3UW3A 3PXAA 3NC0C 2J41A 5IXJA 2IS1A 3HCAA 2VJOA 4I6JA 4JODA 4RSRA 5H4HA 3C3JA 7AT1A 4HPWA 3O2NA 4J90A 5LIPA 1NY6A 2QX4A 1QUEA 2QHXA 1JHRA 2DJ5A 2JJ2A 2WHXA 2WWIA 1XRJA 1H2BA 3SVZA 5EFZA 4E7OA 4K81B 1SA0A 4LY3A 2IXEA 2X0FA 4YRNA 3U61B 3BILA 3PV0A 1AQ6A 5CLLA 4DVGA 3KALA 3OEWA 3OKFA 1T9CA 2ACVA 3DP7A 5K09A 2PV7A 5DX0A 4B3FX 2FZWA 3I5MA 2D1QA 3ROTA 2DBQA 1ZSVA 5D1HA 2XYHA 2J7KA 4MYCA 2HV8A 4UDNA 3WKEA 4KPEC 1BDIA 1GJRA 1OI7A 2G3YA 1ZM4A 4MUFA 3RVJA 4CFYA 5C18A 5CXQA 1WW8A 4KPYA 1BQ4A 2VR1A 5KHOC 2J07A 4G1VA 5A04A 1PZNA 3FMVA 4GZ5A 1PUXA 1N5LA 1AO3A 3OEEA 3DQQA 5JFGA 3ETDA 1X92A 4ASUD 2R48A 1R4NB 4AI6A 3K6RA 5CYGA 2E4AA 1DBIA 1PT8A 3CC8A 4PQGA 3ND9A 4LA4A 1GCIA 1A97A 5K0SA 4CDRA 3E4CA 4JS0A 2XSZD 2YWHA 5KC8A 1K6IA 3GEIA 2WIBA 4XQEA 2LTAA 3IAM1 3W3AH 4J3JA 4B85A 2C2YA 3CV3A 1QZ3A 3GPBA 3B1VA 3LYHA 3HWWA 1NPYA 3D6JA 4UUBA 1YJXA 4ENVA 3DBRA 4R5MA 1JIXA 1R66A 5FUXA 1MLDA 4KPGA 5C5IA 1IN1A 2W90A 3LM8A 2QVYX 3GZ4A 2IPNA 2QROA 3ASVA 5HMMA 1QQ5A 3QMMA 4U7JA 3WB2A 1T8SA 3NYQA 3ZWQA 3BG5A 3GNSA 5BSKA 3LT4A 1P45A 4FMCB 4WKNA 5HZGA 1U8YA 4DMMA 3C5VA 2VBFA 4LFAB 4CKXA 4BV8A 2REQB 4PZ9A 3NXSA 4BN5A 1SNYA 3A0UA 3CUYA 4REQA 4P3YA 4BLPA 1KY5A 4MIKA 3RT1A 3IMEA 1B6TA 3CCBA 1NX9A 2FSIA 4J49A 1OXBB 2I2FA 1N2CB 2ZQYA 5JANA 3HYRA 4HH4A 4Q48A 2VDWB 2J5RA 4BWFB 3AFIA 3COWA 1ZG3A 1P2FA 1EQ2A 4ZVKA 4XWOA 4CIWA 4MW1A 3QG5A 2VHWA 1EEXB 3DMFA 3I58A 2WJIA 4C04A 3GJ7A 4LK3A 1E1RA 2YUTA 5BV7A 3R8FA 3K0EA 1Y6JA 1WXHA 3ROZA 2OV6A 4D3ZA 1PNVA 2Y2UA 5D6OA 1RQGA 4D9IA 1T2FA 4LYJA 4QWMA 4RC9A 4YJGA 2CXQA 3T5CA 1A9XA 4ZT2A 1KYIA 1D8AA 2JFWA 3THRA 5HOEA 1ZWKA 4DBLC 3M5DA 2B1GA 1PJBA 5EEGA 5EWLB 3GBSA 1SKAA 3FYUB 4U6SA 1PEAA 3CN9A 4LG1A 3SYTA 4M8KA 4N40A 4HWSA 4PVDA 1ZXXA 2A3NA 1DKUA 2PU7A 2ZSUA 3HSSA 1P62B 3R3XA 4WCFA 1DOHA 3AF5A 4YBZA 3WYDA 5I8ZA 1QRUA 1I3KA 1KWGA 3ZS9A 3QPAA 3JQPA 1TU3A 5CM9C 2V98A 3ZNNA 5MF6A 4K9OA 1Z3IX 3N28A 1KFEB 1YB6A 3I1FA 1WZNA 3IHTA 4GZMA 3IUNA 4I3HA 1UC9A 1H6AA 1UR5A 2FMFA 1VYTA 4FMCF 2Y71A 5KNCA 5LLSA 1BS9A 2C29D 4BN4A 4NF2A 4KAJA 1CF2O 2YVKA 1WU7A 1WO8A 4HQKA 4J7UA 4XIFA 2WTNA 4Y2PA 2H7VA 1XTTA 1RLIA 1QU2A 1KY2A 1XNHA 3TAXA 5AFSA 1TJ5A 2PJDA 3DLAA 3JWPA 1DO0A 3Q6NA 4P53A 5BN1A 4IKOA 1ATZA 3AI7A 3N6XA 4EY6A 4Y1FA 2OA0A 1OTHA 4NKRA 3WKAA 4L4ZA 3DWGA 5IBCA 2I1LA 4Q3NA 2YN4A 3JR3A 3O74A 3C6BA 4RA6B 1RPTA 4YP7A 3UENA 4PLPA 2CE7A 3L0OA 3NALA 4BQSA 3BULA 4WNAA 4CGYA 5JS7A 3ADBA 3RM3A 1GILA 2WNIA 3HWX1 3JQQA 3HQ4O 4LXUA 3B9BA 4QIHA 4Y1RB 4XAQA 5BW8A 3ZI0A 2OXEA 4N5NA 4KMSA 5CTJA 5IF3A 5EJIA 1VJ1A 1JQAA 3D3WB 4ZCSA 1AA6A 4Z9AA 2AEEA 1HQYE 3RB8A 3UY4A 4DYDA 3TXXA 4O63O 1CJUC 1SKQA 4AC9A 2Q46A 4DVJA 5DULA 1VFPA 2A7XA 3PC7A 1ND5A 3A1CA 1OTYA 4LTDA 3CR7A 4Q3CA 1YR9A 1Y7LA 2CXHA 2IY9A 3S28A 3INGA 3MWLA 3T3DA 3ZZUA 4G5RA 3MJSA 3FHOA 3GP3A 2QTVB 1EVYA 3NOQA 2WF7A 5LQRA 1NLMA 3O73A 1QHFA 3C8UA 4KO2S 4EBBA 4ZJZA 5CT9A 1KEUA 1G16A 1I7NA 1R9NA 4AP9A 4URXR 2ZB8A 5EKTA 1MOPA 4GI2A 3ZV4A 3W1VA 1K7YA 2JLQA 4NNJA 4KO3S 2AJCA 2P0EA 4KK3A 4O2BA 3B48A 3PJGA 4XCVA 1XX6A 5AKHA 3CEJA 3LDFA 4C4SA 2VSOA 4IHJB 5B12A 2JFVA 1C50A 1NULA 3E9DA 2P27A 4G07A 3M4ZA 1P1CA 4JFRA 2D5LA 2WJWA 4XWGA 5HG0A 3RABA 1K2VN 1WCV1 3GUVA 5FFMA 1M75A 1YE8A 4KGVA 2D2XA 1SQSA 2J8ZA 721PA 3SC2B 1G8HA 2DPLA 4YWHA 1MRSA 5EJ8A 2QYOA 1XZJA 5CNMA 4H7PA 1Z28A 3A9CA 2FDXA 3OZDA 1LTKA 1T2AA 2QZSA 3INYA 4YO8A 5HIKA 3MB8A 3MHPA 2WT9A 4BASA 1FRVA 1UJMA 1K3TA 4NV0A 2C04A 1FTYA 1O5OA 2NXJA 1SUDA 2R8OA 3AUUA 4CL8A 4E2XA 5LYJB 2GEJA 3N07A 2OMKA 1TT5B 5BUCA 2ISCA 1QE3A 3W2EA 3BGSA 2R0QC 2ORIA 4PINA 4HUJA 1ZMXA 5AM5A 1IZ9A 5D3ZA 4GMXA 2FMTA 2AS0A 3PF9A 1WZIA 3AG5A 4QYSA 2IEAA 4RMHA 4WK0B 4DNOA 5A5GA 2PMFA 3SLRA 3DULA 2G07A 4IP0A 4NMWA 4PSCA 1ESMA 1YU9A 3LBAA 2CVPA 1QH9A 4NC9A 5EJEA 1TNDA 1TAHA 1WPQA 4DABA 2O1XA 3V8NA 3WYGA 1HKUA 2XUZA 3CZAA 4JBNA 1T2UA 4FOOA 1I1QB 1I5RA 3PQ3A 2JH9A 3FBTA 3ISJA 3LPLA 4N3BA 1SXJC 4GDMA 4RMJA 4GOKA 1GZDA 1RIIA 3SJCA 3REQB 3ORSA 4YT4A 2IP1A 3IURA 3O4RA 4RSGA 1XLTC 2O20A 4UVIA 2PKEA 3LFHA 4LFCB 1CUBA 1XKQA 3E8XA 4BP8A 2J6HA 3GEHA 5HZMA 1A1SA 2C5LA 1OR8A 2ECFA 1MGPA 4L9RA 4EBFA 5AUPB 2AOXA 2PRSA 3DZDA 1ZITA 4GUAA 4D74A 4DJJA 3KOZA 5D87A 1MG0A 1YASA 2VT6A 2C9DA 2NO7A 2VATA 4NE9A 3AUJB 4QG3A 5L3VA 2BMVA 3NTXA 3TPZA 5LYJF 4CTJA 5EJ6A 4R9UC 1SKYE 5L4SA 2PRIA 3EZFA 2CXNA 2ES4A 3BAFA 2BGRA 1E94E 3F74A 4OQFA 2Y27A 3OKPA 4UCWA 3V8MA 2BKUA 2TS1A 3AWIA 1EXVA 2PH1A 3PUVA 3A2KA 1NT2A 3COZA 1SOAA 2ZYGA 1Z33A 2IELA 3BWEA 2DWOA 1OVGA 2JGNA 1R6BX 3M1LA 4TMZA 2AMFA 4FNAA 1ZIXA 3D54D 4ZCQA 3QHQA 4R16A 3ZD9A 2OECA 2IWRA 2AA3A 1YVPA 1MEOA 4L8VA 3GVXA 4YALA 4WECA 1DV1A 1ZO8A 1Z2DA 4OHFA 4WLEA 1U9YA 3NJ4A 2ZRHA 4HTFB 3VR6A 3PXCX 1X1AA 5LWHA 4US1R 3THWA 4PF1A 3DDHA 4UVDA 1C14A 1U9ZA 4N3CA 2YL2A 2FZGA 4KR3A 3GU3A 3FMOB 2JJQA 3EH2A 3F2VA 4MKFA 5EZYB 4U7PB 5EYPB 3N58A 3T9EA 3GRVA 2GCIA 2BKLA 5EHQA 1Y1KE 5E6RA 4QT0A 1QC5B 3T4UA 3C4JA 2CXXA 1SIOA 7MDHA 3RJ5A 3RYHA 3D5TA 3LC0A 3UICA 5F23A 6ABPA 2VNJA 3EVEA 5KS2A 2QTWB 2ORVA 3DAOA 5J59A 3PQ5A 2JAWA 1O1YA 3WLPA 4DNXA 3WISA 4C2UA 3H4MA 3U49A 1Y81A 4UQLA 4FWTA 4MR8B 3LQYA 3UMVA 3GJYA 1S4MA 1U2ZA 4ZOLB 4K86A 2QBYB 5B53A 2P6MA 3QX9A 4ACAA 3H3XA 4C4YA 4JMPA 1MX9A 4L4YA 3LQKA 4YBRA 2BF4A 3E1SA 3HM2A 4DV5B 1XQ6A 4XW2A 5M34A 2QUIA 3HDYA 4NH4A 3UMSA 2HLPA 1AZWA 4EJSA 3RSQA 2A0YA 4RVNA 1BXZA 2WJGA 5IU6A 1TRHA 4KQXA 3RWBA 3BTSA 2GTPA 2ZE6A 1CJMA 2BJWA 3LUHA 1O97D 3P2KA 4OHZA 2OO5C 2QRGA 4CF4A 2Y1DA 1C9NA 1WBBA 2HEGA 4OU5A 1K2WA 3PL1A 5DVZA 4A0RA 1O89A 4OB8A 3EBPA 4GE0A 3SC6A 4BY9E 2O7NA 1QCYA 4DSUA 4EKEA 2ZS7A 1DLIA 3L06A 4EUKA 1JBEA 2WUVA 3V32A 5EZYF 1O8CA 2WQZA 4QECA 4BIMA 3OC0A 3T5PA 3D1VA 1WCIA 5G0TA 4PBTA 3QELB 1W46A 4W5JA 5BWCA 2CFIA 5KNBD 2RB4A 1MO3A 4NDNE 5IUKC 2BFEA 2EQBA 3AQIA 2VZ8A 2QPTA 3KEGA 1N32B 1Y1PA 1KGSA 1S6YA 3VAAA 3KOXA 1H2HA 3UKDA 3IAHA 3OWXA 13PKA 4H4CA 1ZMRA 2JFBA 4CLDA 5JMOA 3SVTA 1UMDB 2XYQA 2J45A 1GU7A 1GVHA 3RC1A 3RNLA 1AXRA 3E5HA 1CCWA 4XX0A 3R7LA 1W2GA 3C7CB 3Q7RA 1R8SA 4J7AA 4PPQA 3O6VA 1BRTA 2IZ1A 4UNSA 4RQTA 4ZDWA 5AR1A 3QVGB 4U7FA 2G8NA 3BHMA 3PG5A 3UJPA 5DTRA 1IMJA 2QNRA 2G70A 3H6HA 1SR8A 3E48A 4P4NA 2AG5A 1HDYA 2JHCA 2ZIWB 2R6R1 2JFQA 3UMJA 5CJJA 4ZZ3A 4M88A 2OR3A 4B3XA 1XQ9A 2V54A 4MV6A 4MXDA 4A1FA 2XHZA 1Z4NA 1JDPA 2QEQA 4IFTA 5DNVA 5ECWA 3TUJC 3V3TA 4B17A 3V7YA 3EPRA 4EG7A 4YV2A 1XD8A 1B1CA 1YL6A 2VJNA 3KZMA 2PZGA 2PH5A 3HJAA 2XA1A 2HJRA 2FJUA 4PQYA 3OTQA 2ZBGA 1Y5LA 3QYAA 4MVCA 4DQKA 2FW9A 4RKWA 2HRBA 2ZB2A 3UK6A 1SUIA 2GEUA 3OQ6A 2NUAA 3AETA 4YMLA 2QQGA 1E3TA 1XDSA 2PO7A 2VUUA 2XDAA 4F84A 4KIFA 3M5WA 3UXMA 4TLBA 2DR0A 1SBYA 2VWGA 1DT5A 4K9MA 5E6SB 2P41A 5TARA 1LDGA 3PBKA 3U26A 3WGVA 1Z25A 2CVHA 3IAFA 4CMIB 1UPFA 3DPIA 3NXKA 4ASUA 1TTPB 4EATA 1W4BA 4DV3B 2UYGA 4MQEA 4UHDA 1BH2A 5DGCA 3IBSA 3IAM6 4PXYA 3LBNA 1V16A 2N9UA 1QLJA 4EY8A 1L7VC 4C30A 1FJGB 4BJ1A 3V8RA 4AQ7A 3KLBA 1ESCA 2MJLA 5GJBA 3KVOA 1G8FA 4H15A 4N12A 3N70A 5IBRA 3TTUA 4EI7A 2A78A 1JEEA 2NZUG 4FX5A 4ZT7A 1OH7A 4L6CA 1M9NA 1PR3A 4ZVRA 5KDDA 5LD2B 3CUUA 3BXHA 4ZWNA 4EJFA 2PUBA 2AX3A 3IP5A 4ZXFA 5KKAA 1U2PA 1BE1A 3JVVA 1VKNA 3GB9A 1X1BA 3JYPA 3G2MA 3A6PC 1YRHA 1HT1E 1NU8A 2BSQA 1T8TA 3EIHA 1DUIA 1WB6A 3I8OA 4MCAA 2J9RA 2OQVA 1V71A 1U80A 5ALQA 2R8BA 3GN1A 1QHXA 2OAEA 4W63A 1NBMA 5ERXA 3GZJA 4JB2A 1J90A 4JVSB 1QFSA 3EGVA 3HO8A 1E0DA 4HWKA 3CNNA 2BEVA 1N36B 1M6VB 1ZNWA 5FWYB 3F90A 4ZYXA 3BIFA 3RFXA 3JASB 1I80A 2P1ZA 3R44A 2FUEA 4OJYA 4BO2A 5IHXA 3G0GA 2IDZA 4FGJA 5AW9A 4BE4A 3RG2A 3OQNA 1FQWA 1F6WA 2A9OA 2YNMD 4YRJA 2NXWA 1PR6A 4LCJA 3EGCA 4WLOA 1YRBA 4EZEA 4HFJA 3KKLA 1O5IA 4LXIA 4M21A 1CUSA 4OXRA 4YP5A 4HB2A 5FBZA 3OTOB 2I1QA 1YO6A 2QAGB 2HV9A 4HAVA 2CJXA 4WBNF 1UKCA 2ZTMA 1UANA 3AY7A 3OZUA 3WZLA 1DELA 4DR4B 2NGRA 4NOJA 1EWVA 1YZNA 3PUZA 2E6KA 3AGPA 1S2OA 4LWZA 4LYDA 3SN6A 1JDUA 1F14A 1U3DA 1JKXA 2KSQA 4TWBA 2C54A 4YP1A 4E5VA 1WBDA 3K5WA 2X3UA 1UQRA 5DLQC 4PC7A 4NCHA 3GK3A 1P2TA 3SMQA 3VYWA 2Z57A 4F56A 3E22A 3RC3A 1P19A 1VCNA 4UDXX 2QYTA 4MRMB 3K05A 4IJQA 1EJBA 4CIVA 1HDXA 3KETA 2MSKA 3ZDYB 3EBLA 4ALNA 5KYVA 3OCUA 3OY7A 4MIYA 4XKJA 5E6UB 1UJBA 3KVRA 3DO5A 3N2KB 4X6XA 3LT1A 1Y4SA 3L7OA 1LKZA 4CHTA 1VI5A 2HIGA 5I7EA 2XQGA 1JDVA 2RJOA 5DHSA 2B7CA 2OCIA 3COPA 1Z73A 2HWYA 3NV7A 4HUQA 1W5EA 1L5VA 3A7DA 3GEPA 3TFQA 3WQRA 1GPJA 2GAIA 1KAOA 3WYFA 3UB4A 4CMEC 5IWCA 4HYQA 5JAUA 2YXBA 1T8RA 1SVSA 2FR0A 4WIAA 1E66A 3KQNA 2RGRA 3LZCA 2BIFA 1L9KA 2A0UA 2R86A 4P3PA 1GGJA 2JATA 4JEUA 4PQRA 3TQQA 4BKOA 2M6LA 3K16A 2G25A 3U4QB 3IE1A 1YOVB 2PTGA 1I3LA 3HXQA 4UD6A 2GPAA 3OKAA 4J0GA 4A0HA 5H3CA 2R9VA 1JH9A 3FPHA 4K5QA 1Y1RA 1ONNA 1XVAA 2REXB 4Y6SA 2VF8A 1JEJA 4G0NA 2ZUVA 3RJMA 2JJMA 4DLNA 4QLAA 3NNDA 2ZUEA 3V6MA 2I7XA 2WRZA 3VFDA 4TWAA 4G0UA 2B7LA 1UJ4A 4KG7A 4MUGA 1VZ3A 2CJWA 2D74A 1QS0A 3OQBA 4QRIA 1JJVA 2ICAA 4EX6A 1T8PA 2Z5LA 3CWQA 3KKQA 3MS4A 2XUAA 4K0RA 4YMWA 5JQGB 4BB9A 5B7PA 4S1WA 2HI0A 4N6NA 4TSRA 3G1TA 4JLOA 3D8HA 2HTEA 3DEYX 2G40A 4JP1A 5HWSA 5JMPA 2VDPB 3PC6A 3NGLA 4B0OA 3WJAA 2HIAA 1OYVA 3A1FA 3OJXA 3IT0A 4ZIRB 4IAOA 2VK8A 2PFSA 5AOAA 3TW8A 3HLKA 1HL7A 4B44A 4XWKA 4A8PA 3ACCA 5IBPA 1F0NA 3N6VA 2ECQA 1HSOA 4X1IA 1QIIA 3T54A 1COWD 3VDQA 2AXEA 3Q0IA 5F1YA 3UJCA 1PS0A 2O8VA 4GWLA 3NWJA 4PW0A 5AVVA 2LW7A 4KXXA 2QPLA 4WOCA 1IAQA 4ZICA 1F9AA 2BUCA 4J0DA 2AW3A 2CK3D 3UZUA 3SS8A 4BQRA 4RQBA 4ECAA 5JWRA 3PEYA 1TMGE 3GUCA 1J1UA 1XNJA 1M34A 1ZC4A 1HWYA 2D2FA 1ODKA 2UYCA 5KVSA 2NXEA 2A5JA 2WFAA 4DXAA 1DKOA 2CNLA 4G84A 3CNEA 4NCXA 3M6VA 2XH8A 3IUEA 3JWJA 1TAUA 4DLZA 5AHXA 1I33A 5C7IO 5FI3A 2PPLA 3JALA 1Z3CA 4IYJA 3ADPA 5I9MA 4ND1A 4PO3X 3F5DA 5I9BA 1E0KA 3RRXA 4D44A 1XD9A 2RHDA 3NC4A 1W35A 3HN6A 3AIKA 1YQDA 1GYPA 3GFOA 3W2TA 1FMLA 1MC1A 2ALJA 2H1SA 3PDWA 3RBVA 4GZ3A 1GPDG 2PY6A 5KYXA 4LRTB 3PVSA 1SQ6A 3FOCA 3QRWA 5M7EA 1UBLS 5L45A 2XRFA 1P4RA 1V96A 4LE2A 5C1DA 2D2EA 2PANA 2UVPB 2E7ZA 3V4PB 2BJHA 2ONJA 1E7MA 4J16C 2QTZA 1SVLA 4DSOA 2WUEA 1OWPA 2UZ1B 3G23A 3HA2A 4EF5A 2Y1CA 3GLSA 3RIEA 1DEXA 3KWJA 4Y2XA 1P72A 3IUJA 5JSZA 1KKLA 2WMOB 2UVQA 3TQFA 2GRJA 2OCYC 3N0XA 4A26A 3Q7SA 5EE3A 5FAKA 4UJ3A 4ZO4A 1T6XA 2A5FA 1DBSA 3GG9A 5A0FA 3E58A 1KZ6A 2QAIA 2XGSA 2WLTA 3TQRA 5JT1A 3ZE0B 1O95C 1VRCA 2CMHA 2JGLA 3Q6IA 4O2LA 3IBGA 4LDZA 4JCCA 1BSVA 3C1OA 1Z6GA 1TVEA 2OFOA 3FNFA 4R2XA 3EFEA 4C7OA 5EINA 2IZ7A 3PRHA 3OZGA 4HWGA 2B1JA 4Z0HO 1Q1ZA 2G0NA 4GYWA 4ER3A 3E4DA 4DRXA 1A4IA 4YCSA 3OMWA 3AF0A 1L7DA 3A31A 4OHWA 3CB2A 3ZW7A 3EC2A 2FSFA 1U8CB 3PYXA 3QE0A 4UJ5A 4F2HA 2Y0BA 3AL0C 2VHQA 1YFKA 4TMYA 1PDOA 2BOVA 1NYLA 2NVUA 4K2AA 3KD2A 4I1SA 1JHYA 4JP2A 2OSVA 1SOMA 2G0AA 3P9IA 4JZKA 4U2DA 3HU3A 4LJYA 5AHOA 2OV4A 3ULKA 4R4JA 1XCLA 1HH4A 2YC2C 3EA0A 1V2GA 1GKUB 2RSLA 4IOKA 1KDZA 3VPXA 5TDHA 5FORA 4DV0B 3WK9A 2YN0A 3R09A 1KDTA 4D4MA 4L95C 2VXOA 3TW4A 1OAOC 3I2JA 5I6DA 1RHRA 3ZY3A 2W8BA 1KNXA 2JAQA 3W6PA 3BKXA 4JSTA 1NI3A 4TMWA 5HILA 2K5UA 4OLAA 2WK1A 3TD6A 4EL5A 1OC2A 1PYDA 1MCZA 2V65A 5IKOA 1CR1A 2NLOA 4AP6A 3BF8A 2WTMA 5KWSA 4DLAA 2KHZA 2GA8A 5FWAA 4AJ4A 1R0YA 3BD7A 3JTMA 3QEMA 3SM3A 1UP6A 2A33A 3JAWB 1MO6A 2ZS8A 5IKXA 2WMNB 1J8VA 1XIVA 1XXLA 3CUTA 4ZOEA 1Z2OX 1TCVA 4OGLA 2EX0A 4EHIA 4YYZA 3UF0A 4H08A 3OCWA 1CP3A 4MRPA 4JJ6A 4B7UA 2QTCA 4WZAA 2HO5A 4FGUA 3C3BA 3L4SO 3WV5A 5CA1B 2ECPA 4CFSA 4LVCA 2CNNA 3L0YA 2HCRA 2O9JA 3C3YA 1L4KA 3CJTA 1YIAA 2HA0A 2QAJA 3FKJA 3GGOA 3IQWA 4IQ8A 1BRMA 5JJIA 1OWMA 3L2OB 2AFVA 4COOA 4WEOA 2RK6A 4H0CA 5AKGA 1TLLA 3F4KA 3H1EA 1QDEA 1G6OA 2YWFA 3Q6MA 3TEMA 1A2QA 2MMCA 2YTZA 3LRPA 3G6KA 1AY0A 2Y0EA 5G02A 3DYIA 1DAIA 2BPOA 3C39A 3LBYA 2FU5C 3K0SA 1L7EA 2DTDA 2AUMA 3TLAA 5C7OO 4BLOA 3IDOA 1MXFA 2Z3VA 4IM7A 4PIMA 3VI4B 4AP5A 1SG9A 3F7NA 1B8UA 2WJ6A 3R3WA 2OLEA 5DM70 2NP6A 4OGKA 5EXTA 2I4LA 3LL7A 5ULLA 2HJSA 2BHSA 2DY1A 4MZXA 4U8GA 1E20A 1S7CA 2ADMA 5DHUA 1LJUA 1VHDA 4O33A 5I5GA 4DV2B 2SBTA 2O3QA 2Q5LA 3QVMA 4KUEA 1TAGA 5KMGB 1G4UR 4CGZA 4EHJA 1RWQA 3RS2A 3O92A 4LDJA 2V4ZA 5IM4A 4UTOA 1TADA 2RMKA 4FHCA 3BPSA 2XTZA 1OYOA 1U7XA 4OP1A 4DS3A 4U7WA 4ZEVA 1Q44A 2GQ0A 3WLFA 1IM2A 2Q6OA 1UADA 4J4BA 5KNBA 1H66A 1V3UA 1CUEA 5E7IA 5KWEA 3L4EA 5H9VA 6ADHA 1E5QA 3OLZA 3EBOA 2BBTA 3SDBA 2DAPA 2GBFA 4G8CA 4K9NA 5CA1F 1N8KA 4EVIA 3NRJA 3EPHA 1KDPA 3VR5H 4KYUA 1E3EA 4M37A 2E5FA 1ADGA 2BM8A 1ZH0A 2CL0X 3VR2D 1KI3A 5B58T 2BGKA 3PUKA 5KYNA 2YJ4A 3B3AA 4XE5A 2DFDA 1SCJA 3H9BA 4RK1A 4UVGA 4LOJA 2EJUA 3KQUA 4OP2A 2D2VA 5TQJA 2F8LA 1OU4A 3IE2A 5ENDA 1L1QA 2FZEA 5JBNA 3S8MA 4PCLA 3JQ6A 4NPHA 4CIBA 3H11A 3OA0A 5I7HA 3TB6A 4ID9A 1ZZEA 1RWMA 1RTKA 4DNPA 4YRDA 3SC3A 3KXKA 3HCWA 2P9HA 4WCDA 3TTYA 4JYBA 1BX0A 4D3YA 1ZD8A 5BSGA 2H2GA 2Q07A 1W0KD 4NCJA 3VR4D 1U2RA 2OVFA 4TQGA 2EERA 1HFEL 4UDYX 5BY2A 2OY0A 2BFCA 1K4YA 2QM3A 3NHUA 3BM5A 1G38A 2PX8A 2Z0MA 3CO5A 3FMIA 4BTEA 1KEWA 2AHOA 2B0CA 2VYVD 3A70A 3AUYA 4QJIA 3NOVA 2CUNA 3AEKA 1YHYA 4LOKA 3I1YA 3T38A 3ESZA 4WZ6A 1XMVA 4EGJA 1RAAA 2I6SA 3BRCA 2R6GA 4Z3OA 2BGMA 1ACMA 1ZU4A 2YMQA 1DWUA 5J43A 1X7YA 1Z0DA 5K6RA 3PXUA 1RM4A 4BNWA 4A36A 2W5UA 2XGGA 4E6EA 3SEQA 4M8NE 3GBVA 1FFXA 2JEYA 4TRNA 4MKZA 1N0VC 3IDAA 4KE9A 3CXUA 5BV2P 1R1DA 2VTEA 3RIYA 2BR4A 5A5VA 3LCUA 1O0BA 3K9BA 3TOVA 1WVIA 2XEDA 3DR5A 5EESA 4XGNA 2QMZA 4HG2A 1U98A 4BMNA 1ZW6A 2QTVA 4QNRA 4DLRA 4C6TB 3EGDA 3QITA 1CQXA 1DCMA 2VBGA 3C1AA 3FLMA 3ZXUB 3SVLA 4LHYA 5AESA 2NMVA 2GO7A 1POXA 3TZBA 2XUGA 5IM5A 3AERB 5NULA 3V2HA 2ZJ6A 5I9TA 3H5WA 3EGOA 2DHEA 5JECA 5ALWA 4UQOA 2H85A 1Y9AA 4JJ4A 5K5EA 4L02A 8MHTA 4IHJA 1QOPB 3CVYA 4KXFB 4Q4CA 2Q8NA 1AKVA 5FHRA 2VYQA 2FNAA 3GLKA 3KZVA 4RD1A 5EPUA 3A2MA 1XAJA 4WZZA 3BKWA 2H0RA 4JQOA 4ZO9A 1IH8A 1XNGA 2QN3A 3FYTA 4KYVA 4D4HA 5LXTA 2PUFA 1BMFD 5CCEA 2X0NA 1QGUA 4FLMA 1BD4A 1G7TA 1RHMA 1RFLA 2J5KA 2PN1A 2ZT6A 3ADOA 1IB6A 3MS2A 5TPZD 3EX7C 3S29A 2X76A 3EQ6A 4Z6KA 3BA1A 1LLCA 1UH5A 3LPDA 5CT8A 2VFAA 4PFSA 3IUSA 2FPUA 2YCBA 3V00A 2WBLC 4EG4A 5HUHA 3KYDA 2F1OA 3CF4A 3HB5X 1ZN8A 2JJ8A 3OQPA 3OOYA 4KEAA 3ROKA 3O8CA 4U9HS 2V45A 3CLSC 1YOBA 4U9IS 2XMQA 2C57A 2XNHA 1NVTA 3A4YA 1BG6A 1O9BA 4BZZA 4CHGA 2PS1A 1KVTA 2I87A 4QDUA 2IVZA 4HPJB 4MMXB 1FL9A 3SLGA 3WL8A 4F4JA 1F0PA 4A2PA 2I4MA 5ALRA 2DEUA 1OLSB 2WD7B 1SM4A 1UUFA 2FW0A 1EX7A 3RU2A 3RRJA 3OSUA 4MB2A 5I48A 4AO7A 2JVJA 1KA9H 1NURA 3QUSA 4RH0A 3VV2A 5G3ZA 1I6LA 4X71A 5CR9A 1EAMA 1J9EA 2QLBA 1EE2A 2FGKA 4QRHA 2VP4A 1M1YE 1MIHA 4LY6A 5DLEA 5E1MA 2AF3C 4JJAA 2YZ7A 1Q3TA 2OGUA 4MUKA 1D1PA 4CF3A 3LF2A 5KCMA 1R6VA 2GCEA 2JIMA 4QQFA 3I83A 1BOFA 2D2IA 3JQ7B 4GE3A 1H2EA 3R0IA 1J8FA 1QH8B 2BFBB 5K3BA 4A03A 1PW7A 5JZ9A 3RGGA 4CKZA 2QYHA 3W4IA 3R0ZA 3S2GA 3FFBA 2WG2A 1Q0ZA 3OOWA 3TMKA 3OF5A 3OFND 2NQTA 2VUSA 2F1HA 4M49A 4N7RA 4BOYA 1CUFA 1UWVA 4PCAA 2WUFA 4K6OA 3PEWA 1RQRA 1T3ZA 2OORA 2EL9A 4MYSA 2HMWA 1PFKA 3IUPA 1N3LA 4RFSA 2HAEA 1V9LA 2I2WA 3PFHA 1W9HA 4O08A 1ZM2A 2PIAA 3K20A 2M6KA 2L0XA 1V11A 4QELA 4C0WA 1X80B 4NL4H 4LHVA 5BR4A 1E3LA 3DO6A 2MTBA 2AFHE 1PJAA 4C78A 4AQDA 5CB0A 1UZNA 4HYYA 1SUEA 3N53A 3QW4B 4E5UA 3LGAA 3R6LA 1XTIA 4XDZA 4JU9A 1XZGA 3NHLA 1JX6A 4PO1A 1V1JA 3T5MA 4NBSA 2FI1A 1Y82A 4AJ9A 4AZ0B 2QMHA 1RWKA 4F38A 2M1ZA 2DT5A 2JK1A 3FSJX 4AKEA 4BFUA 3ZJ4A 3F7MA 3PCRB 5EE1A 3GMDA 4UDOA 1YACA 1UBEA 5TS3A 4A4DA 1DQPA 1B15A 2Q2OA 2RARA 3ILHA 4EZBA 2P79A 2VC2B 2R97A 2AE2A 2O8FA 1SCDA 2FXVA 3K73O 4TZ0A 2FX5A 1OGJA 3OTIA 2V7WA 1NVAA 4R0MA 2RBKA 4UASA 5F33A 3DV0A 1TA9A 4MV9A 1AQJA 1G0OA 1OX4A 2FMXA 3L40A 3T15A 5JQWA 3GLGA 3BFKA 1ZKMA 2ONCA 1ICEA 3RS5A 1A8PA 2CK3A 3A9WA 2I7TA 4P80A 4QXPA 3RHTA 3A28A 4ZMSA 3QLJA 5DYWA 1SXJA 2HK9A 3GDOA 3DEIA 3G8YA 1KH2A 3OZIA 1G1MA 1LUAA 3FCSB 1CR0A 1JEQB 3FKQA 4ZOLA 4B6SA 5KJFA 2WWWA 4ZOQI 4IILA 2C77A 5DASA 3RJTA 1XLTA 3RRFA 2WJ3A 5BWOA 3T9DA 5KVCA 1D5CA 1X7ZB 3DZJA 3EHDA 3LLSA 3TR6A 3X1MA 3PD0A 4CFZA 1T9GS 3B3QA 4DWJA 4CEJA 3P0RA 2O57A 4K6HA 1M1YB 1XDWA 2XJ4A 4GM0A 4BEBA 1JW9B 4XDGA 2H7XA 4H0FA 4MRVA 2ZDHA 2QI9C 3MJTA 1P5RA 2R6AA 3QVUA 2D7JA 5LP1A 1MQ9A 1P6XA 4IOJA 4OHXA 3MGKA 4BRUA 1KH1A 2C2KA 1EFTA 4MHSA 4BTLA 3C43A 4DIBA 3T7AA 4Q1VA 2FK7A 1M2WA 3B2QA 2YHUA 3FIJA 1TCCA 2OENG 3R5JA 3UT5A 4KKVA 3G6WA 3U62A 1WW2A 2RH4A 3WOHA 2HPAA 3N3AC 2ILTA 1QLHA 2D1RA 1MGOA 3TD9A 3T94A 2LDXA 5FDFA 4WXMA 4BJ3A 4IO1A 1UFRA 5CW1A 2JGFA 2P9YA 2YS7A 3P9SA 2Z8ZA 1OOEA 3AUXA 3RU7A 2V55B 3KQLA 3ORYA 3BN3A 1CZUA 5IUNC 2AFHB 3KHKA 2BFFB 4OYHA 2AI1A 2HBQA 2ZP1A 3IVAA 3IE0A 1L5YA 1XQ1A 3LUPA 4JC8A 4OKIA 3KR0A 1RI4A 2FOIA 3HB9A 4EP1A 3A3PA 1T9HA 4GPAA 4LGVA 4G1MB 2B37A 5DWVA 5H3LA 4CG2A 1EA7A 1JGTA 3LYUA 1DOAA 2OFXA 4PE5B 1JIQA 5TMDA 2JAXA 1KJJA 4MULA 5CJPA 1RJGA 2ZDGA 4BUJA 3U31A 2J3HA 4I5GA 4ZTBA 5D01A 1JJBA 4DA9A 1T13A 2X4DA 1W36B 4GW3A 3DMHA 3UWSA 3IAUA 5IT9A 3SI7A 1N2EA 3DTVB 4DA8A 2A7QA 3E7DA 4XOUA 3F5QA 3CF6R 3QJ5A 4LJKA 4Y18A 4ZQEA 3AVVA 5KNDD 4DHWA 1P9RA 3VKWA 2ZBPA 2W6ID 3P4YA 4FYHA 4NMMA 1XFAA 4JLBA 1LK0A 4MIOA 3ZHQA 1EXDA 1O94D 1TVCA 4E11A 1LDYA 2F43B 4DY4A 1YJ5A 3EEYA 4B43A 3N39C 1JPJA 5GOZA 3BHIA 1MABB 1TM4E 4MUNA 3RUAA 4D0SA 3VDRA 2OWEA 2ZJ8A 3ZUGA 3JZMA 2RGXA 3UWMA 3W5CA 1Y33E 2WZBA 5B3AA 2WI8A 3BZUA 4ZYVA 4YFYA 1U8UA 2WPNA 2OO5A 1I4EB 1E5XA 1BCRB 2R6ZA 1SC6A 1GA4A 1E63A 3BWDD 1JE1A 4FQ8A 3NM6B 4FEYA 4PZPA 4B4OA 2X2FA 3ODGA 4K6KA 2O8DB 4KZPA 1GSAA 3R7WB 4BNYA 1DSSG 4QWWA 3AHHA 3H16A 5AJWA 3VSBA 4AY4A 4DM4A 4V1CI 5IVPA 1CYDA 1FRNA 2WINI 3D5QA 5AKXA 3L8YA 1U2EA 2P4EA 5MFZA 4I7EA 4KREA 4QD3A 2GJSA 4EY5A 1RJ9B 1SG6A 2ERCA 4Q18A 3QMVA 4HDOB 1TT7A 3F71A 1VYVA 2C0PA 3I1JA 1ZD4A 2O0HA 5BOVA 1E1MA 4PG4A 1EIZA 1C0KA 3KWFA 4GLOA 4P32A 4ZC8A 1E4OA 3MCVA 1QR6A 2CSUA 2Q9CA 4KBGA 3DUFB 3O2SB 4QC2A 4ZALA 4AURA 2O5CA 1NLZA 3R5TA 3RV3A 4KFUA 3WIVA 2VP5A 1Z2CA 1E2EA 2WWTA 4FFBA 4C01A 3FMPB 4BFZA 1FX0B 2FOLA 2H5LA 1CUIA 3UEOA 2CW5A 4FR2A 4CQJA 3U44B 4AFNA 2ZSAA 3E8SA 1F38A 3JASA 2RB5A 1PFWA 2C9MA 4WUTA 4B76A 4D9MA 4TV9F 1V43A 3C2QA 1VDZA 4C03A 4RQUA 3IIMA 5DYIA 1OKKA 1X7XB 1ZKDA 1U63A 4E2WA 3NDBB 1ULBA 5EVJA 4HSEA 3WKBA 3S99A 1YQQA 4J1QA 3SJAA 5E7MA 3IILA 5CITA 4RVHA 4BMXA 1P4HA 1OFVA 3CLRD 4N6OA 4UM9B 2ZSBA 1I94B 3LHSA 1L7MA 4EB6B 4F4FA 1RRGA 4MAAA 4EF4A 2BZ1A 4EYKA 3O1LA 4JN6B 1YFJA 3PR3A 3UCEA 1I5EA 3E7FA 5KWIA 1G21E 2BZGA 1E3SA 2ZCJA 1LC3A 1YUNA 4JR0A 4EYGA 3W9UA 4CKWA 1RM0A 4CN9A 4DNFA 1Y1SA 1J97A 1Z2AA 3G0BA 1RXWA 3B82A 1KRXA 3VR2A 1SY7A 4MRMA 5JBQA 1F4VA 3C6MA 3MJCA 3K9HA 2ZETA 1M1NA 3A6HA 1OCEA 5DWQA 3ANXA 2R7MA 3VYRB 1GLGA 2GCOB 3GRPA 5TMEA 4DNQA 1NBAA 3TPCA 3FCXA 3I01A 1P75A 1E6CA 1XN4A 2GHRA 2ON6A 3KQWA 5EGNA 2Z1MA 2CHUA 4DW8A 1N5RA 2MIIA 5JSQA 4V3BA 1C3EA 4LNUB 4QEZA 1N6RA 3U56A 1V1MB 4KIJA 2OKGA 1SU8A 1RRKA 2X77A 4DR3B 5C5CA 2VRCD 1WZ2A 2WLSA 5CX4A 4KN9S 5LA6F 3X1XA 4BEWA 1W0KA 1DKNA 1XWFA 2ZQZA 4N5IX 4PVCA 3VR4A 4TXJA 2HBRA 4BNDA 3PLRA 4Q5IA 5IK2A 2W2KB 1UFOA 1S2MA 3T3GA 2Z6QA 2VYVA 5KJCA 1J22A 4LW8A 1NXXA 2AQHA 3UJBA 3Q3HA 5JNVA 3LHDA 1TOAA 4PZDA 1GQSA 1PTJC 2B21A 4MPTA 2QWXA 1KE2A 1IQPA 1G17A 2V6GA 4LXTA 4BMOB 2QLLA 1V1RA 2JDID 3KSRA 4TTPA 5KQMA 4GIBA 2HJHA 1BJKA 2G04A 3BE4A 4GOLD 3TO5A 5JZMA 2WWHA 2OFPA 1XRMA 5LOVA 1E9EA 1QWOA 2CD7A 1V2HE 1Z8DA 3H99A 2JHFA 5EMKA 5CFNA 2A3RA 2R87A 3RF6A 3KHTA 3NYRA 3I05A 2IRWA 1BHQ1 5CA0B 2DR3A 2ESRA 1DC4A 4BNTA 4GICA 5JQGA 4FPXA 3LUKA 3ZGYA 2BTQB 5JPIA 4Y2QA 1BQ3A 1EJ0A 1T26A 1P8JA 2AI2A 1JG7A 2JB9A 2QVLA 1XMQB 1S2GA 1KQ3A 1P0IA 3HCDA 2NUTA 3SX2A 3ZQ4A 5EHNA 4JMLA 5BSFA 4ZIRA 2ZRJA 4JI6B 3DMTA 2OAGA 2CXOA 4QDTA 3L6RA 1XVVA 4TN1A 1SC1A 2A1TR 5CB8A 3U6BA 1RRMA 2B5WA 3G17A 1JFVA 3ICWA 5EMLA 4L5JA 3CE6A 4AY6A 1VYHA 4ZRDA 2EF1A 3ZQKA 5FX2A 1G21B 2IEBA 2G0TA 3QPCA 2OHOA 4BZXA 5KSZA 2BGLA 4YONB 1OFUA 4B4KA 3DEAA 1WXDA 4I5EA 1KVQA 1GD1O 2Q41A 4MARA 3UYKA 3TZEA 2FVXA 1EDBA 3DAPA 4BFYA 4TZ6A 4B3IA 1FXWF 4UU0A 4NAUA 2O2CA 4Y1GA 4N7JA 1QO0A 4S2UA 1J2RA 3HCOA 4AYWA 3WK5A 4CMEA 4DIFA 1WSWA 4KWTA 2XCLA 1O03A 4NBVA 4UBIA 4M9RA 5SY4A 3L5OA 3UT0A 4BHTA 2D0DA 3V42A 3REOA 1ODTC 3WGUA 5IZCC 1D9ZA 1CUZA 4KODA 1U31A 4GPZA 3JARB 3EISA 1IWOA 2PUDA 3NHPA 3AP2A 3PK0A 2Z4TA 4C4PA 3L04A 1ZBDA 2NZWA 1DHRA 2DWPA 1ESDA 1PJRA 3GQVA 2K87A 3Q10A 1TUIA 4RH1A 3PPVA 2VVTA 1E7WA 2A9VA 1C1DA 1QAOA 1EK5A 1U1IA 1L4UA 2P30A 4FKMA 1YI1A 1YJAA 4UULA 5FO0A 4AS3A 1W4ZA 2CEKA 1NUAA 3OY2A 3VA7A 1KJ8A 2D5IA 4G25A 1F2TA 3B38A 3BIOA 4KH1A 4QXOA 4YK7A 1KK0A 1UC4B 1B3RA 3Q9SA 3HV2A 5DM2A 1RWXA 5CAEA 1MX1A 1EU1A 1Y4AE 4FT2A 2PQMA 1JSCA 2H7CA 4J94A 2IXTA 5KAPA 3AI3A 2C4HA 2I29A 2MYPA 4ZV9A 1KPHA 2HJ9A 2QMEA 3B6JA 4AAYA 3EWSA 4X94A 4ALKA 1MDBA 3ELUA 3ESRA 3AX6A 5E3HA 2DQSA 3SKVA 3KFXA 4JGBA 4TLDA 5E3IA 3HKBB 3R5XA 3RTBA 3VYUB 4XFJA 3ZQUA 2KYRA 5GY7A 4RCVA 1E5DA 4QSHA 1FFEA 3GNTA 2APJA 2A9PA 3GFFA 4Z99A 4IH9A 4ZPJA 1TRKA 1XU4A 1JEYB 1LBSA 1RWNA 4RMGA 4JBXA 3KB2A 1XAGA 1U90A 2CNBA 3DTVD 3VNBA 1GADO 2QTBA 2OV1A 3EQ7A 3KUCA 3BMNB 3PC3A 4FIZA 4GF5A 4QREA 4DOMA 1ORHA 2NNWB 3CZ9A 4QHSA 3QWHA 4V38A 2ZJ3A 5A4DA 5H70A 3VV3A 4HXFB 1IK6A 3CKLA 1MBZA 1JHXA 1X74A 3GAFA 2PZJA 1VGVA 5JYEA 4EUFA 1WXWA 3UWPA 3UQZA 1OZ0A 5JCJA 2PKXA 2BH2A 2ENWA 5G4KA 3EZXA 5FV7A 4MYRA 1KPIA 2ZR9A 1TEZA 2IUUA 4ND8B 1NUHA 2P62A 3S5UA 2GRUA 2TMKA 4AN0A 1CUYA 2IEYA 1WZEA 1UWCA 2WG0A 5A9SA 1XD2A 4RDHA 4RL4A 4WY5A 3OETA 2IQ5A 4TTQA 4JSRA 2XYGA 4XLLA 1LRLA 2GK4A 3CX6A 3EASA 2E4XA 3NHAA 4DGSA 3QKWA 1SKUA 3JAWA 4PIPA 1HOXA 2GLTA 5AVZA 1ULAA 2D59A 2HMUA 2GHTA 2VSYA 1QP7A 2YWGA 3KVVA 3DE4X 5B1SA 3IPYA 2BZSA 2Y68A 1NZJA 2OHVA 2X8BA 1V8PA 1V8FA 1Z0JA 4DBZA 1IUOA 5HF8A 5MGBA 3WIUA 3ZHSA 3IT2A 5EPOA 5CA0F 5CDFE 4QHTA 3SNKA 5LP6F 4G1BA 4TSKA 3GLGE 2OKCA 4RKYA 3KR2A 3PNBA 1B76A 4AG6A 4FN5A 1GZ7A 1O95A 1PN3A 2WMDA 2GYVA 5CT6A 1U0BB 1CF9A 1T9GR 2AOTA