3QTBA

Structure of the universal stress protein from archaeoglobus fulgidus in complex with damp
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
134
structure length
125
Chain Sequence
b'MIYMPIVVAVDKKSDRAERVLRFAAEEARLRGVPVYVVHSLPGGGRTKDEDIIEAKETLSWAVSIIRKEGAEGEEHLLVRGKEPPDDIVDFADEVDAIAIVIGIRFGSVARDVILKANKPVICIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Structural and functional insight into the universal stress protein family.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Structural genomics, unknown function
total genus 44
structure length 125
sequence length 134
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00582 Usp Universal stress protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3qtbA00
2VTBA 1JZQA 4HJXA 2Z3VA 5EKDA 2IJGX 2X0KA 3MUEA 3IMEA 1M8FA 1NURA 2A7XA 2DXIA 1N3LA 4J75A 4QRDA 4JYZA 1PFYA 4DDKA 3CLRD 3KT6A 3F3MA 1J1ZA 3FH0A 4F4HA 4QREA 1OWMA 1PFVA 4XFJA 3TNJA 3P0JA 3KFLA 2JAXA 1ZH0A 1J20A 1OBCA 1VBNA 3UOWA 1V8FA 4U7JA 1J70A 2A1UA 3UC5A 1OBHA 4MWBA 1R6TA 2YWCA 4YP7A 3FG9A 2OQ2A 2JANA 1N2IA 1XNJA 3C8ZA 1JMVA 1OWPA 5TEVA 3AKZA 1I6LA 2J08A 1EFVA 1F4LA 5JBNA 4NDAA 1KP2A 2J5BA 1F7UA 4HK4A 1WQ4A 1JEEA 2DPLA 4PBRA 1EFPA 3SYTA 4MW9A 3CLTC 4DDMA 1KP3A 2A1TR 2H29A 4ZCPA 2EL7A 1VLHA 4OJMX 5KHAA 1JGTA 1M1ZA 1ZUNA 3G5AA 1EUQA 1O6BA 3SDBA 3H99A 4JFAA 1YI8A 4JXXA 1MAWA 3KT0A 4MWDA 1YULA 1GTRA 2AG6A 4MVXA 1O97C 2I1LA 1TEZA 3CLUD 1D2RA 1ZH6A 1JILA 3HZRA 3CR8A 1GTSA 3VRHA 1N77A 3K32A 1IVSA 3PNYA 1Q15A 1LI7A 1H3FA 2XRZA 1QRTA 3LCJA 3KT8A 1TYCA 2A1TS 1KQNA 4KR7A 4R2LA 1G8HA 1N1DA 1Q11A 2QUKA 4R2MA 4EG3A 1O96B 4MUKA 1K97A 1MBZA 1O95D 3ND7A 4E1AA 4FZJA 3IVGA 4EGAA 5F23A 1WOYA 1H3NA 2A84A 1JZSA 4MUEA 1BS2A 3PXUA 2VTBB 3FHJA 1MB9A 1NP7A 3A04A 4ZCQA 4CT0A 3IOCA 1J1UA 4EG6A 4CDMA 3HMQA 4JZYA 3IVCA 4MUFA 3N05A 1JEDA 2OV4A 3COZA 4I6GA 3UY4A 4HJRA 3DV2A 1OWNA 2D13A 4NZPA 3ZXIA 1GZUA 1T6YA 1KQOA 5IJXA 2DEUA 5FO0A 3X1KA 3D6VA 5LFAA 3DPIA 3SEQA 2BYTA 1IRXA 3L93A 1HYBA 4BWVA 1T9GR 2D5BA 1SURA 2PZ8A 2QUJA 5AHWA 5J5AA 3TQOA 4EF6A 1O0CA 1K4KA 3ND5A 1PG2A 2A1UB 2R5WA 3HGMA 2DLCX 3FNRA 3ILVA 4MW5A 2HZ7A 2WB2A 4K0RA 1EFVB 1MOPA 3A2KA 4MW4A 1N2JA 2HMAA 4U8HA 2BTEA 1VL2A 3BL5A 3GMIA 4ZT4A 2O5RA 1IH8A 1EFPB 2QUIA 4X0EA 4MW6A 1OWLA 3IVXA 3NBKA 3P52A 4MUHA 2WSIA 3CVWA 2DETA 3ZXSA 3G59A 3S3TA 5FNZA 1QJCA 2VXOA 2A88A 1T9GS 2C5SA 4DE5A 1GLNA 1NSYA 4MW7A 3FETA 2PZAA 4QBTA 3CLSC 3HFJA 3ZIUA 4MW0A 4RUKA 1IQ0A 2IP1A 3FDXA 1TFUA 5KCMA 1FYDA 4MUIA 2ZUEA 3I05A 3IH5A 3DO8A 3TQIA 1H1TA 4ARIA 3CVYA 1Q77A 2CFOA 2CUZA 4ND7A 3U1VA 1NZJA 4UZEA 2G36A 4AQ7A 1NUQA 2QUHA 3UK2A 3SZ3A 5LLTA 1U3CA 2J4DA 1K92A 1WJGA 3IUEA 1XNHA 2J07A 2YWBA 1N2OA 3K9WA 1EJ2A 1O5TA 4YP6A 1DNPA 2PIDA 4ZT2A 1IQUA 3SP1A 3E27A 1YIAA 1WXIA 2CYBA 4NATA 5J58A 1QU2A 1KAQA 4NX2A 1I6KA 3MLAA 3SZGA 1I6MA 4PBSA 5HG0A 1M8JA 1LW7A 3ZJTA 3TZLA 1WXHA 2DUMA 4ZCSA 1JECA 4ZCTA 2E18A 2V0CA 2O8VA 2QTMA 4EG1A 4Q93A 5TEWA 2GM3A 4MLPA 4EG8A 1VBKA 1WQ3A 1WY5A 4H3SA 1QNFA 3OP1A 4CDNA 2PG3A 4ND6A 3DLAA 5H7XA 3HV0A 1R6XA 2QJOA 4A91A 4G5FA 1X8XA 2IELA 3RHSA 1YUNA 1P7PA 1IFXA 1M8GA 3CLRC 1F9AA 3H97A 4MUNA 1ILEA 2WQ6A 2TS1A 2AZXA 4NAUA 1KAMA 1YIDA 1TQ8A 2ZP1A 2CYAA 1S4MA 2QJFA 3RFFA 5DEOA 1MRZA 5DB4A 1N2BA 1YUMA 2E89A 3LOQA 4GRIA 4J76A 1KR2A 1TYBE 4U63A 5BNZA 4ARCA 2Z09A 4MULA 3VGJA 3AG6A 3IDFA 3Q12A 2ZUFA 3D6UA 2CV2A 4MQ6A 4R0NA 1G8GA 3INNA 4YBRA 5DASA 3TZEA 1R6UA 2X1LA 1KKUA 1G8FA 4PY2A 1U7XA 2B7LA 2E0IA 1NYLA 2E21A 4EG5A 1Q19A 4DNXA 4XSVA 2NZ2A 4AS1A 3ZGZA 2CV1A 3LE8A 3IODA 3SEZA 2NSYA 4EG4A 1NUUA 1KORA 4HPWA 2X3FA 5TGTA 1CT9A 1N78A 4DLPA 4OUDA 1N75A 3CLUC 4P2BA 1OWOA 1KH2A 1M8KA 1T6XA 3HL4A 4ZT3A 1MC1A 3GUZA 3RK1A 4F3RA 1WXGA 4EFKA 4WNYA 3RJZA 1O97D 3P0HA 3L92A 3RK0A 3N8HA 3RBAA 4L2IA 2RE8A 1V47A 2AKEA 1JHDA 5HUJA 1ZJWA 1QRSA 1WKBA 1GN8A 4ZT6A 1O95C 1X6VA 1O94D 5TS2A 3MLBA 3ISJA 3ZUGA 1JIKA 4YMIA 1F7VA 4CQNA 4ZCRA 1J09A 4KPUA 2YXNA 3H9BA 3M5WA 3MMXA 4PBTA 1QTQA 1XJQA 2PZBA 2CV0A 1TYAE 3IMCA 2CT8A 1J21A 1N2HA 3IMGA 3FIUA 3AIIA 1GAXA 1KH1A 2PXHA 2H2AA 3TS1A 4DDHA 1IQRA 4Q16A 4UZFA 1MJHA 2D54A 4RPIA 4WSOA 4JXZA 1M83A 1O0BA 3Q4GA 5K0TA 4MAFA 1MB2A 1N2GA 1WXFA 4NAHA 1FFYA 3N2YA 4MUGA 3N9IA 2GOYA 3FWKA 1U7DA 2HGZA 1K4MA 3ZJUA 2J09A 4I6JA 3CVUA 1U3DA 1JIIA 5LM3A 3AL0C 1I2DA 2CYCA 3KT3A 4I6EA 4GU5A 4DJAA 2XRYA 3NV7A 3QTBA 5IHXA 4KKVA 4MW2A 3PNBA 3QTTA 4YP5A 2RD2A 5J59A 1B6TA 2A4MA 3UMVA 1WZ2A 4MUJA 5DK4A 1QU3A 2YY5A 1TYDE 4ZT7A 2PFSA 4KR9A 4XFDA 1EXDA 1QQTA 1PG0A 2WQ7A 2CSXA 3H05A 3P0IA 3G6KA 1G59A 2X1MA 2GKSA 3CVXA 3MXTA 1VBMA 1QRUA 4MWEA 2QTNA 4OUDB 4G5YA 5KWVA 4MVWA 2QJTA 4MVCA 2QTRA 1T6ZA 3Q10A 5HUHA 4TS1A 1O94C 1COZA 3AG5A 3CLSD 3FY4A 2EJCA 1A8HA 2DERA 4MVYA 3FI0A 4L2IB 3X1JA 3JXEA 1H3EA 3X1MA 1NUTA 5FO1A 3OTWA 1JIJA 1UFVA 1LI5A 5H16A 4KPUB 3PRHA 1NUPA 1ULHA 3FOCA 4KR6A 2A86A 4EG7A 2DR2A 1M8PA 3A4IA 3CLTD 2Z08A 4MWCA 3COWA 1Y42X 4MW1A 3IOEA 1IHOA 1N2EA 4S1OA 3ELBA 3QE4A 1MAUA 1GPMA 4ZT5A 1RQGA 3VU8A 1KQPA 3GLVA 3CVVA 1OD6A 5K0SA 3NBAA 3ND6A 2JA2A 3CA8A 3AFHA 3IOBA 3ZJVA 1EUYA 3COVA 1NUSA 1NI5A 2V0GA 3IUBA 1PFWA 4G6ZA 3PNVA 1U0BB 4K03A 3COYA 3H9CA 3A05A 1WXEA 1XNGA 1O96A 1KH3A 1EE1A 1PFUA
chains in the Genus database with same CATH superfamily
1ZBQA 4PNEA 4B43A 1Q7CA 3CCBA 5BSUA 5JS7A 3ZCPA 2XWJI 3HA2A 3PR2B 2FK7A 4Y2HA 3W3AH 3AZQA 1HDYA 3GY0A 4A0GA 1W0KD 3I9OA 5HQTA 5JFOA 1UJMA 4MUBA 4HNRA 4H4DA 3OJCA 3OPQA 5L3VA 2B7CA 3MW8A 4RLQA 3TL3A 3K5IA 4DV5B 1IM5A 2WWFA 5F5LA 1A27A 4ZVKA 4F4HA 3EZYA 2GBLA 4GZ5A 1PFVA 4NQZA 1ADYA 4HUJA 1LBQA 1KI2A 3F8TA 2FSGA 4FVTA 3SXUB 2NAPA 3N1UA 4X64B 5K0GA 1E1MA 2DLDA 5B4UA 3BDAA 5IXYA 4L57A 3HDQA 1CWUA 4MO9A 3LSYA 4I55B 5BN5A 1SCDA 1Y7PA 2A14A 4IQ4A 1SVWA 4FFSA 4RPLA 1VE3A 4RZSA 4RS3A 5HE8A 1EUCB 1GRCA 3H3JA 1BIFA 1Q0UA 4HXGA 7REQB 3IPXA 4WOKA 5B1SA 3DEYX 4QASA 4K9RA 5KTRA 5DM0A 1O5IA 2VXCA 2RG1A 3K2BA 1S8OA 3B6ZA 1ATIA 1MX9A 4TVBA 1GNTA 4URWR 1ZMBA 3DMPA 5KI6A 1I2ZA 2C0QA 1QDEA 1QHHB 1RXYA 1SXJD 2Y2UA 3D5QA 3FTEA 3KQTA 3QLVA 1BJKA 1EFPA 2CF5A 3BRWA 3FHLA 1GNSA 2YICA 4NAVA 4PLVA 4NCBA 1YT5A 4LWOA 5F12A 3BDIA 2IITA 1UQUA 3D0QA 4FQ7A 5DV9A 1ZMOA 1J9GA 2W2VA 5DPMA 3H1TA 3U17A 3PX7A 4R1PA 3H8JA 4FDMA 5AXAA 4JJAA 1W75A 3GBSA 4MI6A 5A6SA 1KSJA 1H5UA 4UAGA 1DE0A 1NUHA 1KS9A 3AT1A 4JVNA 4N6GA 2O5VA 3KG2A 4JEIA 1CVIA 2YW9A 2VJKA 2R751 4JA2A 1E1KA 5A4JA 1ZRHA 3UAXA 2REXB 1C3OB 4BVHA 1OH8A 1GTRA 2G7ZA 3UV6A 1VKOA 5IYZA 3GJQA 5A2GA 2ZPUA 4C7JA 3AR9A 3I9KA 1Z38A 2I1LA 4UUQA 3VO9A 1OLUA 3IDZA 1XKXA 2FUCA 4PR3A 3W6ZA 3CT4A 3IE0A 3SVLA 2WU0A 3RREA 1PLLA 1PJ4A 1YI1A 2H1FA 2YQZA 3D2CA 5KDOA 4G9BA 3L49A 4LJYA 4KAAA 1ZN2A 1HDOA 5AHKA 3TLGB 4IDDA 2XRZA 2ZJYA 3TZKA 1IY8A 4IRXA 4TS9A 1G8KA 3LLMA 4GLJA 3R6DA 1FPMA 3EW9A 2DTXA 2C98A 2WFAA 2BSQA 2BWJA 1Z2PX 3REQB 4B3XA 2DT5A 4EGAA 1SHTX 1WOYA 2VTEA 5SYMA 2AF3C 1BS2A 2ID7A 4NESA 3RYFA 4C0LA 2YOHA 1MB9A 4KIWA 2OCGA 3FGOA 4OD0A 1HL7A 1QC5B 3IOCA 1PDVA 5CU7A 3K0FB 2Q1XA 5JAMA 2JJQA 4OGFA 4OJQA 4YQZA 1JEDA 3UW3A 4M0DA 3DV2A 3WGJA 2GESA 4NZPA 2RH4A 3MQ4A 1GQYA 5JXIA 3Q88A 4ZGBA 1FDWA 2J4FA 3WGYA 3NXSA 4BB9A 1DFHA 4EUFA 3G7UA 3HUDA 1J49A 4MWZA 2WJJA 2YQ5A 1IJFA 2EOAA 1X94A 4ZOEA 5HQ3B 3O9ZA 3V1MA 4YRTA 3TYXA 1SULA 3W6NA 1CRLA 2CXQA 4QXPA 3OX3A 1G21E 1ICEA 2YVQA 4ZD6A 3LT1A 1S3SA 1Y1PA 2GJ9A 5EXPA 2IHVA 1E3SA 2OB1A 4O1HA 3RF7A 1OAOC 2CLSA 4CTKA 4H1WA 5CX4A 2LKCA 4ZQFA 1NONA 2N1MA 2V7PA 2BTEA 4WGGA 3BDVA 3TTWA 1MQSA 2ZROA 4KFSA 1SKAA 1JQAA 2ZUSA 1N1GA 3KWLA 1UDWA 2ZKLA 1NI4A 4J43A 4L4RA 3TAXA 1R0SA 1BHJA 1YZYA 2WG0A 5KQRA 1E2LA 2WF6A 1VG8A 3GDGA 2CL6X 3MOSA 3NYIA 3PD7A 3DF9A 3IV7A 4HB2A 3ZYZA 2C8VA 2OSBA 3LPCA 1SFRA 1SXGA 4GP6A 3R76A 1A5BB 1L7VC 4YCAA 3U44A 1T0BA 1KNXA 5E95A 2F3SA 4MGYR 4DDTA 3RIYA 1LS1A 2VCEA 4ZP1A 3QJ5A 1YJBA 2EL9A 2Q5FA 4Z5XA 1O03A 1NSYA 1UR5A 1DG9A 2X3YA 3CEHA 1Y4ZA 4DLZA 2QNBA 2ZQ5A 2BFFA 1DCFA 3ECAA 4K26A 4Z1MD 1NT4A 3AMVA 4E94A 13PKA 2QM3A 4FFNA 1ISJA 2DPMA 2R68A 3NEPX 4CT4B 4JJFA 4TYWA 3ER9A 3FDXA 1XDBA 2FUG6 1Z4MA 3CWZA 3H2GA 3PSHA 3DEJA 1WMFA 3E3OA 5JCOC 2FFJA 3THYB 4W99A 4LF5B 4I4NA 2Q9CA 4PVDA 1DZ3A 4EI2A 4JOQA 2OFFA 3TQIA 3GVXA 4ARIA 5U1PA 4D9KA 4EBFA 5SZKB 4F8JA 1S6YA 3ZE9A 2Y05A 5A3RA 1PJ3A 1B2RA 3LRPA 2FSUA 4IIUA 5KPDA 3KE8A 3LKBA 3JWJA 3QWBA 1JYSA 3FWYA 3KXKA 5FRDA 1NUQA 3N8KA 4M1EA 3RRXA 1GGKA 1DKUA 1PIWA 2C31A 2CMFA 3A9WA 3EGIA 1U9IC 4Y1EA 5EEHA 1D2AA 3UUFA 5EP4A 5AK5A 3UB2A 1VCHA 2W6JD 1Z26A 3W6PA 2Q3EA 4HEJA 4OHBA 3BH7A 3C14C 3WGQA 1HXHA 4OJTA 4N6OA 2ACEA 3NHJA 2WTXA 4AYXA 3B7WA 5IBPA 1E3QA 4FI3C 2RH9B 2V6FA 4QBHA 1KEUA 2J5QA 4ESOA 5JNTA 1ZD8A 1EUDB 1FXWF 1PS0A 2AL7A 2PCJA 2VPPA 1V1RA 4JLJA 2WF5A 5LA6B 3A3PA 1S89A 5B5SA 2C20A 3TKAA 1SUIA 3B1KA 4B7XA 2PS3A 3ZBUA 2BGJA 1OZHA 3MOGA 4D99A 2LD4A 5CLLA 5CYOA 4D3ZA 3LYUA 4PFJA 4QHYA 5I9IA 1RNLA 2PNJA 3QPDA 1GRNA 3OG9A 4UCQA 2RK6A 3AF3A 2ZS8A 2PMCA 1L7BA 3HV0A 2BUCA 3QMVA 5C5EA 1AB6A 4YT8A 2CVPA 3TRDA 3W2GA 2WOJA 1XWWA 1VGVA 4RACA 3QI7A 4LC9A 1EGVB 2HNAA 2L18A 4Q4LA 4MQBA 4G8BA 2H0QA 4LMAA 3AY6A 4BO0A 2G0NA 2REQB 3ZCTA 1ZAYA 5HIMA 4HWOA 4W8GA 4AG5A 5KTMA 5K7SA 5DBIA 2FLWA 2FX5A 3MHPA 2ZSJA 5LSAA 2QXYA 5EOVA 1ECBA 3TECE 2X4GA 3IBTA 4KJXA 4HMPA 2G8NA 2PFGA 1YIDA 1EBUA 1MJ5A 4FZRA 1RDFA 1RS0A 4UXHA 4KQKA 1BN7A 4B84A 2AYYA 3WGOA 4E13A 2G5GX 4EHJA 1NM5A 4OMCA 3V8MA 1D04A 1YUMA 4C4AA 3CKMA 4RFVA 4FYVA 3RUCA 1ZU4A 1RQ7A 2DWCA 1J0CA 4M0CA 3C45A 3IKLA 4RJLA 3I32A 5BNZA 1UBSB 4LHEA 3V7WA 1BDBA 3NBMA 4KIGA 1NW7A 1PJQA 3IDFA 4HRYA 5SY9A 5K8LA 3FTCA 3PYMA 2FCRA 3GUUA 5HM6A 3SM3A 3UATA 1I3LA 2IS2A 2NTEA 3GT4A 4RAOA 1QZXA 1XIVA 3LQFA 3K73O 1LV8A 4TPKA 4IHKA 2VHJA 2RHOA 4JLOA 1MXHA 2YASA 3SYLA 2D1SA 3L9WA 3NC4A 4QUIA 1G3IA 4OB6A 3RLIA 3G9QA 1B1CA 5BSHA 1Z28A 4BUJA 1KYWA 2C99A 4I5FA 4KN8A 5FTWA 1IK4A 4PLHA 1SC3A 1K98A 2FOLA 1I36A 2E4YA 2IPAB 3C39A 2IYSA 4ENRA 3T95A 1TQ6A 2QNIA 4DWVA 1FEZA 1P60A 2APJA 2P2NA 2OQRA 1EDDA 3WWDA 1I5EA 1BS1A 1N4DA 4DG5A 1E7RA 2HX1A 2XYVA 4PAMA 1RVV1 5TMBA 4FYMA 3W90A 1D5CA 1QG6A 1JLRA 1P31A 2QT9A 3R7WB 5GWXA 4W1RA 3IDOA 2LNDA 4DJJA 3CRMA 3L1KA 2H31A 2DPGA 4BEBA 2YV2A 3U49A 3RJZA 4QZVA 3P0HA 2VDQB 4HDRB 4YTEA 1H2BA 2YJTD 4RMGA 1WKVA 4GLOA 4R2XA 3RRJA 1ISFA 3VZRA 5DYTA 4L2IA 4NSNA 2CE2X 4I1SA 5MGNA 1KO8A 1U3UA 1ZJWA 3UT5B 3MB8A 2OO7A 3VR6H 5KVSA 1NF2A 1WDWB 3OKFA 2W9XA 4E51A 4EG0A 4CIYA 4O3MA 2QJWA 5CT4A 3CRZA 1A9QA 3H1EA 2CNWA 2IXTA 2F3PA 3QH4A 1ZKMA 2QAGC 3BMNA 2EJTA 3WZMA 5AVTA 2O2XA 1NYQA 2XAUA 4DBLE 1LC0A 2BFDA 2YXNA 1L4KA 2YJNA 5EJAA 4TROA 3R3SA 5H3HA 2PZBA 3EIOA 3ZLUA 2WY2D 4HD8A 1B0PA 1RXCA 3OZUA 1GNLA 4WKGA 5D1HA 5JH7B 1G7SA 2OGZA 4Z4FA 3PC2A 1Z2DA 2BEJA 2ZUVA 4AO6A 2ZRHA 4RA6A 5ADUS 2D74A 4HFNA 4EJ6A 3P9QA 4LNAA 5EGNA 2ZYSA 4KW7A 1WZEA 2EFJA 3SHQA 3UOGA 3L40A 4IDQA 4IVRA 3F2VA 4KQXA 4Q3KA 5CD9A 3F5SA 1ZI8A 3AZOA 3HA7A 2CMDA 2D1TA 3OZIA 3BQNB 4U2FA 5E1DA 3C1AA 4A0QA 1YZLA 5HOEA 1JG6A 4BTLA 3HM9A 4M7RA 2FUNB 5I4CA 1K4MA 2VNAA 2AJ8A 4JJIA 3C4QA 2OFWA 3TG2A 1XDSA 1CZLA 1I7LA 1I2CA 2EQ5A 2IZZA 2ZIFA 3Q1KA 4OK6A 1GGMA 4PXYA 4P93A 1CZOA 1JU4A 2C57A 1TRHA 1W4CA 2I7DA 3AOEC 1NQTA 2E37A 4TZKA 5EA2A 3V00A 4DJAA 1ULSA 1V7PC 1JAXA 1I33A 3DYIA 4HGPA 4KKVA 4WHMA 4XIYA 1OYOA 2WNHA 2PCLA 3R3XA 4XGIA 3BT7A 3W77A 4MWGA 3I8OA 3ENVA 1DJNA 1ZC4A 3O4GA 4JJKA 1TM3E 2Q0HA 2WKWA 3P27A 4A92A 5BRJA 3PT5A 1FC0A 4XXHA 5C8DA 1J0XO 3KJEA 2FW0A 4UBMA 2AGVA 1W2HA 4K05A 1T8RA 1GPJA 4F5EA 4Q66C 1P80A 1V8OA 1E69A 3OQJA 5CB4F 3FSJX 5G2OA 1FY2A 4J4TA 3EDYA 1QCDA 4GL2A 2CSXA 2NNLD 4KXNA 4I9NA 3CF2A 4XJSA 1M74A 3AHIA 4BZZA 3BQ9A 5AM5A 5A4KA 3MWKA 5A5EA 5BOSA 2JRLA 3W9BA 1N3IA 4AP5A 5LQCA 3NKLA 1JSRA 4KQFA 2B37A 1YCDA 1L8OA 5FR1A 3ACBA 1UBMS 4Q12A 1FZTA 2PANA 1HSZA 3CN9A 3K6JA 3DLHA 1MOQA 4HXFB 5SYAA 5GJVC 3VHQA 4G0OA 1P7WA 1WS6A 3HCRA 4PVCA 4ITVA 4X1IB 3U7QB 1YB7A 2J30A 1R15A 2BCJQ 3H9EO 3X2EA 3OHSX 2Y1FA 4M1KA 3ADPA 2V9CA 4OH7A 2WIGA 1YC2A 3B6IA 2JFYA 4RTMA 3BERA 3OESA 2XZPA 1WQ1R 2FP4A 2AEJA 4TLBA 2HCBA 2O8NA 3FSGD 3LP8A 3UJCA 1GP2A 2MSNA 3IQFA 5YASA 4Y2QA 4PWZA 5TPWA 5ICSA 1R1DA 3RVSA 1QVRA 2J8ZA 4LGYA 1XPUA 4PCVA 1NQVA 1TU3A 3VO2A 1J2JA 4Z9FA 1EK5A 3I4FA 4M0MA 2XB6A 5KU1A 3O4RA 1T2AA 3I9FA 1ETHA 3P97A 3RS5A 4RWEA 3D02A 4AWXA 3W8FA 1EX6A 1EFHA 3PFKA 4V0RA 2UYHA 5AW5A 2GRJA 3ELBA 3HXPA 4LCBA 4MYTA 4RORA 4WN3A 3T15A 1CQPA 4A6EA 3R41A 2ZJ7A 4L28A 1O4WA 4JDPA 3R9IA 3ROPA 1FNDA 4RESA 2WTMA 3SXJA 3W4JA 5JZOA 4PZZA 2A94A 1I1OA 5LBUA 3A3KA 5MN4A 4DIBA 3UK7A 4QECA 3TMAA 3LZ6A 2QVLA 2X0EA 4XWTA 3A36A 1LBEA 4C7OB 2JFVA 1X19A 2C5BA 4JLWA 4IJ6A 2PS9A 5KX5A 2PT5A 4PC1A 1IHPA 4FFBB 4FEGA 1S2OA 1ZX1A 3SQXA 2J33A 4BP1A 1V9SA 2PUFA 4TQUS 1V4NA 1RBZA 3P4UA 3K0KA 1PVDA 4ZCIA 2VTBA 2O07A 2OO3A 1COWD 2JLRA 2QU8A 1X14A 3IMEA 4W5OA 2JFWA 5H68A 4GH5A 2ZWAA 4UBLA 4P34A 4TXNA 1NHGA 1G20B 2QRLA 3NC0C 1FSPA 4TYMA 5EESA 1USUA 2XEXA 3KTOA 4JQYA 5LP1A 3RAFC 3F7OA 3M9LA 3P1JA 3QEOA 3QHAA 3CISA 5TQ2A 1L9XA 1NP6A 1FK8A 4AUNA 3K72B 1BJRE 4GOKA 4XI9A 1N57A 3BMXA 2AOWA 1YL6A 1J70A 2QRPA 1ZJ6A 1OLSB 3KX2A 1Z12A 3AVTA 1Z8HA 3HNRA 4MWBA 4BQFA 1XDGA 2ADMA 3H1AA 4XM2A 3FVQA 5BR7A 4LJ8A 1DDIA 2W2KA 4HZUA 4BLTA 4G0UA 1H5QA 2JANA 4FKMA 1QGYA 3JQQA 3KVNA 5ALRA 3G5UA 3KD2A 5IAJA 2IT1A 3LC2O 1EFVA 4J8PA 5CDFA 5CDHA 1C3XA 3MGBA 2FPRA 5F76A 1S3FA 1UPCA 2CJFA 3TB6A 3ASZA 2GTPA 2QLMA 1DZIA 2X2EA 2YBDA 3O7MA 4YDHB 3A58B 1WQ4A 4QQNA 4TWRA 1W52X 1U0OC 2YJ6A 3EY4A 5JXGA 4OEHA 3D6MA 4DLBA 5JRJA 4GGOA 3U60B 1KF0A 2H7VA 4V0MA 2IK8A 2G5CA 2AN4A 3KYDA 2G63A 4OJMX 4AF6A 4XUDA 1M5UA 1RFLA 2ONJA 4RQAA 1WLYA 2OCBA 1DUSA 2R2GA 1T3TA 2WAYA 4HCJA 1SRQA 3GIWA 3H6GA 3LNCA 4L5YA 4QPZA 4D3XA 1PKXA 1Q95A 4NKRA 5A9SB 3JQAD 1PZGA 3WQRA 1GSHA 2DF8A 2RK3A 3ZK7A 3WY9A 1XA3A 3AJ9A 2A33A 2O48X 4PE5B 1E3DA 1NXVA 1MO5A 2CVFA 3AF0A 4PAGA 1XHEA 4CQLA 3NM4A 1ZH6A 1I5RA 4EY8A 3L7NA 2V7GA 3PFNA 5DYWA 3R8CA 4FFRA 3ZHRA 5TJ9A 4XIJA 2AZMA 2B36A 3P9YA 4OQZA 4GIBA 4E32A 1G5HA 3K32A 3D4OA 1EA7A 1IN6A 2I3GA 3EQ6A 3EULA 1GZ7A 4JT9A 4U39A 4Y2TA 5IMSA 1JKXA 1JG4A 1N0WA 1OJ7A 1BWPA 1TE2A 1TUIA 2VBIA 3KPVA 2FPLA 3U4QA 3UJ9A 1ZD3A 2IQIA 1N5RA 3JD2A 4K9SA 4OIMA 3AW9A 9GPBA 3HK2A 1HDXA 1M6WA 3GEIA 4URZR 3CCCA 1XX6A 4NS1A 2VTDA 3SHFA 3PYXA 4CMCA 1AKRA 2HUPA 2ZYUX 3Q8XB 4ETWA 1K7YA 1H3NA 1Z2CA 1ZNZA 4TV9F 5JCPA 5ISMA 1SC1A 1Y1SA 2GEVA 1QQBA 4U7GA 2EYQA 4XVRA 3VUFA 4KE6A 5FPQA 3X43A 4CT0A 1OB2A 3VC7A 2DHRA 4CDMA 4V2IA 3GLSA 2HLDA 4A26A 3E9DA 4I6GA 2QL5A 1NR1A 5DOZA 3VKFA 4ZRNA 4Z54A 4UTVA 2NUTB 4YMHA 1ZZGA 4ENSA 5FNVB 5LU9A 1ORTA 3W7AA 2E2WA 2BYTA 2O3TA 1IRXA 3CX6A 3QWAA 3M3DA 1H4QA 4RBNA 2GN4A 2VTVA 4G84A 4V0QA 4Y2RA 4BWVA 4L6AA 2PZ8A 3W1EA 1XKQA 1MJFA 5B3LA 3NH6A 3EGXB 4DV3B 2PUEA 1K4KA 2PSSA 3KZKA 4C07A 3MTIA 4KXFB 4BZPA 2QLFA 4KBGA 3UAVA 1OILA 1SCBA 4POAA 3BSYA 4XRRA 2RHDA 4ECEA 2XGGA 4B3DA 1YE3A 4WESA 3W78A 5JV5A 4AUMA 2WKRA 2JZNA 3MPOA 2WJ6A 1F1JA 2NZXA 1XEFA 2P6MA 1N2JA 4LAFA 1AE1A 2O0KA 3EIFA 5HJ2A 4G0QA 4MK4A 1JBKA 1RXWA 2EZ4A 4OJNA 3PF8A 2FPPA 3LY5A 2EARA 3F9IA 3RTCA 4NI5A 1ZK3A 2B4RO 4BLQA 3PL1A 4B81A 2Z8YA 1XTUA 3D4BA 3HCPA 2DETA 3R7SA 3ZXSA 5HIAA 1THTA 2QPAA 3RVPA 3EXHB 3HBNA 1XRJA 3FUCA 3LY9A 4LXXA 4ZQGA 3TD6A 1F5SA 4XYMA 4AQYB 3WWEA 1CLUA 4QFCA 4ZK2A 5JZBA 4ANFA 3B3FA 4RGBA 1ORVA 1TC2A 2GDJA 4MS3A 4KXQA 2JBAB 3IJ5A 3O92A 1G1AA 1OI3A 4NMXB 1GV0A 5CVCA 4D1YA 3GZNB 2DX7A 1TZMA 5D85A 4MW0A 3QKTA 3BB3A 2E49A 3VGPA 2M32A 1SQ6A 4X9XA 3SSMA 2AN3A 3F97A 3ROKA 2VQSA 1NQAO 2FWNA 3FYUC 4KC0A 4O2AA 3SMQA 4P1ZA 4JBLA 2XZDA 3DCIA 3BD8A 1VLMA 1E1CA 4M55A 3UJBA 3U19A 1G21B 2H5IA 2WMYA 2P9EA 3H86A 4OQMA 2XUOA 1B3RA 2ODWA 1OXTA 3PQ2A 2RAUA 4JQCA 4RY2A 2CUZA 2G1KA 1R0WA 2VBCA 2OHJA 1RACA 5EGSA 3I76A 2BKUA 2G36A 4YALA 4B35A 1QO7A 2EX1A 3AY7A 4ZCLA 4IAOA 2QM8A 4MPTA 4HO1X 4JLVA 2R6R1 3IFSA 1QG2A 1O6CA 2B4YA 3T7KA 1XNHA 2WE7A 3IB6A 3LHIA 2OM2A 4FI3F 4JX9A 1ODKA 2FN8A 5ALSA 5F77A 3URMA 3FGNA 2XNDD 4GGPA 2XCRB 2WICA 2WJYA 4QBIA 5CAEB 5HZGA 3CLVA 3GX1A 1T6NA 4Z4QA 4CM1A 1TZJA 4C4RA 4HLNA 4NNPA 4E31A 4NATA 3WYBA 4YRKA 3WGVA 3WLLA 1KAQA 1G98A 3BMOA 3L7MA 4LKOA 3ZJTA 1I0ZA 4FPXA 3KEMA 3TZLA 1RTKA 3FBTA 1VIYA 3F3KA 4FWTA 4OFBA 1V2HE 4RXUA 4B76A 3L02A 5C8YB 4YYEA 5C37A 2DR0A 5F64A 1U8XX 3D43A 3KSRA 3MJ4A 1GPLA 3LBFA 3NTLA 3TLYA 2IS1A 1XO1A 3OJXA 1J8DA 2JAOA 1CUFA 4EATA 4DARA 1G60A 1Z6PA 3IJPA 5LQAA 1W85B 3PQ7A 2WD9A 2OVBA 4FD2A 3ESBA 3ZHUA 4WN9B 2I7XA 2IELA 4AC9A 4KXWA 4IBOA 1PV1A 4EB6B 3RGWS 3SQDA 5FOWA 4A8JB 3O8QA 3NT4A 1WDMA 1NVGA 3KLPX 4AJEA 4DLSA 3D8BA 1VMEA 1K6EA 1FZQA 3I42A 2ID8A 2UU9B 4U6QA 3SHOA 3RRYA 4BUZA 4RPCA 4J91A 4EA8A 4QJ5A 3LQYA 2WFLB 4QAJA 4OV6B 2ZRKA 3OFSA 3L6BA 2XYPA 5I4IA 3G0DA 1S8AA 1DDGA 3RADC 4RU1A 4BVEA 5EP2A 1AF7A 4ZO6A 2YZMA 1E9VA 4FOOA 4HPXB 4RYDA 2EVWX 4L22A 4TTRA 1ECLA 3GAFA 3O3NB 5E6RB 4C22A 3A26A 4ZJYA 2QL6A 4P80A 4L5AA 3V1YA 4MJ7A 2B1IA 4M53A 1P81A 4MQFB 3MLEA 3PJFA 4NYMQ 5EJ2A 4ER5A 1XMSA 5TT0A 4IQ8A 2R25B 1SGWA 1EEXB 3M6VA 5CJ2A 1YS2X 1U80A 2PL1A 4IWNA 4JA0A 5BVGB 4X24A 5EYPB 2HRQA 3R23A 1KOJA 3D4IA 4GZMA 1DX6A 5BPFA 4RTJA 4AULA 3EWSA 3PYLA 1RYEA 2C95A 3MWJA 1NYLA 2VOJA 2ZKIA 3HEMA 4GPD1 3DV0A 3F4KA 3OI7A 4IS3A 2J6IA 4B45A 1Q19A 4CU2A 4AJOA 1GG8A 1YVRA 4DIEA 4AJ4A 1XZQA 1B14A 2J9RA 4R40A 4M1SA 4D4GA 4XQ0A 1F0KA 4DADA 1SBHA 4JR0A 3RFTA 1W5AA 5BNIA 2A2ZA 1R4NB 2FE4A 5TGTA 5CFRA 2Q1UA 3FMPB 3LO5A 2C4WA 1I14A 2ES4A 2A59A 2JD2A 3M5DA 5EZYA 2ZE6A 2UZ1A 1ZGCA 2W0SA 4P98A 5M5BA 1KJYA 5BSRA 4CVNA 3CO5A 2HK7A 3VV3A 4ZZ0A 1AZWA 3NHLA 5C5CA 5F2KA 4FE4A 2WE8A 4R98A 2ZE5A 4N3BA 5K4GA 4ER6A 4A7PA 3HG7A 1MNAA 2DUUA 2ZWVA 3NBYC 3QSGA 3EEQA 2EP5A 2IHZA 2HQBA 2RE8A 2B2NA 3C1UA 2OXCA 2ZBVA 1BMDA 1VKNA 5HKLA 4RTPA 2Y1LA 4BATA 1JHXA 1QIGA 1GQRA 1U04A 1LPSA 2DBYA 4JC0A 1IL0A 4OVKA 5I48A 4ZT6A 1MF7A 4XZ3A 2PYDA 3CW9A 1YDHA 5L51A 3RV4A 1N8KA 2O59A 1A2BA 1ZVVA 1CQJB 2PSDA 3WA6A 1KEKA 3ZBQA 2WI8A 3T3HA 1FSZA 5BQXA 4MYDA 2K4MA 5H02A 1FCJA 3X2FA 4G4GA 5KNDH 2CV0A 1FYVA 1YRBA 7ADHA 2YZGA 1NRXA 3MD0A 4G0PA 2Q2NA 2GILA 2GYYA 3QEMB 1G66A 1W5SA 4IXWA 4R01A 1KH1A 2RIRA 5HFNA 5I8WA 3E3NA 4R2IA 2O4CA 1R88A 2I80A 4RCYA 2O8DB 2Q6KA 4ZEXA 3ES9A 3ICVA 1ADGA 1H1LA 3HCAA 4CLEA 2D54A 1AA6A 3C5HA 4O4IF 3GEPA 5D3ZA 1I4OA 5EE9A 4BAGA 4ESEA 4FGKA 4BXOA 3KYBA 3Q4GA 1DTSA 5DJ5A 1TVCA 1T9DA 4AZWA 1ULTA 1WL8A 1HDCA 1UK6A 2WSSA 1RZUA 1T24A 3E9YA 4V24A 2OORA 5AM4A 4F1JA 2AXPA 3C48A 2BGIA 4JHXA 2JGKA 1HORA 2BFMA 3C5CA 4EUNA 1NQUA 3O95A 3GRUA 4OHPA 3AL0C 2G28A 3OT1B 1DGQA 3C6ZA 4HXEB 2HJHA 2N0SA 2NW6A 3GZJA 3KT3A 3MWDB 4KODA 4KQIA 4COOA 1ZJ4A 3I04M 2BKEA 2O14A 4RMJA 2JIOA 3DZBA 1RADA 3NANA 1W6RA 3P94A 4LV5B 5CPBA 5NLLA 5LMZA 3GGGA 1PFKA 2G1UA 3QENA 1U5BB 2WWIA 3I0MA 4M87A 5DTRA 4BP8A 1U9IA 2GXUA 2B2XA 2EEPA 1WZ2A 4PG5A 4KDEA 3EVZA 1Q0SA 1XQVA 1XZBA 3GUYA 3GF4A 1JR3D 1U4NA 3A4MA 3BA1A 3LI2A 3AESA 6Q21A 5IJAA 5KQGA 4ZOAA 1TCBA 3VR1A 1U28C 1WZNA 3HYLA 3HCEA 4OBXA 3GJ0A 2H48A 5CEEA 5KOJA 1EXDA 1QQTA 1FRNA 5KQLA 2YN0A 3DYVA 5D6OA 4D97A 4BB6A 3WNZA 2IYVA 1XZKA 1N9GB 2Q3DA 1G59A 5FA8A 3QHQA 4L27A 2P5SA 4KQEA 2XCOA 3SNHA 5DP2A 3KK0A 1G0OA 4ZARA 1Z6YA 2R7LA 4HGZA 2C84A 3LY7A 1WV0A 2GCOB 3FPSA 1ZNWA 4NE2A 4TWIA 3W34A 1ZHOA 2QZ4A 3PNMA 4GFDA 3LSTA 2QQ0A 2QTVA 1CC1S 2ZIEA 4C0SA 5FTJA 4B9AA 4K9QA 1D0VA 2P3QA 1H9BA 2JLBA 2QLNA 1WPXA 2WV9A 4B4VA 1AA9A 2CMGA 3MTAA 4NG4A 4MVYA 4HWGA 2FAXA 3L0BA 4PNHA 3IT1A 1IAVA 1IPFA 5E9WA 3W8NA 3X1JA 3QSYA 1AV6A 1XLVA 3DR3A 5F7JA 1BDHA 3N5KA 1OH7A 1X80B 3MCUA 3EFEA 2O1SA 3N2ZB 1FS4A 3ASVA 1QP7A 1UFQA 5INTA 4I8DA 1CP2A 3B9RA 4YI3A 4QKQA 1HUQA 3OC6A 1PR3A 3KFVA 4OLBA 4Z4EA 3N2KB 2PX6A 3RU9A 2IUTA 1QTRA 4U4AA 2BMWA 4EF4A 3KKMA 3OJ0A 4LGCA 1V39A 2ZCUA 4RQUA 4RZIA 1XSEA 5GMOA 2ZI3A 4C2UA 3I62A 4PHHA 2QL9A 1GSOA 1M8PA 3GRCA 5IKOA 4IDGA 5KYYB 3TN7A 1YACA 2PV0A 3ETHA 2YKGA 4K28A 4M76B 5IXSA 1IEQA 2FRXA 4MW1A 4MP6A 1OYYA 3KUXA 3H13A 3PC7A 1QAMA 1RRPA 2BELA 3FZEA 9ATCA 4LTDA 1IHYA 2FMHA 2QQ5A 2LP4Y 3GR6A 5BNFA 4M1QA 1MC4A 3V3TA 1M7HA 3ND6A 4XEHA 1B26A 3L6RA 5GZ3A 2CUNA 1G0NA 3F5DA 3TWOA 5IMBA 3ZWXA 1VKHA 4PLZA 4ZJPA 3A14A 3WI7A 4TTSA 1XU9A 4Z4IA 1XKLA 2JLUA 2R8EA 2IYFA 1TPZA 4C0HA 5JASA 5B7NA 1ST3A 2QF7A 2DQ4A 5DULA 1E79D 1NMXA 1F48A 2FN9A 3M6WA 4JBWA 4L72A 5FLYA 4PYMA 2Z04A 3DWFA 1K89A 1GKKA 1QCCA 3KUCA 4Q05A 3VVLA 4RJ2A 1T3GA 3VZSA 4B3JA 1W8DA 1G6HA 3ITEA 1B8NA 4Q3LA 5EKDA 5JAQA 1HOTA 3DL0A 2BGUA 2ZAYA 4O4JF 1Q92A 1VGQA 3P9IA 3ZE1B 1LNSA 4CUZA 3R8FA 2QR3A 3K92A 4LRXA 1NVUQ 5ARDA 3B38A 4F3CA 3UTDA 1C7IA 3MTDA 2P4UA 2E4XA 3E1SA 5AIAA 2O05A 1QKKA 3VBCA 3ZCSA 4BNJA 2D2EA 1DX4A 1KDRA 1ZRSA 2XWQA 3GC6A 1Z5UA 3JQ7B 4TKMA 1FVOA 4I4CA 1G3MA 3ZG6A 5FFNA 2I9KA 3GJTA 4AN4A 1D6SA 3ZCXA 1G5TA 5BSKA 1CY1A 2NXWA 4F5ZA 4FUTA 5L3ZA 5HX7A 5TQVA 1VTKA 1X8JA 2GUGA 4UVGA 1GNPA 1T26A 2VL7A 3QA3E 5D3MB 1XJ5A 3VI4B 1CS0A 2QN9A 1CB7A 1SXHA 2YWJA 2ATVA 1B0AA 1TIKA 4UVDA 1SD5A 1XHFA 3V8RA 4N8DA 4CV3A 4CG3A 1AUVA 3BB4A 2GB4A 5HPYB 4DV1B 1SOMA 1PT9A 2OHVA 2GWHA 1HC7A 1BC5A 2VYCA 3I58A 1ICIA 2FEMA 4JCCA 4QUJA 1NFQA 1UDAA 2QAGA 3SKXA 1Y1KE 3QOYA 2PO5A 5FL7A 1HDRA 3Q6NA 1F6DA 1N9KA 3DBVO 3K0BA 4HH0A 3WK6A 3TLBA 2NTVA 3G2JA 3Q41A 2H2IA 3N75A 4ZDKA 1YV9A 2JGDA 3PTZA 2OB2A 1LSJA 4B3CA 1XOIA 1TC1A 4JB3A 3IVRA 4GPTA 1CRQA 1P8JA 2V6JA 3CRVA 2HXGA 3HN6A 3RWOA 2NZJA 1N2CA 1P3JA 5A4DA 1KO4A 5FPYA 4A2WA 1YQ9A 4IH4A 3SDBA 2XRFA 3VR3D 2B83A 2AXQA 2VS1A 1GCAA 2W7TA 4F5YA 3K0CC 3DLIA 3CJTA 4BFZA 4PLYA 4Z7NB 3A1DA 3AEKB 3KT0A 3O8OA 4TKUA 3MRSA 4W1QA 1U8CB 2ZYTX 3T6KA 1WD7A 2CLIB 2JI6A 5FUMA 3T5PA 2R97A 5A2QA 1QG4A 1UT8A 3IV9A 3TRJA 4F38A 3IMKA 2FFRA 3DZKA 4H0NA 1O89A 5FI0B 4NV3A 5T67A 4BVLA 2DFNA 5CVJA 2O0HA 4DVJA 4G1VA 4H7FA 3Q7IA 4ZEMA 3OAAA 3TK1A 3ZY5A 1PZMA 1IXRC 1ZDMA 2B2CA 1RT9A 3AOEA 1NN1A 1Q15A 1LI7A 3NWOA 4DAEA 5IABA 3ILHA 4FK8A 3C6XA 4NDNE 4I4TF 3WIBA 4UUAA 1CE8A 4CIXA 1AB5A 3Q0TA 5AI0A 5IK2A 1KY4A 2JZCA 1Y1TA 3LT4A 1K97A 1ZM4A 4M7WA 2XUJA 1SVOA 4JX8A 3ZDYB 1CV2A 2NG1A 5LCXA 2YVKA 2ZPAA 3GJ3A 5D51S 1M6EX 2ZBRA 1JZSA 2OCLA 4DIDA 1K9SA 3PXUA 4TX1A 1IZ8A 3CRW1 1CERA 4UTPA 1AGRA 1F12A 1Q84A 1YH3A 2F1KA 2QSYA 2QVZX 3A04A 4GPBA 4P7FA 3UXHA 3P20A 2VXYA 4ITUA 5KQSA 2MYNA 1DG1G 3HMQA 2MHCA 3QG5A 2VDOB 4MKZA 3UAOA 3D3NA 1ZR4A 3GQVA 4D5GA 4PZUA 3TLKA 3W7BA 3D4PA 4LSGA 1EXMA 4LZWA 3ABRB 4QDJA 5BOVA 5FO0A 1BG6A 4X61A 3IX7A 1P5RA 2A9FA 2WJZB 3D59A 4JKYA 3BRSA 1LBTA 3NNSA 1I3MA 2DWPA 4HQRA 1FBTA 4R69A 3E1KA 2O8CA 1T8PA 1A82A 3BIXA 1N6RA 3ZE0B 1DEOA 4AX8A 3KNZA 4W1PA 3O90A 3ZWMA 4TGLA 4WASA 2DSNA 1JA9A 3GU3A 2YXBA 3B9BA 4C78A 1I24A 2Q8NA 3S2GA 3ED1A 2LVBA 1ZHHA 1ZVJA 3EQ2A 1LPAB 1JKJB 3URKA 1U5AA 2Z5LA 3PQ6A 4TKLA 1UMCA 1XZHA 4NJMA 2CLCX 4CL0A 1FF9A 1Z5NA 2VJLA 4RFSB 1EIWA 3GLFA 1AOXA 4HWTA 3GMIA 2AMVA 4I3HA 4YJ3F 4WKPA 4Q7QA 1FNMA 2PL9A 4C05A 4ARBA 2AOTB 5HCIA 1RQLA 4NOJA 4F3NA 3STYA 5BSGA 3E9RA 3F6BX 3PGXA 2VDKB 4NBWA 3S3TA 1BXKA 3JYPA 3KQKA 3WRVA 1BXGA 3SD7A 1ENYA 3I2IA 3WYFA 2HMWA 5AKYA 5JADA 4LRSB 4WKBA 1M2NA 1XZNA 3MAAC 2LCIA 1ONPA 2AVNA 3UUWA 1LLUA 1TLTA 4DE5A 1FJXA 3ABZA 5BN3B 2VXBA 2PZAA 3EW7A 5AHXA 1RM5A 3LK7A 4H6VA 3PHGA 3MIZA 3WJ2A 1R2QA 4AMUA 3U1TA 4FUQA 3HKCB 5IAAA 2OT3B 1K5HA 4RZQA 3W2FA 3HNOA 2BC9A 3NXKA 4E70A 4G97A 4GMKA 1BAPA 4RHCA 3VH4A 3RAPR 2ARKA 1VIMA 1VE5A 2WQZA 2W2NA 1YNSA 3IH5A 3AVXA 4G1CA 3DYBA 4RWZA 2ZB2A 1DC7A 4ZA2A 2UYOA 1B4DA 4JH0A 1UC9A 2H85A 2YZ7A 3CPSA 4OP3A 4IOLA 3ONDA 1II8A 1T3HA 3I2KA 1CQZA 4ND7A 4ED9A 2I55A 4UZEA 4IINA 1WP9A 4MIOA 1AHHA 4XA8A 5BV2P 4CR7A 5LYJB 1IZZA 3RTGA 1C0LA 4IGIA 3SZ3A 3GCXA 3SR4A 2H0RA 1PF7E 1FQOA 2GSWA 3GN1A 4K9LA 4RVFA 4RH0A 4RHUA 2MT9A 1EUZA 1LJUA 1SZJG 2WUEA 2ZU0C 4G85A 5EP3A 1R9JA 1LNQA 2CUKA 3C5WP 4KBFA 1EJ2A 1G5RA 5ALKA 1OIVA 1XCLA 2VJMA 1IBCA 4QVGA 5LOVF 1O5TA 1P7YA 1T4MA 1GPH1 1F2UA 1PR0A 2H4XA 2VNSA 3L7KA 2NUAB 3SICE 4D0RA 1ONSA 2OYSA 4BQEA 1IQUA 2HBYA 3O4VA 4Y0VA 3WVNA 3L4JA 2GLTA 4TXHA 3MJCA 5T41A 5L45A 2PXXA 3FBWA 3NWBA 3MLAA 3FUVA 2G6BA 4P6VF 3BZUA 3IILA 4UM7A 1WXHA 1R9MA 2DUMA 4D4JA 3RAGA 4P4SA 1U7WA 4ZCTA 5IKEA 3M81A 5KS2A 2DKNA 2B21A 3IE2A 3KQWA 2WWRA 2E18A 2J6BA 2XVAA 4RKRA 1S1CA 3ZI7A 1A5ZA 1X74A 4DQDA 4EG1A 1J0EA 1GFIA 4NNOA 1HR0B 4KRFA 2DFTA 1VBKA 3G8CA 3OP1A 1QS0B 2VAXA 4ND6A 1YVUA 2QMEA 4M60A 4R8MA 4G01B 1RD4A 4FFOA 3E9EA 3KOUA 3N5CA 2K5UA 4HH4A 1C3VA 1DXQA 2QJOA 3B9PA 1JAZA 1WRBA 3KZCA 4IFIA 5HSGA 3BXFA 2HRCA 1GNRA 3QLTA 2W2LA 4UBOA 3RO7A 4IDFA 4J29A 4YK7A 3KHKA 3AV0B 1KAOA 2IF2A 1Q1EA 3GD5A 4FSHA 2PDAA 3BIJA 2AV6A 3B82A 3GUVA 2WYIA 3D2LA 4H1HA 1WBJB 1USIA 3HSSA 4GKJB 4PGHA 3BSSA 1DTWB 1SQGA 3EQ9A 1GTG1 4ICIA 1AMUA 3NX4A 4FNOA 1DAGA 1B8UA 1G5QA 1SC4A 3O2JA 4CMGA 1DPGA 5JROA 2Z2IA 2I4NA 4Q47A 1I1QB 2H8KA 5C51B 2H4WA 1D4AA 4ND3A 4KE7A 2LCQA 1QX4A 2FH5B 3K6SA 4C2TA 2PZKA 3GNSA 4KQJA 2NU7A 3FNFA 2DAPA 3QPUA 4Y2YA 3ICOA 3RSLA 1NF8A 4OUKX 3N0TA 3RYCB 3T5TA 4LRYA 2ZRIA 3ZR4B 3P0FA 2I1QA 1M33A 5K3DA 4ND2A 3TOXA 2ZUFA 1EZZA 2B94A 2W48A 3KVOA 4CMIA 1LQUA 3A6GA 1CQIA 3D6FA 3CUVA 3SBEA 4U2BA 2FZ4A 4Y6QA 5JWOA 1P1HA 4GX2A 4PHFA 5H0IA 3MF4A 2QQGA 1JN0A 3H18A 4IZHA 1AK2A 4RLSA 3H16A 3OMLA 1X1EA 1X7ZB 2GPAA 4QGGA 4YAOA 1U2GC 2O3SA 2VJOA 3GFSA 4X7RA 3OHMA 1CYDA 3NHPA 2HW8A 3P45A 521PA 2IYTA 1JFFA 3NRCA 4CN8A 3GARA 1BFDA 1OTHA 2A0KA 4J16A 5JSYA 3OM1A 1MVOA 4LW8A 4DLRA 4OKSA 4DNXA 1MHPA 3F4LA 5A4FS 5FTNA 1HFWA 3HJTA 2ZUTA 4F11A 5DN6A 1LW6E 1N5KA 3QVVA 5IH3A 1XCPA 5JMOA 4J0HA 3X1YA 3C6KA 2ZU6A 2W2XA 1QIJA 4EMBA 3QEAZ 3BBPA 5I3ZA 2PBLA 3EG9A 5JXWA 1F5NA 4YCSA 2ZIXA 5KNCH 4KHPB 4YXWA 3D3JA 1N75A 1J2RA 2A6PA 2GR9A 1R0LA 2J9ZB 2QRHA 2XWBF 2OFXA 3F5FA 3NUZA 3HB4X 4IWYA 1M7BA 4J7AA 4EBBA 5FUVA 3I45A 4NV1A 4XCVA 2ZATA 1KI7A 4AS3A 1QNLA 1WXGA 4MI3A 1U0NA 2HXYA 4K86A 4WV3A 2WABA 1M0EA 3H5AA 4F56A 2X9VA 4X1KA 1XP8A 3A6DA 2QMYA 4JC5A 1OH5A 3E8SA 4JCOA 2GCEA 2DUNA 2OV6A 2AR9A 4ODIA 2PH3A 3N6VA 5IC5A 4DKJA 4YIKA 2J3KA 1ESZA 4QAQA 4QYIA 2UYYA 3PUXA 1NAHA 1UANA 1C80A 1JQEA 3AETB 3Q8KA 1ODJA 4YMIA 1Z06A 2XCUA 1CVLA 1MX1A 3N6RA 3QEJA 5TQ0A 3LXRA 3ZHZA 5T64A 1UZUA 1H8HA 3MK31 1A4UA 2F59A 3AUJB 2HJRA 3JQEA 1SCKA 1U9YA 1MG0A 2OP0A 1EVEA 3I5UA 4GOOD 2FPXA 4KQMA 1DXHA 1OASA 1SEPA 2Q3MA 4LV8B 4KH0A 4ZQHA 4ZVSA 3SE7A 4EMTA 2PA0A 3Q5GA 4NPHA 3ZVKA 2BEWA 1UPBA 2ECQA 2YWDA 3STUA 3KDAA 1KSGA 5BWOA 4YASA 4QTZA 3VTFA 3SF0A 4FHEA 4YLGA 5FUBA 1Z29A 3ZZUA 4AY6A 4R1QA 4G1EB 5CX1B 1ZS9A 4IRMA 4LISA 4DG9A 2A1IA 3G2PA 3G2LA 4Q19A 2HBZA 1EVYA 3U81A 5IEBA 3EGWA 3TCNA 5AD1A 3UANA 2C7PA 4JXZA 2ZYWX 4NH0A 5C81A 1O0BA 3D0OA 4QPPA 5EMMA 4QNRA 3UOAB 2C5AA 2GFQA 4GD3Q 5TB5A 3GFTA 2VWHA 1DDOA 5HHTA 2FP3A 1JA1A 3BE6A 3SSAA 3WOVA 1U2TA 5JS2A 4ZVNA 1M72A 3OCYA 4HEHA 1XAJA 1NRWA 1NULA 1H2RS 1U3DA 3CVUA 1VJTA 5DGHA 3W1WA 4E3ZA 5B6IA 1WDTA 1I2DA 4B7UA 1BE6A 2AOVA 2A9KA 3PNQA 4OGKA 3K9FC 2YS6A 4CE6A 5DXJA 1E2MA 1PX0A 5F21A 2QIPA 2E9SA 5EMJA 1AM4D 4R3NA 4GAEA 2NYVA 3DW3X 1TM7E 5AK6A 1GSIA 3QTTA 1BN6A 1QE5A 2NO5A 4MPPA 2OYRA 3VR2A 5F73A 2NUBA 3MPUA 1JG2A 3NNNA 5GV7A 1YE8A 5TR9A 3ZWDA 4KUHA 3UMVA 4BTVA 3ZD7A 1XNQB 3GFOA 3IPRA 5BWNA 4CKXA 1Q91A 3L04A 2C9ZA 1W4RA 3HB7A 4FX5A 1FQWA 3LCMA 2VK1A 2NZVG 5DLPA 5I5GA 3V97A 1L4LA 1QX3A 1Z08A 4HFRA 4P33A 2J41A 4WXHA 4YR7A 1WB5A 2OCAA 4PG8A 5LZ2A 1A97A 1J0BA 4AP9A 4WI1A 1ISHA 2ECFA 1DKMA 4NXNB 1U0RA 1B1AA 2B92A 2QW8A 5FTLA 3AL2A 1ZSVA 2ZTVA 4BGEA 2J3IA 4GOND 4WKCA 3TH5A 5C1DA 3EB9A 4IOJA 5I01A 5DTQA 4TV8A 4OUDB 1K0FA 3UIEA 3H5NA 4JLAA 5B1HA 1I80A 2QYHA 3AB7A 4PR0A 1I7SB 3GDFA 2Y3IA 3NETA 4IGFA 4X94A 3GOQA 4CXMA 3V4FA 2AHRA 4QUKA 2RHMA 1COZA 1DAIA 2REBA 3B7GA 2PMFA 3RB8A 3VHRA 3CF4A 3VPGA 3UBMA 3F7NA 4L4ZA 2ISSD 2IEIA 4RHEA 1J5PA 3P9CA 2DY0A 1GRVA 3IIEA 3TRKA 3OZBA 1PGNA 5CDFE 1MH1A 4YY3B 1GWNA 2VQFB 2EWVA 4AZSA 4EECA 5CVUA 4GE0A 3ZWBA 1TKCA 2O2ZA 3ZNQA 4CM9A 2GS9A 4J7XA 4NFYA 2AOUB 3GLIB 1K2VN 2NSLA 5JCJA 1KFJB 4N0DA 4LFAB 5JYEA 2FK8A 1IUNA 4N3NA 4V0ME 2NU6B 1NVKA 4O63O 4IIEA 2QW1A 1G2OA 1E6CA 3PR1A 3TX6A 2YHSA 2F8SA 2QQEA 1HEYA 3EC1A 1RWXA 2WNIA 3PQ3A 1FOEB 1UUFA 5FYQA 1P77A 1JDJA 1A88A 4N0PA 4HNAA 4MEJA 1QWOA 2C9MA 4U7TB 1NLFA 3AUYA 4NYJQ 5AIBA 4YLEA 5JS1A 2Z9CA 2J4CA 3HC7A 2JW5A 1ORWA 4DSAA 2OPBA 2NPFA 1FYEA 2NZYA 2FWRA 1E62A 1G17A 1E1NA 4BNXA 3GLVA 1SU6A 2IEBA 3LT2A 8ATCA 1IYZA 1JDSA 1PE0A 2NT4A 4QQKA 5EPOA 2IYAA 3C3PA 1I2BA 2AXNA 3DUFB 4KL8S 1EUYA 4AY4A 4KQ6A 3IUBA 5LDHA 5IBCA 4G3XA 3G1TA 3IQXA 4YMLA 1E2GA 5LMUB 3RUHA 1XQXA 3EBPA 1YBVA 1K06A 4E1BA 2O7NA 3H19A 3OA0A 4U2GA 2AIRA 2IIBA 3PGJA 4UEJA 1V95A 4FLEA 5ENZA 3PPYA 1OCEA 1ZM3A 5ALVA 5DM4A 5KMGA 2J45A 3NAGA 5TVGA 3O21A 2E55A 2IXFA 3M9WA 3MUEA 3T4EA 4EKNB 5KNBA 5DCLA 1XEAA 4WZAE 1WMDA 1QK5A 5J4VA 3SE0A 4S1NA 3SQLA 5BUSA 2WKQA 4R1NA 1LQ2A 4G1BA 4EPYA 2HF7A 4OXYA 1CUGA 3BE4A 4A8PA 4D4KA 2WFZA 2P4EA 3O8RA 1D5WA 3F3MA 2J0VA 4TLMB 1IULA 2JAUA 3JR3A 4OSPA 4Q21A 4Q9NA 4MR7A 5ARCA 4MHOA 1E5QA 5FEUA 2Q27A 3ZWWA 1J56A 1PR1A 4KTVE 4M99A 2RONA 3D1JA 4F7WA 4YYZA 3BGWA 1VBNA 2IHNA 2B69A 4M9RA 1PQ4A 1VP3A 2GZMA 1XTPA 2JIPA 3EUAA 4WEQA 3D2BA 2W43A 1XF9A 2P3SA 1NLUA 1VJDA 1Z0SA 2YDYA 1JFVA 3H4IA 3H3XA 5C4GB 3NTRA 3ONEA 4GUDA 1V16A 3FRJA 3WQBA 4ZGWA 2HHJA 3S1AA 1YJ8A 2P2SA 1KJWA 1WHSB 1JMVA 1DB3A 3N53A 4HDOB 3AKZA 2QX4A 4F2GA 1VL0A 2PZJA 4CN9A 1K63A 1QHYA 3D8RA 1V45E 2HDHA 2H51A 3KEFA 3TQSA 2CLKB 3S5UA 5IVKA 5K0JA 1JXOA 1JEEA 1NP3A 3C3CA 4F92B 3F90A 5K8TA 1N32B 1BSVA 1E9RA 1WHTA 2HXSA 4PEVA 4B79A 4PICA 5CLJA 3G3EA 4IO1A 3MELA 1ZA1A 2H29A 4L08A 2PUWA 4WBXC 4ZCPA 5DLYA 6AT1A 1U2PA 2HLHA 5JVDF 4GGMX 2V5AA 5HF5A 3VDNB 4YCDA 1ZUNA 2JJMA 1R5OA 4M98A 2P40A 2JLXA 2MYPA 3R44A 1Q7BA 4MYHA 4RVUA 3T7RA 3V8EA 3BH6A 2FW1A 3UK0A 3ADCA 1Y6ZA 3VHLB 4WW0A 4JXXA 1YULA 3L1VA 4FFMA 3ZDZB 5FPKA 2HK9A 4RD1A 3WR5A 3ZZTA 3KQPA 4LY3A 4M88A 3L0ZA 4CV0A 3LF1A 3H04A 4PG4A 4LF8B 1DQPA 1NGSA 3O31A 2C3YA 1NJ8A 3HA3A 1F8YA 2DHEA 2JA1A 1G8MA 4PG6A 3CU5A 5DNAA 5JNRA 1R74A 1YQXA 4G81A 2VPQA 2VH5R 4UTRA 3RFXA 2H2GA 3DXXA 3K9GA 1SPBS 4GI7A 4GRAA 3LCJA 4J2OA 5KINB 1KY2A 4IDBA 2A1TS 4Z99A 1EJ0A 3IMFA 3I1FA 4YRPA 2CL0X 2R00A 4MRPA 4TTTS 4AROA 4DBVO 1ITZA 3TQHA 3U7IA 3ZU6A 1U7PA 4CDGA 4PFSA 3VH3A 2YHBA 1KVSA 2IYXA 4TYYA 2HWUA 1PJ8A 3N2NA 1QE0A 1CZKA 2WMNB 4JQZA 4F0JA 4IMPA 1KEWA 2EDAA 5A03A 1L7QA 1CIJA 3CWQA 4RDIA 4BIIA 1ZSYA 1SO8A 2BUBA 1WBBA 1BXRA 4QYXA 4IUDS 2WD7A 4LNHA 2ZRMA 1EE9A 3DMRA 1SQSA 1CZRA 4PX2A 4ENTA 3KBOA 4YRMA 1I0LA 221PA 3H3FA 5DDIP 2CXPA 5G0WA 2OO5C 2WMOB 2YMMA 3K6RA 4INAA 3V8QA 2ZI5A 5TLSA 2H1HA 1H42A 3IQIX 1FDVA 3LQ4A 4MRSA 2ZIZA 4CMJA 3C6BA 3X1KA 1G55A 2PU5A 2HFKA 2RGUA 4FDVA 3C2QA 3HBFA 3SJAA 5FQNA 4RMHA 3S2YA 3A9UA 4Q1EA 1HYBA 2TMYA 1P1CA 3A1CA 4XB1A 3OBIA 3T5BA 4QFMA 1MABB 1IQPA 1QGZA 3RHTA 3OJOA 4QEDA 4RENA 5CG2A 5L9AA 2VNHA 3MINA 3WE7A 2EXXA 1E7QA 2HUNA 2IP2A 1US8B 3ONNA 3ZDQA 4F7DA 1ENZA 5GIPE 4NU8X 4BPRA 3GPCA 3KYIB 3FPHA 3K9CA 3OQVA 1SU8A 3ZY4A 4F1WA 1KYQA 4NENA 3EHEA 2PKXA 1MJNA 3T3GA 2WLTA 1KYZA 5L7WA 1IH8A 3BKXA 3TIXB 1UK7A 2EJBA 3CSSA 4W4TA 2GTHA 5E0OA 3JQ9C 4FOSA 4J7UA 5CA1F 3I9JA 1GCGA 1UBJS 2VZEA 3WC4A 4MUHA 3WDKA 3MJEA 1YDGA 2OECA 5HDQA 2CMHA 4E12A 1RKBA 2VTKA 4QLBA 3ABQB 3W3AA 5H4HA 3W2TA 4D02A 4XFKA 4UBKA 5ALTA 4UEKA 4E33A 4OPMA 4YJKA 5HMMA 2H7CA 4QOEA 4AL4A 1A1SA 4C88A 4EMSA 2CEAA 4NMLA 2PNFA 5EJGA 1YS7A 4P4NA 3T7TA 3A28A 2LPMA 3BIFA 5BQFA 4YHBA 2H4JA 1FTGA 3UHJA 4B32A 1I7QB 3ZIUA 2COEA 2XOKA 2AMYA 4OXQA 3QELB 1KMHB 1ZMRA 3DBHA 3IBCA 2CDBA 2LCFA 3L8HA 4I46A 4RUKA 1T8UA 2AR7A 3AFGA 3PC4A 4C5BA 2SECE 4KLRA 3IIMA 4OYLA 2ACWA 1LTKA 1NPTO 2NQ2C 3L7JA 3QWHA 4UDNA 4DSOA 3JQFA 1Q6ZA 3KJIA 4XASA 3IUYA 2HMTA 1OX4B 1GZ3A 5C7YA 3QM1A 1EDBA 2PPLA 1X7YB 2Z6QA 1YZTA 5A5GA 3TFOA 2B3DA 4HDMA 4CL2A 3SBOA 2ZAGA 5EIBC 1DKLA 2GFIA 1IMOA 1EVQA 2VHZA 4Y7CA 3UCXA 1XU4A 4O4HA 2MINB 5EZ6B 3VVCA 1QH8A 3IEMA 2PWZA 3ETNA 5HR5A 2IA5A 1UFKA 3K9WA 1GARA 2R1TA 5DIFA 1W36C 3PK0A 1XRPA 1Q12A 2CB9A 2ENUA 4BKQA 2I2AA 2PSHA 1MQ9A 1QAQA 1OC4A 2Z43A 4MVJD 4MZXA 3L4KA 3QXHA 2JD0A 3GI1A 1QIFA 3OU7A 1I6KA 1PJLA 2Z95A 2PLRA 4QBFA 4TWBA 4B5KA 4BEJA 3FNBA 3WL5A 2AJTA 2X1HA 1W47A 3JD4A 3PC3A 3EGDA 3GOHA 3R6GA 1ZQ1A 2V0CA 2AN5A 1JHQA 3ABSB 3R3YA 4WZBA 3SLKA 3TXYA 3WB2A 2YINC 3IQEA 3JARA 4Q93A 1YBAA 3SWWA 3R09A 2VWGA 2VHVA 1XRSB 4GUAA 2BGLA 2HWXA 4JB8A 1Z6QA 2I8AA 5A0FA 2W2QA 3LIIA 3PHHA 3LKVA 5E3HA 4P5DA 3ER6A 4H31A 3M49A 1UP4A 3WGNA 1J6UA 1RBMA 3I34X 4B33A 2RGRA 1MN6A 2PWPA 1CX9B 5GONF 5K2MA 1HLDA 1P9WA 1Y3BE 3NGXA 4L8VA 5BVHA 5BQOA 1XQ1A 2WILA 1M0WA 2C7OA 2V58A 1DWPA 4JGIA 4MUNA 5FB3A 2PKWA 2YV3A 3P71T 1Y4SA 1LRKA 3N8NA 2WVAA 4QTXA 2G76A 2A35A 3LFHA 2AZXA 3FMIA 1IBKB 2XMBA 3VR5D 3RFCA 3AQ4A 1MGPA 5AKEA 3WWCA 4GQIA 4EB0A 4UMVA 5DEOA 4ZHQA 2QVXX 4IJKA 1N2BA 1TJ4A 4W9NC 2X4IA 3CH5A 3VX4A 4CMAA 3JQBA 2WF9A 2DLNA 1KZ4A 3A1SA 4Z0HO 3VFDA 4YRDA 4WFQA 4BX0A 2XYRA 4Y1FA 3D7KA 4LYJA 2GMWA 1T3SA 1ZCJA 3MD9A 2RGEA 4GMGA 2CV2A 1Z5WA 2LRHA 4HWRA 1U1GA 2GYWA 1Y37A 3NHKA 5CTAA 4PZEA 1FQKA 1JX6A 1XRMA 2N1BA 2CJYA 3H2ZA 3IXMA 1NT2A 2VZ9A 4PFKA 3TW0A 4F8YA 5GVSA 2XLBA 5LIPA 2I1VB 5FBLB 5J2TA 2IOQA 4JLPA 4R4JA 1P0QA 5ALMA 3SJUA 4LNUA 2VO1A 4GDMA 2NPIA 4HYTA 4DCNA 5ITSA 4EG5A 2FMTA 4G26A 3C3YA 2AG0A 4Q1DA 1TT7A 3CNBA 4G63A 1E8MA 4R7GA 2WZDA 2CBZA 5KDLA 1CUSA 1GT6A 2X4LA 1ABEA 1DO8A 3BXZA 5AI5A 3QXGA 1UDXA 3VZDA 4H2DA 4X3OA 1Z4JA 1M3SA 1E20A 3NVMB 2CMKA 4HX2A 3T7JA 2HDWA 3LZCA 2BGWA 1L4FA 1V3QE 4NP6A 1JF8A 2V3WA 3G2IA 1RI4A 2GYVA 3T3OA 2R6HA 2RHBA 4MB6A 4YJGB 2VHTA 3QUSA 3E9CA 1YRYE 2IYOA 2V6GA 2I3AA 1VHDA 2HWYA 3JYOA 1S2GA 2C2XA 1FU4A 4IICA 4FR2A 1TGYA 2XHZA 4LI0A 4N82A 2WWTA 1DBSA 4AYWA 3K2EA 3DTVB 2QP4A 4NJEB 4LX0A 1U4OA 1JVNA 2FR0A 3OT5A 2A3RA 4ZO4A 5HUJA 2AI1A 2BDTA 2QB5A 3V42A 5JARA 1W1UA 2XECA 5EJFA 1DKPA 4HZGA 4LYEA 5JWRA 1X6VA 10MHA 3DL4A 5TS2A 3Q3GE 1RMYA 3MRVA 1LTQA 1YB6A 2BFBA 3ZKWB 1SHZA 2GEKA 5KB3A 1RHKA 5JXHA 2IQ5A 3VPBA 4RA9A 2C7BA 2P4SA 2GZ2A 3REOA 4QULA 5KSZA 5K0NA 4DNQA 3CUTA 2CVZA 3S6JA 4ZZIA 3DM9B 5JANA 2BEVA 4FFVA 2CT8A 4AKHA 1WUHS 3EEIA 1ML4A 5F3RA 1GG2A 1NNEA 3HKBB 3S2UA 1CZUA 3EXHC 3FNQA 5E6UA 4OYYA 4JI0B 1XLTA 1IEXA 4FIDA 4YJ2A 4OMFG 1OSNA 1FXUA 1PCXA 1H0KA 2XAAA 2AZTA 1X2EA 2DE0X 3F3SA 3SOZA 4G1FA 2HADA 3SPXA 6REQA 4RGVA 5JNSA 2RI1A 4BC0A 4IHJA 2ODTX 1X3SA 3L0IB 1E3LA 3FCAA 3TIFA 1B23P 1EWTA 3THRA 1RHQA 3OX4A 1DBPA 2GZSA 4BCCA 5KYUB 2AJDA 1DLIA 2CY0A 4HN9A 1YR3A 4D80A 4BEVA 2V03A 2D4AA 4G07A 5BUQA 3NAQA 1BYUA 3HTXA 1JIIA 1UJNA 3FB4A 3JQRA 3KDPA 4F2HA 4PSCA 5EG5A 4AECA 1DKQA 1CUZA 3KKZA 4KGVA 4F84A 4CM8A 5FUWA 4K9MA 2QRJA 2XRYA 3NV7A 4GM1A 3MXOA 4ZEWA 1U0EA 4ZQEA 1OTYA 3RVLA 1ULBA 2WT9A 2E4ZA 2Z6VA 3O6VA 1PGQA 3KPYA 3N70A 4CRWB 1U8ZA 2Y68A 4GS5A 3RBVA 4XYLA 3PFCA 3G0HA 4Y9TA 3NBQA 4BNGA 5JAZA 2JJYA 3UH0A 3OM9A 2GAAA 5T8KA 3L4BC 3UMMA 1TD9A 1TZKA 1SKYE 4YCJA 4ZIRB 2VRBA 3CB2A 2ZBGA 3WGUA 3NYQA 2HCTA 4HDKB 4ZT7A 2F9MA 4N47A 2Q41A 4BIMA 5BSWA 1DLJA 1RAAA 1SUCA 1MX5A 2QE6A 1GN9A 1H66A 3KLOA 3SXUA 2Z30A 4TT3A 1K3UB 5JSZB 1IMJA 3VNBA 3H5TA 4CIDA 4RVGA 4U9UA 4I55A 3K9BA 4YRLA 1F8FA 1ODSA 4JJ6A 5AK0A 5CDTA 1EUCA 3K09A 5KWVA 2KWIA 1F60A 2CJWB 3B3JA 5KSPA 7REQA 4D44A 4C7KA 1C0IA 1OXKB 3I72A 3OJEA 1SXJB 3PXBA 1B73A 4TT8A 2GZRA 3DAYA 1W9MA 4QPDA 3H0EA 4ALKA 1Z9BA 1ZI9A 2CNDA 2E82A 4F2DA 5JLJA 3LX4A 3B12A 3FWZA 3HY3A 4KYTA 4ALLA 4B6SA 1LEHA 2B5VA 5F7OA 1T25A 5EHIA 1QHHA 2BV3A 2FPOA 2PS0A 3RK4A 4DKXA 3DE6X 1JDVA 4FMDF 2CVQA 4E11A 1XXHB 2I3DA 1W4LA 2RBGA 4C1BA 4DB2A 2IPMA 3R9WA 1PTKA 3I04A 3NG1A 3LCCA 5H80A 5PGMA 5DLQC 4D9HA 1JEYB 1QLWA 3QXJA 3SIPA 1K0UA 2CXSA 4ZEOA 3LHDA 1A1VA 1BE0A 3T9DA 3A1EA 4B4WA 5AHOA 1FFGA 1N2CE 3AUTA 4MVJF 3E4DA 3RC3A 3ETCA 1RC0A 3KRTA 2DR2A 4YFVA 1UBNA 1C3OA 3A1VA 2XUPA 5ILGA 5A9TA 5C1IA 3BMQB 1CPYA 1SOVA 1J06A 4RYLA 4BECA 2QN2A 3WK8A 3ROMA 4ZYWA 3W5CA 1W36D 3G8DA 1SZPA 4PRYA 4Q9AA 2Y67A 2JLSA 3CN7A 4NE9A 4ZT5A 3TVDA 4GC5A 1A9SA 3PQCA 1KQPA 1NBOA 4NE7A 5FPTA 2W37A 2RJNA 4RSMA 2JA2A 2PD4A 2WWWA 3IOBA 4ZVLA 4F12A 3QLUA 3OO0A 3T7SA 3PI6A 4JROA 2PMDA 2ZCVA 3TLGA 4GPZA 3T4UA 1TF2A 4F4IA 4GOLD 5LU8A 4N3GA 4JV5B 5I8ZA 4U9IS 3PC8A 3EZ6A 3OWHA 2DJ5A 4IIBA 4R3UC 1T8TA 4LRWA 4IW3B 3ZY6A 1EESA 1YA4A 3DAHA 1U2GA 7MHTA 5DYIA 2AB0A 5KBYA 3DPSA 3REQA 1E3WB 4G0VA 3HFSA 3VR6A 2NSJA 4M0LA 4JT8A 4BLOA 2X7JA 3GFGA 1O57A 1P18A 4MV9A 3S28A 4F2PA 5C9ZA 5JNWA 3JQGB 2XGMA 2PUJA 1QC5A 3BC1A 4IPTA 3K0FA 1NURA 5FORA 5EIHA 4E3WA 3A0UA 2DXIA 2B34A 2ZR9A 3LDUA 3GBPA 3VYRB 2P11A 3FMOB 3KB8A 3GO4A 1QFJA 5B3JC 2O2EA 5G41A 3TR6A 4DDKA 1ZK0A 2A58A 3LRTA 5EXDA 3FTFA 1W29A 3PEWA 3FYCA 2X6RA 5P21A 1DWQA 1D8TA 4MWSA 3KOOA 3ICEA 1CDDA 2D3WA 2IPNA 1EA5A 1W4AA 3KFLA 4PXAA 4REOA 4MV8A 2RKBA 5KKAA 1NBAA 4E2YA 1VG0B 2GX6A 3NGMA 4R2HA 4CLDA 5HQ3A 1R16A 1UL1X 2QDKA 4J0EA 2F9FA 3UC5A 3JD3A 3ZXXA 2ZRBA 4B75A 3FPCA 3QKUA 1N9ZA 2G06A 2ODBA 1LQTA 2XE8A 2ZBPA 3T41A 3WS7A 3ZU4A 1ZHFA 3RG8A 3NRJA 1FS5A 1V4BA 3O8NA 5L3QB 1Z2OX 4KPGA 1BDMA 3F67A 1BX0A 1G16A 2PT9A 3LG2A 1K1EA 1LDBA 4FDTA 1P7ZA 2OPHA 4KH1A 3U26A 3GLFE 2DPLA 5T4HA 2GSDA 2XRMA 3WAKA 2MSCB 4EGFA 4DDMA 4B6FA 1RXUA 2FSPA 3CE6A 4L5JA 4R1LA 2FWBA 5FBVB 2G0AA 4I66A 2GXSA 4WZAB 2N3ZA 2QG4A 1AQLA 2PGOA 1C8VB 3VSCA 4A0HA 3OQOA 3TI9A 1RPAA 1IM8A 1Q0HA 2IYWA 1NQ5A 3MJTA 3P5SA 3T4XA 3LC7O 1V3TA 5IXJA 3M5CA 4P5EA 4LHWA 4GE3A 2V4UA 4PTZA 4C6RA 4DSTA 5CB4B 1T1GA 2K2QB 3ZN2A 1II9A 1RYNA 3A10A 3KQYA 5KYNA 3OQNA 1PD1A 1VKJA 4DEXA 3WKBA 4PRLA 1ZIXA 1P2VA 3T9AA 1Y8QB 4KIJA 1OXBB 2JAHA 4LRQA 3FJOA 1YBFA 1Z56C 3SF8B 3WX0A 4QM7A 2BISA 3ZD6A 2Z1DA 5DMXA 2Q9AA 4IGKA 1RWNA 1KFCB 3ENQA 1Z8DA 3MUOA 4ZOCA 5HGJA 3ROFA 5JDIA 2C2ZA 4RPJA 4L9SA 3PNYA 4RVNA 1XYYA 3VTZA 4KFCA 2CVHA 1J2EA 4HDSB 4Q4JB 2ZBEA 4ECAA 2XKAA 1X13A 3M2TA 4WXEA 1EK6A 4UU0A 4A27A 4LWZA 2PEYA 4XCXA 3RS7A 4R2LA 3EUEA 4EUHA 5EJ8A 1OC2A 2HBQA 3DP9A 2KMLA 4R05A 1T43A 3S0JA 5IASA 4NBNA 2UYGA 2YMLA 3ND7A 4PO3X 4C0QC 2A5LA 6YASA 2CLDX 3DZDA 2RGWA 2QT0A 4OHCA 2K7ZA 4S35A 2JFOA 1I4EB 3FHJA 2QS9A 2E48A 4JNKA 4KUEA 3LBAA 4NK4A 4D8YA 3EFHA 3THWB 4TQGA 4Q1FA 1A7AA 3TLEA 1GKUB 5L40A 3B7PA 3HYCA 4GPEA 1OAAA 4L02A 4DPLA 1G5FA 3N05A 3RODA 4HJRA 4OI0A 1W4BA 1EUDA 3Q7TA 2Q2QA 1C2TA 2IF0A 2GASA 5GY7A 4C0WA 4FHFA 3K9LA 4XPIB 5LA6A 2BFPA 3QBDA 3HU3A 2QXUA 3Q0IA 2UXDB 1JDNA 1OQAA 2OKGA 2WHEA 4ALJA 1NLMA 1UEXC 4L0QA 5IDQA 3OKCA 4OU4A 4BJ6A 3K9NA 5DNYB 3IP3A 4ZV7A 1V5WA 1NW5A 4KOAA 4QODA 3UW1A 2HC9A 4PGAA 1VDZA 3HKDB 1U2QA 1ZRMA 3QNUA 5K3SA 4PQGA 2NSHA 6GPBA 4EO7A 4RJJA 4D43A 2YRFA 1I4LD 2P5UA 1HH4A 5LMCA 1AHPA 4HLCA 2WB2A 3AXSA 4K0RA 4WECA 1YJCA 1MOPA 3W9SA 3KTAB 2VYQA 4BFCA 1XLWA 2HMAA 1KFBB 2OLEA 3KB6A 3SBDA 2REQA 4KRGA 2CCKA 2JK1A 3B48A 4ZT4A 1LX6A 1EFKA 4DR4B 4M89A 4NYIQ 4UBJA 4HUQB 3NLLA 4RD2A 3DHEA 4TS3A 5JALA 2FZKA 1RU3A 2GCNA 3LGSA 4FGJA 1JQKA 4UW9A 3C3EA 1BMTA 3IAFA 4N54A 4XH9B 1UJ5A 3FB1A 3WSVA 2WWGA 3I8SA 1Z4KA 3MMNA 3FTQA 4HHEA 5LDGA 1RPZA 4DF3A 4U7PB 5DYYA 2NZUG 4DB4A 3QXXA 2QLJA 1TTPB 1RKUA 3IP1A 3WWOA 5HYVA 4DR6B 4IL5A 4MVJP 3K20A 4Y0AA 2I1WA 2OOSA 5IKXA 3Q3VA 1V6CA 2O2SA 5B3AA 3CO0S 3VV2A 3L7AA 4UHHA 2D0OB 5DSZA 1ECJA 1Y7HA 1OBOA 1GU1A 2JFHA 4GNKA 1FYDA 4RHTA 3U9LA 5DOVA 3X2SA 3N07A 1YZHA 1V7ZA 1OV4A 5CLHA 3B6MA 4B4UA 1CUIA 1BOOA 1SOAA 1UMBB 4M8NE 4BU0A 3G13A 3QOWA 4KLCA 1WF3A 4R71A 2W00A 2J9YB 2Y92A 2WLSA 5ITZB 1E32A 2G70A 3LUFA 1WU8A 2FJPA 3LUDA 1V71A 2I65A 4B6PA 3K0HA 4D41A 1RI1A 4I50F 1EKXA 2BRUC 1C0KA 3BPSA 2QM7A 1K92A 2A9PA 3EXEB 2F8MA 2YVAA 3MAJA 3OBBA 4NYMR 5F2EA 1QQ5A 1Y8RB 2EKBA 1Q0RA 3DCJA 3QU2A 3QKIA 4AIIA 1BKYA 3AI1A 4GO1A 1K08A 1FYFA 1NBEA 1TO6A 2PXAA 4TS4A 2RGDA 3A3YA 3PWZA 3R7WA 4Q4AB 4XD7A 5E0KB 5TJHA 3L7YA 4OFXA 4P7JA 1E2KA 3HA5A 1U1CA 1E2FA 4ZYUA 2HDOA 3OZFA 1DOHA 3KHUA 1QU2A 1Z0KA 2QR5A 1NY6A 2JEYA 1OX5A 4HDRA 1QIDA 3G88A 2XX3A 4K3VA 3ZE6A 2QLTA 3H0CA 3TVTA 1J2UA 1VIDA 1STOA 3B5EA 3H8VA 3PWTA 4KPYA 2WNSA 4M8IA 1J24A 1XDDA 1DADA 2VC2B 1WABA 3UT5A 1N6PA 1TMYA 4HY3A 4OG2A 3CIFA 4G56A 5CNMA 1NJ1A 3KOWA 4JKOA 4RJKA 3K4HA 3PB3A 4I9FA 4XR9A 4A2QA 4YWHA 4JI1B 3G5MA 5K03A 1YFZA 2HYDA 3O4JA 3QHPA 4KE8A 4ZOLF 4BNWA 4AAYA 3OY2A 1NMZA 2C9BA 1WTAA 2R79A 3DFZA 5A0TA 4TV9B 5HA5A 1YRLA 2EIHA 3NHFA 5LZ7A 1O87A 2PH1A 3A9CA 4DSNA 1HYGA 1TF5A 2OHHA 3ZWCA 2A0FA 1RPTA 2WJIA 2ZJFA 4F85A 5JH7A 4M1TA 3ECSA 3FKSA 2GJ8A 4GVLA 4XLLA 4DCPA 4N3AA 3CWCA 4URFA 4XDZA 5BT8A 2X9NA 1P75A 4TL8A 2FWMX 1LDYA 1ILEA 1QUEA 1VSVA 2Q4OA 3W6UA 2CZGA 2WQ6A 2PMKA 4B17A 5A9RA 1KHTA 3HWSA 1N3BA 3L41A 5EAIA 3IB3A 2J3MA 1C2YA 4PRKA 1SK9A 5JD4A 2I4IA 5I9LA 1TJ5A 3DHWC 3DZHA 4R6WA 3U4IA 2HH9A 4CNBA 5IZCA 4A1FA 1DAPA 2ZJ2A 3T5MA 3U09A 3OEED 5EKSA 1OZFA 2BM0A 2UDPA 5EIFA 2MU1A 2VUIB 2XQIA 4CEJB 4IIFA 3ZI0A 4OXXA 2Z57A 3D6UA 3DBOB 1E2QA 1QGDA 3DF7A 4TRJA 3U48A 3VU0A 5HGXA 2RH8A 3MWYW 1LGYA 3ZK8A 4DV6B 4IWXA 4S05A 2QX9A 4FC7A 1TFRA 4RE5A 4ZPJA 4RQBA 3KKEA 4WK4B 4MV4A 2P9JA 3ZTYA 4Y9SA 1NUAA 3E5MA 4ETMA 4XVUA 5IJ0B 4GPAA 3PEVA 4L4YA 4LXQA 3EY9A 2XITA 2VEDA 9LDBA 4ILEA 2E21A 1YJQA 4HTFB 4MWTA 1DS6A 1MIOB 2C5GA 4BLRA 4ENQA 1C1XB 5C5IA 2Q3BA 1TCAA 4US1R 1BZYA 1Z5GA 4QGAA 2EFYA 1BVHA 4L8YA 1LBSA 2OO5A 1IBRA 1RCFA 1T5OA 2X8AA 2GH1A 3FJ1A 3MERA 2F62A 3ETDA 3SQNA 4IJ5A 3BEOA 1WMEA 3M8KA 2HRZA 2PTGA 1B3BA 1KXZA 1H8ED 3JZIA 5DLEA 5E3IA 5AP9A 4BVGA 2J85A 4HB4A 4BQIA 3N58A 3VNSA 4XGNA 2CFSA 1M9NA 1IWBB 5JDCC 3RIHA 1P4HA 5A06A 1P0MA 1ULAA 5FWXB 5ILQA 4C4TA 1KEVA 2CLHB 2J48A 3DZGA 4FDLA 4EFKA 1PFGA 3AW8A 3DVAB 1AKQA 2CHVA 1UOEA 2XYHA 3L7CA 4FONA 4FYHA 2EHDA 4UUNA 2B3TA 4YJFB 4AJPA 4LTNA 2CFCA 4B40A 1XRQ