3QTLA

Structural basis for dual-inhibition mechanism of a non-classical kazal-type serine protease inhibitor from horseshoe crab in complex with subtilisin
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
274
structure length
269
Chain Sequence
AQTVPYGIPLIKADKVQAQGFKGANVKVAVLDTGIQASHPDLNVVGGASFVAGEAYNTDGNGHGTHVAGTVAALDNTTGVLGVAPSVSLYAVKVLNSSGSGSYSGIVSGIEWATTNGMDVINMSLGGASGSTAMKQAVDNAYARGVVVVAAAGNSGNTIGYPAKYDSVIAVGAVDSNSNRASFSSVGAELEVMAPGAGVYSTYPTNTYATLNGTSMASPHVAGAAALILSKHPNLSASQVRNRLSSTATYLGSSFYYGKGLINVEAAAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Subtilisin-like serin protease
publication title Structural basis for dual-inhibition mechanism of a non-classical kazal-type serine protease inhibitor from horseshoe crab in complex with subtilisin.
pubmed doi rcsb
source organism Bacillus licheniformis
molecule tags Hydrolase/hydrolase inhibitor
total genus 83
structure length 269
sequence length 274
chains with identical sequence B, C
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 2011-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 3qtlA00
1R0RE 1GTJ1 1GNVA 4ZOQI 1Y34E 4H6WA 4OV6B 1LW6E 2PWAA 3WIUA 3DVRX 5AVJA 1P7VA 3AJ9A 3A3OA 2G4VA 1BE6A 5I9SA 1SUPA 1BFUA 4KB5A 2ID8A 3WQBA 1IC6A 1SCAA 4M1ZA 3VYVA 2WUWE 1SBIA 1SPBS 2XTJA 3I30X 3VV2A 3F49S 4LVNA 4GI3A 5SICE 5JXHA 1TM1E 1C9NA 1C9JA 4RYDA 1SIUA 3DE3X 1NDQA 4DWWA 3DE0X 3PTLA 3L1KA 3CNQS 1TM4E 4C3UA 2V8BA 4WOBA 3DE2X 2IY9A 1GA1A 1GCIA 4H6VA 1AVTA 1Y48E 5FAXA 1TMGE 4AKTA 3BPSA 1GTL1 1SCNE 1P7WA 2E1PA 1WMDA 2B6NA 4OMCA 3I37X 1R6VA 1KDZA 1GNSA 3QFHA 5AMXA 2PKCA 3LXUX 5ARDA 1ST3A 1V6CA 1EGQA 3VV3A 4LVOA 2ID4A 5AVKA 1NLUA 2SECE 2ST1A 1WMEA 2HD4A 4NE7A 1Y4DE 1Y9ZA 3DE6X 1PJ8A 2Z2XA 1UBNA 4MZDA 4YN3A 1SBHA 1CSEE 5K7SA 3F7MA 3TECE 2PQ2A 3WIVA 3GCWA 1TM5E 3QTLA 1SUAA 3DE5X 3GT4A 3DYBA 3TI7A 1XF1A 1SCDA 4B5LA 2ZWOA 1GT91 1SUEA 2Z2YA 2QTWB 1SIOA 4Z2AA 1S02A 1IAVA 5CW1A 4CFYA 2Z56A 5AQEA 1GA4A 1Y3FE 1OYOA 1MPTA 1BFKA 3BGOS 3DE4X 3DW3X 4KPGA 4OMDA 1KE2A 5B1DA 4NMXB 1KE1A 3I2YX 2WWTA 3LPCA 1Y3BE 1SBTA 2PYZA 1AH2A 1AF4A 3EIFA 3DVSX 3WHIA 4DJ5X 1AQNA 3GT3A 1YJBA 3GCXA 2W2QA 1SCBA 3H42B 3F7OA 2PMWB 1GA6A 1GTG1 3D9QX 1ST2A 3BX1A 3CO0S 2Z57A 3A3NA 1MEEA 3Q5GA 3I34X 3DWEX 2Z58A 1R64A 3T41A 1BJRE 1T1EA 1T1GA 1AV7A 2ZRQA 4H6XA 5JXJA 1SN7A 1VSBA 2Z2ZA 4BWGA 5JMOA 4I0WB 2SBTA 2W2PA 3DDZX 3QMPA 3D43A 2W2MA 1AK9A 1Q5PA 3TI9A 1A2QA 1BH6A 2SICE 4NE9A 1OYVA 1YU6A 2W2OA 1AU9A 1SIBE 5ARCA 4JP8A 1SVNA 1TM3E 1SELA 2ZWPA 5ARBA 1OT5A 3Q40A 3AJ8A 2P4EA 2XRMA 1WMFA 1SUCA 1Y1KE 4C3VA 3LPDA 5B1EA 2DQKA 2X8JB 5FBZA 3ZXYA 2GKOA 1JEAA 3EDYA 3SICE 3VHQA 2Z30A 4ZARA 1TM7E 3DE7X 1EA7A 3VTAA 5JXIA 1C9MA 4J94A 2PWBA 1THMA 2DP4E 4HVLA 4DZTA 1SBCA 4AKSA 1HT3A 4FONA 1KDVA 1YJCA 2WUVA 4WOCA 3A3PA 1SH7A 1WSDA 2SNIE 1TO2E 5JXGA 1P8JA 3PRKE 1PFGA 3ZXXA 4HX2A 1ZVKA 1WVMA 1Y33E 4CFZA 1KDYA 2PRKA 2DUJA 3VSBA 1PEKE 3HJRA 1Y4AE 2HPZA 1SUBA 3UNXA 1DUIA 2TECE 3OSZA 1YJAA 1CNMA 2IXTA 1C3LA 1DBIA 2WV7A 1S2NA 3AFGA 3DVQX 3P5BA 4K8RB 1TK2A 2W2NA 4KG7A 1T1IA 2X8JA 1ZVJA 1SCJA 1BE8A 3LPAA 3DW1X 3EE6A 1Y3CE 1S01A 5FFNA 1TECE 1SUDA 1V5IA 1Y3DE 1PTKA 3SQOA 4CG0A 1SBNE 1TO1E 3DE1X 1NDUA
chains in the Genus database with same CATH superfamily
2IC5A 5JWRA 4LZJA 2GASA 2YZ7A 4LXIA 3RVOA 1NVVR 4R81A 3HKBB 3NH6A 1G5IA 4UAVA 4N65A 3VR2A 3L41A 3AUYA 1H0HA 4I9NA 2GSDA 1XYYA 4FLEA 2JAQA 4M1YA 2QW8A 4AMUA 4DR1B 2YNMA 1GN9A 1QHNA 1C7IA 1U7DA 1WVIA 3OPYB 1NVUQ 1E2KA 4K9PA 4L5JA 4OFXA 2E4YA 1KH3A 3G88A 5AVJA 4IJWA 1NP3A 1V1MA 1T36B 2IYNA 3H1EA 1ZIXA 3F4LA 3WLQA 1U1GA 3BWEA 4BRUA 4JQYA 2X9VA 2HX1A 4GAEA 4DB2A 2BEWB 2HIHA 2CL7X 2X77A 3FB1A 3V1NA 4IHJA 1MAVA 1LSSA 1V8BA 2BCJQ 1U2RA 3KQMA 3TW8A 4C1NA 2EFJA 2J4CA 1DXHA 1Y1LA 2EZ9A 5HCIA 4BYMA 5A3VA 3K0SA 5JZ9A 4DTCA 1H6CA 2AW5A 3PCRB 4J8PA 1WD5A 3HB9A 5FA5A 3V55A 2V58A 2PS3A 4JLUA 1EFPB 3TTWA 5A71A 2X7JA 3RI3A 5JFOA 2I6UA 1YQTA 1W52X 3UMJA 4GL4A 3TCKA 1NBHA 3RW9A 3PEWA 5B3JC 1UC5B 2Q6IA 4M9SA 1B8VA 3RBVA 2GBLA 4HWOA 2EF0A 1CZNA 3D6AA 1T4DA 2FMTA 5KYUA 5G53C 4L27A 1Q7RA 2XTJA 3KE9A 4FZRA 3A32A 4GH5A 1T5LA 3NBYC 3SEAA 4BO7A 4DCUA 2HWWA 3IUYA 3KZCA 1IY0A 5DHPA 5FPSA 1DL5A 1QNLA 4GQAA 1CJSA 1XLUA 1JH9A 1ZSVA 2WHYA 4RTQA 3HEAA 5L3SA 2W6ZA 3M6IA 2JC3A 1XVTA 1FMTA 1XZJA 1LGYA 2R84A 1C9JA 2RIRA 4E22A 5A2GA 3MTBA 4RJLA 2IJGX 5GM2A 2GD2A 5EJGA 1J39A 3PXEA 1P0IA 2QYTA 3LTNC 2FLWA 1PVVA 1NE2A 2Y0BA 4PAOA 4NL4H 1TYEB 4EA6A 2XUHA 2R6GA 3CNQS 2QRGA 1N78A 4CCYB 4WZAA 1KNQA 4J16C 5KDOA 1RYNA 4C29A 3E9DA 1O4WA 1G4HA 1GP2A 2VO1A 1ICIA 3WLAA 2EIXA 3JQBA 3ZDCA 3G89A 2OCKA 1FYWA 4LZWA 5EZYF 3A37A 4EP1A 5ADWA 2BELA 3DWGA 1N0IA 1TZCA 4GWGA 2JCBA 3WADA 2LTAA 1Y6ZA 4FFNA 4DM7A 2X4GA 4BNXA 1DLIA 3NHUA 5EA2A 1JHMA 3LZDA 3TL6A 3MMPA 5IJ0A 4CI9A 5B1IA 1Y48E 3D7KA 1BMQA 2B30A 3KTAB 1FLVA 2QG6A 4L6IA 3O2SB 2XE6A 5F64A 1FMFA 2B5VA 2G9NA 1XRQA 3QUAA 3DTYA 1JHRA 1JHUA 2P4UA 1XK7A 1J0AA 4M53A 4J0GA 4PLPA 4EG3A 3Q8KA 4EW3A 1MVNA 1R8QA 4LJ5A 4CIWA 3AEYA 5GP1A 3BMQB 1L9KA 3LKBA 4RV5A 1FDWA 2LE0A 1R0SA 4EPVA 1W5TA 1FYFA 1BQ3A 4G86A 3T52A 3NTQA 4DREA 1U3VA 5K45A 2ANBA 1CUZA 4D0LB 3UJBA 5FL3A 2JCGA 3PE3A 5AMXA 4ALMA 1E4YA 2JG3A 2ENUA 3BXZA 2O2XA 3ESZA 3LNTA 4HQRA 1FFDA 1OLSB 1QU2A 3AW8A 3JARB 2Z09A 3QZUA 3V42A 1R6UA 3VO2A 4BFLA 2I7CA 5EJ4A 2Y1CA 2IYWA 3AHIA 1WQ3A 1QDEA 4MV4A 2YQZA 4N5DA 3LYLA 1N5DA 4YUXA 4ZV4A 4FDAA 1MGPA 5TSDA 2KBFA 5ADUS 1EP2B 3F2VA 2VP9A 4OBWA 4WEOA 1YC2A 3HRHA 3LP5A 4IZIA 5GAJA 4ZOCA 2NU8A 1RPNA 1Y9ZA 2Q3LA 2QMOA 4M8LA 1FVOA 2BP7B 2R00C 4X7PA 4IMPA 5JD4A 1GZ6A 4PGFA 2Z2XA 3WWYA 3WAJA 2AN4A 4PFKA 4RHXA 1SUWA 3EPPA 5P21A 1ADFA 3Q41A 4EB8A 2E5FA 5H16A 4HC4A 1OU0A 4MVJI 2WT8A 4G65A 1NVFA 3U3RA 4HN9A 4QX6A 4FWTA 3MS2A 1Z6QA 3O2NA 1VKHA 4UNPA 1FL9A 4PWYA 4IOMA 4D3FA 1ECGA 1RWNA 1XA3A 1GFWA 2HA0A 2Q5OA 3PITA 4RMNA 4X94A 4E21A 4FU0A 1UT5A 1V26A 3HFGA 3MWEB 2C0CA 4M1WA 2Y0CA 3GUHA 4L50A 1MTOA 2W2XA 3V2IA 1U0FA 2ODWA 4U2DA 3N2IA 3BFKA 4LBWA 4C88A 5B64A 3OZAA 4N0QA 3UA3A 1BQEA 3L79A 4EPRA 3TX6A 4HFMA 3C1OA 1YDHA 5A1TA 1L6RA 1CBUA 4D8XA 1E0JA 3WYCA 3ESBA 1QO0A 3G7SA 4I8DA 3WRYA 5HW0A 1LK0A 4WOPA 3IS3A 4QJBA 3FIUA 5DBOA 2WU0A 4OM8A 1FNMA 4UM9B 5DSZA 4GR5A 3ANSA 3E8SA 1P5JA 2PANA 1IAVA 1P73A 3HZZA 2Z5LA 7ADHA 2FR1A 4O4LA 1VIAA 1VE3A 1L4MA 1V7ZA 3AKEA 3PI6A 3PUKA 3Q87B 1CHNA 5CU7A 5FUBA 2XUKA 1RS0A 4BQRA 2YMMA 2H1RA 4Q00A 3UBTA 2ZJYA 1Z0IA 4RX1A 4N5NA 3GRKA 1OH7A 3QPAA 4TMWA 1PDOA 4XDGA 3E9ZA 3C8DA 4D45A 4NEGA 1OREA 5E4FA 5E2BA 2MCFA 2IOFA 4KPGA 5CXSA 4YFYA 1EU1A 1VMDA 5CA1B 3OM0A 3G59A 3I4LA 1KIMA 1GPH1 4CMKA 4DV1B 4NZ9A 4QGGA 2JLRA 4FEYA 1SNYA 3I6BA 5AKZA 4ZT4A 3D64A 5BQFA 1WCWA 3R9IA 4PWZA 2Y27A 3K2EA 5IW8A 3RT7A 1G4UR 3IFSA 2GSWA 4JBYA 1LDYA 2AMYA 2I8CA 3H5OA 2ZB3A 1EBBA 3BDAA 4LQCA 1RQLA 3W05A 1RBZA 1XXHA 1JW9B 4P7JA 4PC6A 2PSFA 3TQRA 1U65A 2VF4X 5LP6A 4TVKA 1O57A 3QNUA 2X3FA 4EEXA 3WRXC 2W2LA 4EFLA 1J0CA 1DRVA 1V11B 4DFDA 2UXBB 1A50B 2XQKA 3GP8A 2ZM6B 2MSLA 2GI4A 4DJAA 3FYCA 2GLUA 2P6RA 1IRIA 3UW3A 1R0BA 5DBIA 1F6DA 3BGSA 2OV8A 3F78A 4OOFA 4D9NA 2G6TA 2YL2A 2GFHA 2PMWB 3IV7A 3NIDB 2IYOA 3ETDA 4MIEA 3IBTA 4TRNA 4C06A 1QCDA 1OCEA 4ZXPA 4JA0A 3ZHQA 3F3YA 2JL1A 1U2DC 4G5OA 4KX3A 5LUBA 2JBAB 3VO1A 4KR6A 4Y2XA 3ZCVA 3SXUA 1KRXA 2H3HA 5JCZA 1BVYF 4PRKA 2O05A 3RFFA 1MEEA 2HFKA 4E2WA 4GC5A 3OBBA 5DM70 2HBQA 3EDOA 1E1NA 3FWHA 4TGLA 3ZGLA 1KWGA 4WVLA 1Z07A 2ZI6A 1XRSB 3MRXA 2WI8A 4CZ2A 1TTHA 3T9FA 5FIUA 1HNNA 5FO1A 5CDGA 1J1ZA 3D8SA 2BIFA 2AE2A 1W44A 3CF6R 5AW1A 4LSWA 1DQNA 4ASUA 4JC4A 1G21E 4QHTA 2BDTA 3QMPA 1H4SA 1BNCA 1FVXA 1P39A 3PC3A 4U1RA 1LVUA 2XNDD 4CTMA 3GF4A 1ECPA 2ZM5A 6PFKA 1SVMA 4G37A 1UWVA 3W6PA 3EBPA 3H6HA 4FK8A 4FTWA 5EQDA 2IQ5A 4LRXA 4AY3A 4Q02A 3ZDZB 3HA5A 3ZLJA 3ZDYB 1S4QA 5JD5A 2NO0A 2H07A 2E82A 1U0NA 2ADMA 4CDRA 1PO7A 2BOVA 3B78A 4UXHA 1FB5A 2VP4A 2GK7A 3A0UA 5JS7A 2AI3A 3IPAA 3R6LA 4KLAA 4QU8A 4C14A 1F12A 1SHUX 1V96A 3H0CA 3CLTC 1ZK2A 3A1SA 1FFCA 3DVAA 4X84A 4KWEA 4P9NA 3EGDB 3LCMA 1QIMA 2VP6A 4G5FA 2H4ZA 3RSFA 1OPRA 1QE5A 2HPHA 5HUQA 1A8QA 1JHDA 1THGA 2H2WA 2X14A 4OHBA 2ALJA 4OHCA 4Q01A 3PHLA 4FYIA 3JD4A 2AJBA 3EGXA 3MUFA 3P9QA 2A7XA 2XE8A 3G9XA 3PWKA 1JTFA 1A4UA 4CTJA 4F2HA 3C48A 5KMGA 4ND8A 1KKUA 3FXAA 3ZCXA 1DE0A 2XRMA 3K4QA 2ZRFA 1U28A 4E1VA 4Y2TA 5CUQA 2ATCA 3FUTA 5I51A 1RLOA 4DY4A 4UFOA 4Q9AA 4ZU1X 3QVTA 2H2HA 4IX9A 1YZLA 5L40A 5DN9A 4JNKA 5KNBA 4MV6A 1QK4A 5BN4A 1K92A 5HQTA 1BCRA 1P9NA 4MKGA 4F84A 4AULA 1SCKA 2PS1A 3PUXA 5FOVA 5IVDA 1MUUA 1N0HA 2JVKA 2NQTA 2PBRA 3FLEA 1Z2NX 1WXDA 3ZBTA 1T9ZA 2PZEA 4BLPA 4FT2A 1D1TA 1VSUA 3N2EA 5IS2A 3BUSA 5AVZA 1ETUA 3NATA 4IEEA 5KTYA 2I78A 1W0KA 3I9KA 3IQHX 3PEFA 1WOYA 5LMUB 1PV1A 3LHFA 2VK4A 1LPSA 4JR0A 1EIZA 1N2CA 2Q5FA 4RMJA 1YGYA 1ZEJA 1UL1X 3FLMA 2CXNA 1V1RA 1ZW1A 4WASA 3Q3JB 4GKAA 3S2ZA 3QFCA 2RGXA 4HB4A 4Q37A 1DZIA 4YAGA 3UHAA 4C4TA 3MHTA 1VPLA 1X7GA 2VPXA 3K53A 1R8SA 1GZVA 3TEMA 5F78A 2GR9A 2VJCA 3A1UA 4J3JA 1SKYE 5HYVA 4HO1X 1R18A 3DDWA 3JQEA 4FW9A 5HDQA 2ZSDA 3THSA 1TO6A 1JJAA 2FW6A 2VOEA 4IO1A 1KK0A 5DHQA 4FD2A 4F3NA 4DZTA 4W7SA 4CF6A 2O07A 3IURA 1M3SA 1Z2CA 2H1LA 5JCXA 4HYTA 1FBNA 2HPVA 5KZMB 3ZJUA 3VSEA 5IAKA 4B3DA 1EE9A 4D46A 5JIBA 5KU7A 3PLAE 1M2OB 3N59A 5CVJA 1JQAA 1I2BA 1KDVA 2Y1FA 5K09A 5AW3A 3B36A 2ZXFA 3K0BA 4QXAA 3KOXA 1N9GA 2UDPA 1SIWA 2BFDA 1BGVA 1NP6A 1LZLA 4BIMA 3UGTA 5CA0B 1OZ0A 3IKJA 3H16A 2B20A 5D5PA 3OM9A 1IRXA 1C2TA 1QTNA 2J09A 4NCAA 3O93A 3PRKE 3HLYA 4I1RA 4XFJA 5A4KA 1WPQA 2DFTA 1Q1QA 1YWGO 2WINI 3HKDB 4JWTA 2C2HA 3TLMA 2HNBA 2VDWB 4L2IA 4MIKA 3VZBA 2W6JD 5DBGA 4DMMA 4O2AA 1G8HA 1XAIA 3TQIA 1Y7HA 3B6EA 3EOAI 4B9EA 4EAQA 2GK3A 4QE3A 4QECA 4BPRA 1L8AA 2GWRA 4QUBA 8ATCA 2AGVA 2Q4TA 3FFBA 2D2VA 4B45A 2F43B 4G24A 4UTVA 1IBRA 1PEKE 1ZH8A 2FRXA 2OWEA 3HJRA 4GPAA 5LU8A 4YI3A 2QJOA 4GSYA 3E2IA 2XT9A 1ZUNA 2O2IA 5G4LA 4XPIA 4Y9UA 3BDIA 2XB4A 4JLSA 1CY1A 4P83A 1VHJA 2H2DA 2HA7A 3CLKA 3UNXA 3TK1A 1CS0B 2PIDA 3PL5A 3BTSA 3SYTA 5KX5B 1JF8A 1SVWA 2CHVA 5JFTA 1DKLA 2XV1A 3TM4A 3VZDA 4OYRA 1E9FA 2CF5A 3JD0A 2GK6A 3GT7A 4KN8A 2NTVA 1FCJA 2G8LA 1ZJ4A 5BN1A 1O08A 2W6QA 1OZFA 4YRNA 4EFKA 2VP5A 4XQCA 4AIRA 1SC6A 3ANNA 3ZHRA 4ZU3A 3OT1B 4Z54A 2X8JA 5CP8A 1BD4A 3WE7A 3ZY2A 3NAMA 1ZVJA 2ZWMA 4ZRDA 4QFCA 4ZT5A 1YHZA 1NVAA 2RHGB 4V2IA 1R8XA 2RGNA 3M8KA 1USWA 4RK6A 4ZAZA 3OMLA 4RL4A 3K3PA 1JSXA 1Y3CE 5KC9A 5EY5B 1N2XA 2H16A 2XLBA 3DWIA 5EJEA 3EXAA 2ZVJA 1X77A 4L8VA 5A4FS 4X71A 5E7QA 3K6SB 4X91A 4R8VA 4RTOA 1VB3A 4HJRA 3PXDA 3DZ8A 2HZBA 2FQWA 4YJ2B 1JDSA 4NV0A 4RA9B 5CK4A 1TVKB 2PPVA 4BEJA 2IDMA 3DHNA 1SKUA 3NDJA 1Z8NA 5TC4A 4E2ZA 5F7XA 3EZNA 3BXFA 2RHDA 2FZLA 4WDRA 1WU7A 3BMNB 3I4CA 3U61B 2BGUA 3GMDA 1V16B 2EZ4A 1BO6A 3HR4A 4H4CA 4DNOA 1TAGA 4JJAA 4R4JA 3OF5A 1HEUA 1IATA 1Y34E 2B4KA 2VBCA 4R9RA 4V02A 1D09A 3AG5A 3EQ7A 4MRMA 3X1DA 1RCUA 2D5CA 2ZR0A 2AUNA 3U9TA 3OQHA 4GOKA 2X0IA 3WIUA 3HP4A 1M1NB 3TZCA 4EH1A 2IBTA 1I3LA 5HQ3A 1PNOA 1WG8A 1L7PA 3UMFA 4GW3A 4TQGA 5EG5A 1HPLA 3I45A 3KTDA 2IV3A 2JK0A 3CN9A 4LV6A 4F45A 2ZRPA 5B4UA 1LSUA 1EJ0A 1XTIA 2HZ7A 3UT5A 4BNJA 4X6UA 1NZFA 2I22A 3A26A 4JB3A 4R8MA 1IXYA 2I1QA 2ODPA 1UJBA 4Z2AA 1GL3A 1VGQA 5TX7A 2WD7B 5TPWB 3ZWQA 3UEOA 4EB6A 3RC2A 3BIJA 3MTEA 3WLPA 3UJ6A 1E9BA 3WYNA 4OGWA 3VYTB 2J4DA 3TRHA 4QLBA 4CCSA 2QZPA 2P68A 3PC8C 5MN6A 5D3KA 3ZW9A 4ARSA 2DUUA 5DRYA 1BN6A 3QP9A 1XEFA 2GEBA 4LHSA 4Y2GA 1Z2OX 1IY9A 2B1JA 3NJ8A 1XA4A 3NXSA 4ARAA 1BX1A 1A7UA 1UADA 2CGEA 3KLNA 1EFUA 4TT3A 3L6BA 3W5SA 1N6OA 4EW6A 2YOFA 3B6IA 1ZS9A 2DQSA 1QE0A 3LWZA 5EMHA 2UU9B 1UEJA 2C9OA 3CZRA 1H5QA 3F49S 3HN7A 1B16A 4I5FA 4MKRA 3BBLA 4CM9A 3SSNA 6REQA 2PBFA 4UUPA 4D96A 1DAIA 5DHAA 1FXSA 1Z08A 3DBHB 1E1YA 3MPOA 1E79D 4M0FA 4ZT7A 4WWHA 4TKVB 1ORRA 3U5ZB 4U02A 1E63A 4PX5A 2I9PA 3AJAA 1BRTA 2WSSA 1DEOA 4JLNA 3UGQA 4NYIR 1G42A 4AW9A 1GHTA 1DIOB 1K7FB 4I55A 2A9FA 4ZOBA 4MRVA 1YRHA 3EIXA 3KR2A 4HGYA 3KSZO 4M1KA 3ASZA 4A8JC 4KQCA 4RMGA 1ZA1A 3OF3A 3PHIA 3RUPA 3R2JA 1LW7A 1F6WA 5AW4A 1ZD2P 3F5QA 1I13A 4XI9A 5JD6A 2C5GA 3EVFA 4PBTA 3DGEC 5E7IA 5DLDA 2QDXA 5JAIA 3W7AA 4V0LA 1AHNA 4GYKA 4U7GA 3RASA 1QR6A 1P75A 3DZDA 3M49A 2PX8A 3Q7QA 1KBZA 1UM8A 2IZ7A 1CEXA 4LJ6A 1CVIA 2FN3A 3OCWA 2IX9A 3R9WA 1MD9A 4WKNA 3D6TB 4N01A 5AHRA 4LFCB 4JL5A 4ZV7A 1C30A 1U1CA 2BKLA 3BWBA 4IIXA 5FFFA 3WSTA 4TV9F 3SK0A 5AW0A 2BM9A 1G6KA 2C3OA 2PJDA 1J8MF 1TCVA 5JANA 4UKDA 4M8KA 1OX4B 4BXOB 4REQB 2HWUA 1OPXA 4EAAA 3L0ZA 1RJFA 5AW5A 3OE5A 4Q4DA 1T8TA 4PW0A 2VOJA 1EXWA 3N7TA 4B8ZA 3F98A 4BU0A 3KPVA 5AW8A 1Z0AA 1A5ZA 3IHKA 2JHFA 1CR0A 3MTAA 4OHPA 5DX1A 3TIIA 4BNYA 1G7CA 4U2FA 4UXIA 5E4JA 2VS1A 3Q3EA 3ZCUA 1OIXA 3X2FA 5FL7A 3I61A 5KQGA 5DHTA 1M1UA 3NGMA 1PZHA 2BYTA 4UHBA 3LXUX 3A9CA 3MT7A 4JJ7A 4PCAA 3BCSA 1MAAA 3JQ8A 3OPQA 4ZVNA 3M6FA 1FJ2A 1QGYA 1II8B 1OFGA 4X1IB 3WGZA 5DM60 1SFRA 5CNJA 4US2R 1H42A 4Y0NA 1DX6A 4G07A 2GPAA 1D1PA 3ZCPA 1XEXB 2ZJFA 4TLMB 4AG6A 2YWGA 4AYXA 2FZCA 4R2JA 2K2QB 4HDSA 3I6IA 1QBKC 2XGGA 2HD4A 1GCOA 5GY7A 3SJZA 2R0QC 4Q7EA 1YA8A 2QENA 1U1IA 2GAAA 3NOVA 1LTKA 2L82A 3EXEA 2X2PA 2W2VA 4NVRA 5CGQB 5IVKA 4ZI5A 2VT2A 3N6XA 4F04A 3WWDA 1E3DA 2KYRA 4S35A 1P0MA 3B1KA 1CSEE 2DY1A 1O2DA 1J4AA 4L75A 4F6RA 4BZQA 3MJVA 5F3WB 3LZCA 2RGBA 4A1OA 4OMUA 4RZQA 3UHJA 4RVCA 3K71B 2BFCA 1E3TA 4V0KA 2BZGA 3S29A 2HF7A 2PKYX 4NKRA 3DE5X 2I66A 5CR9A 3HJAA 5CVEA 4DSAA 3HYRA 1ZM2A 3I1IA 4MVJF 4C0AC 2DKFA 4GX2A 5CT8A 3EDRA 2BR4A 4N9QA 4U7TB 3OZIA 3SD7A 3WK7A 2OB2A 2FUEA 1EVIA 3FBTA 4OQPA 5AKLA 2E4ZA 1OVMA 2IHBA 4WCVA 1CJMA 2FPXA 4E4RA 3NHKA 3ZKAA 2XUQA 2XCTB 4MUNA 2YFKA 4YJ3A 3L5KA 2ACEA 2V59A 9ABPA 1VHWA 5TE9A 2NYVA 2X6RA 3QPUA 3NO4A 2EDCA 4IMJB 2ZSUA 1PK7A 2WLTA 3MYYA 1FP2A 2JKYA 2X19A 4Q6BA 2Z56A 3UHOA 3F5FA 5IKXA 3KEOA 5BUSA 2A0WA 3BILA 3FVWA 4EFMA 3SBOA 1XZPA 3RJMA 5LZ5A 1RYFA 5B3KA 1M67A 2QR5A 1TPZA 3LX8A 1YRAA 5KDLA 1KO7A 4BVJA 3IB3A 2B92A 1NNEA 4O4JA 5C52B 3AJDA 2PL3A 3WHKA 4TMYA 4DA6A 1B2LA 2IXBA 3O8NA 3ET4A 1ANKA 5BR1A 2XWSA 5D3MB 4DUGD 3RUAA 3QEMB 1ZBQA 5KUTA 2IUTA 2EG9A 5B1DA 1L8OA 2HLNA 1I94B 1D1QA 1ULBA 1DC3A 1CUGA 3TDKA 3LP6A 2ONCA 3QXJA 4UHFA 2DWOA 4O2BA 3DB2A 4LGVA 2PYZA 4LRTB 1E4EA 3KZKA 2CV1A 2IYYA 4D8YA 1BWRA 1TZBA 2P2SA 3A4IA 3EZLA 4LXHA 3KXKA 3L8CA 1Y80A 2QTNA 4GE0A 3FIJA 1YDFA 1DP4A 1YR3A 2GZDA 2QK4A 2LCIA 2YFQA 4EUKA 2JEYA 2FNAA 4ODIA 4NCKA 4R2LA 3GDHA 4ZT6A 1P7PA 5LZ2A 2JJ1D 5E1MA 3A04A 3QENA 3HB4X 2IH2A 2I67A 4MYCA 4X54A 4MIYA 3G2QA 3PJGA 3TZBA 3THXB 4G23A 5H8WA 3GDFA 1DAEA 4MUFA 2H4WA 1X7HA 4CKXA 1I9CA 5AI6A 1LPMA 4NONA 1T2EA 1EWYA 2AQKA 1YQ9A 4KUEA 1GVNB 2FZKA 2WNIA 3PT5A 1DX4A 4AZ0B 4BCCA 3KT6A 2R86A 3CO0S 4UCXA 2WTUA 4MEBA 2OV1A 2FRDC 1M33A 3ISJA 3VR3D 4R5MA 2WDZA 1OFHA 4RTKA 2ZKIA 2JGIA 1IUPA 1XD2B 3WBBA 1WL8A 2CHGA 2QORA 1VSTA 2DHRA 2XX3A 4C6SA 5SZHB 3HXLA 2CDBA 3CW8X 3OIDA 3HCBA 4GSKA 1T2NA 3K96A 5JXJA 3OH8A 1VIDA 3W3ZB 5TMEA 1SN7A 2JIZA 5DO9A 2R5WA 2X7HA 2AOUA 3HCPA 1NMYA 2JB9A 5AI9A 1S9HA 4URFA 1H2HA 1JDBC 2GM4A 5AH0A 3NOOA 1ZRNA 1M34A 3QNMA 3B5EA 3ZOKA 3BHIA 2YWDA 2DBQA 4GM0A 4ES6A 3AFIA 3VKHA 4XLZA 5KNDH 2Z9CA 4PAWA 3NU1A 4OK6A 2QM3A 4H35A 2OD2A 2PN1A 5IHPA 1AC5A 2ZQYA 4FPXA 1HM5A 3EIWA 2UZ3A 2V7TA 1NU8A 3GRVA 3IX7A 4JBXA 3WRVA 3FFXA 4DLUA 3HDHA 3RLIA 3IEVA 4AJ4A 4BQOA 1EHYA 3DEIA 4PC2A 4L5YA 2QRZA 4OP3A 1QAOA 4TMTA 4EHKA 2V98A 5J2TB 2PQMA 1OKKD 2XF2A 3D81A 3STXA 2P9GA 1LWNA 4LEIA 1Z3IX 4NJMB 1A7JA 2GNOA 4LDAA 2HMWA 2OO5C 1L7NA 4I4CA 4ZGBA 4XW2A 3GNQA 1Y8AA 3I52A 4I66A 2GXSA 1D4ZA 1MJNA 3TPCA 5JECA 3C24A 4GX0A 4KOEC 2XDWA 5J43A 1URPA 2XZPA 5EKDA 2EDAA 1NMXA 1JLHA 2Z6VA 4JT9A 3C3EA 5LLSA 1YRQA 2QE7A 1VJGA 3O6VA 3OY2A 1U3WA 1SG6A 4DXAA 1WW8A 2ZYVX 5LD2B 1CE8B 1EFVB 1ODFA 5ELLA 3A8TA 1U9ZA 4LZNA 1CVLA 4JLVA 3L1UA 1SB8A 2ODTX 2FWIA 4U7FA 4H7EA 1NXWA 3KR9A 2XCLA 4CQMD 2HQBA 1AQ6A 2ZWAA 1OB5A 2NYUA 1EUDB 3N8GA 1T35A 3QF4B 1VYHA 3EY9A 3ENZA 2HA5A 2PSHA 3ES9A 1AKEA 2DCUA 3D1JA 2CNBA 4TV8A 5C34B 1PLJA 4B3MB 1L5VA 4ZEWA 2AN3A 2WQ7A 2RARA 1HKUA 5BR8B 3G8CA 3DOHA 3AVXA 4F1WA 3EMKA 4D9MA 5B7QA 3D0KA 4MP3A 1E2GA 1B93A 1PKXA 1R0CA 3T3MB 5KYKA 2IEIA 3D4PA 3WL4A 3U7IA 1XF9A 3U7QA 3GLHB 1UDAA 1EINA 1I2ZA 2JIPA 1WMBA 1K7CA 2PIAA 4JQOA 1J2TA 4CKCA 3ZQUA 2J07A 1K0FA 4URWR 4I1IA 4GI2A 4GOOD 4EQZA 4J94A 4AUMA 3QLUA 2JJQA 3KPUA 5IC6A 3E9QA 3IMEA 4LECA 4R8SA 4N6GA 1XTUA 4RQBA 4YAUA 3FCXA 2Y9PB 3UQYS 2A1UB 3GEMA 1PBTA 5FPPA 4Q7QA 2ZUEA 4WX2B 3IAM1 5DKFA 3FUUA 2XUPA 3LFHA 4KGVA 3X1ZA 2J46A 5IARA 3TSZA 4HZUB 3PHCA 4WZ6A 2OPHA 3RRZA 4DDHA 4K9LA 1CJUC 2WZQA 1ZN7A 3NBUA 4AJPA 3OA0A 5A6SB 5FPKA 1V5EA 2DYKA 2BKAA 2G04A 1B6RA 3E1GA 3M82A 1SH7A 5EIXA 3WK9A 1II0A 1J8YF 3K72B 3KVYA 1BC5A 2ZLBA 4PGAA 4F06A 4C0XA 3IKMB 1X2EA 4FFMA 3PEEA 4QEZA 5C1OA 2BJHA 5CFQA 3PC4A 2EBUA 3F6SA 5LLDA 3HB7A 1JA0A 3G7NA 5BRAA 2Z8ZA 5EE9A 3WSWA 4MUXA 5JYBA 2EIHA 3GYBA 1USIA 3H19A 2AXEA 4ZCQA 1BCSB 5SZKB 3HWRA 4FYKA 1JXMA 1W9HA 1U63A 3LT2A 1WCYA 2PD4A 3ZXXA 3HCAA 1S8FA 4C0JA 5DIFA 2CBXA 2XA2A 2XNCA 3ESDA 4G01B 3QA3E 2O8BB 4BWVA 1QHEA 3F6CA 1XMQB 1I5OA 2Y1EA 1M74A 4MRNA 4ND1A 3ZWPA 1L7VC 4URHA 1TKAA 3JAWB 3GJ7A 2NOAA 2A5YB 3MWJA 4YXWD 1LH0A 4PGMA 2FG5A 4FDUA 4Z9YA 4P5DA 2WHRA 3C74A 1G2PA 5IK2A 1ZH6A 2QRLA 5CDFA 2G09A 5ICSA 1PZGA 2H63A 3REQB 3BE6A 4P86A 4Q1CA 4UM7A 3T5GA 3TQHA 2QYHA 1UMBA 2AG0A 3OSZA 1YJAA 5B12A 3K70C 1X8XA 2R6AA 3QE9Y 2DFLA 2WA2A 1NZJA 1USKA 1T2UA 2D4AA 2MYTA 4IJVA 4BMVA 1MA3A 4HVCA 1GZ3A 4GICA 4PQRA 1I3KA 4CKBB 4XD7A 1NJ6A 3WB0A 2ZCUA 4FEAA 4JSYA 1ZJ5A 2H54A 2YBEA 3P9KA 4NIMA 1NG1A 1IEWA 1XHEA 1ENPA 5E6RA 2LGJA 1E1QD 3N3BC 4EL0A 4B4DA 3ASUA 4D5GA 3CISA 3TUIC 1Z68A 3UMSA 1GCGA 1T4CA 4KYIB 1ZC4A 4L9AA 1ZIPA 5DHSA 1BDMA 1HC7A 3B52X 2C9CA 1TVMA 5B4VA 3K6JA 5C53B 4AYTA 3OE1A 2IY8A 3NV7A 3EVBA 5ECGC 1PZEA 1E69A 3MGAA 1OLXB 3S2IA 3E9NA 4LX0A 4I5EA 4GD3Q 3NANA 4EI2A 3I04A 3O4VA 5HRCA 3BXHA 3QUTA 2RGWA 7YASA 3JD1A 3ZWWA 1KSHA 1HURA 5A9SB 1JIQA 1X70A 4QOSA 2Z6QA 2TS1A 5ICFA 1SC1A 1PD1A 1KWKA 3NHLA 1CUHA 1KIFA 1WP9A 3WDLA 1GTJ1 5EZ6B 2L19A 5HF6A 1G3MA 2V03A 5FWXA 4XWWA 2J9GA 3WL8A 3P2EA 4P93A 2XTAA 1HDYA 3JSAA 3AVUA 2CFCA 2BFMA 5BV7A 4FJ1A 1TYZA 3JVDA 1KTIA 1Q1NA 2R6DA 3YASA 5BNIA 4JL6A 1ZOPA 2A14A 3ICPA 4FGLA 4Y2SA 1FE8A 1GLNA 1NRXA 3QUQA 4XD2A 2YW2A 3T7KA 5JCPA 3KQUA 1MX1A 2W83A 4ND3A 3V1YA 2YWHA 3EIQA 4ND2A 5JCJA 3UBMA 4L9WA 3I64A 5TVGA 1P7VA 3JQPA 2PQ0A 2C20A 4XTCS 1H6BA 1IONA 1IY8A 4RH3A 2XVMA 2XECA 5CJ2A 1SR8A 4F7WA 4AS1A 1YU9A 3EHEA 1PTJC 5J2UB 1U4SA 3GNLA 5HE8A 2QAGC 4I50A 1FJGB 1PT8A 3B70A 1NC3A 1YQDA 3FM9A 3ZIAD 4AU1A 1Q92A 3U26A 1TEXA 2NNWB 4EJ0A 1PK9A 3PGJA 1WX1A 3KIPA 4H08A 4KPUA 4UHJA 3G9ZA 2OZEA 3MAAC 3QMWA 4GIBA 2CJYA 4KRXA 1G7TA 4A7PA 2P9CA 3Q1KA 5M2QA 4IIUA 4OQMA 4BEBA 1M7BA 1DOAA 2QQGA 1VIYA 3EW9A 2G7ZA 4D9HA 2W11A 3G5AA 4QXRA 4QQKA 3KKKA 4O3MA 1IJBA 2PYIA 3L6RA 2QGNA 3KHTA 4II7A 1E3WB 4WKPA 3DQZA 4YP0A 4A8PA 1CTQA 1GUFA 2UKDA 1P7CA 2OZLB 2WJZB 2ZK7A 4J7UA 3N2KA 2G76A 2IT1A 1YONA 2PTGA 4NBNA 3U31A 4DMKA 2XVZA 3C5EA 2L42A 4DCCA 5BNWA 2VSFA 2B1RA 1XHLA 4LOJA 4NRDA 1RBMA 3L1KA 5LBTA 4RDCA 1HFKA 1U9JA 5JATA 1Q6YA 1C3OB 2G9QA 4RXTA 3T0GA 3QKIA 3AEKA 3TLKA 4LOAA 1LS1A 1X7XA 1Z0DA 2DWQA 2OMKA 2PXXA 5U9CA 3TBHA 5HKBA 2EYQA 1KYXA 3KOUA 2I5PO 3T95A 4IUDS 1NW6A 2F3TA 3COSA 4DUZB 5UKDA 4MAFA 2JHGA 5E6UB 3THYA 4V0OA 3T61A 2IZZA 4Z4IA 2DWCA 4NBSA 4MO2A 1EFRD 5FAXA 3UJ8A 5ALDA 4CQMB 1J5PA 1YZHA 1TC1A 2WTAA 1NLFA 3NGLA 2HRZA 2CCJA 4RCVA 5D6NA 1DO2A 3HGQA 5EIAA 2IDJA 3THRA 4RDXA 5KQLA 2OENG 1Y4UA 3FDZB 4CT4B 1EM6A 1E9DA 4NENB 4Z3KA 4BNFA 2HT1A 4RSHA 3EZ6A 2H1SA 4HI0E 1W87A 2OFWA 3DZFA 4U3JA 1CDOA 1UP4A 1JS1X 5F9HA 2CMDA 3MTGA 1I0ZA 5BN3B 2IE0A 1IJFA 3SDSA 5A3RA 1TT7A 4Q3EA 4ZZ3A 1DVRA 4UCQA 4OXQA 1NM5A 3I37X 4NFLA 1TDJA 2P5SA 1GV1A 3GEPA 3HKBA 5IZ4A 2PMDA 3DVLA 3H1PA 1KDRA 2QY9A 1KDZA 4EELA 5HIMA 4JY7A 4YR9A 2JJ2D 2XRFA 1JXQA 2NXNA 5F7JA 5FOXA 5BV8A 1K6XA 2TSYB 3EMDA 1W7AA 2WF9A 4RK5A 4Q9KA 3R3WA 5FPYA 1RNLA 4HX5A 1T36A 2RHBA 4OEHA 4Q9NA 3NM6B 1I6MA 1K6IA 4FIZA 3FMPB 4KNVA 3KQHA 2BEWA 4MPPA 1Z2PX 5H80A 2R8PA 3R7WB 2I7XA 3L7MA 4QNRA 3HM9A 4JJ6A 3P4UA 4KLZA 4QVIA 4AICA 1GY8A 1FPMA 4AUEA 4NPAA 3BB4A 3OQVA 4O4LF 4K86A 4JLKA 3TWOA 2AF3C 1MB4A 1P61B 4TT8A 1P44A 3DMTC 3IUPA 1DJNA 2EFEB 1EFPA 2DHQA 1IHOA 3K32A 4KQHA 5CFPA 3N58A 1U80A 3O92A 2R5NA 3BXXA 3OY7A 1IXSB 5CYPA 4B87A 4ZHQA 4S3MA 3IDOA 4GPEA 1ELOA 4NLLA 5EOVA 3C6QA 5CGZA 2C88A 4FLFA 4TWBA 4JL8A 3WIVA 2PVCA 3GCWA 2LWIA 3ILVA 4IHAA 4MQMA 5DYWA 4DQVA 3C8HA 1ZD3A 1WJGA 5ENDA 4QHSA 2PZ8A 2QX6A 1KEPA 5L3RA 2N3ZA 3CB4A 1D4OA 2I7VA 2QT0A 3ULKA 4MUIA 4DZRA 4F12A 4B5LA 1GLVA 1YHYA 2R1TA 3AY3A 1QP7A 3A1WA 1NJ1A 4Y7CA 4WBNB 1GTZA 3QWIA 5IPFA 3H4TA 3E7DA 3LY7A 4BMYA 1T5SA 2A9PA 2NAPA 4TN1A 1FSSA 1I2CA 1KK2A 3HN2A 1MRSA 5TMBA 4W5QA 3GYGA 4G4SP 3LBIA 3RVPA 1HGXA 1O6ZA 2WFLB 2WM3A 2XGSA 3AIKA 3DOOA 4NPHA 4R6WA 3RS0A 2W4MA 4AWBA 3CVYA 2RKWA 4TYQA 4CCYA 2B94A 1FNNA 4ZYUA 4YB8A 2B5OA 2J9RA 1HE3A 1L5LA 1XVAA 1CXZA 4OXRA 4LQLA 4UU7A 3ZWYA 4BNZA 2JLXA 1U5BB 1U0OC 4O59O 5B2FA 4MB2A 5JY6A 2NM0A 3IXMA 4ND5A 1GQRA 3W5AA 2XQVA 3E70C 4B4WA 1B6TA 4P58A 2YWEA 3GJZA 3GP3A 1V39A 1EQUA 3IIMA 3TOCA 1P29A 2B61A 3ENWA 4GMFA 2Z4RA 3KTAA 1AKRA 1A5TA 1DDOA 3IULA 4GUDA 4YP5A 3VUFA 4W7IA 5E8RA 1JWBB 3CX4A 4Y8VA 3ZK7A 3Q85A 3QYPA 1WQ1R 1M1YE 2JS7A 2LUOA 3LQ4A 3NT5A 1V8PA 3INYA 4ZPXA 3AT1A 4OX9B 1OWMA 3PQ8A 3J7TA 4IG4A 1IQPA 4GECA 4TLAA 3V32A 1PJAA 1JEQB 1PVDA 4HFJA 2I2DA 4R2HA 3P2JA 3PA8A 5EJIA 5FRDA 3BMQA 4LKOA 1FDTA 1BXZA 1UBEA 1E2BA 1SU4A 1GQOA 2JI4A 4RU1A 1ULAA 2A33A 4P92A 4LYHA 2BSQA 1EJ2A 3EUFA 3NDIA 1ISPA 4MJXA 2PT5A 2Z43A 3TMAA 4GVPA 5M34A 4ZMBA 1LBIA 3KAQA 3O2QB 3EGWA 3H4MA 4D80A 1F17A 2FVYA 5JTUA 2J08A 1OLSA 3AINA 4WACA 4WRRA 3JARA 1C41A 2QPTA 3ZWOA 1FRFS 4S05A 1TXGA 3IH5A 3ZYCA 4AM8A 3K4PA 1KTVA 1RE1A 1V8FA 4LNAA 5EIFA 4DARA 7MHTA 1YZFA 1LDNA 1T5HX 2C8JA 4AY2A 2PKEA 4RVNA 3EVNA 5JE8A 1Y5RA 3DF7A 1BXRB 2NGRA 4NHEA 2BP7A 4XSVA 1EEHA 1KPGA 4M2LA 3PXCX 4Y67A 1OTHA 3OZDA 4HLUC 3LY9A 1L5YA 2BRUC 3CT6A 1AXEA 5C7YA 3A2MA 1P3DA 3TYXA 4ZAFA 5EVCA 1M2JA 4MWDA 1W19A 3R3UA 2HO5A 2PGAA 3SU8A 3NDPA 5KDDA 4BNWA 1RR6A 1LU9A 1SG9A 4YFVA 1PV2A 4WY8A 4BLWA 3MELA 3MWEA 4TRJA 4D6YA 4MS3A 3TR6A 5BWBA 1BA3A 5DTMA 4UD6A 3O8CA 2HBZA 3NHJA 3FKSD 5DK6A 5JMOA 1YD7A 4AROA 2SBTA 3MTDA 1TF7A 1FYXA 3O3OB 1PNVA 1RMQA 3W6UA 2ZU0C 2EGHA 1Z73A 3D3KA 1AK9A 3RK4A 3VDXA 1YVPA 2ZTMA 3RSQA 2ZUUA 1NZDA 2NUBA 3BQ9A 1D0SA 4RZ2A 4K6KA 3X1XA 1WQ4A 2QJTA 3O8LA 1RPJA 2IYFA 2OO7A 3HJCA 1R2QA 2B25A 3PGA1 1W1WA 1XZCA 4JC0A 1HZZC 2BN4A 3CLSC 3LPNA 4JZKA 1SVKA 4UXJA 4JP2A 3SIPA 1GT6A 4ZQEA 3IXLA 3NRJA 4C4AA 2KHZA 1N5RA 3K0KA 4PYLA 4HV4A 4PYJA 1GQFA 4RM2A 5DSTA 1C14A 4QICA 2R8RA 4KODA 2OQ2A 3O8BA 3FZEA 3VJLA 5GIPE 1Z33A 3BS4A 3GEHA 3NYWA 3IHLA 2W6PA 1Q1BA 2I62A 3NM4A 3C6ZA 5G0TA 3N8NA 3SOZA 1QUFA 1Y82A 1JXOA 3B53X 4Q3KA 1RHJA 1TVEA 3GZ4A 4RY9A 1JHZA 4ENTA 1KYVA 2VJAA 5DM1A 4ZJYA 4RF4A 2PR7A 4M21A 3ECCA 2Y2UA 2X0DA 3FTEA 3WOVA 1TX4B 2IITA 3SJCA 3IP6A 5CA1A 3QVJA 1R0KA 3MRSA 1JB9A 2YRWA 3OKCA 3W2FA 2FFHA 1NXVA 4RVUA 4WERA 3I5UA 2C42A 4N7RA 3TR0A 4BB5A 2ZJAA 1F2UB 4BZZA 4PN7A 5KWIA 5LM3A 2HMTA 1GKKA 3NHAA 4A92A 3HWWA 3O3MB 3BXEA 3H3XA 3R8XA 3FH0A 1I7DA 5KKAA 1XPJA 3DBRB 4CU2A 2Z2KA 1TIBA 1CQXA 3S1AA 4C07A 3EDQA 3F3KA 4ARVA 3NASA 4LN1A 1G21B 2R1VA 1BXGA 3FNHA 5I7HA 2UUCB 4Q3AA 4AUKA 1W6RA 1DADA 2AVDA 3AJEA 2RIPA 1S5PA 1SKAA 1Z7WA 3CHYA 1W9MA 5CH8A 3ZJYA 1AGYA 1OY1A 1Z4OA 4Z0NA 2QRVB 3BSFA 1Y98A 2GAIA 3PDHA 3PU6A 5E0KB 5EZ5A 1K63A 2IPMA 1QB8A 5IJZA 2AL7A 2FW0A 5K99A 4HMOA 2G7MC 5A0FA 1B6SA 3GLKA 3KXDA 1C29B 1L4NA 2AFIE 3IUJA 2F48A 4HQKA 1ZRSA 3KYDB 1U9IC 4E46A 4UD2A 1UT6A 1PL6A 4M7RA 4NNOA 4DMRA 2SHKA 4W9NC 4MUGA 4O2AF 4EW2A 1JR3E 1THZA 3FMVA 1ODLA 3T1HB 2O59A 1GKUB 3K09A 2JBAA 2NXWA 1DBSA 2B4AA 3AB8A 1XL1A 4G5GA 3L0IB 4RTSA 1G5PA 4RK0A 5A2QA 3AEUB 4U6NA 4OI0A 3EZ7A 4IILA 3UKJA 4DJJA 4DIEA 1Y8ZA 3LZ6A 2HMYB 3P97A 4MWBA 5A06A 4OHZA 1ZY2A 3IUEA 2ZDQA 4M4SA 1A8SA 4B3GA 2B8EA 3OM1A 3T06B 3DDOA 1YB2A 1FQOA 1FF9A 3ZWMA 1VG1A 4ZANA 4DA0A 4XWTA 4P35A 5DBEX 3DKIA 2HBYA 3CKLA 1TJ5A 3EDMA 3L49A 5DGIA 3D7NA 2MYNA 1NONA 4DQ0A 4OXNA 3KKMA 3KTOA 1H8EA 3L6UA 1TQ4A 2BZ0A 3GEDA 1OGYA 4X7MA 3NBKA 3HACA 4B3CA 3N8KA 4ZODA 1I3CA 2V0NA 4G5XA 4V0QA 4OSOA 5E4TA 3LKZA 3KK0A 3BJZA 8ABPA 4B85A 3AESB 1K5HA 4L4UA 5C5IA 3AO0B 2XAUA 4CQNA 1Z7BA 2GHRA 2P27A 2HU2A 4CFZA 1UC4B 5ILOA 3TBKA 1ITZA 4YPFA 3HJGA 4UPDA 5D3QA 2D0DA 2F64A 2VA9A 4F46A 4MH0R 4IQ8A 4WMLA 2YVKA 1EGMB 1P2SA 3CLTD 4JP5A 4F9TA 3EGDA 3W3AH 3ZLVA 2R85A 4JI1B 2R68A 4MMXB 5I7EA 4AN1A 4CWAA 3AQIA 2VBFA 3U7GA 4IDCA 1WS6A 2F8MA 2F59A 4XX1A 2F3PA 2NPOA 3FCUB 5JSQA 3HRKA 4B3RB 3RUFA 2IYUA 3GG9A 5FF9A 5L4LA 3UYKA 2VBGA 2IXTA 5J63A 3AONB 1FMLA 4DC9A 4PPFA 1L5GB 3AKZA 4HYYA 2X4DA 3B3JA 3RVSA 2C7OA 2DR3A 1J20A 1QHYA 2PHZA 1MOZA 1CZRA 4M6WB 4XUCA 1UUFA 2M98A 3DPSA 4MTLA 4Q9DA 3SZ3A 4DB4A 4JWKA 3S5UA 3HXKA 3WK6A 1G3QA 4K5QA 4IXTA 4B48A 4M1TA 2QVBA 3INGA 4MRRA 1PLKA 4W1PA 3BD7A 3JPYA 3T1QA 3O21A 1WW2A 1TCUA 3G0BA 4CEHB 5EIWA 1X1DA 5C4IA 1XQXA 4YUWA 3UK0A 5BY2A 5CX1B 3T5CA 4I19A 5EJAA 2YXPX 4NU0A 1K75A 1MAHA 4LZLA 4JIGA 4PNZA 1DJQA 5FWDA 4D9KA 4QEDA 4YT5A 4J0QA 2VQFB 2JVJA 2ZBDA 4H4EA 3GA0A 3PNKA 3HH8A 2QOEA 2XMSA 1Q7GA 1Y3DE 2R60A 2YASA 5I4KA 5JS6A 2A94A 3GXBA 3IIEA 3IVXA 2IPAB 4RK7A 1R8YA 1GEGA 1KL7A 4URVR 1C80A 2VJYA 2GH1A 4HAWA 4MLPA 2Q45A 4MXDA 1M6NA 1RRVA 1WY5A 2OAEA 4FKBA 1SCAA 1HYGA 2FSFA 2XY4A 3WYEA 3CZPA 3O3CA 4NEHB 1WOMA 1ZIYA 4YAOA 2LIVA 4EPYA 4ZOQI 1NL3A 1U3UA 4OM7A 1VXRA 2YZMA 1RIFA 4YCDA 2TMKA 2HXSA 1W96A 1DBPA 3OLYA 1S8OA 2V3WA 1GM5A 1CF9A 4HGQA 5GV7A 2PWAA 3I3OA 2I7DA 4OPMA 2GCGA 4B3BA 3N0WA 5BORA 1M2OA 3JQ9A 4YRTA 1Y6FA 1DDIA 1LFDB 4ZC8A 3AERB 4UUAA 1TLFA 2E37A 2RJ3A 5CA0A 4OLJA 3TNFA 4YQEA 3S70A 4H2DA 4I55F 3U62A 3PKJA 2PRJA 4QRHA 1ZVMA 3MJEA 4QXPA 1G0OA 3S55A 2DB3A 4HKTA 1PCXA 3AW9A 3KWJA 2HI0A 3O4IA 4UM8B 2A5DA 4GRDA 3P4YA 4IDNA 1KYZA 1TYAE 4LX8A 5I9IA 3NCHA 4NS4A 5FQOA 1KEKA 2JCXA 5H9WA 2VDWA 3REGA 1SOMA 2IPLA 4AMZA 2YVAA 1F14A 2F4NA 1KDTA 1DS6A 3AVVA 2ZIUB 2L18A 4OIMA 3U3ZA 2QUAA 2JHCA 1XPUA 2Y6VA 3UZUA 3NETA 1FZQA 4MX8A 3VC2A 1RHMA 3W2TA 1OWPA 4F3RA 5I7UA 3KYCB 2C2ZA 3SFVA 5EJ2A 1Z3CA 1MX5A 2PLNA 1BWSA 3OCZA 1XQVA 3VV2A 4GP6A 1WHTB 2F43A 4MGYR 4S1VA 3OEED 1E9EA 5DYNA 1NXOA 4NU5A 3IEIA 3BFPA 1YR1A 1DGQA 2QZZA 1A9RA 3B1XA 4WLEA 1Z5ZA 2AI2A 1TKRA 3GQVA 5L9AA 4W5RA 1A04A 5IASA 4EKYA 4J0EA 5KX5A 2OQIA 3TQQA 1TAUA 3QKUA 3V46A 4JI3B 1L5FA 3TL3A 3I62A 1AN9A 2V3VA 5ESWA 5EUBA 1LQUA 1M8PA 1ECJA 4GKVA 3TAHA 4QBGB 1I80A 3RM3A 2XYVA 4ILKA 2WAYA 2I6FA 4LDNA 1J7JA 1PS8A 4UHEA 3OT1A 1EFKA 4GF5A 2NO1A 3LX6A 2D5BA 4ZMSA 1NXSA 1QR2A 5JAHA 4RELA 1PFVA 3PPWA 1ZWLA 3OPMA 5FOTA 2O0HA 4CL8A 4NDNE 2BJVA 2QYSA 4KH0A 3T3OA 4OQEA 3C3WA 1R3UA 1DG3A 4R3NA 4J4BA 2ATIA 1NATA 3AI7A 4BQQA 3VUEA 5LQCA 1C7RA 3CYFA 2VT7A 1W93A 2Y66A 3TBFA 4KFCA 2QSYA 4AP9A 1G5HA 3GR6A 2IBMA 1CNEA 4MDEA 2RG7A 2AD5A 2YYAA 3G6WA 4YJ2A 3DL2A 1QX3A 2O1SA 4RA9A 4JI7B 3ZHCA 1T2VA 1TVKA 4QDXA 4NE2A 3WL3A 3ETJA 2WF5A 1EX6A 4QXQA 2AW3A 2GLTA 3N2GB 1WV1A 1FLAA 4GVXA 4MGIR 2YRFA 3ZU5A 3BMNA 4PZZA 2G1JA 2YN2A 5FLKA 4KRFA 3WMXA 3MWGA 1IZZA 4GZ5A 2ADFA 4ISBA 1U0GA 3DOFA 2P4HX 4NH4A 2YZKA 1UK8A 4LHZA 3F71A 3N53A 3ZQJA 1I7NA 1R6VA 1N2SA 1YR6A 2FK7A 5AJTA 4C78A 2F1KA 2RG1A 3COJA 4M7WA 4B1FA 2G1UA 1T6NA 2HSGA 4XM1A 4UQOA 3AG6A 4WY5A 3UJHA 1M1NA 5ARDA 3HBMA 1W5FA 2PFKA 5JNWA 4NWIA 2Y2VA 5ENZA 4YJ3F 3D2LA 3V4PB 1ZLXA 2C2MA 1M6VB 2WSIA 5BSKA 1N2IA 1TU3A 3H1BA 3RRXA 4UFNA 1QIEA 2O7RA 1O54A 3G0CA 2QNIA 2J0SA 1YF3A 5TPWA 2B1QA 2FEKA 3PFHA 4CNQA 3DEAA 4RK4A 3RT9A 4DLTA 1C8VB 2J9ZB 3VJRA 1GL9B 2OBYA 3QUBA 4Z9XA 1E18A 1MEJA 3GOHA 4C43A 1YSCA 1I6WA 3M9WA 2D62A 3ZWDA 4TSFD 2PSSA 4KH1A 5JTTA 3S7ZA 4WNYA 1RQNA 1ORTA 5SZIA 4O4JF 4C1BA 5LYJB 2G1KA 1KORA 1IWOA 4YAFA 4CMJA 5CLLA 2AJCA 2XNDA 3BMXA 3NRCA 3JTEA 2AG5A 1IBKB 3AHDA 3T9AA 1FEZA 2CV0A 2LW7A 1KFJB 1U3FA 1KO1A 5F2KA 4JD5A 4IUCS 3D8UA 3FR8A 1F8GA 1NBAA 1U3DA 4ZC1A 5TQJA 4P80A 5DLEA 3DBHA 1PFWA 3QTBA 4KN9S 4OK3A 1I1OA 4PLFA 4NR0A 5FLEX 3SIXA 3GHYA 4CV1A 5CLJA 2BUCA 3EOBI 1G1MA 4D5EA 2O52A 2PX6A 4O2BF 2Z2YA 4WDQA 2V6MA 1T5OA 4D44A 2NO9A 4O4HB 5IWCA 3A6GA 3U80A 4BP3A 1QZUA 4QD3A 2XSZA 1D2CA 1G8GA 4IIGA 2FN9A 4L4XA 4ZVPA 4CFYA 2JGKA 3CEAA 4MGKR 1GRRA 2ZROA 3SN6A 1OJ7A 4QVKA 2MOKA 5HWSA 4MYHA 2E5LB 4Q7MB 3RFVA 5D7BA 1TRKA 4JJ8A 4OHWA 1C3VA 3LQKA 3LQYA 1UFVA 3T9EA 4BMCA 1L4GA 2J3EA 1P2VA 4RPKA 4DCOA 5L8VA 2Q4DA 1UT8A 4H17A 4YXFA 2DAPA 3DW3X 1OUMA 2FPPB 3CUKA 4R41A 1Z25A 3T7JA 2O6LA 5ALEA 2PR2A 1DKRA 1U7PA 2HK7A 4K6MA 4RLFA 3M1LA 3F7NA 4XM2A 3WWOA 3USZA 5L4SA 1P3Y1 3NDBB 2BMFA 3OLQA 4YV7A 1N2JA 3PVCA 1AS2A 1BWPA 3R3SA 5TJHA 3WLLA 5CLQA 5L4NA 3MOSA 3KU4A 3CF0A 4FYYA 2WVJA 3LBNA 1I4LD 3AFMA 3P2OA 1OX4A 2H17A 3LPCA 4YX9A 5K8CA 4REQA 4BXOA 1CDDA 3TTTA 1L4EA 1JEJA 3N8HA 4BB0A 3ZE9A 4QJ4A 4IV5A 1NUSA 2RGGA 2Y3IA 1PI3A 4DDMA 1OBHA 1RRMA 4K0RA 4PC7A 4JP1A 1KJ8A 1X1AA 4U9HS 2IS4A 2IQIA 2WM8A 3QFSA 1NQXA 2WHXA 1Z5WA 3KS9A 2PWYA 5DHFA 5K0FA 1AQNA 2P6OA 3GT3A 3ND5A 5FI3A 5MGBA 1E99A 1YJBA 3I1JA 5LP6F 1E8MA 5KNLA 1A0OA 1KFBB 1BE0A 3NTRA 3H8JA 5CEFA 1K8ZB 4X1IA 4GR4A 1RI5A 1II8A 2XZTA 1X1CA 4JQZA 1XRLA 2OM2A 4ANFA 5A5VA 1T4MA 2CFTA 2OGSA 1NF9A 1NW4A 1P8AA 3ORFA 1W36C 1GA6A 1XEXA 4WZBE 2VDMB 4PLZA 4R8KA 4ZYXA 3HY6A 4YMSA 3N0VA 1YVDA 4MO9A 2CV2A 4LGMA 3D02A 2V9CA 3A1CA 3DDCA 5K0TA 4KYTA 2R8EA 4GKKB 2RHJA 3OX2A 5AOAA 2AX3A 4TPKA 4Q3CA 2AXPA 1VG8A 3E61A 5C0OE 3TDNA 4JLPA 4UVHA 5K8VA 1M8JA 1F06A 1ZK4A 1L5NA 4JT2A 1NBMD 1TJNA 3JD3A 1HE2A 3EVTA 4KWTA 3CE9A 4CKZA 3KAJA 4HG2A 2QJRA 2WJ4A 3VNAA 2UYHA 2GJKA 2GAFA 1ZU5A 1JQ3A 2Q99A 1OWNA 2F3QA 3KQWA 2ECOA 4RKYA 3IKTA 3VYWA 2W6JA 1G0NA 1LRKA 3NOQA 1KZ1A 1L8LA 4Z9BA 1YUNA 3TLCA 1IZ9A 1QO7A 3DMRA 4BJ6A 4F4JA 1BH6A 2IKSA 5L7WA 2JAXA 1EDBA 2XWJI 2ZYAA 5AT1A 5GQSA 2IOFK 1TU0A 1EVLA 2IYSA 1SOAA 2Q46A 4DNFA 3IOEA 3TOXA 1CQPA 1ZVVA 1UKAA 2ZUTA 5E95A 2M9MA 1OFUA 2O06A 4TV8F 4D9CA 2PBZA 2QUIA 4Z0PA 2C7RA 1D5WA 5DBHX 3GFVA 1ZNWA 2J7PD 3A9VA 2NZ2A 3D8BA 4CMHA 3C98A 3AX6A 1NTOA 4K6GA 3WYGA 1HQYE 2CNWA 1HLDA 3CRNA 2FE4A 5LPNA 4P32A 1RE0A 1WZEA 1UMCB 2QR2A 2RBGA 1ZHFA 4IQGA 4GX1A 4CIDA 3IAUA 4ZYYA 2O6HA 5B6JA 1DIRA 2ID7A 5HIKA 4RTMA 5A9RA 1LBSA 2P4EA 4GE3A 5D3MA 1G9SA 3QEMA 1ZLYA 2I3BA 5BSHA 1QVRA 2A6PA 1U2TA 4AB1A 1A9PA 3ONFA 4EHBA 1E0KA 1UPCA 1IQ0A 3HR8A 4YCAA 3WLRA 3AF0A 2GXAA 3AVYA 3ZR4B 1NYLA 4G0UA 1N57A 3R7FA 4DN6A 2VYVD 1M8GA 1SU7A 2ZZKA 1DBQA 4HLDA 1BS9A 3ITKA 3UJAA 3CIOA 4ZI7A 3PWSA 3FNQA 1L4HA 2ZRDA 3T7CA 4E30A 3KJHA 2EAUA 1YBVA 3EXHB 3FNRA 4GMKA 4LOHA 1QRDA 2PJUA 3IP8A 1NR5A 4ARZB 4KVZA 4KRGA 1UBHS 3DE7X 3OJ0A 3D3WB 5C1DA 3BWYA 4FZVA 4K81B 2X42A 1EVKA 2WQ6A 1DEHA 4PLYA 5C8YB 5JAUA 5DP2A 1GAXA 4OJNA 2VH2A 4OG2A 3THXA 4E6EA 1A5SB 4DM4A 1PSZA 4D97A 4IJ6A 1XPRA 3WOHA 3TD6A 2V7WA 1G5TA 1RPTA 1LPAB 3AVOA 1RYZA 1GTVA 1J2UA 5K6RA 4WOJA 3WGYA 3ZCRA 1I7LA 2O2ZA 1Q0LA 4AZ0A 1WBDA 2PWBA 1AGNA 3QE2A 4FD3A 5ALWA 4HEJA 5JDIC 1VRVA 1HOXA 2AJTA 1MX9A 1UXJA 5JJBA 2HLHA 1FBTA 1FU8A 5B37A 1NMZA 4M86A 1KZHA 4CLXA 1XD2A 2PG3A 3PI7A 2NZUG 2RC5A 1KI7A 1PR6A 4I9GA 5ABPA 1ZNYA 4G9BA 2B7LA 4JFAA 1EFHA 4H1HA 3WAKA 2A0UA 5TR9A 3C3YA 1RXIA 2O0KA 4G81A 5LN1A 1HE1C 3AIIA 3B1VA 4DLPA 3QUCA 4DA9A 2A9KA 1B8OA 1OXSC 1X3LA 2W0MA 3AEQB 1EJBA 4IPTA 4E2FA 2BBOA 1LX7A 1K8XB 5D1NA 1LLDA 1U7ZA 1VPWA 1YASA 2X4LA 3WFZA 4QDZA 3JR7A 1RJ9B 1RKXA 4MQLA 3AR3A 3MLAA 1NY6A 1PGPA 2AZDA 5NULA 1GQQA 2CXTA 1UODA 3EH2A 1UFOA 3QM1A 3JQGB 5I45A 1WXQA 1V9CA 3M1IA 4HX2A 2QR3A 1ENZA 3E84A 2GGSA 4JLAA 2IELA 4FGKA 3TXXA 3AZQA 3ZY6A 4GPBA 3LUJA 2OECA 2ZVQX 4PBSA 4BMOB 1M7HA 2C4UA 1RLJA 1IOVA 2JDID 4G36A 2IVZA 4ZV9A 3WY9A 3O1HB 4ZO4A 1Q1EA 2IF0A 3G3EA 2ZR8A 3T94A 4DNPA 1V35A 1VMKA 2BJWA 2HNAA 3FSEA 1DOHA 1K4YA 1P4HA 1SHTX 4H59A 5A3SA 2DUNA 3T0FA 2NZ8A 2RGUA 5J2TA 4XJTA 4NJMA 5CDSA 2PUJA 3LUHA 3FAZA 4TKUB 1U0LA 2Z9DA 3AHCA 3R7DA 1BJKA 4XVHA 3PE6A 3EGOA 1MR3F 1AKMA 1XZEA 5CB4B 4W8GA 3V00A 1RAIA 2Z83A 1SD5A 1QG6A 4MVCA 4A8JB 3K70D 1DMRA 2QE6A 2VHEA 1A9XB 4WCDA 4M1MA 3NYRA 3OIVA 2J0QA 3L0PA 3PGXA 3P9XA 1G60A 1PWZA 4E1BA 4F4IA 1B42A 1EFVA 1CE8A 1S2NA 3BAFA 3DOCA 3ZD8A 2VHYA 3JRXA 1MMFB 4BNVA 4KG7A 2QGFA 4N54A 4F96A 4YV1A 1J0XO 4YXWA 4JHXA 1BE8A 1MZPA 4ZYWA 3OF2A 2ACWA 1ONSA 1Z62A 3E2MA 4A0HA 2WB2A 3FOZA 5HF9A 2FQ1A 3LXMA 5EXTA 2WUFA 3I2HA 5E7JA 1TAHA 5HVNA 3PVSA 5DYIA 1BOFA 4HD8A 2FI1A 3B38A 2FAXA 2ZZMA 2QYOA 2YJTD 3G8BA 3HLTA 4R83A 2HJWA 1CDEA 3JX9A 4KMRA 2RK6A 1Q16A 1RYYA 2CXHA 1FX0B 3RAGA 1SB9A 1HYHA 4MHSA 1RXVA 2OL4A 3EZXA 4NBUA 2ZB8A 4DPMA 1GZDA 3PEUA 2D2IA 5LXTB 5CFOA 1UBMS 4I50F 3DCYA 4L4ZA 4UASA 1MB3A 2E87A 3C5WP 1YB4A 2NPIA 4IMRA 5FWYB 1G2OA 1QQAA 1QX4A 2AG8A 1TLLA 3U13A 3CONA 1HYBA 1SBZA 2B34A 1Q83A 2V7EA 3C8ZA 4JBWA 5AVOA 3TLBA 1AUQA 3FVQA 1NDUA 3NEAA 5JPCA 1EUZA 4N41A 3U0BA 4PTYA 4UOEA 4R8LA 3KDAA 1YJ8A 2WIDA 2J9FB 1RYBA 3GFFA 1MXFA 3Q88A 4WZZA 1A2OA 4N9WA 2WJYA 3AJRA 5FQNA 1KAHA 5E1DA 1TGVA 3TTUA 5HRAA 1FUUA 3UMGA 2A1UA 5LNK1 4UNRA 3IMFA 1WWKA 3Q2OA 4XGIA 1CUFA 3FDFA 2Q4BA 1UIRA 5DX0A 3WKCA 5A5DA 1XI2A 3N28A 4I1OA 2JD2A 4HZUA 2C9MA 1TU4A 3HYCA 4KQXA 5JBNA 1WXFA 4B79A 5A6SA 2O8EB 3KUDA 4E6PA 3QEOA 3S2FA 5JDCA 3AJ9A 1QLHA 2EKQA 2FUG1 1UBJS 2WRZA 5BWLA 3F1KA 1NR1A 1XZNA 2QS9A 2Y6UA 2O2SA 3K5WA 3BMCB 3C14C 3NV9A 4ZQHA 5F1PA 3TLEA 4YCMA 4NAVA 4HUQB 1U4NA 2ZRNA 1IHDA 2CWWA 3ABZA 3LT4A 3VAZA 5I9SA 1GPLA 5FUQA 3EEIA 5AUNB 3GGOA 4RHFA 1MO5A 4ZCMA 3A4VA 4XASA 2O14A 3M9XA 1QOZA 4F6LA 1NWCA 1RLUA 2ZG6A 3HZRA 3QLJA 4XIIA 3ZV3A 4TTTS 1BTOA 3FLBA 1YBAA 2JCVA 2OHVA 1WULS 5BMVB 1Q14A 3LLSA 4PS1A 2O8BA 1JE0A 3CJQA 5BQ3A 1Y6QA 2N42A 1HLPA 4I9UA 4BE4A 1K6MA 4Q4CA 2EBHX 3JAWA 1OJLA 2QMQA 4MWGA 1JG7A 4F92B 5AR1A 2XYPA 2B4YA 1U6KA 3QVUA 5BNTA 1CF4A 3KAPA 1PX2A 3UAGA 3HL0A 1MABB 3C97A 4QODA 1N3YA 3AYZB 3IIJA 4M88A 2MYPA 3O4RA 4ZO8A 5EE1A 5K3FB 3Q7PA 4EATA 5JYDA 1VPTA 4IRXA 2OYRA 1OIWA 3V8QA 4ZK2A 3RC1A 4ZOEA 2WAMA 1U7WA 4W7HA 2IA5A 5FUVA 5BWMA 1QO9A 1Y9EA 1POWA 3FVVA 3WGJA 1A82A 3F6EX 1TQ6A 3PTLA 4UNNA 3I8SA 1KMIY 4QNMA 4UUMA 2GDJA 2CMKA 1L1FA 4LXYA 1T8SA 1FJHA 4QDTA 3GY0A 1A8HA 1CJCA 5AO9A 1UBOS 1E9SA 4QBFA 1E2PA 1IN4A 1KQ3A 3PHJA 3Q3CA 3T9DA 2CEKA 3WGOA 1IMJA 4EY4A 4US0R 4CKBA 1BWQA 4YRJA 4H1WA 1BW9B 4NATA 1W48A 3KJGA 2X8WA 3I01M 4I81A 3CJRA 2P0EA 3G5MA 4MW7A 1GZUA 3G2IA 1NE7A 5HCUA 3OTOB 4DUGA 3FWYA 4URYR 2P2YA 4RW0A 1OI4A 1HX7A 2ZRIA 1VCIA 4DW8A 2PT7A 2ZRMA 5BQOA 3QBJA 5AHOA 3VR6H 3KWFA 4X7BA 3R7LA 5IU6A 4OF4A 1TQ8A 2JFWA 1SXQA 2BH9A 4BUZA 4DQXA 3OG9A 3ZV7A 3A9RA 2QL6A 1OLXA 1ESDA 4WLVA 2R1ZA 2YXDA 4Y6QA 2HRBA 2JPDA 1B8UA 2FXIA 1Y1QA 3NIBA 1GTL1 4QASA 1SCNE 5T4FA 5CDHA 2VDJA 4TWRA 4BMNA 4BYGA 5A9TA 3MJRA 4AQ7A 1QXSA 1IN7A 5A9SA 3BWVA 1ESZA 5A7GA 3E53A 3OAAD 1SPXA 2OHGA 2BFAA 4ZOAA 4D6PA 1QRUA 1CQJA 4TUYA 5FPQA 1WSWA 4QJ3A 5EFZA 1PT6A 2Q3FA 1EVYA 3H4IA 2WJWA 4MITA 3LLMA 2ZTLA 3KQLA 2C82A 2QVCA 4R3UC 3HYTA 2P2NA 4U0KA 5G41A 1FTSA 1APBA 3AP3A 2EKPA 1KIAA 4HJXA 1Y5LA 4NCIA 5LQRA 1I1QB 3JWJA 1CR4A 5L3QB 2PO7A 1KR2A 3RTAA 3PQ7A 4FX5A 4HDMB 3Q0IA 2A4MA 3DHVA 1AURA 2C5SA 1SHZA 4YPVA 2H0RA 2ZRJA 1XZGA 4ND4A 1NLUA 3C5CA 3O9VA 1JH8A 3PFFA 3X3HA 2Y4OA 2RFLA 4CG3A 1DEXA 2HN9A 1L8QA 1NQWA 4I2VA 3M4NA 5EQFA 3UN1A 2GILA 2JLUA 3CPHA 3N7AA 1N5MA 1XD8A 4JP3A 3QSYA 3ABQB 2QZJA 3Q7EA 4KXYA 3U3XA 1J23A 1GG8A 3GJ3A 1KQFA 5J2UA 5TGTA 1N77A 1FTQA 3KUXA 4OHKA 3N1UA 1ZMOA 4H3SA 3RFCA 3JQFC 4AZ3B 3P9YA 1JVNA 3P27A 1SXGA 3MT9A 4BRZA 2EQ5A 2HF8A 3OO0A 4IUYA 4M9UA 2Q7DA 4YP7A 4E2XA 1JWLA 3KALA 1NIPA 1OSNA 3LDUA 4H7HA 4M0UA 2JZCA 3MBIA 2FP3A 2QTMA 1BHSA 2DX7A 1WXGA 1QORA 1M2VB 2VHCA 4K3UA 3ZU3A 1F5SA 4R2KA 1PR4A 1GSAA 4K7JA 3U40A 2HAEA 4P2GA 2P6PA 4J1TA 3CLHA 1JDBB 1X1QA 4AYWA 4DQUA 1YUMA 3FPFA 1M6HA 1E3QA 1E3WA 1WZIA 2H1OA 2YNMC 5EHZA 1I4OA 5GZ6A 1QPBA 1JLSA 5KJFA 1QWSA 3VHXB 2FJUA 2OZLA 2OHIA 3AVPA 4B09A 4D9FA 2PUBA 2JBWA 2HEIA 3BA6A 2ZWOA 3K4HA 3M5WA 2FZWA 4IGAA 4ZO7A 1IDOA 3I6ZA 5B5SA 3RC3A 5KNCD 2PYDA 2FEAA 3DD5A 2PU5A 1ZUHA 2V7VA 1MP0A 2YXBA 3LCRA 3WYDA 1VMAA 3L01A 3OCCA 2AYXA 1WMAA 1OKKA 3MWDB 2P8JA 3G0OA 2AN9A 4LTMA 3SJBA 3H5LA 3ZE1B 2DKOA 3OFNA 2D1TA 5D5QA 4TS9A 4CEJB 1TUBA 1C3OA 2WU4A 3KUCA 4NU6A 5IVIA 5EXXA 4QO7A 3TINA 3VKFA 3ZNOA 4GYWA 2CFOA 3HMQA 3IVMA 4E14A 1DCKA 3KJZA 3W6NA 4XQ9A 3FPLA 1Y5NA 4KUHA 3RU7A 5FA8A 3ZW8A 4B3SB 3AL0C 3FGOA 1MC5A 4C2UA 3BGOS 5LA6B 1VJDA 1RVV1 2GBLC 1IJKA 2CVZA 3AZPA 2DT5A 2DZDA 3IHTA 4KQMA 2ATXA 2IIVA 2J0VA 3EA0A 3S1SA 3OFSA 4X8LA 5AKEA 1JTVA 5H83A 2RH9B 2IZOA 3DHWC 1J49A 3RVLA 4BE7B 1M5TA 1ZCAA 3IBGA 4FDLA 2XMQA 3DO6A 3OBIA 4XWYA 3R5SA 2XUAA 3FCYA 2K4MA 5L3ZA 1K4KA 2IEBA 2QD2A 2XNJA 4JUFA 4D02A 4XB1A 4YQZA 1R5BA 3PJEA 3R3VA 4IH4A 4W6ZA 2AQHA 2PKQO 4QREA 4DPLA 4BNLA 2B4QA 3GLIE 3TRJA 3FDZA 1E1CB 1RDFA 5BVHA 2X22A 1VLQA 2OXEA 3EEQA 4LGYA 2C96A 2DPLA 1RAFA 1GPJA 2JKVA 2WWWA 3TIXB 5BN3A 3O75A 2WM9B 1T5DX 1USUA 2UXCB 2FP4B 2WSMA 3GIWA 1KJNA 2OK7A 4BKUA 3LVRE 3SLRA 3ZQKA 1E20A 1XDBA 4E2YA 5ALYA 3WMFA 4YREA 1MJHA 1P5RA 4KK4A 1LQTA 5LBUA 2GKGA 5JS2A 4I1VA 4KXWA 1XJQA 2HLDA 3BFXA 1JECA 3GCXA 4OB6A 4UNSA 4I3HA 3QVLA 2A3NA 2PO5A 2VP2A 1L7BA 3K5IA 4PLWA 2DU8A 4HDOB 4OQFA 4JI8B 1MJGA 3E7PA 1Q3TA 4D4GA 4DCVA 2AC2A 2H8GA 4N3NA 1UXGA 4KBYA 1OZHA 1Q7BA 2QN2A 4NZOA 5H3HA 1Q1ZA 3R7WA 2WJPA 4KLNA 4L5CA 1QGUB 3GK3A 4L85A 2VZ8A 1VKJA 1JUDA 5FUWA 1JLLB 1JNXX 4GT1A 2POCA 1MVLA 2TYSB 3O4JA 4HH3C 2DPXA 2D1SA 3UOGA 4A0SA 5T41A 1Z83A 5J58A 1UCFA 2YUIA 4GDFA 3AI1A 3FI9A 4UBNA 4MARA 3PQ5A 5C8VA 3NGXA 1C1XB 4G8DA 4H6XA 4EY3A 2V6BA 3CUWA 1K7XB 8AT1A 1M0WA 3PQCA 2IS6A 2O1WA 3L6EA 4LYAA 2J6BA 5CVUA 1KDPA 3GPIA 4ZK6A 1FFWA 1GNTA 1V4BA 4N5IX 2HRCA 5CA1F 3HGMA 2VL7A 5CB0A 1M1YB 3VAYA 2ZSHA 1BKDR 2FV8A 3LDFA 4CM4A 3BTOA 1XU7A 4D2IA 5KOYA 2MU1A 2JIOA 4LZZA 1A2QA 3ZVNA 3HNPA 4UU0A 5IM4F 1OYVA 4ZRMA 4WBNA 2N1MA 3KV3O 5FBWB 1FUYB 2EFGA 5TNXA 4DBLE 4YRAA 1NVDA 2M1XA 3RHSA 3Q0EA 1I5EA 1M54A 221PA 5FPTA 2YV1A 2WYIA 3G0IA 2WFLA 2JLYA 1R12A 3H13A 2FU5C 3LHIA 3OOSA 2G9ZA 1WHSB 3ZY3A 2JFHA 3WDKA 1EK6A 1SZDA 1G38A 5EEHA 4PZ0A 3QX9A 2Q41A 1RRPA 3CSSA 4Y1EA 4MK4A 4RF2A 1KS2A 5ULLA 2XMRA 3R7AA 1R9MA 3DBLA 3Q9UA 4FHCA 1S0UA 3GPLA 3WB2A 1U5BA 1D2MA 1YTUA 3K70B 2V6FA 2G1AA 2YXLA 3QV1A 1YMVA 4RFLA 5J1TB 4OI1A 1R6XA 2OLJA 3L2OB 4Q4AA 1L7EA 2AX4A 1J90A 4DV3B 4HRAA 3MMXA 2IIBA 2IYAA 2J1LA 1ULZA 4EI7A 4C4XA 2XEDA 3T1TA 1ZR4A 4JEIA 1O0CA 4XFDA 5HSGA 1MRZA 4PHHA 5AKIA 4YMLA 1BD3A 1YJQA 2C2GA 1W4BA 4NICA 4ZXFA 1QKKA 4MQ5A 4YT4A 5K9ZA 4PFQA 1RFLA 1KMHA 2DG2A 2YJ4A 4XUGB 5FBLB 1K3TA 2AVNA 2GBCA 5HZMA 3SICE 4DR4B 3QELB 2PL5A 3OE7D 5EKSA 3LWDA 5T64A 1JEQA 3V8RA 2BGKA 2ZBFA 4HB0A 3LYHA 1GDDA 1NXQA 2DJ5A 2F00A 2FX5A 3HJNA 4ZPJA 4ATNA 5JROA 4ZARA 3DLPX 1LV7A 2R3SA 4DYDA 4IBOA 2ZJ7A 2AE1A 3FNGA 1DWPA 2ZDHA 1OC4A 1O58A 2BMJA 5CLHA 3D5EA 5ES3A 2OV3A 2QSUA 2RHTA 2CYAA 5FEUA 1M76A 3BFVA 1IPFA 3OZSA 3PHGA 2GCIA 3DTVB 2YY5A 4R69A 1UC9A 5HF8A 1GADO 3H1FA 4NXNB 3FNBA 3H9CA 1IBLB 3V1TC 3EHDA 1NRJB 4NC9A 4WNAB 1XZIA 5AI0A 2CXPA 2IYLD 3KYBA 1KYQA 4ZP1A 5DGXA 1HSOA 4AURA 3B2EA 1BS2A 4P33A 5K1ZA 4IKOA 2VLBA 4KHPB 1T9HA 4NBLA 4B0OA 3LC7O 3HXOA 1FLDA 1LLFA 1BXRA 4MUBA 4PLTA 5DI9A 3PDCA 3WMEA 4YCSA 4Q18A 4P3XA 1G3RA 3R9XB 2JAUA 4EY6A 1N92A 3U3OA 5BN5A 2A9JA 2O7VA 3KKLA 5BYBA 2QU7A 1DJPA 1KY5A 1Q84A 1VSQA 1FSGA 2AOWA 2ZCVA 4JS0A 5HS4A 3I9LA 2PAFA 3GCDA 3GDOA 4RS4A 5C4MA 4S12A 4FDMA 4KOAA 5LP6C 4IQFA 2PXHA 1PSWA 5DIZA 2J45A 4UAUA 4YK7A 1G6Q1 1VP3A 3URMA 1HV8A 1J70A 2VNAA 2DFDA 4L5IA 3ZK9A 5CDYA 3B9PA 2ACKA 2QAGB 2I3AA 2R7LA 2ZXEA 3CPJB 3NBQA 5DMHA 3VI4B 5CFRA 5HJEA 3P9ZA 4MW2A 5FPHA 4BB9A 3LECA 1CNFA 2ZTHA 4CM6A 2C4HA 1XTRA 2FHPA 4BP9A 5KOHB 4ZDIA 3DR5A 4PPQA 1KFEB 3QKTA 3J7AC 4L9RA 3N87A 1HL7A 1LEHA 1JHOA 1VI5A 4ER6A 1SZJG 3MG9A 2JI8A 4PG8A 2AC4A 3D59A 1YZYA 3SZGA 1AMNA 4A4DA 1ZMXA 3CLSD 4YMGA 1I2AA 4Q1DA 2CVHA 4M46A 1ZMBA 1N2OA 2LZ0A 2AFIB 4J0KA 4JVNA 3COZA 4EHDA 1UOQA 4CJXA 3TSWA 1B0UA 4JLJA 1XLWA 4I9HA 5ECWA 3VHLB 3TS1A 2NIPA 3VZQA 1UDRA 4FC7A 3OE4A 2OV4A 2OA0A 4ZYZA 4GSLA 5BNZA 1IHXA 2E6UX 5HEKA 3UXYA 4A73A 1IN1A 3HRIA 1E7SA 1M8KA 2PGDA 4X63A 4JLBA 3MCVA 1P0CA 1ETHA 2R6R1 2XTNA 5JISA 1TOAA 1HUQA 4ZKEA 4DOMA 2O7NA 2OKCA 4RIGA 5HF5A 3K8OE 3HBFA 2UYOA 3NWOA 1X14A 1VIVA 3DXYA 1JZSA 4J4HA 2XWQA 1F2UA 3GUYA 2AC7A 4KXVA 3WB1A 3HUTA 2D0PB 1MO2A 2P0YA 1W8IA 3G85A 3AF3A 4QAJA 1S1CA 3TTYA 1VE6A 4QTYA 5BXYA 4F5YA 2VN8A 4EDFA 4I4IA 4OI4A 2UYQA 4JYAB 2G67A 3ETLA 2OFPA 1QJ4A 2ON6A 1G21A 3CGGA 2RI6A 4NAUA 3LPAA 4Q7KA 2ZEJA 2XUIA 2XHEA 3L18A 3R09A 2EVWX 5EESA 3COVA 5CA0F 2OXTA 1EM8A 3VHRA 4HEA6 3TEFA 2OR3A 5LYYA 3SAJA 2FK8A 2QRVA 1JFTA 1S01A 4PSKA 4BQNA 3A4MA 3MJFA 2IS2A 2AHRA 1SUDA 2Q3JA 3H6KA 3LCUA 4CODB 2C5AA 1GYRA 2QSZA 1YOVB 5EJ6A 3Q7RA 3AF5A 1RMTA 3KYDA 1YI0A 2VDNB 3ZHTA 4ONEA 1JG1A 3MXTA 1AHIA 1SVLA 5PGMA 3C3JA 1XDZA 1D6SA 3E5NA 4L7QA 2J85A 1K6EA 2C54A 1GCUA 1UBCA 5KINB 4KIUA 3CF2A 2DRIA 1GNVA 2ZITA 3CRW1 4PG6A 1UZLA 2RH8A 3RT1A 1E9VA 3COWA 3CF4A 2H65A 5LJIA 3WNQA 1EESA 1MAUA 4JVLA 3AEUA 1UKZA 3W5VA 2P79A 1Q95A 1AO3A 2VXCA 1VYVA 3BJEA 4GBED 3UXMA 4A2CA 1C2YA 1ESCA 1NJFA 4JITA 4LXTA 1C81A 4ZAGA 1A5BB 1ZJYA 4WBSA 4PN3A 4QGAA 5KX5F 4OLBA 3IIKA 1AN0A 3RVRA 1CR2A 1GAJA 1CWUA 5EP4A 1HYQA 5EHNA 1DTWA 1AGPA 1O03A 4L22A 1UAGA 4AP5A 1FFSA 5TPZD 5KCZA 1E61A 1NQVA 4EA8A 1O9HA 4EARA 1COWD 2RJOA 3JWIA 3QU9A 5B58T 3TLZA 3I39X 1Y1SA 2IRWA 3NAGA 4D1YA 1T13A 4I1UA 3M3PA 1PGJA 1DJLA 1NMSA 2XHZA 4PZEA 3LDGA 5B3JA 1ULHA 4RH0A 4DEYA 2XRYA 2VK2A 1YIOA 3DZKA 4HSGA 2FDCA 3WLSA 4M1ZA 3DKKA 2JD1A 3D4LA 1NWHA 4X8OA 4AX8A 4F93B 2JD0A 4M0DA 3AESA 4UBMA 2D7JA 4N0DA 3MCZA 4UU1A 1YQGA 3VU9B 3MB8A 3FYTA