3QTYA

Crystal structure of phosphoribosylaminoimidazole synthetase from francisella tularensis complexed with pyrophosphate
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
348
structure length
348
Chain Sequence
AMAGLKYEDAGVNIEAGNQAVERMKQHVKKTFTQDVLTGLGSFGSLYSLKNIINNYDDPVLVQSIDGVGTKTKVAVMCGKFENLGYDLFSAATNDIVVMGAKPITFLDYVAHDKLDPAIMEELVKGMSKACAECGVSLVGGETAEMPGVYQAGEIDMVGVITGIVDRKRIINGENIKEGDIVFGLSSSGLHTNGYSFARKLFFDVAGNKHTDTYPELEGKTIGDVLLEPHINYTNIIHDFLDNGVDIKGMAHITGGGFIENIPRVLPQGLGAQIDKDSFATPAIFKLMQRIGDISEFEMYRSFNMGIGMTIIASQDQFDKMQELAKKHTNTKLYQIGKITNSGKVEII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoribosylaminoimidazole (AIR) synthetase
publication title Crystal structure of Phosphoribosylaminoimidazole Synthetase from Francisella tularensis complexed with pyrophosphate
rcsb
source organism Francisella tularensis subsp. tularensis
molecule tags Ligase
total genus 99
structure length 348
sequence length 348
chains with identical sequence B
ec nomenclature ec 6.3.3.1: Phosphoribosylformylglycinamidine cyclo-ligase.
pdb deposition date 2011-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00586 AIRS AIR synthase related protein, N-terminal domain
A PF02769 AIRS_C AIR synthase related protein, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.10 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; PurM-like, N-terminal domain 3qtyA01
3.90.650.10 Alpha Beta Alpha-Beta Complex Phosphoribosyl-aminoimidazole Synthetase; Chain A, domain 2 PurM-like C-terminal domain 3qtyA02
3FD6A 2Z01A 3C9UA 3MDOA 2Z1EA 3KIZA 2HS0A 3D54A 1VQVA 3FD5A 3C9RA 2RB9A 3MCQA 2ZODA 2I6RA 3QTYA 2HS4A 2ZAUA 3VTIC 2V9YA 3VYSC 1VK3A 1CLIA 2HS3A 2Z1UA 3C9TA 3VIUA 3M84A 2Z1TA 2YXZA 5AVMA 3VYTC 3C9SA 3U0OA 2BTUA 3WJPA 3P4EA 2HRUA 2Z1FA 3VYUC 3WJQA 2YYEA 2HRYA 3WJRA
chains in the Genus database with same CATH superfamily
3I56F 1NJIH 1QVGF 1YIJF 4X20A 4G4YA 4IHJB 1M1KH 5GONB 3J81M 1Z5VA 1UI9A 5G4VC 3G6EF 2AIZP 3TD3A 3VCZA 1U40A 3VYSC 5IJ9B 1KQSF 5HXUA 2IG8A 2KG4A 5KMGA 4BT4A 1YJWF 1JFFB 3V4DA 3CB2A 4LNUA 2Q1XA 5AVMA 5LA6A 3C9SA 2BTUA 3GYQA 2OHWA 3ZO8A 1VH8A 4X1IB 3CYQA 1YITF 3RYIB 3CCLF 4XCQA 1QVFF 3CCVF 1KC8H 1VQPF 4WBNA 5IJ0B 2VAMA 2OTMA 3C9RA 5J2UA 2KTVA 4DXDA 5LXTB 4I4TB 3N2KA 1VK3A 3UT5B 2HS3A 2Z1UA 2GLZA 4FFBB 4BW0B 4I50A 2MQEA 1K73H 1RLGA 2ZOVA 5J2TB 3NK7A 4NQ3A 1RLUA 2Z1TA 5GAPK 3CCUF 1VQ6F 3C8LA 4TV8B 3FPIA 3CCSF 1CN7A 4DRXA 3E20B 1RA4A 3OBWA 4X1YB 1W41A 5HXZA 2CW4A 5LYJA 2KGWA 2K1SA 2CZWA 5CB4A 1X52A 3HKDB 4ZHYB 1W5BA 3JASA 2AMTA 1JN1A 2IQQA 2CHTA 3JCMM 5LOVA 1QAHA 1U3LA 1W42A 3JAKB 3RYFB 3HTNA 3N2GA 2JNBA 3CXCF 3D00A 5EB1B 5JCOA 4R40B 3NVKE 3TD4A 1ZWZA 3RA5A 2LCAA 2QI2A 3ZP7A 2RHHA 3HKBA 3WGJA 1U43A 2HP0B 4O2BA 4RHAA 3FD5A 1QU9A 2RHJA 3N4ZA 3S03A 1W2BF 3WGMA 2I6RA 4E6EA 3LMEA 3D01A 3E22A 5BMVB 3QUWA 5CA1A 1QD9A 3VOAA 2LBTA 1IV3A 3JATA 3K14A 3S02A 1IPAA 5HWEA 1FSZA 1W57A 1VQOF 2UYNA 4O4JB 2AIFA 4HNAB 3VOBA 4ZHWA 1VQMF 3J80M 3BYQA 3P4EA 5GINC 1W55A 1R1MA 1W581 3Q8HA 2OTJF 1SZQA 1T0KB 2P6YA 3RYCA 1S72F 3JARA 3PAFA 3CCEF 3IEQA 4YJ3A 4X1KA 3JAWA 2RB9A 3T80A 5MN6A 5EIBD 3WGNA 3WGKA 3IEWA 1GZ0A 3O85A 3IKEA 5EYPA 1SDSA 5C8YB 1Q86H 3KJKA 3IR9A 3WGLA 4EB6B 1TVKA 4G4XA 1IV1A 5JVDB 5EWRA 1N8RH 4B46A 4NWOB 4U3JB 4EI9A 3ERNA 2RHOA 4IIJA 4B5CA 1W5EA 1XBIA 2ZODA 3CPQA 1YI2F 4G4WA 5EZYA 2ZAUA 4TUYA 1ODEA 5GANK 2IAFA 3V3TA 3I55F 3CCJF 3HWUA 4ZHQB 4YJ2A 5IJ0A 1H47A 3RYHA 1UFYA 3VYUC 3V7QA 4I4TA 3CPWF 3I7TA 3AGKA 4FFBA 1Q7YH 3SIVA 4O4IB 3C9UA 5J2TA 1SA0B 4O4HB 3IMPA 3L7QA 1H7MA 4C8EA 2PMPA 1TUBA 4O4LA 1FNKA 3ZP4A 3P0ZA 3QHDA 1GO1A 1Z5WA 2BTQB 4X20B 5FNVA 5GIPC 5LP6A 2FGYA 4C82A 2HX0A 4BVTA 4ZOLA 1U3PA 1FFXB 4RQOA 3WJPA 3TD5A 1KNKA 2VXYA 1COMA 1W5FA 2HP3A 2R6R1 3MQWA 3G71F 3CYPB 3ON1A 3FD6A 1K9MH 2Z01A 3HKEB 5A2QM 5CA0B 4C8IA 5LA6B 2CWJA 3OBYA 1JJ2F 2VAWA 2HS0A 2GVIA 5KX5A 5B8FA 2BO1A 3F6MA 3VO8A 3VIUA 4I55B 3RA6A 2QTPA 4ZHVA 2VAPA 2ZVZA 1NMUB 4BVRA 5J2UB 2EWCA 1KNJA 4G4ZA 3ESJA 4C8GA 2QEXF 1FNJA 3JVHA 2OZBA 4BT7A 1K8AH 4I50B 5ITZB 4BVQA 4M8IA 3DC2A 1PF5A 2Z1EA 1IV2A 4O4JA 5GIOC 1JD1A 5HY2A 5LYJB 3MCAB 4U39A 3KE1A 2OTLF 3LWRC 1VQ7F 3KJJA 3VYTC 1VQ4F 1W40A 2CHSA 2R751 4TV9A 5EIBC 3M1XA 3ZOPA 5CB4B 2Z1FA 5MN4A 2UZHA 4BT5A 3JASB 3FFMA 2YYEA 3HKCB 2H6LA 2DYYA 4PWTA 3WJRA 3E1YA 3JALA 5FJ4C 1OFUA 4F6RA 1M90H 3MDOA 3S06A 4X3MA 3N2GB 3KIZA 3GTZA 1IV4A 5JH7A 3P10A 5C8YA 4B45A 3CD6F 4EB6A 3S0YA 2HS4A 1Q81H 3F0FA 1X25A 2DT4A 4O2AB 2NMUA 1VQNF 4O2BB 4U3JA 2YXZA 5EB0A 4IHJA 5GONA 1VQKF 3E22B 4ZI7B 5CA1B 5HP8A 5HY1A 3CC4F 5IJ9A 3CCMF 4C81A 2UYNB 3LYBA 1JFFA 2I6DA 3LFOA 2UYJA 3EORA 5DCVA 1CK2A 3K2XA 3RYCB 4X1IA 5HP7A 3JARB 4O4IA 2UYPA 3GHZA 3RYIA 1SA0A 4X1KB 3VMFB 3JAWB 1XHOA 3PLAC 3LDTA 3DDNA 2CVLA 4G4VA 5JQGB 5LXTA 3UT5A 3CC2F 2ALEA 3K0TA 5EAZA 5EYPB 1DBFA 1JY8A 5IYZB 1J7HA 1PXWA 1FFXA 4TV8A 1TVKB 2B33A 3F0DA 3NK6A 4BVSA 3QTYA 2LBWA 1RQ2A 5FLXM 2HQSC 4ERHA 4X1YA 1CLIA 3HJWC 5MN5A 5CA0A 3HKEA 5LP6C 4B62A 4IIJB 3R0PA 4ZK7A 1W59A 2PHNA 5HY0A 5EZYB 4TUYB 5EO3A 3LWVC 3F0EA 3HKDA 3CCQF 1YGYA 4I55A 5KMGB 1Q82H 1VQ8F 2H8CA 2WALA 1XRGA 4LNUB 4YJ2B 3RYHB 4BT3A 4EI7A 1VQVA 3JAKA 3RYFA 3MCQA 3CMAF 3HAXD 2L26A 5ITZA 3B6NA 3JAMM 1VHAA 2QA4F 4WBNB 2GZLA 3G4SF 3LWPC 2HP0A 1TUBB 1T0AA 2HRUA 4O4LB 2CSLA 2H8EA 2HVYD 3MBMA 3N2KB 4C4WC 5JCOC 5FNVB 5LP6B 3CG6A 5BMVA 4X3LA 1RQ7A 4ZOLB 2VGNA 3ELCA 2ZVYA 4DRXB 4HNAA 1X7OA 3HKCA 3VTIC 3C9TA 5IT9M 1VQ9F 3RE3A 3M84A 1YHQF 1YJNF 2FC3A 3CCRF 3U0OA 4LCKA 1XV2A 3IKFA 5KX5B 4G88A 3LWOC 5LOVB 3WPWA 4O2AA 3WPXA 3KHNA 3J7AR 2KTUA 3S0HA 1GX1A 3M4SA 3D54A 2F9ZC 4BT6A 1OAPA 1W5AA 4KWEA 2N48A 1VQ5F 2V9YA 5HY4A 4ZI7A 3V7EA 5JVDA 1NQ3A 3FBAA 3NMUC 3N4YA 3HKBB 1VQLF 2LBXA 2RHLA 3F0GA 3JATB 1Q8RA 3OONA 4TV9B 4BY9D 1ONIA 3WXMB 4ZHQA 4EI8A 1H48A 1X7PA 2VGMA 2ZF8A 3JALB 5JQGA 4F6RB 2UYKA 3SIUA 2BTOA 4BT2A 2W8BC 3NVIB 3I3FA 2Q1YA 2G9IA 1YJ9F 3K12A 1GO0A 5JH7B 1DT9A 1YQNA 5IYZA 4YJ3B 3CC7F 4O4HA 4TZZA 3CMEF 1W3EX 3S0WA 3VI6A 3WJQA 3OW2F 4NUTA 1KD1H 5G4UC 1E7KA 2HRYA 3LWQC
chains in the Genus database with same CATH topology
3FD6A 2Z01A 3C9UA 3MDOA 2Z1EA 3KIZA 2HS0A 3D54A 1VQVA 3FD5A 3C9RA 2RB9A 3MCQA 2ZODA 2I6RA 3QTYA 2HS4A 2ZAUA 3VTIC 2V9YA 3VYSC 1VK3A 1CLIA 2HS3A 2Z1UA 3C9TA 3VIUA 3M84A 2Z1TA 2YXZA 5AVMA 3VYTC 3C9SA 3U0OA 2BTUA 3WJPA 3P4EA 2HRUA 2Z1FA 3VYUC 3WJQA 2YYEA 2HRYA 3WJRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FD6 A;  2Z01 A;  3C9U A;  3MDO A;  2Z1E A;  3KIZ A;  2HS0 A;  3D54 A;  1VQV A;  3FD5 A;  3C9R A;  2RB9 A;  3MCQ A;  2ZOD A;  2I6R A;  3QTY A;  2HS4 A;  2ZAU A;  3VTI C;  2V9Y A;  3VYS C;  1VK3 A;  1CLI A;  2HS3 A;  2Z1U A;  3C9T A;  3VIU A;  3M84 A;  2Z1T A;  2YXZ A;  5AVM A;  3VYT C;  3C9S A;  3U0O A;  2BTU A;  3WJP A;  3P4E A;  2HRU A;  2Z1F A;  3VYU C;  3WJQ A;  2YYE A;  2HRY A;  3WJR A; 
#chains in the Genus database with same CATH topology
 3I56 F;  1NJI H;  1QVG F;  1YIJ F;  4X20 A;  4G4Y A;  4IHJ B;  1M1K H;  5GON B;  3J81 M;  1Z5V A;  1UI9 A;  5G4V C;  3G6E F;  2AIZ P;  3TD3 A;  3VCZ A;  1U40 A;  3VYS C;  5IJ9 B;  1KQS F;  5HXU A;  2IG8 A;  2KG4 A;  5KMG A;  4BT4 A;  1YJW F;  1JFF B;  3V4D A;  3CB2 A;  4LNU A;  2Q1X A;  5AVM A;  5LA6 A;  3C9S A;  2BTU A;  3GYQ A;  2OHW A;  3ZO8 A;  1VH8 A;  4X1I B;  3CYQ A;  1YIT F;  3RYI B;  3CCL F;  4XCQ A;  1QVF F;  3CCV F;  1KC8 H;  1VQP F;  4WBN A;  5IJ0 B;  2VAM A;  2OTM A;  3C9R A;  5J2U A;  2KTV A;  4DXD A;  5LXT B;  4I4T B;  3N2K A;  1VK3 A;  3UT5 B;  2HS3 A;  2Z1U A;  2GLZ A;  4FFB B;  4BW0 B;  4I50 A;  2MQE A;  1K73 H;  1RLG A;  2ZOV A;  5J2T B;  3NK7 A;  4NQ3 A;  1RLU A;  2Z1T A;  5GAP K;  3CCU F;  1VQ6 F;  3C8L A;  4TV8 B;  3FPI A;  3CCS F;  1CN7 A;  4DRX A;  3E20 B;  1RA4 A;  3OBW A;  4X1Y B;  1W41 A;  5HXZ A;  2CW4 A;  5LYJ A;  2KGW A;  2K1S A;  2CZW A;  5CB4 A;  1X52 A;  3HKD B;  4ZHY B;  1W5B A;  3JAS A;  2AMT A;  1JN1 A;  2IQQ A;  2CHT A;  3JCM M;  5LOV A;  1QAH A;  1U3L A;  1W42 A;  3JAK B;  3RYF B;  3HTN A;  3N2G A;  2JNB A;  3CXC F;  3D00 A;  5EB1 B;  5JCO A;  4R40 B;  3NVK E;  3TD4 A;  1ZWZ A;  3RA5 A;  2LCA A;  2QI2 A;  3ZP7 A;  2RHH A;  3HKB A;  3WGJ A;  1U43 A;  2HP0 B;  4O2B A;  4RHA A;  3FD5 A;  1QU9 A;  2RHJ A;  3N4Z A;  3S03 A;  1W2B F;  3WGM A;  2I6R A;  4E6E A;  3LME A;  3D01 A;  3E22 A;  5BMV B;  3QUW A;  5CA1 A;  1QD9 A;  3VOA A;  2LBT A;  1IV3 A;  3JAT A;  3K14 A;  3S02 A;  1IPA A;  5HWE A;  1FSZ A;  1W57 A;  1VQO F;  2UYN A;  4O4J B;  2AIF A;  4HNA B;  3VOB A;  4ZHW A;  1VQM F;  3J80 M;  3BYQ A;  3P4E A;  5GIN C;  1W55 A;  1R1M A;  1W58 1;  3Q8H A;  2OTJ F;  1SZQ A;  1T0K B;  2P6Y A;  3RYC A;  1S72 F;  3JAR A;  3PAF A;  3CCE F;  3IEQ A;  4YJ3 A;  4X1K A;  3JAW A;  2RB9 A;  3T80 A;  5MN6 A;  5EIB D;  3WGN A;  3WGK A;  3IEW A;  1GZ0 A;  3O85 A;  3IKE A;  5EYP A;  1SDS A;  5C8Y B;  1Q86 H;  3KJK A;  3IR9 A;  3WGL A;  4EB6 B;  1TVK A;  4G4X A;  1IV1 A;  5JVD B;  5EWR A;  1N8R H;  4B46 A;  4NWO B;  4U3J B;  4EI9 A;  3ERN A;  2RHO A;  4IIJ A;  4B5C A;  1W5E A;  1XBI A;  2ZOD A;  3CPQ A;  1YI2 F;  4G4W A;  5EZY A;  2ZAU A;  4TUY A;  1ODE A;  5GAN K;  2IAF A;  3V3T A;  3I55 F;  3CCJ F;  3HWU A;  4ZHQ B;  4YJ2 A;  5IJ0 A;  1H47 A;  3RYH A;  1UFY A;  3VYU C;  3V7Q A;  4I4T A;  3CPW F;  3I7T A;  3AGK A;  4FFB A;  1Q7Y H;  3SIV A;  4O4I B;  3C9U A;  5J2T A;  1SA0 B;  4O4H B;  3IMP A;  3L7Q A;  1H7M A;  4C8E A;  2PMP A;  1TUB A;  4O4L A;  1FNK A;  3ZP4 A;  3P0Z A;  3QHD A;  1GO1 A;  1Z5W A;  2BTQ B;  4X20 B;  5FNV A;  5GIP C;  5LP6 A;  2FGY A;  4C82 A;  2HX0 A;  4BVT A;  4ZOL A;  1U3P A;  1FFX B;  4RQO A;  3WJP A;  3TD5 A;  1KNK A;  2VXY A;  1COM A;  1W5F A;  2HP3 A;  2R6R 1;  3MQW A;  3G71 F;  3CYP B;  3ON1 A;  3FD6 A;  1K9M H;  2Z01 A;  3HKE B;  5A2Q M;  5CA0 B;  4C8I A;  5LA6 B;  2CWJ A;  3OBY A;  1JJ2 F;  2VAW A;  2HS0 A;  2GVI A;  5KX5 A;  5B8F A;  2BO1 A;  3F6M A;  3VO8 A;  3VIU A;  4I55 B;  3RA6 A;  2QTP A;  4ZHV A;  2VAP A;  2ZVZ A;  1NMU B;  4BVR A;  5J2U B;  2EWC A;  1KNJ A;  4G4Z A;  3ESJ A;  4C8G A;  2QEX F;  1FNJ A;  3JVH A;  2OZB A;  4BT7 A;  1K8A H;  4I50 B;  5ITZ B;  4BVQ A;  4M8I A;  3DC2 A;  1PF5 A;  2Z1E A;  1IV2 A;  4O4J A;  5GIO C;  1JD1 A;  5HY2 A;  5LYJ B;  3MCA B;  4U39 A;  3KE1 A;  2OTL F;  3LWR C;  1VQ7 F;  3KJJ A;  3VYT C;  1VQ4 F;  1W40 A;  2CHS A;  2R75 1;  4TV9 A;  5EIB C;  3M1X A;  3ZOP A;  5CB4 B;  2Z1F A;  5MN4 A;  2UZH A;  4BT5 A;  3JAS B;  3FFM A;  2YYE A;  3HKC B;  2H6L A;  2DYY A;  4PWT A;  3WJR A;  3E1Y A;  3JAL A;  5FJ4 C;  1OFU A;  4F6R A;  1M90 H;  3MDO A;  3S06 A;  4X3M A;  3N2G B;  3KIZ A;  3GTZ A;  1IV4 A;  5JH7 A;  3P10 A;  5C8Y A;  4B45 A;  3CD6 F;  4EB6 A;  3S0Y A;  2HS4 A;  1Q81 H;  3F0F A;  1X25 A;  2DT4 A;  4O2A B;  2NMU A;  1VQN F;  4O2B B;  4U3J A;  2YXZ A;  5EB0 A;  4IHJ A;  5GON A;  1VQK F;  3E22 B;  4ZI7 B;  5CA1 B;  5HP8 A;  5HY1 A;  3CC4 F;  5IJ9 A;  3CCM F;  4C81 A;  2UYN B;  3LYB A;  1JFF A;  2I6D A;  3LFO A;  2UYJ A;  3EOR A;  5DCV A;  1CK2 A;  3K2X A;  3RYC B;  4X1I A;  5HP7 A;  3JAR B;  4O4I A;  2UYP A;  3GHZ A;  3RYI A;  1SA0 A;  4X1K B;  3VMF B;  3JAW B;  1XHO A;  3PLA C;  3LDT A;  3DDN A;  2CVL A;  4G4V A;  5JQG B;  5LXT A;  3UT5 A;  3CC2 F;  2ALE A;  3K0T A;  5EAZ A;  5EYP B;  1DBF A;  1JY8 A;  5IYZ B;  1J7H A;  1PXW A;  1FFX A;  4TV8 A;  1TVK B;  2B33 A;  3F0D A;  3NK6 A;  4BVS A;  3QTY A;  2LBW A;  1RQ2 A;  5FLX M;  2HQS C;  4ERH A;  4X1Y A;  1CLI A;  3HJW C;  5MN5 A;  5CA0 A;  3HKE A;  5LP6 C;  4B62 A;  4IIJ B;  3R0P A;  4ZK7 A;  1W59 A;  2PHN A;  5HY0 A;  5EZY B;  4TUY B;  5EO3 A;  3LWV C;  3F0E A;  3HKD A;  3CCQ F;  1YGY A;  4I55 A;  5KMG B;  1Q82 H;  1VQ8 F;  2H8C A;  2WAL A;  1XRG A;  4LNU B;  4YJ2 B;  3RYH B;  4BT3 A;  4EI7 A;  1VQV A;  3JAK A;  3RYF A;  3MCQ A;  3CMA F;  3HAX D;  2L26 A;  5ITZ A;  3B6N A;  3JAM M;  1VHA A;  2QA4 F;  4WBN B;  2GZL A;  3G4S F;  3LWP C;  2HP0 A;  1TUB B;  1T0A A;  2HRU A;  4O4L B;  2CSL A;  2H8E A;  2HVY D;  3MBM A;  3N2K B;  4C4W C;  5JCO C;  5FNV B;  5LP6 B;  3CG6 A;  5BMV A;  4X3L A;  1RQ7 A;  4ZOL B;  2VGN A;  3ELC A;  2ZVY A;  4DRX B;  4HNA A;  1X7O A;  3HKC A;  3VTI C;  3C9T A;  5IT9 M;  1VQ9 F;  3RE3 A;  3M84 A;  1YHQ F;  1YJN F;  2FC3 A;  3CCR F;  3U0O A;  4LCK A;  1XV2 A;  3IKF A;  5KX5 B;  4G88 A;  3LWO C;  5LOV B;  3WPW A;  4O2A A;  3WPX A;  3KHN A;  3J7A R;  2KTU A;  3S0H A;  1GX1 A;  3M4S A;  3D54 A;  2F9Z C;  4BT6 A;  1OAP A;  1W5A A;  4KWE A;  2N48 A;  1VQ5 F;  2V9Y A;  5HY4 A;  4ZI7 A;  3V7E A;  5JVD A;  1NQ3 A;  3FBA A;  3NMU C;  3N4Y A;  3HKB B;  1VQL F;  2LBX A;  2RHL A;  3F0G A;  3JAT B;  1Q8R A;  3OON A;  4TV9 B;  4BY9 D;  1ONI A;  3WXM B;  4ZHQ A;  4EI8 A;  1H48 A;  1X7P A;  2VGM A;  2ZF8 A;  3JAL B;  5JQG A;  4F6R B;  2UYK A;  3SIU A;  2BTO A;  4BT2 A;  2W8B C;  3NVI B;  3I3F A;  2Q1Y A;  2G9I A;  1YJ9 F;  3K12 A;  1GO0 A;  5JH7 B;  1DT9 A;  1YQN A;  5IYZ A;  4YJ3 B;  3CC7 F;  4O4H A;  4TZZ A;  3CME F;  1W3E X;  3S0W A;  3VI6 A;  3WJQ A;  3OW2 F;  4NUT A;  1KD1 H;  5G4U C;  1E7K A;  2HRY A;  3LWQ C; 
#chains in the Genus database with same CATH homology
 3FD6 A;  2Z01 A;  3C9U A;  3MDO A;  2Z1E A;  3KIZ A;  2HS0 A;  3D54 A;  1VQV A;  3FD5 A;  3C9R A;  2RB9 A;  3MCQ A;  2ZOD A;  2I6R A;  3QTY A;  2HS4 A;  2ZAU A;  3VTI C;  2V9Y A;  3VYS C;  1VK3 A;  1CLI A;  2HS3 A;  2Z1U A;  3C9T A;  3VIU A;  3M84 A;  2Z1T A;  2YXZ A;  5AVM A;  3VYT C;  3C9S A;  3U0O A;  2BTU A;  3WJP A;  3P4E A;  2HRU A;  2Z1F A;  3VYU C;  3WJQ A;  2YYE A;  2HRY A;  3WJR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...