3QTYA

Crystal structure of phosphoribosylaminoimidazole synthetase from francisella tularensis complexed with pyrophosphate
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
348
structure length
348
Chain Sequence
b'AMAGLKYEDAGVNIEAGNQAVERMKQHVKKTFTQDVLTGLGSFGSLYSLKNIINNYDDPVLVQSIDGVGTKTKVAVMCGKFENLGYDLFSAATNDIVVMGAKPITFLDYVAHDKLDPAIMEELVKGMSKACAECGVSLVGGETAEMPGVYQAGEIDMVGVITGIVDRKRIINGENIKEGDIVFGLSSSGLHTNGYSFARKLFFDVAGNKHTDTYPELEGKTIGDVLLEPHINYTNIIHDFLDNGVDIKGMAHITGGGFIENIPRVLPQGLGAQIDKDSFATPAIFKLMQRIGDISEFEMYRSFNMGIGMTIIASQDQFDKMQELAKKHTNTKLYQIGKITNSGKVEII'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoribosylaminoimidazole (AIR) synthetase
molecule tags Ligase
source organism Francisella tularensis subsp. tularensis
publication title Crystal structure of Phosphoribosylaminoimidazole Synthetase from Francisella tularensis complexed with pyrophosphate
rcsb
total genus 99
structure length 348
sequence length 348
chains with identical sequence B
ec nomenclature ec 6.3.3.1: Phosphoribosylformylglycinamidine cyclo-ligase.
pdb deposition date 2011-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00586 AIRS AIR synthase related protein, N-terminal domain
A PF02769 AIRS_C AIR synthase related protein, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.10 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; PurM-like, N-terminal domain 3qtyA01
3.90.650.10 Alpha Beta Alpha-Beta Complex Phosphoribosyl-aminoimidazole Synthetase; Chain A, domain 2 PurM-like C-terminal domain 3qtyA02
3C9SA 2Z1TA 5AVMA 3VYTC 3QTYA 3D54A 2Z1UA 3MCQA 3C9TA 3KIZA 2HS3A 2YYEA 3VYSC 2Z1FA 2HRUA 1VK3A 2BTUA 2HS0A 2RB9A 3VIUA 2ZODA 2ZAUA 3U0OA 3WJRA 3C9RA 3VYUC 3FD6A 2HS4A 3WJQA 2HRYA 3FD5A 2I6RA 3M84A 3P4EA 2Z01A 2V9YA 2YXZA 3VTIC 3MDOA 3WJPA 1VQVA 2Z1EA 1CLIA 3C9UA
chains in the Genus database with same CATH superfamily
3Q8HA 5LA6B 3RYCA 4DRXB 1U40A 4O2BA 4G4VA 4I4TB 5MN6A 3S02A 3EORA 3CC2F 3LFOA 5GONB 4LCKA 4X20A 1W3EX 1VQNF 5FJ4C 4B5CA 3M4SA 3CG6A 3WJRA 1T0AA 2VGMA 4ZHQA 3FD6A 4TV8B 5G4UC 2JNBA 4O2AB 3S0HA 4B46A 1TUBA 2ZF8A 1GZ0A 1QD9A 3HAXD 2VGNA 4LNUA 1FFXB 5KMGA 3V3TA 3WPWA 5MN5A 5CA0B 2CWJA 2KGWA 2LBWA 3VI6A 5EZYA 3MBMA 3KHNA 3S03A 1VQLF 5LOVA 3VYSC 4C8GA 3D00A 2BTUA 3I55F 2HP3A 3G4SF 5HXUA 4RHAA 3HKBB 2GLZA 3MCAB 1RLGA 1H48A 3I56F 3CCQF 5J2UA 1M90H 4O4HA 1U43A 2LBXA 4G4WA 3UT5B 2HVYD 2YXZA 5JH7B 5JQGA 1VQVA 1Q81H 4BT2A 1GX1A 2BO1A 1IV1A 1U3LA 3ON1A 1KC8H 3CCJF 1Q82H 1YQNA 4C8EA 3TD4A 1W55A 2HS3A 4TV8A 2R751 4ZHVA 2AIZP 5BMVB 2NMUA 3N2KA 2HP0A 3HKEB 3L7QA 1JN1A 3CCSF 1FFXA 3K12A 3E20B 1UI9A 3M1XA 1IV3A 5EWRA 3J7AR 3N4YA 3JALB 3QHDA 1RLUA 4NUTA 4YJ2A 1YI2F 1DT9A 5LYJA 5LOVB 3TD3A 1W5AA 2PMPA 4G88A 3B6NA 3CCEF 4EI9A 3FFMA 4TZZA 5HY1A 2L26A 4BT5A 5DCVA 2VAWA 2KTVA 1VQ4F 4NQ3A 1JFFA 2R6R1 4ZI7A 3CD6F 1E7KA 4X3MA 3HKCB 2UYNB 2RHOA 4O4IA 4IHJB 3CXCF 4TUYA 2UZHA 1S72F 3LWPC 3HTNA 3V7EA 3LWOC 3N2KB 1VQ5F 5CA1B 2HP0B 2Z1UA 3HKEA 5EYPB 3OONA 3HWUA 4ZOLB 1VQKF 5JVDA 1JD1A 1SA0B 4F6RB 5KX5B 4PWTA 3QUWA 3WGNA 4O4LB 4I55A 5EAZA 3WGJA 2RHHA 5G4VC 4C81A 1COMA 1W5FA 3KJKA 4ERHA 4X1YA 3FBAA 3E22A 5AVMA 3VOAA 1KQSF 3JARB 3HKDA 3F0EA 1JFFB 4YJ3A 4EB6A 1R1MA 1XRGA 3WXMB 5LP6A 1OFUA 4IIJA 4KWEA 5EZYB 3RA6A 5IJ9A 3RYFA 5HP7A 1M1KH 4O4IB 4BVQA 4G4YA 3CCMF 2VAMA 3ZP7A 2W8BC 4X1IA 3OBWA 5IYZA 5GINC 5GAPK 2QA4F 2UYPA 3SIUA 5HY0A 3VTIC 4I50B 1IPAA 3FPIA 5CA1A 3SIVA 1CLIA 5IT9M 3CYPB 3C9SA 3K2XA 5JQGB 2KTUA 3CYQA 5EB0A 1RQ2A 1ONIA 3IKEA 2N48A 3AGKA 1W41A 4TV9A 1VQ9F 3CMEF 5GIOC 4EI7A 1XBIA 4ZK7A 3CB2A 4O2AA 2VXYA 1YITF 3LDTA 1W581 3MQWA 4G4XA 1IV4A 3WGKA 1QVGF 3ELCA 5B8FA 1PF5A 3RYIA 4EI8A 4HNAB 1X25A 2P6YA 3WGLA 1YJNF 3FD5A 4BT7A 2F9ZC 1W2BF 3RYHA 1RQ7A 3GYQA 4O4JB 4BT4A 5FLXM 2H6LA 5LP6B 3N2GB 1W59A 1IV2A 5LYJB 1XHOA 2FGYA 1Q8RA 4X1IB 1TVKA 2IG8A 1PXWA 1X7PA 2ZODA 3NK7A 4BVSA 5IJ0A 4ZHWA 3K0TA 4M8IA 4WBNA 4ZI7B 3JVHA 5LP6C 1SZQA 1Q7YH 2UYNA 3OBYA 2BTQB 4IHJA 4O2BB 3VMFB 2Z1TA 3P10A 5GIPC 4TUYB 1SDSA 3NVIB 5LA6A 3RYCB 3N4ZA 5C8YA 3S0WA 2GZLA 3CCUF 3TD5A 5EB1B 2Z1FA 5GONA 3JAKA 3JCMM 3U0OA 2EWCA 3ZP4A 3IEQA 4O4LA 2HS4A 4E6EA 2ZVZA 4I55B 1X52A 3O85A 2UYKA 2I6RA 4RQOA 2IAFA 4ZHQB 5FNVB 3MDOA 3G6EF 4BY9D 2OTLF 3J81M 4B62A 3F0DA 4X3LA 3NMUC 3CC7F 5KMGB 2OHWA 3KIZA 5LXTA 2UYJA 1QAHA 5ITZB 1FSZA 4IIJB 1VHAA 5MN4A 2GVIA 4C82A 2Q1XA 2OTJF 3CCVF 2CHTA 3JATA 3ESJA 3WJQA 1QVFF 4ZHYB 1QU9A 3WJPA 3BYQA 3CMAF 3CPQA 5HP8A 1VQ7F 5JH7A 4I50A 1NJIH 5HY4A 2FC3A 1SA0A 5KX5A 5EIBD 2AMTA 3QTYA 3OW2F 3D01A 1Z5VA 2QTPA 2PHNA 2LCAA 4U39A 4DRXA 5JCOC 1W5BA 3V4DA 2RB9A 3LWVC 1OAPA 3NK6A 4BW0B 1Q86H 1ZWZA 3ERNA 3WPXA 1W57A 4NWOB 1H47A 4YJ3B 4EB6B 2RHJA 3LWRC 5LXTB 3RE3A 2RHLA 3E1YA 3PAFA 3RYFB 2I6DA 3IEWA 3IMPA 2CW4A 3MCQA 1YGYA 1GO1A 3C9TA 3JATB 3G71F 4BT6A 5J2TB 3KE1A 2CSLA 2CZWA 1JY8A 3JASA 2AIFA 4R40B 3C9RA 3HKCA 2DYYA 1RA4A 3LMEA 1VQ6F 3VOBA 5IJ0B 4BVTA 3J80M 3ZO8A 4BT3A 4WBNB 3HJWC 4C8IA 5A2QM 1KD1H 3VYTC 1YJWF 4U3JB 3CC4F 2VAPA 3PLAC 3CPWF 5JVDB 2H8CA 1K8AH 4F6RA 3GHZA 5C8YB 3RYIB 5EYPA 2HRUA 1VK3A 3RA5A 4ZOLA 4DXDA 3IR9A 2ZOVA 4G4ZA 3LWQC 2H8EA 3CCRF 5EIBC 4O4JA 2CVLA 1VQOF 1TUBB 1X7OA 2MQEA 2KG4A 2Z01A 3P4EA 1T0KB 2OZBA 3NVKE 4LNUB 3C8LA 1VQ8F 2QI2A 1W40A 3JARA 3KJJA 3HKDB 1XV2A 5J2TA 5HWEA 3F6MA 3JALA 3D54A 1VH8A 3JASB 4C4WC 2BTOA 1H7MA 2YYEA 2HQSC 3P0ZA 4XCQA 3JAWB 1KNJA 5IYZB 2OTMA 3I3FA 1JJ2F 2ZVYA 1NMUB 5J2UB 3VIUA 4O4HB 2Q1YA 4X1KB 3UT5A 3DDNA 4BVRA 1J7HA 3V7QA 2HRYA 1K73H 4U3JA 1YIJF 5CB4A 3F0FA 5HY2A 4FFBB 4TV9B 3T80A 3JAMM 1FNJA 2HX0A 3JAKB 5GANK 1GO0A 1FNKA 1KNKA 3S0YA 2WALA 1VQPF 5BMVA 1K9MH 2QEXF 4B45A 4I4TA 2LBTA 1CN7A 5FNVA 2HS0A 2IQQA 3VO8A 4HNAA 1ODEA 1U3PA 1N8RH 3DC2A 1CK2A 1DBFA 3K14A 3R0PA 4X20B 4YJ2B 5JCOA 2V9YA 3S06A 3GTZA 2Z1EA 3N2GA 2CHSA 3C9UA 3VCZA 1VQMF 1W42A 5EO3A 3RYHB 1YHQF 1YJ9F 2K1SA 2ALEA 1UFYA 3CCLF 3JAWA 5ITZA 5HXZA 3I7TA 1TVKB 2B33A 3LYBA 4X1KA 4X1YB 1W5EA 3E22B 3WGMA 3F0GA 2G9IA 5CA0A 1Z5WA 2ZAUA 2DT4A 3VYUC 5CB4B 1NQ3A 5IJ9B 3ZOPA 4FFBA 3M84A 3IKFA 3HKBA
chains in the Genus database with same CATH topology
3C9SA 2Z1TA 5AVMA 3VYTC 3QTYA 3D54A 2Z1UA 3MCQA 3C9TA 3KIZA 2HS3A 2YYEA 3VYSC 2Z1FA 2HRUA 1VK3A 2BTUA 2HS0A 2RB9A 3VIUA 2ZODA 2ZAUA 3U0OA 3WJRA 3C9RA 3VYUC 3FD6A 2HS4A 3WJQA 2HRYA 3FD5A 2I6RA 3M84A 3P4EA 2Z01A 2V9YA 2YXZA 3VTIC 3MDOA 3WJPA 1VQVA 2Z1EA 1CLIA 3C9UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C9S A;  2Z1T A;  5AVM A;  3VYT C;  3QTY A;  3D54 A;  2Z1U A;  3MCQ A;  3C9T A;  3KIZ A;  2HS3 A;  2YYE A;  3VYS C;  2Z1F A;  2HRU A;  1VK3 A;  2BTU A;  2HS0 A;  2RB9 A;  3VIU A;  2ZOD A;  2ZAU A;  3U0O A;  3WJR A;  3C9R A;  3VYU C;  3FD6 A;  2HS4 A;  3WJQ A;  2HRY A;  3FD5 A;  2I6R A;  3M84 A;  3P4E A;  2Z01 A;  2V9Y A;  2YXZ A;  3VTI C;  3MDO A;  3WJP A;  1VQV A;  2Z1E A;  1CLI A;  3C9U A; 
#chains in the Genus database with same CATH topology
 3Q8H A;  5LA6 B;  3RYC A;  4DRX B;  1U40 A;  4O2B A;  4G4V A;  4I4T B;  5MN6 A;  3S02 A;  3EOR A;  3CC2 F;  3LFO A;  5GON B;  4LCK A;  4X20 A;  1W3E X;  1VQN F;  5FJ4 C;  4B5C A;  3M4S A;  3CG6 A;  3WJR A;  1T0A A;  2VGM A;  4ZHQ A;  3FD6 A;  4TV8 B;  5G4U C;  2JNB A;  4O2A B;  3S0H A;  4B46 A;  1TUB A;  2ZF8 A;  1GZ0 A;  1QD9 A;  3HAX D;  2VGN A;  4LNU A;  1FFX B;  5KMG A;  3V3T A;  3WPW A;  5MN5 A;  5CA0 B;  2CWJ A;  2KGW A;  2LBW A;  3VI6 A;  5EZY A;  3MBM A;  3KHN A;  3S03 A;  1VQL F;  5LOV A;  3VYS C;  4C8G A;  3D00 A;  2BTU A;  3I55 F;  2HP3 A;  3G4S F;  5HXU A;  4RHA A;  3HKB B;  2GLZ A;  3MCA B;  1RLG A;  1H48 A;  3I56 F;  3CCQ F;  5J2U A;  1M90 H;  4O4H A;  1U43 A;  2LBX A;  4G4W A;  3UT5 B;  2HVY D;  2YXZ A;  5JH7 B;  5JQG A;  1VQV A;  1Q81 H;  4BT2 A;  1GX1 A;  2BO1 A;  1IV1 A;  1U3L A;  3ON1 A;  1KC8 H;  3CCJ F;  1Q82 H;  1YQN A;  4C8E A;  3TD4 A;  1W55 A;  2HS3 A;  4TV8 A;  2R75 1;  4ZHV A;  2AIZ P;  5BMV B;  2NMU A;  3N2K A;  2HP0 A;  3HKE B;  3L7Q A;  1JN1 A;  3CCS F;  1FFX A;  3K12 A;  3E20 B;  1UI9 A;  3M1X A;  1IV3 A;  5EWR A;  3J7A R;  3N4Y A;  3JAL B;  3QHD A;  1RLU A;  4NUT A;  4YJ2 A;  1YI2 F;  1DT9 A;  5LYJ A;  5LOV B;  3TD3 A;  1W5A A;  2PMP A;  4G88 A;  3B6N A;  3CCE F;  4EI9 A;  3FFM A;  4TZZ A;  5HY1 A;  2L26 A;  4BT5 A;  5DCV A;  2VAW A;  2KTV A;  1VQ4 F;  4NQ3 A;  1JFF A;  2R6R 1;  4ZI7 A;  3CD6 F;  1E7K A;  4X3M A;  3HKC B;  2UYN B;  2RHO A;  4O4I A;  4IHJ B;  3CXC F;  4TUY A;  2UZH A;  1S72 F;  3LWP C;  3HTN A;  3V7E A;  3LWO C;  3N2K B;  1VQ5 F;  5CA1 B;  2HP0 B;  2Z1U A;  3HKE A;  5EYP B;  3OON A;  3HWU A;  4ZOL B;  1VQK F;  5JVD A;  1JD1 A;  1SA0 B;  4F6R B;  5KX5 B;  4PWT A;  3QUW A;  3WGN A;  4O4L B;  4I55 A;  5EAZ A;  3WGJ A;  2RHH A;  5G4V C;  4C81 A;  1COM A;  1W5F A;  3KJK A;  4ERH A;  4X1Y A;  3FBA A;  3E22 A;  5AVM A;  3VOA A;  1KQS F;  3JAR B;  3HKD A;  3F0E A;  1JFF B;  4YJ3 A;  4EB6 A;  1R1M A;  1XRG A;  3WXM B;  5LP6 A;  1OFU A;  4IIJ A;  4KWE A;  5EZY B;  3RA6 A;  5IJ9 A;  3RYF A;  5HP7 A;  1M1K H;  4O4I B;  4BVQ A;  4G4Y A;  3CCM F;  2VAM A;  3ZP7 A;  2W8B C;  4X1I A;  3OBW A;  5IYZ A;  5GIN C;  5GAP K;  2QA4 F;  2UYP A;  3SIU A;  5HY0 A;  3VTI C;  4I50 B;  1IPA A;  3FPI A;  5CA1 A;  3SIV A;  1CLI A;  5IT9 M;  3CYP B;  3C9S A;  3K2X A;  5JQG B;  2KTU A;  3CYQ A;  5EB0 A;  1RQ2 A;  1ONI A;  3IKE A;  2N48 A;  3AGK A;  1W41 A;  4TV9 A;  1VQ9 F;  3CME F;  5GIO C;  4EI7 A;  1XBI A;  4ZK7 A;  3CB2 A;  4O2A A;  2VXY A;  1YIT F;  3LDT A;  1W58 1;  3MQW A;  4G4X A;  1IV4 A;  3WGK A;  1QVG F;  3ELC A;  5B8F A;  1PF5 A;  3RYI A;  4EI8 A;  4HNA B;  1X25 A;  2P6Y A;  3WGL A;  1YJN F;  3FD5 A;  4BT7 A;  2F9Z C;  1W2B F;  3RYH A;  1RQ7 A;  3GYQ A;  4O4J B;  4BT4 A;  5FLX M;  2H6L A;  5LP6 B;  3N2G B;  1W59 A;  1IV2 A;  5LYJ B;  1XHO A;  2FGY A;  1Q8R A;  4X1I B;  1TVK A;  2IG8 A;  1PXW A;  1X7P A;  2ZOD A;  3NK7 A;  4BVS A;  5IJ0 A;  4ZHW A;  3K0T A;  4M8I A;  4WBN A;  4ZI7 B;  3JVH A;  5LP6 C;  1SZQ A;  1Q7Y H;  2UYN A;  3OBY A;  2BTQ B;  4IHJ A;  4O2B B;  3VMF B;  2Z1T A;  3P10 A;  5GIP C;  4TUY B;  1SDS A;  3NVI B;  5LA6 A;  3RYC B;  3N4Z A;  5C8Y A;  3S0W A;  2GZL A;  3CCU F;  3TD5 A;  5EB1 B;  2Z1F A;  5GON A;  3JAK A;  3JCM M;  3U0O A;  2EWC A;  3ZP4 A;  3IEQ A;  4O4L A;  2HS4 A;  4E6E A;  2ZVZ A;  4I55 B;  1X52 A;  3O85 A;  2UYK A;  2I6R A;  4RQO A;  2IAF A;  4ZHQ B;  5FNV B;  3MDO A;  3G6E F;  4BY9 D;  2OTL F;  3J81 M;  4B62 A;  3F0D A;  4X3L A;  3NMU C;  3CC7 F;  5KMG B;  2OHW A;  3KIZ A;  5LXT A;  2UYJ A;  1QAH A;  5ITZ B;  1FSZ A;  4IIJ B;  1VHA A;  5MN4 A;  2GVI A;  4C82 A;  2Q1X A;  2OTJ F;  3CCV F;  2CHT A;  3JAT A;  3ESJ A;  3WJQ A;  1QVF F;  4ZHY B;  1QU9 A;  3WJP A;  3BYQ A;  3CMA F;  3CPQ A;  5HP8 A;  1VQ7 F;  5JH7 A;  4I50 A;  1NJI H;  5HY4 A;  2FC3 A;  1SA0 A;  5KX5 A;  5EIB D;  2AMT A;  3QTY A;  3OW2 F;  3D01 A;  1Z5V A;  2QTP A;  2PHN A;  2LCA A;  4U39 A;  4DRX A;  5JCO C;  1W5B A;  3V4D A;  2RB9 A;  3LWV C;  1OAP A;  3NK6 A;  4BW0 B;  1Q86 H;  1ZWZ A;  3ERN A;  3WPX A;  1W57 A;  4NWO B;  1H47 A;  4YJ3 B;  4EB6 B;  2RHJ A;  3LWR C;  5LXT B;  3RE3 A;  2RHL A;  3E1Y A;  3PAF A;  3RYF B;  2I6D A;  3IEW A;  3IMP A;  2CW4 A;  3MCQ A;  1YGY A;  1GO1 A;  3C9T A;  3JAT B;  3G71 F;  4BT6 A;  5J2T B;  3KE1 A;  2CSL A;  2CZW A;  1JY8 A;  3JAS A;  2AIF A;  4R40 B;  3C9R A;  3HKC A;  2DYY A;  1RA4 A;  3LME A;  1VQ6 F;  3VOB A;  5IJ0 B;  4BVT A;  3J80 M;  3ZO8 A;  4BT3 A;  4WBN B;  3HJW C;  4C8I A;  5A2Q M;  1KD1 H;  3VYT C;  1YJW F;  4U3J B;  3CC4 F;  2VAP A;  3PLA C;  3CPW F;  5JVD B;  2H8C A;  1K8A H;  4F6R A;  3GHZ A;  5C8Y B;  3RYI B;  5EYP A;  2HRU A;  1VK3 A;  3RA5 A;  4ZOL A;  4DXD A;  3IR9 A;  2ZOV A;  4G4Z A;  3LWQ C;  2H8E A;  3CCR F;  5EIB C;  4O4J A;  2CVL A;  1VQO F;  1TUB B;  1X7O A;  2MQE A;  2KG4 A;  2Z01 A;  3P4E A;  1T0K B;  2OZB A;  3NVK E;  4LNU B;  3C8L A;  1VQ8 F;  2QI2 A;  1W40 A;  3JAR A;  3KJJ A;  3HKD B;  1XV2 A;  5J2T A;  5HWE A;  3F6M A;  3JAL A;  3D54 A;  1VH8 A;  3JAS B;  4C4W C;  2BTO A;  1H7M A;  2YYE A;  2HQS C;  3P0Z A;  4XCQ A;  3JAW B;  1KNJ A;  5IYZ B;  2OTM A;  3I3F A;  1JJ2 F;  2ZVY A;  1NMU B;  5J2U B;  3VIU A;  4O4H B;  2Q1Y A;  4X1K B;  3UT5 A;  3DDN A;  4BVR A;  1J7H A;  3V7Q A;  2HRY A;  1K73 H;  4U3J A;  1YIJ F;  5CB4 A;  3F0F A;  5HY2 A;  4FFB B;  4TV9 B;  3T80 A;  3JAM M;  1FNJ A;  2HX0 A;  3JAK B;  5GAN K;  1GO0 A;  1FNK A;  1KNK A;  3S0Y A;  2WAL A;  1VQP F;  5BMV A;  1K9M H;  2QEX F;  4B45 A;  4I4T A;  2LBT A;  1CN7 A;  5FNV A;  2HS0 A;  2IQQ A;  3VO8 A;  4HNA A;  1ODE A;  1U3P A;  1N8R H;  3DC2 A;  1CK2 A;  1DBF A;  3K14 A;  3R0P A;  4X20 B;  4YJ2 B;  5JCO A;  2V9Y A;  3S06 A;  3GTZ A;  2Z1E A;  3N2G A;  2CHS A;  3C9U A;  3VCZ A;  1VQM F;  1W42 A;  5EO3 A;  3RYH B;  1YHQ F;  1YJ9 F;  2K1S A;  2ALE A;  1UFY A;  3CCL F;  3JAW A;  5ITZ A;  5HXZ A;  3I7T A;  1TVK B;  2B33 A;  3LYB A;  4X1K A;  4X1Y B;  1W5E A;  3E22 B;  3WGM A;  3F0G A;  2G9I A;  5CA0 A;  1Z5W A;  2ZAU A;  2DT4 A;  3VYU C;  5CB4 B;  1NQ3 A;  5IJ9 B;  3ZOP A;  4FFB A;  3M84 A;  3IKF A;  3HKB A; 
#chains in the Genus database with same CATH homology
 3C9S A;  2Z1T A;  5AVM A;  3VYT C;  3QTY A;  3D54 A;  2Z1U A;  3MCQ A;  3C9T A;  3KIZ A;  2HS3 A;  2YYE A;  3VYS C;  2Z1F A;  2HRU A;  1VK3 A;  2BTU A;  2HS0 A;  2RB9 A;  3VIU A;  2ZOD A;  2ZAU A;  3U0O A;  3WJR A;  3C9R A;  3VYU C;  3FD6 A;  2HS4 A;  3WJQ A;  2HRY A;  3FD5 A;  2I6R A;  3M84 A;  3P4E A;  2Z01 A;  2V9Y A;  2YXZ A;  3VTI C;  3MDO A;  3WJP A;  1VQV A;  2Z1E A;  1CLI A;  3C9U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...