3QTYA

Crystal structure of phosphoribosylaminoimidazole synthetase from francisella tularensis complexed with pyrophosphate
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
348
structure length
348
Chain Sequence
AMAGLKYEDAGVNIEAGNQAVERMKQHVKKTFTQDVLTGLGSFGSLYSLKNIINNYDDPVLVQSIDGVGTKTKVAVMCGKFENLGYDLFSAATNDIVVMGAKPITFLDYVAHDKLDPAIMEELVKGMSKACAECGVSLVGGETAEMPGVYQAGEIDMVGVITGIVDRKRIINGENIKEGDIVFGLSSSGLHTNGYSFARKLFFDVAGNKHTDTYPELEGKTIGDVLLEPHINYTNIIHDFLDNGVDIKGMAHITGGGFIENIPRVLPQGLGAQIDKDSFATPAIFKLMQRIGDISEFEMYRSFNMGIGMTIIASQDQFDKMQELAKKHTNTKLYQIGKITNSGKVEII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Phosphoribosylaminoimidazole Synthetase from Francisella tularensis complexed with pyrophosphate
rcsb
source organism Francisella tularensis subsp. tularensis
molecule tags Ligase
molecule keywords Phosphoribosylaminoimidazole (AIR) synthetase
total genus 99
structure length 348
sequence length 348
chains with identical sequence B
ec nomenclature ec 6.3.3.1: Phosphoribosylformylglycinamidine cyclo-ligase.
pdb deposition date 2011-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00586 AIRS AIR synthase related protein, N-terminal domain
A PF02769 AIRS_C AIR synthase related protein, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.10 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; PurM-like, N-terminal domain 3qtyA01
3.90.650.10 Alpha Beta Alpha-Beta Complex Phosphoribosyl-aminoimidazole Synthetase; Chain A, domain 2 PurM-like C-terminal domain 3qtyA02
2HS4A 2HRUA 3C9TA 1VK3A 3U0OA 3VYTC 1CLIA 1VQVA 3FD6A 2V9YA 3WJPA 3C9SA 2HS3A 2RB9A 3D54A 3WJQA 3M84A 3VYUC 2HS0A 3MCQA 2BTUA 3VYSC 5AVMA 2Z1EA 2HRYA 3C9UA 2Z1TA 3C9RA 3FD5A 3MDOA 3P4EA 2YYEA 3VIUA 2ZAUA 2YXZA 3KIZA 2I6RA 2Z1FA 2ZODA 3WJRA 2Z01A 2Z1UA 3VTIC 3QTYA
chains in the Genus database with same CATH superfamily
4YJ3A 4ZOLA 5JCOC 1Z5WA 2V9YA 3EORA 5KMGA 1GX1A 3FPIA 5DCVA 1VQ8F 2CWJA 3TD5A 1SZQA 3NVKE 3F0DA 5HXZA 2RHJA 4X20B 3JAMM 1W581 3F0GA 2G9IA 1W42A 4TZZA 3ZP7A 3IR9A 1YJNF 1SDSA 4I55B 1X52A 2UYNA 3N2KB 2Z1FA 3L7QA 1QAHA 2DYYA 1OAPA 4ZOLB 4BW0B 4IHJA 3I3FA 2ALEA 2P6YA 5FLXM 1VQVA 2KG4A 4ZHVA 3IEWA 3G4SF 5HY0A 3LFOA 4O2BB 2H8CA 5J2TA 4ZHYB 3RE3A 2LCAA 5FNVB 3TD3A 3VYUC 1W55A 1JY8A 3RYIB 3VOAA 5AVMA 4LCKA 3IEQA 3M4SA 5LP6C 4F6RB 5EWRA 5FNVA 3VCZA 3N4YA 3F0EA 2VAPA 4BT5A 4BT2A 4ZHQA 1VQ7F 3ZP4A 3LWPC 4NQ3A 3HKCB 1U43A 3QHDA 3WGNA 1CLIA 3KE1A 5LA6B 4LNUB 1RQ2A 1JFFB 2UYJA 2CVLA 4O4JB 5C8YB 5CA1A 1NJIH 1YHQF 4TV8A 1XHOA 3CCMF 5HP7A 3NK7A 2Q1XA 4EI7A 4ZI7A 3N2GB 2IG8A 2GLZA 4O4JA 2NMUA 3CYPB 1JD1A 1PF5A 4HNAB 3UT5A 3JVHA 5LOVB 2R751 3ZO8A 2VXYA 3BYQA 5LYJB 1VK3A 3VYTC 4WBNB 5EYPB 5IJ9A 5JQGA 2PMPA 4DRXB 3PAFA 1U3LA 2DT4A 3D54A 2B33A 3CC7F 3RYHB 4RHAA 5IJ0A 4BVSA 3JARB 1K8AH 3MBMA 3JAWB 1VQ5F 3KIZA 1RQ7A 2BTQB 2CZWA 3CPQA 5CA0B 4EI9A 4RQOA 1K73H 3K0TA 3U0OA 1VQLF 1W41A 3LWRC 3FBAA 4IIJB 4B62A 1VQ9F 1NMUB 1GO1A 4BVQA 5HY2A 1J7HA 4X1KB 2QTPA 5CB4B 3N4ZA 2KTUA 3G71F 2Z1EA 2HRYA 3MQWA 5J2TB 3D00A 3CC4F 2OZBA 1YIJF 1QD9A 5IT9M 4X1YB 2N48A 5KX5A 3LYBA 1VQKF 2MQEA 1K9MH 2BTOA 1PXWA 3DDNA 2LBTA 4C4WC 3CCRF 4U3JA 4ZK7A 4BT7A 3WPXA 5G4VC 1Z5VA 3QUWA 4M8IA 3B6NA 4O4LA 3WXMB 1YJWF 4C81A 1VQ6F 3CCEF 3T80A 4X20A 4ZI7B 4C8EA 5ITZB 2BTUA 4B45A 3LWQC 1CK2A 2HP3A 2UYNB 1FSZA 2HX0A 3V3TA 3KJJA 3LDTA 3E20B 4TV9A 5HY1A 2QEXF 1FFXA 2ZAUA 3S02A 3HKBB 3G6EF 1X7OA 5JQGB 3I56F 1TVKA 4G88A 2ZF8A 1XV2A 3ZOPA 5LP6A 1CN7A 4O4LB 3HTNA 3UT5B 1XRGA 5JH7B 4KWEA 2HP0A 5GONB 4BVRA 2HS3A 3DC2A 1U40A 5G4UC 3SIUA 2OTJF 2CHSA 5JVDA 2OTMA 4R40B 3CMEF 1RA4A 1Q8RA 1Q86H 3JATA 1H47A 2KGWA 4U39A 4LNUA 1YITF 3TD4A 1E7KA 1Q81H 1R1MA 3VTIC 3V7EA 5JH7A 4G4ZA 2UZHA 4X1KA 2LBWA 4E6EA 2H6LA 2VAMA 4ZHQB 5EZYB 1U3PA 4O4HA 2UYKA 2VGMA 3C9SA 2PHNA 2QA4F 1T0KB 4U3JB 3VO8A 5JVDB 4TUYA 3WGKA 3CB2A 1X25A 3JASA 2KTVA 1FNJA 5JCOA 2AIFA 4NUTA 4O2AA 3S03A 5MN4A 1IV3A 3CCUF 4WBNA 1JFFA 2K1SA 3RYCA 1IV4A 2Z1UA 1VQMF 2CSLA 1W2BF 3OW2F 3JALA 4I50A 5HXUA 2AIZP 1RLUA 3P10A 3S0WA 1GZ0A 2W8BC 3LMEA 3D01A 4X1IB 1VQPF 2IQQA 4O4IA 3MCQA 3M1XA 3RYFA 3HAXD 2BO1A 1COMA 1SA0B 5EB1B 5EIBC 2VAWA 5FJ4C 3ON1A 3CCJF 3WGMA 3ESJA 4NWOB 3JARA 2VGNA 1YQNA 3KHNA 3CXCF 5LP6B 4IIJA 2ZODA 1VQOF 1W5AA 4B5CA 1H7MA 2QI2A 3C9TA 1ONIA 2FGYA 4EB6B 4BT3A 1TUBA 3ERNA 3CD6F 2WALA 4BT4A 3WJPA 1VQNF 1W3EX 2H8EA 4C82A 1UI9A 3M84A 4PWTA 3OONA 1W40A 3ELCA 4HNAA 5GAPK 5A2QM 5KMGB 4BT6A 4C8IA 5IYZA 3R0PA 4G4WA 1KD1H 3WPWA 3S06A 5B8FA 2Z01A 1ODEA 3WGJA 2LBXA 2IAFA 4DRXA 2ZVZA 3AGKA 4X3LA 3SIVA 3N2GA 2CW4A 4EB6A 5EO3A 5BMVA 5KX5B 3OBWA 2HQSC 1FFXB 1OFUA 1W5EA 1YJ9F 1IV1A 4F6RA 3IKEA 5GIPC 3RYIA 3JCMM 2UYPA 1RLGA 2F9ZC 5EYPA 5CA1B 1N8RH 1W5BA 2YXZA 3I7TA 2I6RA 1SA0A 5LA6A 1H48A 1DBFA 3NVIB 4I50B 5MN5A 2HP0B 2Q1YA 3CG6A 3HKEB 3CCSF 1KNKA 1NQ3A 2FC3A 1GO0A 2R6R1 3C8LA 2RB9A 4IHJB 3HJWC 3J7AR 2RHHA 3GYQA 1W57A 3J80M 4O4IB 3RYFB 3S0YA 1W5FA 2YYEA 3VIUA 1KNJA 2EWCA 1JN1A 3VMFB 4EI8A 1VH8A 3K2XA 5IJ0B 1QVGF 2OHWA 3C9UA 1QVFF 3CYQA 3HKDB 3NK6A 5IJ9B 5GINC 1UFYA 3N2KA 3V4DA 5LYJA 3F6MA 3OBYA 5LOVA 3HKDA 3CC2F 3HKEA 3S0HA 2L26A 3WJQA 3E22B 2CHTA 1Q82H 5J2UB 3JAWA 4FFBA 1M90H 5GANK 3J81M 4TUYB 5ITZA 3CCQF 3LWVC 2GZLA 3RYHA 3K12A 1S72F 4YJ2A 4TV8B 1KC8H 4B46A 3WJRA 3JALB 5GONA 5HY4A 2I6DA 2OTLF 4G4XA 1DT9A 2GVIA 2JNBA 1W59A 3RA5A 1QU9A 3FD6A 4G4YA 4YJ2B 5CA0A 3CCLF 3P0ZA 3NMUC 3HKCA 3RA6A 3PLAC 1ZWZA 3LWOC 3I55F 5MN6A 3JAKB 4I4TA 3VOBA 3HKBA 5HP8A 4X1IA 3P4EA 3FD5A 4XCQA 5BMVB 5CB4A 5C8YA 1XBIA 4YJ3B 1VQ4F 5EZYA 2RHLA 4O2BA 3QTYA 3KJKA 3WGLA 2HVYD 3Q8HA 3K14A 1JJ2F 1YGYA 1TUBB 2RHOA 1M1KH 5IYZB 3JASB 1YI2F 2HS0A 3CCVF 4I55A 3VYSC 4C8GA 4TV9B 2ZOVA 5HWEA 2Z1TA 3MDOA 3FFMA 2ZVYA 4ERHA 3O85A 2AMTA 5LXTB 4O2AB 5EIBD 3F0FA 4O4HB 2HS4A 2HRUA 3GHZA 5LXTA 5EAZA 1TVKB 3E1YA 1VHAA 1IV2A 1KQSF 3IKFA 3MCAB 3HWUA 1T0AA 4G4VA 1IPAA 1FNKA 4X1YA 4BY9D 3RYCB 3CMAF 4X3MA 4ZHWA 3C9RA 3JATB 3CPWF 3GTZA 1Q7YH 3E22A 4BVTA 3VI6A 4FFBB 5EB0A 4I4TB 3IMPA 1X7PA 3JAKA 3V7QA 5J2UA 4DXDA 5GIOC
chains in the Genus database with same CATH topology
2HS4A 2HRUA 3C9TA 1VK3A 3U0OA 3VYTC 1CLIA 1VQVA 3FD6A 2V9YA 3WJPA 3C9SA 2HS3A 2RB9A 3D54A 3WJQA 3M84A 3VYUC 2HS0A 3MCQA 2BTUA 3VYSC 5AVMA 2Z1EA 2HRYA 3C9UA 2Z1TA 3C9RA 3FD5A 3MDOA 3P4EA 2YYEA 3VIUA 2ZAUA 2YXZA 3KIZA 2I6RA 2Z1FA 2ZODA 3WJRA 2Z01A 2Z1UA 3VTIC 3QTYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HS4 A;  2HRU A;  3C9T A;  1VK3 A;  3U0O A;  3VYT C;  1CLI A;  1VQV A;  3FD6 A;  2V9Y A;  3WJP A;  3C9S A;  2HS3 A;  2RB9 A;  3D54 A;  3WJQ A;  3M84 A;  3VYU C;  2HS0 A;  3MCQ A;  2BTU A;  3VYS C;  5AVM A;  2Z1E A;  2HRY A;  3C9U A;  2Z1T A;  3C9R A;  3FD5 A;  3MDO A;  3P4E A;  2YYE A;  3VIU A;  2ZAU A;  2YXZ A;  3KIZ A;  2I6R A;  2Z1F A;  2ZOD A;  3WJR A;  2Z01 A;  2Z1U A;  3VTI C;  3QTY A; 
#chains in the Genus database with same CATH topology
 4YJ3 A;  4ZOL A;  5JCO C;  1Z5W A;  2V9Y A;  3EOR A;  5KMG A;  1GX1 A;  3FPI A;  5DCV A;  1VQ8 F;  2CWJ A;  3TD5 A;  1SZQ A;  3NVK E;  3F0D A;  5HXZ A;  2RHJ A;  4X20 B;  3JAM M;  1W58 1;  3F0G A;  2G9I A;  1W42 A;  4TZZ A;  3ZP7 A;  3IR9 A;  1YJN F;  1SDS A;  4I55 B;  1X52 A;  2UYN A;  3N2K B;  2Z1F A;  3L7Q A;  1QAH A;  2DYY A;  1OAP A;  4ZOL B;  4BW0 B;  4IHJ A;  3I3F A;  2ALE A;  2P6Y A;  5FLX M;  1VQV A;  2KG4 A;  4ZHV A;  3IEW A;  3G4S F;  5HY0 A;  3LFO A;  4O2B B;  2H8C A;  5J2T A;  4ZHY B;  3RE3 A;  2LCA A;  5FNV B;  3TD3 A;  3VYU C;  1W55 A;  1JY8 A;  3RYI B;  3VOA A;  5AVM A;  4LCK A;  3IEQ A;  3M4S A;  5LP6 C;  4F6R B;  5EWR A;  5FNV A;  3VCZ A;  3N4Y A;  3F0E A;  2VAP A;  4BT5 A;  4BT2 A;  4ZHQ A;  1VQ7 F;  3ZP4 A;  3LWP C;  4NQ3 A;  3HKC B;  1U43 A;  3QHD A;  3WGN A;  1CLI A;  3KE1 A;  5LA6 B;  4LNU B;  1RQ2 A;  1JFF B;  2UYJ A;  2CVL A;  4O4J B;  5C8Y B;  5CA1 A;  1NJI H;  1YHQ F;  4TV8 A;  1XHO A;  3CCM F;  5HP7 A;  3NK7 A;  2Q1X A;  4EI7 A;  4ZI7 A;  3N2G B;  2IG8 A;  2GLZ A;  4O4J A;  2NMU A;  3CYP B;  1JD1 A;  1PF5 A;  4HNA B;  3UT5 A;  3JVH A;  5LOV B;  2R75 1;  3ZO8 A;  2VXY A;  3BYQ A;  5LYJ B;  1VK3 A;  3VYT C;  4WBN B;  5EYP B;  5IJ9 A;  5JQG A;  2PMP A;  4DRX B;  3PAF A;  1U3L A;  2DT4 A;  3D54 A;  2B33 A;  3CC7 F;  3RYH B;  4RHA A;  5IJ0 A;  4BVS A;  3JAR B;  1K8A H;  3MBM A;  3JAW B;  1VQ5 F;  3KIZ A;  1RQ7 A;  2BTQ B;  2CZW A;  3CPQ A;  5CA0 B;  4EI9 A;  4RQO A;  1K73 H;  3K0T A;  3U0O A;  1VQL F;  1W41 A;  3LWR C;  3FBA A;  4IIJ B;  4B62 A;  1VQ9 F;  1NMU B;  1GO1 A;  4BVQ A;  5HY2 A;  1J7H A;  4X1K B;  2QTP A;  5CB4 B;  3N4Z A;  2KTU A;  3G71 F;  2Z1E A;  2HRY A;  3MQW A;  5J2T B;  3D00 A;  3CC4 F;  2OZB A;  1YIJ F;  1QD9 A;  5IT9 M;  4X1Y B;  2N48 A;  5KX5 A;  3LYB A;  1VQK F;  2MQE A;  1K9M H;  2BTO A;  1PXW A;  3DDN A;  2LBT A;  4C4W C;  3CCR F;  4U3J A;  4ZK7 A;  4BT7 A;  3WPX A;  5G4V C;  1Z5V A;  3QUW A;  4M8I A;  3B6N A;  4O4L A;  3WXM B;  1YJW F;  4C81 A;  1VQ6 F;  3CCE F;  3T80 A;  4X20 A;  4ZI7 B;  4C8E A;  5ITZ B;  2BTU A;  4B45 A;  3LWQ C;  1CK2 A;  2HP3 A;  2UYN B;  1FSZ A;  2HX0 A;  3V3T A;  3KJJ A;  3LDT A;  3E20 B;  4TV9 A;  5HY1 A;  2QEX F;  1FFX A;  2ZAU A;  3S02 A;  3HKB B;  3G6E F;  1X7O A;  5JQG B;  3I56 F;  1TVK A;  4G88 A;  2ZF8 A;  1XV2 A;  3ZOP A;  5LP6 A;  1CN7 A;  4O4L B;  3HTN A;  3UT5 B;  1XRG A;  5JH7 B;  4KWE A;  2HP0 A;  5GON B;  4BVR A;  2HS3 A;  3DC2 A;  1U40 A;  5G4U C;  3SIU A;  2OTJ F;  2CHS A;  5JVD A;  2OTM A;  4R40 B;  3CME F;  1RA4 A;  1Q8R A;  1Q86 H;  3JAT A;  1H47 A;  2KGW A;  4U39 A;  4LNU A;  1YIT F;  3TD4 A;  1E7K A;  1Q81 H;  1R1M A;  3VTI C;  3V7E A;  5JH7 A;  4G4Z A;  2UZH A;  4X1K A;  2LBW A;  4E6E A;  2H6L A;  2VAM A;  4ZHQ B;  5EZY B;  1U3P A;  4O4H A;  2UYK A;  2VGM A;  3C9S A;  2PHN A;  2QA4 F;  1T0K B;  4U3J B;  3VO8 A;  5JVD B;  4TUY A;  3WGK A;  3CB2 A;  1X25 A;  3JAS A;  2KTV A;  1FNJ A;  5JCO A;  2AIF A;  4NUT A;  4O2A A;  3S03 A;  5MN4 A;  1IV3 A;  3CCU F;  4WBN A;  1JFF A;  2K1S A;  3RYC A;  1IV4 A;  2Z1U A;  1VQM F;  2CSL A;  1W2B F;  3OW2 F;  3JAL A;  4I50 A;  5HXU A;  2AIZ P;  1RLU A;  3P10 A;  3S0W A;  1GZ0 A;  2W8B C;  3LME A;  3D01 A;  4X1I B;  1VQP F;  2IQQ A;  4O4I A;  3MCQ A;  3M1X A;  3RYF A;  3HAX D;  2BO1 A;  1COM A;  1SA0 B;  5EB1 B;  5EIB C;  2VAW A;  5FJ4 C;  3ON1 A;  3CCJ F;  3WGM A;  3ESJ A;  4NWO B;  3JAR A;  2VGN A;  1YQN A;  3KHN A;  3CXC F;  5LP6 B;  4IIJ A;  2ZOD A;  1VQO F;  1W5A A;  4B5C A;  1H7M A;  2QI2 A;  3C9T A;  1ONI A;  2FGY A;  4EB6 B;  4BT3 A;  1TUB A;  3ERN A;  3CD6 F;  2WAL A;  4BT4 A;  3WJP A;  1VQN F;  1W3E X;  2H8E A;  4C82 A;  1UI9 A;  3M84 A;  4PWT A;  3OON A;  1W40 A;  3ELC A;  4HNA A;  5GAP K;  5A2Q M;  5KMG B;  4BT6 A;  4C8I A;  5IYZ A;  3R0P A;  4G4W A;  1KD1 H;  3WPW A;  3S06 A;  5B8F A;  2Z01 A;  1ODE A;  3WGJ A;  2LBX A;  2IAF A;  4DRX A;  2ZVZ A;  3AGK A;  4X3L A;  3SIV A;  3N2G A;  2CW4 A;  4EB6 A;  5EO3 A;  5BMV A;  5KX5 B;  3OBW A;  2HQS C;  1FFX B;  1OFU A;  1W5E A;  1YJ9 F;  1IV1 A;  4F6R A;  3IKE A;  5GIP C;  3RYI A;  3JCM M;  2UYP A;  1RLG A;  2F9Z C;  5EYP A;  5CA1 B;  1N8R H;  1W5B A;  2YXZ A;  3I7T A;  2I6R A;  1SA0 A;  5LA6 A;  1H48 A;  1DBF A;  3NVI B;  4I50 B;  5MN5 A;  2HP0 B;  2Q1Y A;  3CG6 A;  3HKE B;  3CCS F;  1KNK A;  1NQ3 A;  2FC3 A;  1GO0 A;  2R6R 1;  3C8L A;  2RB9 A;  4IHJ B;  3HJW C;  3J7A R;  2RHH A;  3GYQ A;  1W57 A;  3J80 M;  4O4I B;  3RYF B;  3S0Y A;  1W5F A;  2YYE A;  3VIU A;  1KNJ A;  2EWC A;  1JN1 A;  3VMF B;  4EI8 A;  1VH8 A;  3K2X A;  5IJ0 B;  1QVG F;  2OHW A;  3C9U A;  1QVF F;  3CYQ A;  3HKD B;  3NK6 A;  5IJ9 B;  5GIN C;  1UFY A;  3N2K A;  3V4D A;  5LYJ A;  3F6M A;  3OBY A;  5LOV A;  3HKD A;  3CC2 F;  3HKE A;  3S0H A;  2L26 A;  3WJQ A;  3E22 B;  2CHT A;  1Q82 H;  5J2U B;  3JAW A;  4FFB A;  1M90 H;  5GAN K;  3J81 M;  4TUY B;  5ITZ A;  3CCQ F;  3LWV C;  2GZL A;  3RYH A;  3K12 A;  1S72 F;  4YJ2 A;  4TV8 B;  1KC8 H;  4B46 A;  3WJR A;  3JAL B;  5GON A;  5HY4 A;  2I6D A;  2OTL F;  4G4X A;  1DT9 A;  2GVI A;  2JNB A;  1W59 A;  3RA5 A;  1QU9 A;  3FD6 A;  4G4Y A;  4YJ2 B;  5CA0 A;  3CCL F;  3P0Z A;  3NMU C;  3HKC A;  3RA6 A;  3PLA C;  1ZWZ A;  3LWO C;  3I55 F;  5MN6 A;  3JAK B;  4I4T A;  3VOB A;  3HKB A;  5HP8 A;  4X1I A;  3P4E A;  3FD5 A;  4XCQ A;  5BMV B;  5CB4 A;  5C8Y A;  1XBI A;  4YJ3 B;  1VQ4 F;  5EZY A;  2RHL A;  4O2B A;  3QTY A;  3KJK A;  3WGL A;  2HVY D;  3Q8H A;  3K14 A;  1JJ2 F;  1YGY A;  1TUB B;  2RHO A;  1M1K H;  5IYZ B;  3JAS B;  1YI2 F;  2HS0 A;  3CCV F;  4I55 A;  3VYS C;  4C8G A;  4TV9 B;  2ZOV A;  5HWE A;  2Z1T A;  3MDO A;  3FFM A;  2ZVY A;  4ERH A;  3O85 A;  2AMT A;  5LXT B;  4O2A B;  5EIB D;  3F0F A;  4O4H B;  2HS4 A;  2HRU A;  3GHZ A;  5LXT A;  5EAZ A;  1TVK B;  3E1Y A;  1VHA A;  1IV2 A;  1KQS F;  3IKF A;  3MCA B;  3HWU A;  1T0A A;  4G4V A;  1IPA A;  1FNK A;  4X1Y A;  4BY9 D;  3RYC B;  3CMA F;  4X3M A;  4ZHW A;  3C9R A;  3JAT B;  3CPW F;  3GTZ A;  1Q7Y H;  3E22 A;  4BVT A;  3VI6 A;  4FFB B;  5EB0 A;  4I4T B;  3IMP A;  1X7P A;  3JAK A;  3V7Q A;  5J2U A;  4DXD A;  5GIO C; 
#chains in the Genus database with same CATH homology
 2HS4 A;  2HRU A;  3C9T A;  1VK3 A;  3U0O A;  3VYT C;  1CLI A;  1VQV A;  3FD6 A;  2V9Y A;  3WJP A;  3C9S A;  2HS3 A;  2RB9 A;  3D54 A;  3WJQ A;  3M84 A;  3VYU C;  2HS0 A;  3MCQ A;  2BTU A;  3VYS C;  5AVM A;  2Z1E A;  2HRY A;  3C9U A;  2Z1T A;  3C9R A;  3FD5 A;  3MDO A;  3P4E A;  2YYE A;  3VIU A;  2ZAU A;  2YXZ A;  3KIZ A;  2I6R A;  2Z1F A;  2ZOD A;  3WJR A;  2Z01 A;  2Z1U A;  3VTI C;  3QTY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...