3QU3A

Crystal structure of irf-7 dbd apo form
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
122
structure length
122
Chain Sequence
RVLFGDWLLGEVSSGQYEGLQWLNEARTVFRVPWKHFGRRDLDEEDAQIFKAWAVARGRWPPSGVNLPPPEAEAAERRERRGWKTNFRCALHSTGRFILRQDNSGDPVDPHKVYELSRELGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of apo IRF-3 and IRF-7 DNA binding domains: effect of loop L1 on DNA binding.
pubmed doi rcsb
source organism Mus musculus
molecule tags Dna binding protein
molecule keywords Interferon regulatory factor 7
total genus 34
structure length 122
sequence length 122
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2011-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00605 IRF Interferon regulatory factor transcription factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3qu3A01
2O6GE 3K1PA 4HAMA 4DNCA 2PQ8A 5E17F 5CVVA 4RB0A 3IL2A 3V7CA 4YFXF 2PMUA 2VOOA 2EV5A 2GXGA 4M9XA 2Y0MA 4HW0A 2A6HF 3REOA 4G8XA 2P5LC 5ICGA 4L9NA 1SFEA 2UXXA 4A5NA 2V6CA 4BH9A 4RB2C 4RB3C 3WG9A 4G7OF 2L3DA 3E5UA 3LA3A 2EV6A 4BNCA 1TLHB 3FXQA 1J9IA 1Q1HA 5DV5A 1KYZA 3KP5A 3HRTA 4B8XA 1XSXA 1IN7A 1ZN2A 4G94A 3MFKA 1PP7U 4U88A 5BMZA 3JSPA 2GZWA 5CVIA 5LBQA 1FSHA 2Z3YA 3WTYC 2OU2A 4PGGA 2X0LA 5E20A 5IT3A 4YIIA 1PUEE 1K78A 4CYDA 3HHHA 5HLHA 1G3YA 2VODA 3I64A 4LGWA 4GCVA 2HYGD 2RQPA 2NRAC 5BPDA 4PDKA 2NYXA 5AONA 3ZMSA 2QQAA 1MZBA 3K1MA 4KFCA 1HW1A 3WTXC 2DAOA 4KICA 4MEXF 3K69A 4A5MA 3NEUA 4HOBA 1JHFA 4LD5A 2RGVA 1RI7A 3C18A 3COAC 1QGPA 1OMIA 1WWXA 1MKMA 1TQMA 5HS8A 3GYHX 1D5VA 5FFZA 1FSEA 3JAMK 3GVAA 3KCCA 3BJ6A 2XIGA 1FYLA 3ZN0A 1JXSA 3KP4A 2V1XA 3TKYA 2HQRA 5CLSA 1D3YA 1P6RA 3VEPA 3M9AA 5AIQA 4XSZF 4RAYA 4HV5A 2HDCA 3P9CA 1MDMA 2RN7A 2Z9OA 2TDXA 3WE2A 1SD6A 4XBFA 2PI0A 2NS0A 3SQNA 3EQLF 1QZYA 2EFNA 1ZLJA 3H3ZA 2YU3A 2P8TA 4CGZA 3F6OA 2VE9A 4KIFA 2BBYA 5HLIA 3LAJA 2D2WA 4IJAA 3C7JA 3HUGA 1J2XA 2WWYA 4WX9A 1BBYA 1IRGA 1MJAA 4NHJA 1O3RA 5CVRA 1Z91A 1T0FA 1QZZA 1IN6A 3RPQA 4U7BA 3GXOA 4ESJA 2V79A 5JR3A 1XCBA 4S05A 1BN5A 1IZ1A 2G7UA 2DLLA 4JBAA 1U5TB 1HW2A 2E7XA 3JW4A 2QYOA 4U0VA 1FP2A 5DUKA 3I71A 4BQAA 3F8NA 1FYKA 1J59A 3LQQA 5FGMA 4YFNF 4CO8A 3I59A 1IXCA 1FZPB 1J75A 1KGSA 2K86A 3V4GA 3J7AO 5LLQA 2E1NA 1OR7A 1KU2A 3RYPA 2OQRA 3ML6A 2ZKZA 1FBQA 1DDNA 1U78A 1D8JA 3OOPA 4L0ZB 2ADUA 4LB5A 2XAQA 1G3TA 2QENA 3MAJA 1A04A 1HKQA 5JHUA 4YIFA 3SZPA 3I59B 4EGZA 2HWVA 1SD4A 2UWMA 1E17A 1FC3A 4MTEA 4IRIA 4GGGA 2PMHA 2EFQA 1H9GA 4IPAA 3BROA 4BXUA 4UVBA 1LDDA 1EV7A 4WF2A 5E8IA 2P5KA 3HOTA 4MEYF 4Y13A 3R60A 1KQ9A 3H92A 2Z99A 3JTHA 2VE8A 3CDHA 1U5TA 2M87A 5AIPA 5LEKA 2BGCA 3TO7A 4TV7A 4L18B 4G7ZF 2CG4A 1B4AA 3V7RA 1SAXA 1GXPA 4O6JA 4P55A 1W4MA 2XKPA 2L54A 1ZRDA 2RKHA 2COMA 2P6TA 3W6JB 2MLGA 4EJOA 1YO5C 1LVAA 3DPTA 4LB6B 1ZHFA 3ECOA 4KA4A 3P9IA 3RKXA 3WTSC 4HBLA 3MEXA 2DTRA 2CQKA 5H6RA 5HOOA 2FMLA 3NRVA 2NNYA 3L2CA 1L3LA 3T8TA 1BC7C 1STZA 3CJNA 1FNNA 4PCQA 2L01A 4IHSA 4KT5C 4KN4X 1U8RA 1K78B 2P7CB 1I1GA 2Q2EA 5D5XB 3WGGA 1BJAA 5L3GA 1XSDA 1YLFA 1O7LA 1K7AA 4AD9A 2M5WA 2Q0OA 1ON1A 2QLZA 2WTEA 5D5WB 4ZZDA 2FA5A 1ULYA 2HZTA 5E18F 3M7GA 3KEOA 1BI0A 4MHGA 4I98B 5F64A 2AS5F 2DI3A 1MDMB 1TBXA 4ZYEA 5L3EA 5KVRA 2VBXA 1LB2A 1IF1A 3FMQA 2M8EA 2O3FA 4UUVA 2FBKA 3RIRA 2XAHA 1YFHA 4AIJA 4BAYA 2QM3A 4NB5A 4S04A 2ISYA 3FXRA 2FQ3A 3GZ5A 4L9TA 2M30A 2P5VA 3N97A 4ENNA 5JVTA 4Y15A 3RYRA 3K9TA 5L3BA 4I2OA 1XMAA 4EJUA 2PBIA 3QU6A 2ACJA 4FX4A 2FMYA 5D5VB 1WKMA 4M73A 5BPIA 2HR3A 5DD8A 2YR2A 4OMYA 1FY7A 4IF4A 1IXSB 3RDIA 1S6LA 3BPXA 4Z2YA 1J7KA 3FMSA 4D0PA 2ELHA 2L4MA 3L09A 4BHCA 3HHGA 3GF2A 4LK1F 2C6YA 4HX4A 3TGNA 3BY6A 2DW4A 1F9NA 5DCMA 1CGPA 2H09A 3TDUC 4WWCA 5DEQA 5D6FA 3CLOA 1P4AA 2A61A 5JFRA 2FOKA 3WU0A 3ERED 3BOQA 3IRRA 2A07F 2ESHA 4I0AA 4L9JA 4JK1X 1TQIA 3RKWA 2LF8A 4EMSA 1RZ4A 3I0TA 5EEGA 1IN5A 5FLXZ 3ABTA 5CJ9A 1FPQA 1HBXG 3WE3A 2FNAA 1BI1A 3TQNA 1LNWA 2FE3A 1ZARA 1E2XA 1K6OA 2HOEA 1OYIA 3F8FA 2D1VA 3DV8A 2L4AA 1LEBA 5HDGA 1EH6A 2F5FA 5DDGA 2IA1A 1R5GA 1RNLA 2W57A 3FF5A 3R4KA 2Z33A 1LDKB 4HLYA 3WTUC 4HQEA 3M8FA 5FLXK 3WU1B 1BM9A 3VODA 2IP2A 4A0ZA 3MZHA 4P96A 2LNBA 2AXLA 4HLXA 5JI6A 6PAXA 2OD5A 1BIAA 4ZYHA 3E5QA 2P6SA 3J80K 4OMZA 1KYWA 1ZGJA 1BC8C 1DP7P 1O3SA 3RJPA 3SXYA 3K0LA 2BEOA 1YYVA 2IJLA 1O3QA 4MQVA 1R1UA 1ON2A 5D6EA 1Y0UA 1S8NA 2CW0F 3DXJF 1HKSA 5DD4A 1BOAA 4L0YB 3U9GA 1ZG1A 4M71A 3J81Z 4AVPA 3D5LA 2Y48A 4F7ZA 3BPVA 5D8KB 1IN8A 3ECHA 2CWEA 4ZH4F 1W7PA 2JZYA 2KJCA 2IVMA 1XMKA 3DP7A 3DPLC 1P4XA 3M1EA 1G3SA 4AIKA 4MGRA 4GYIA 2M1BA 4MQ9F 3V8JA 4XLPF 2XUBA 2FXAA 1YW7A 2MC3A 2IA0A 1TW3A 3J81K 1IUYA 3I58A 5FB2A 3IRQA 1RIOH 3SZTA 3T8RA 4HQMA 5DYMA 1KA8A 4A12A 3ZPLA 3FXUA 1WRJA 5DCMB 3WGHA 3NQOA 3BZ6A 3LWFA 1S7AA 3K2ZA 3KZZA 1YS6A 2IRFG 2F2EA 3L7WA 4EQQA 3T1BA 2DK8A 2GXBA 1DPRA 1Z6RA 4G6DA 2QQBA 2JRTA 5HDNA 2A69F 5FD5A 2FF4A 5A2QK 2GWRA 2MD5A 4U0YA 3WTWC 2RDPA 4OOIA 3RTRA 2E1CA 4LLGF 2Y75A 3U2RA 3C1DA 1TNTA 1XD7A 3KLNA 3HRSA 2HS5A 3E5XA 3F3XA 1ZREA 3JTGA 5ICFA 2HEOA 1QNTA 2EWNA 3FM3A 2STTA 3T0YA 2CYYA 4HX8A 1J5YA 1B9NA 3GEZA 1F1ZA 4QLCU 2F5CA 3WTVC 2UZKA 2H27A 3L9FA 1UCRA 1DUXC 4L5IA 2DK5A 1XDUA 2OA4A 3F21A 3WODF 2PLYA 3LFKA 3QAHA 3I4PA 3L00A 2IW5A 4EM0B 4O3MA 1KU3A 5HVQC 3F72A 2FBIA 3K1NA 2ZBKA 4AWXB 2FBHA 5LGNA 5E8GA 5ILSA 4KUMA 4XLNF 4IRHA 2ETHA 3IHUA 3KP7A 4M9ZA 3TOBA 4U7DA 2EB7A 2VC0A 1KQ0A 3DF8A 4KIBA 3WTTC 4ENJA 3IWZA 3DEUA 1FX7A 1PP8F 4KNYA 4BHBA 1OKRA 1U5TC 2XROA 4ESBA 3ELKA 1HSJA 3CO6C 3GW2A 3V8LA 2MBFA 2VBYA 3FWEA 4IVNA 5HS9A 1UB9A 2X4HA 5D4SA 5LHIA 3FMRA 2VONA 4UHTA 3P9KA 1SMTA 2JPCA 1Z7UA 4N0BA 4I09A 3G73A 1YW8A 4HF0A 4UXNA 3BJOA 5F1RA 4OIOF 5BQTA 3M8EA 1ZG3A 2QZ8A 4RGXA 2PFBA 3TDZC 2O03A 1T39A 4KIGA 3I5UA 3EUHA 3SHFA 2XV4S 1ZG5A 2KIUA 1W7PB 1XDSA 4R8HA 2YX4A 2K4JA 3LQRA 2LKPA 3F8BA 1R7JA 2VT2A 3F22A 3C3WA 3E6DA 1WQ2A 4I02A 3KEQA 1V3FA 1W7PD 1HXDA 2KRFA 2YX7A 4LJZF 3KETA 4LK0F 5L3DA 4LG0A 3WTZA 1ZLKA 2WV0A 1HSTA 2R7FA 1G3WA 3FZVA 1S29A 4UNOA 2RVCA 1YW9A 3ZMZA 1REPC 1YS7A 3BJAA 1FWZA 2RV8A 3ZMUA 2QBYA 5E1WA 1OYYA 3HTSB 1CF7A 2XVCA 2ZNYA 1ZH5A 1H9TA 4H0EA 3AAFA 1DPUA 1B9MA 2YPRA 3VFZA 1LJ9A 2Q8KA 2E7WA 1SFUA 4UV8A 2YSRA 1PDNC 4Y17A 1B1BA 2VT3A 4P5OA 2A5YB 1JE8A 1GXQA 2EA2A 4CDGA 2XASA 3R0JA 2KIFA 4ZYGA 3ZMDA 3ZQ7A 2CO5A 5FFXA 2K02A 2XRNA 3FHZA 4CZZA 3D0SA 2JSCA 2OBPA 4N9HA 3E6BA 4LG0B 3ZMVA 3BDDA 1HW5A 1BI3A 2V9VA 3P7NA 1UHWA 1ZAOA 2HFHA 4RAZA 1T6SA 1QQIA 2HKXA 5D8LB 1XSVA 3Q9SA 3HOSA 1R36A 4JQFA 4EM2A 1G4DA 5H20A 5LRSA 3GFIA 3QP5A 3HSEA 4A2UA 3QOPA 2EFOA 3RPUA 5K5QA 4QWQA 1HKTA 4GO1A 4GYGA 4OIPF 2GAUA 4OU0A 2CSOA 4Q4ZF 1FLIA 1MJ9A 5LRRA 3KZYA 4EV0A 4MNUA 4FT8A 3MZYA 4Q47A 1P4WA 1R23A 2DO7A 1FT9A 2HTSA 4G6QA 5DCFA 4PZJA 3RKYA 3SFZA 3I54A 1JHHA 4LLLA 3PFIA 4OIQF 2ISZA 1YIOA 2VBZA 1C0WA 4IHTA 3W6KB 5HDKA 4ENMA 1FOKA 1WSUA 1B6AA 2DFIA 2IT0A 3GO5A 2LSOA 4R1HA 4OINF 2H94A 1EH7A 1FP1D 1QBJA 4M6XA 4G9YA 4M9SA 2F5EA 4HV6A 4R79A 4ON0A 4K2EA 2XAJA 3KP2A 1FYMA 4WK8F 4HA8A 4ENKA 2FNPA 3GUDA 4I0BA 1YTYA 3E97A 3KP6A 3O3KA 4WXDA 4RB1A 1ZRFA 2M45A 1SD7A 2B0LA 4HZFA 2XAGA 4RS8A 2HQNA 2R7DA 2H6BA 2PJPA 1I27A 1LQ1A 4DQ2A 2MLKA 2VC1A 5ILVA 2EFPA 3CTAA 1YQAA 3TO6A 4I01A 2QWWA 5EEHA 3T5XA 1F5TA 3F6VA 1IW7F 3IKTA 2VBWA 4EGYA 2O0YA 2OZUA 1O7FA 2DQRA 3GWZA 1RUOA 2EV0A 4HYEA 4Q5SF 4L9VA 5L3CA 2ZMEB 3B73A 5HS7A 5TRDA 2UXNA 3TO9A 2K7LA 2LDUA 4NQWA 1USTA 1XCVA 2FSWA 4M6YA 3Q5FA 2Z5UA 3KP3A 2EFWA 3R6SA 5LHHA 3O2PE 5FO5A 5CVUA 4I7HA 3GX4X 4ETSA 4M74A 2OZ6A 2PN6A 1ZYRF 2G7HA 3E6MA 2VOPA 1MGTA 3BWGA 3HSRA 3WGIA 1IAWA 4RGUA 4P9FA 4CHUA 2DBBA 1CF7B 1JGSA 3GFLA 2JT1A 2RC4A 2NAZA 5E1XA 3VOEA 3R61A 1R1VA 4L5JA 3LSTA 2O61A 1IRFA 3HSFA 1SMYF 4LFUA 2GQQA 2FU4A 4KN7X 1VTNC 2KJBA 3G3ZA 5ICEA 1Z9CA 1S7OA 4A6EA 2J5OA 1UFMA 2JTVA 1WI9A 5J8FA 2DQLA 5LGUA 3KFWX 2G9WA 1G6NA 4BYYA 3CUQB 4EJVA 4ESFA 2W84A 1U3EM 4WXHA 1XGSA 4A0XA 2EA4A 2BYVE 3IWFA 4P9UA 1LEAA 3DKWA 3IC7A 5E1ZB 3TOAA 5J8CA 2QUFA 1LDJA 3E6CC 1XGMA 2VN2A 2KKOA 3FM5A 1HQCA 1F4KA 4U0WA 3F8MA 1QPMA 1U6GA 2W24A 3ULQB 2CFXA 2OQGA 2J5PA 3GFJA 4HDUA 2MH9A 3HYIA 3ZMTA 5HLGA 2FEZA 1YG2A 1SFXA 3FX3A 1GHCA 1GVJA 4YG2F 4FX0A 2QQ9A 1ZGAA 3EDPA 4EJTA 4M72A 1IN4A 2D1HA 1XGOA 1FBUA 3GFMA 1R1TA 2V1DA 1T98A 2P4WA 2JPBA 5TJJA 2ZCWA 4KMUX 4IXAA 1BI2A 4O5VA 5J6XA 2GIVA 3KLOA 5D5UB 4KYWA 3F8CA 1I1SA 3ABUA 1P2FA 2KIMA 4AIHA 3DFGA 1I5ZA 3R0AA 5LHGA 3HRMA 2MA3A 5CYVA 3ZP5A 2VXZA 5K5RA 1R00A 5CVJA 4UV9A 4WCGA 4Q48A 2L02A 3EYIA 2A3SA 4ASNA 2GA1A 3OV8A 4EM1A 3B02A 2PEXA 2ZJ2A 3CUQC 3PQKA 1AOYA 3MQ0A 3EETA 1FBSA 2DU9A 4HDVA 5K5OA 3EYYA 2RNJA 5ICCA 2MH2A 3KE2A 4E70A 1TQPA 3F23A 2HYFA 4RGRA 4XRFA 2K4BA 3HRUA 1TNSA 3GZ6A 5ERIA 1T2KA 3I53A 3V7SA 2WC2A 2F5DA 2OAZA 3E3VA 1W5SA 3JAMZ 1K79A 5LEJA 2ZO4A 3S2WA 2R3SA 5ILUA 1Z05A 2W85A 5DUIA 1OYWA 2ESNA 3QPHA 3IKVA 2O8XA 3HTUA 4B09A 3HIFA 1IXRC 3JSOA 1B59A 1NHAA 1RUNA 2PG4A 2V1UA 5FD6A 3J80Z 5LGTA 1S3JA 1ODDA 3LAPA 2HKOA 4A6DA 1ONVA 2DPDA 3DQVC 4OIRF 3V8KA 1J0RA 3ROUA 3CO7C 2ZMEA 5IT9K 4UVCA 3CUOA 4A0YA 2EJRA 1R58A 2GA2A 3CUQA 1EH8A 1TTYA 3MCZA 4LLNA 1KQ8A 2BE5F 5L3FA 1P92A 5K1YA 2ZFWA 4BHPA 4IRGA 1U2WA 4MTDA 1UHMA 2STWA 1MJBA 1AWCA 1O3TA 1O57A 1R5HA 2H6CA 3ISPA 3Q9VA 4HX7A 5IT9Z 2LF7A 1XN7A 4ZZLA 1W5TA 4GXOA 2K27A 1Z6TA 4HF1A 1ZRCA 5A2QZ 1XB4A 3U1DA 5BOXA 4N9IA 4XSXF 5D4RA 2HTJA 2HGCA 4CICA 2IA2A 1QO0D 4WXCA 1Z1DA 3MWMA 1KU7A 2A68F 1H0MA 3VB2A 1KU9A 3LA2A 2D45A 4CXFA 2DPUA 4EVIA 1SD5A 4G7HF 4LMYA 2XKOA 3PQJA 3ZN1A 1BIBA 3QPTA 3O6BB 4UVAA 2A6EF 4KDPA 1R22A 4HF2A 2P7VB 4RGSA 3QU3A 2ZXJA 5KK1A 1X3UA 2DT5A 2QVOA 4EJWA 3QP6A 3RI4A 4ZYDA 3BP8A 2FRHA 1T38A 5H6QA 4KMFA 1D8KA 3LA7A 2W25A 3GLXA 3N4MA 4FHTA 2XGXA 5BS6A 1XGNA 2XHKA 3QRFF 4YFKF 1TW2A 2EK5A 2IPQX 1OPCA 1I6XA 1L0OC 1USSA 3H3UA 2CGPA 2NNNA 2BV6A 5F6FA 2ZNZA 4PGHA 1MD0A 2XAFA 1V4RA 5ED4A 2QBYB
chains in the Genus database with same CATH superfamily
3VYTB 2O6GE 3K1PA 4HAMA 3BG7A 4I76A 4GDFA 3RQIA 4DNCA 2PQ8A 5HLTA 5CVVA 5E17F 1ETVA 4RB0A 3IL2A 3V7CA 3DEWA 4YFXF 2PMUA 2VOOA 2EV5A 5J1UA 2GXGA 3OYGA 4C3JJ 2QQ8A 3FXKA 4M9XA 1IJWC 2Y0MA 4HW0A 2A6HF 2R5YB 3REOA 1S5LC 3OY9A 1Y56A 2GOMA 2R7QA 4G6TB 4AYBN 2IGMA 4G8XA 5IP9J 2P5LC 1ZTRA 3HUGB 5ICGA 2OCCH 1U8BA 1JI8A 4IHXA 5GTHC 1W5CC 4CCOA 2CV0A 2JQ7A 2AO9A 4L9NA 2LMDA 4W97A 2X85A 4LG3A 1SFEA 2UXXA 2XB5A 4A5NA 5J4YA 1MSEC 3U21A 1A36A 2V6CA 2CUJA 4BH9A 4RB2C 4RB3C 4B3AA 3WHBA 3WG9A 4G7OF 2DODA 2X1EA 2L7FP 2CJJA 2L3DA 4XN3A 1OCPA 4XRMA 1Y8QB 3E5UA 3H3VK 3LA3A 2EV6A 4BNCA 1TLHB 3FXQA 1J9IA 1ENHA 5IP7J 1Q1HA 3OSGA 1WJCA 5F27A 5DV5A 3HB9A 3BTCA 1KYZA 3KP5A 3HRTA 4B8XA 3RZDJ 1XSXA 1IN7A 1ZN2A 4G94A 3MFKA 1PP7U 1W36C 4U88A 5BMZA 1K4SA 1IRZA 3JSPA 2GZWA 3ZQLA 5CVIA 5LBQA 1FSHA 1OFCX 2Z3YA 3WTYC 1JUMA 2OU2A 3X2QH 4PGGA 3PL8A 1VQMI 2X0LA 1PJRA 5E20A 4LIVA 3A1YA 5IT3A 1OCOH 5FKMA 1VQLI 2DMNA 2DMPA 4YIIA 1PUEE 4QPOA 3CCJI 1K78A 1E3PA 3ZR8X 4CYDA 2K9LA 2M4GA 3HHHA 4I99C 4RLQA 1G3YA 5HLHA 3AG2H 3I64A 4LGWA 1UAAA 2VODA 1R9TJ 4GCVA 2HYGD 1APLC 3BCAA 2RQPA 2NRAC 5BPDA 4PDKA 2IS2A 4PJ0C 2GBYA 1F36A 2CU7A 1W0UA 2NYXA 5AONA 2WAEA 3ZMSA 2B9SA 1OLTA 2QQAA 1MBJA 1MZBA 1X1AA 2DT7B 3K1MA 4X1EA 1HW1A 3WTXC 4KFCA 2DAOA 5JLXA 4KICA 2E35A 2KIQA 3K4JA 1B8IA 4MEXF 1QRYA 3K69A 1WCMJ 4KITB 4A5MA 3NEUA 4HOBA 1JHFA 2R4GA 4ANJA 2EIMH 4LD5A 2A6TA 2RGVA 4BL0B 1Z0XA 4I6ZA 1DU6A 1RI7A 2WAQN 3C18A 3COAC 4JYKA 1QGPA 2VUMJ 3FIWA 1OMIA 2DDAA 1WWXA 1VFCA 5J1RA 3OYAA 1YITI 1MKMA 1E0EA 3KEYA 1TQMA 5HS8A 3GYHX 1D5VA 5FFZA 1FSEA 3JAMK 3GVAA 3KCCA 1G2HA 3BJ6A 4ZTFA 2XIGA 1FYLA 3ZN0A 1JXSA 3GTGJ 1QVUA 1TP4A 3KP4A 4IO9F 2VJ4A 2V1XA 3PM1A 3TKYA 5K7FA 2HQRA 4ITVA 3P5JA 5CLSA 4BUPA 1D3YA 3UNGC 4IHYA 3DTKA 5LFAA 1OCTC 3IH3A 1P6RA 4DBRA 3VEPA 2HOSA 1Y1WJ 4Z6YA 4D9JA 2IBDA 3M9AA 5AIQA 3KYDB 4XSZF 4RAYA 3QWLA 3K7AJ 4HV5A 3P9CA 2HDCA 1RESA 4II2A 1MDMA 1B72B 2XB0X 2RN7A 4MIMA 2Z9OA 2KDOA 4C9YA 4D7NA 1WI3A 4XORA 3G1OA 4A3GJ 2TDXA 3WE2A 1SD6A 4XBFA 4DYCA 1MBKA 3I56I 2PI0A 1X1DA 2NS0A 4XLFA 3SQNA 1NG6A 1QZYA 3EQLF 1HOMA 2EFNA 1ZLJA 3H3ZA 2YU3A 2XPUA 2P8TA 4AIDA 3F6OA 1T56A 2VE9A 4CGZA 4KIFA 2BBYA 1IUFA 5HLIA 2ELJA 3LAJA 2D2WA 5HNHA 2XGEA 4IJAA 4RAGA 2NOJB 3C7JA 3HUGA 1J2XA 4F55A 2WWYA 2IS1A 4WX9A 2FOWA 1BBYA 1IRGA 1MJAA 4RBOA 1O3RA 4NHJA 5CVRA 3I55I 3VSKA 1Z91A 1T0FA 2F4IA 3M1CA 1ETYA 2M0MA 3S14J 1GVDA 1QZZA 1IN6A 3RPQA 4U7BA 1IC8A 3CP2A 3GXOA 2GIZA 4ESJA 2LOOA 4BY7J 2V79A 2KT0A 4RAFA 5JR3A 1XCBA 1O4XA 4S05A 1BN5A 3NWSA 1IZ1A 2G7UA 2DLLA 2ECCA 2DMUA 4JBAA 1U5TB 1HW2A 2CQNA 2E7XA 4NDLA 3JW4A 1WZ2A 2QYOA 4U0VA 4A3MJ 2ICWG 1FP2A 5DUKA 3I71A 4BQAA 1BW5A 3F8NA 2AHQA 5IY5H 4YELA 1FYKA 1J59A 3LQQA 3DTEA 2E36A 3GLLA 5FGMA 4YFNF 4FTHA 4CO8A 3I59A 4UUSB 3AL0C 1IXCA 3MKYB 3AFHA 4KT6A 1FOYA 1FZPB 2LBFA 1J75A 1D1CA 3ZCOA 3K4BA 1KGSA 2Z16A 2K86A 3V4GA 3J7AO 5LLQA 2E1NA 1OR7A 2JK3A 1KU2A 3ABMH 2LKSA 3RYPA 1A31A 2LY9A 1RKTA 5B66C 3CMAI 2ID6A 2OQRA 3SEZA 3ML6A 2ZKZA 3ASNH 1FBQA 2G0EA 1U78A 1DDNA 1D8JA 3OOPA 4IKFA 4L0ZB 2ADUA 3BR2A 4F92B 4LB5A 1HA8A 3V42A 2R7SA 1N25A 3AKZA 2XAQA 1G3TA 2QENA 3MAJA 4MLOA 3VPRA 1A04A 1HKQA 3FXOA 3HGGA 2JA8J 5JHUA 4YIFA 3SZPA 1X2NA 1WJ5A 3I59B 4UUSA 4EGZA 4CCMA 2HWVA 3GCMA 2EH3A 4AVZA 1SD4A 2UWMA 3OYFA 1E17A 5GAHJ 1FC3A 4MTEA 4IRIA 4V2FA 3JRFA 3LL7A 2IGOA 4GGGA 3FKIJ 2PMHA 2EFQA 1H9GA 4IPAA 2LY1A 3BROA 4X0GA 4BXUA 2RNGA 3IV5A 1JJ8C 5J40A 4UVBA 3TP3A 4D7MA 1LDDA 1EV7A 4WF2A 5E8IA 3L1PA 2P5KA 3HOTA 3H0GJ 4BE1A 3OR1C 4MEYF 4Y13A 3R60A 1KQ9A 3K4KA 4XN0A 2EQRA 4XRSG 3G71I 2VPRA 3H92A 2DA6A 1LFUP 3GBGA 2E2IJ 2Z99A 1DU0A 3JTHA 4HEA2 2VE8A 3CDHA 1U5TA 2M87A 3LFUA 5AIPA 5LEKA 3B6AA 2BGCA 2K9QA 3TO7A 4TV7A 4L18B 4G7ZF 2CG4A 3HZJA 5JVGF 1B4AA 3J7YJ 4C2UA 3HDDA 1ETOA 3CC2I 3SEQA 3V7RA 4BKXA 3S1MJ 1SAXA 4NUBA 1GXPA 3TL4X 4O6JA 4P55A 2EIJH 4CSWA 1W4MA 1JTYA 2XKPA 2L54A 2KISA 1ZRDA 5EGOA 2RKHA 2FX0A 2COMA 5IPAA 1W36D 2P6TA 3IAS2 3S93A 3W6JB 1XTAA 2MLGA 4EJOA 1Y0NA 1WPKA 2BZTA 5C44J 1YO5C 1LVAA 5GPCA 4M3GA 3DPTA 3ZQCA 3S16J 4LB6B 1ZHFA 3ECOA 4BJ6C 2H1LA 2Y9YA 4KA4A 3DBRB 1B8IB 3P9IA 3RKXA 2LP0A 2FJ1A 3WTSC 5DTDA 4HBLA 1ZK8A 1Y39A 3CC4I 3PJRA 3MEXA 2DTRA 2V7FA 2CQKA 3Q0UA 5H6RA 5HOOA 3IP4B 2ZJPF 2FMLA 1IG7A 3NRVA 2NNYA 1U9OA 3L2CA 1L3LA 3T8TA 1BC7C 1STZA 3ZOBA 3CJNA 4HNVA 1FNNA 4PCQA 2LREA 2L01A 3HJEA 3VWBA 4IHSA 4KT5C 4KN4X 1TWFJ 1U8RA 2ZMEC 1K78B 2P7CB 1I1GA 1ORKA 3SZGA 1R6RA 3PO2J 2XAUA 4A3LJ 2Q2EA 2L9SA 2R7VA 3DBLB 5D5XB 3WGGA 1BJAA 5L3GA 1XSDA 2VKVA 1YLFA 3RSNA 1DGRM 1EA3A 1O7LA 1K7AA 4AD9A 3CDIA 2M5WA 2Q0OA 2H8WA 4OAZA 1GT0C 2LVSA 3PNYA 1YRNB 1ON1A 4BQQA 3BR5A 2QLZA 2WTEA 5D5WB 1MIJA 4ZZDA 1LKXA 2N8GA 2FA5A 1ULYA 3BZCA 3CMMA 2HZTA 1IV8A 2R7OA 4L5EA 5E18F 3M7GA 4BACA 3AL0B 2L7ZA 4II3A 3KEOA 2L7KA 5FLVA 1MBGA 1BI0A 3LOCA 4MHGA 2HNHA 4I98B 3DKYA 1VQ8I 5K7HA 2XSDC 1OISA 2CQXA 2X6YA 2M7BA 3PSIA 5F64A 2JMWA 4BDZA 2AS5F 3WG7H 2DI3A 1MDMB 1TBXA 4ZYEA 5L3EA 1X58A 5KVRA 2VBXA 1RKWA 5HNFA 1LB2A 3FMQA 4CYCA 1IF1A 2M8EA 2DA1A 2O3FA 1OCRH 1A6IA 3IH2A 4UUVA 2R7TA 2FBKA 4AU7A 3RIRA 4P1WA 4XLCA 2VIXA 2XAHA 1YFHA 3CJQB 4M3EA 4AIJA 1XC5A 2HI3A 3ZQHA 5C3EJ 2ME6A 2OC6A 4XOPA 2CS3A 4JOMA 3S8PA 4RM3A 4BAYA 2QM3A 2CV1A 3BR1A 4NB5A 4S04A 2F5VA 2ISYA 3FXRA 1SEUA 2FQ3A 3GZ5A 4L9TA 5J3LA 2M30A 2EZLA 1SAUA 4CCNA 2DFFA 3BG5A 1PYVA 2P5VA 3N97A 1MMAA 5GP9A 4ENNA 1ZGWA 5B5EC 4E7SA 4BXXJ 5JVTA 1SC7A 1Z3XA 4Y15A 3RYRA 1JKRC 3K9TA 5L3BA 3A4CA 4I2OA 2VKDA 1XMAA 4EJUA 2PBIA 1BA5A 2O9LA 3QU6A 2ACJA 4FX4A 5M5WJ 3GTLJ 2FMYA 1QPIA 5D5VB 2XC7A 1JKOC 1WKMA 3OOUA 1P7IA 4M73A 2BW3A 5BPIA 2HR3A 5DD8A 3CC7I 3SYTA 2YR2A 1AHDP 4OMYA 3Q0VA 1S72I 1FY7A 4XOTA 4BY1J 4Y7NJ 5F0FA 4DIQA 3BR6A 1X4PA 4BJTA 4IF4A 3DU6A 4IHVA 2JA2A 1R49A 4PSXA 1HLVA 2HU9A 2LFBA 3CLQA 1IXSB 3RDIA 1S6LA 2X6WA 3BPXA 4Z2YA 1J7KA 1ITYA 1MW7A 2WAQA 1D0ZA 3FMSA 4D0PA 2ELHA 3MKLA 2L4MA 2X1CA 4RA2A 4JX5A 3MD2A 2DN0A 3BC8A 2WA0A 2NOGA 3L09A 3OYBA 2ZSIB 4BHCA 3HHGA 3GF2A 1QU3A 4LK1F 1X3WB 3JCUC 1K61A 2C6YA 4IQ4A 1YJ9I 4HX4A 4V19K 3TGNA 3BY6A 2DW4A 1F9NA 5DCMA 3K4NA 4IX7A 1CGPA 3A2KA 1XMXA 2H09A 3A01B 3TDUC 4WWCA 5DEQA 5D6FA 3WU2C 4CYCB 3CLOA 5KAIC 2AQFA 1P4AA 2A61A 4E6KG 2P81A 5JFRA 3CCUI 2FOKA 3WU0A 3ERED 3BOQA 3IRRA 5JHFA 2A07F 3OYNA 2ESHA 4I0AA 1YOVB 4L9JA 4JK1X 1TQIA 5EGOB 3RKWA 2LF8A 4EMSA 2NVTJ 3HOVJ 2DOEA 2WY8Q 1RZ4A 3HKZN 3I0TA 2LH9A 3PFYA 5EEGA 2KPMA 1IN5A 5FLXZ 2L2OA 2E1MC 3ABTA 5CJ9A 1FPQA 1HBXG 3WE3A 2FNAA 1BI1A 3TQNA 1LNWA 2DA5A 2X48A 3CF5F 1AU7A 4XNFA 1P7JA 1YHQI 2M34A 2FE3A 4MFEA 1VQ5I 3JRDA 1ZARA 1LUJB 3K2AA 1E2XA 1R5ID 3IAM2 4Y33A 1TWGJ 3OWTA 1K6OA 2LC2A 4NQWB 4XKWA 1AA7A 2HOEA 3OIQA 1OYIA 1MNDA 1JT0A 3F8FA 3LSPA 2D1VA 5F08A 3DV8A 2EILH 2L4AA 2VKHA 1LEBA 2Y31A 3KYLA 5HDGA 1EH6A 2QSGX 2NS8A 2F5FA 3BG6A 5DDGA 2KLOA 3JRHA 2IA1A 3DEEA 2HVSA 1R5GA 1RNLA 1SANA 2VQGA 2W57A 5F0CA 3FF5A 2F48A 4B48A 3R4KA 2Z33A 1LDKB 4HLYA 2OPTA 5CPRB 3WTUC 4HQEA 1TT0A 1WJEA 1WGXA 4XICA 3M8FA 5FLXK 3WU1B 1BM9A 3VODA 1I39A 3LSMA 1UHSA 2IP2A 4A0ZA 3MZHA 4P96A 2LNBA 2VJ5A 2AXLA 1VZ0A 3BG9A 4HLXA 4M3FA 5JI6A 4BU2A 6PAXA 2OD5A 4FETA 4M3BA 2JA5J 1VI0A 1BIAA 1YX5A 4ZYHA 2XDVA 3E5QA 2P6SA 1IDZA 2OF7A 2EBIA 1T33A 3J80K 2TRTA 4OMZA 2BOLA 1KYWA 5JLWA 1ZGJA 1BC8C 1DP7P 3S1NJ 3GTJJ 2QKLB 4BQOA 1JUSA 1O3SA 4AM3A 3RJPA 1OR7C 2I8DA 3SXYA 3K0LA 2BEOA 1E3OC 3CCEI 1YYVA 2IJLA 1UG0A 1EJ9A 1O3QA 4MQVA 1R1UA 1ON2A 1T0FC 5KHDA 5D6EA 3F0CA 1Y0UA 1S8NA 2CW0F 2UV1A 5IYBJ 3DXJF 1HKSA 4LIUA 4XMYA 1V54H 2ID3A 2JRMA 2VXDA 5EYRA 4ZDOA 4UY8I 2L0KA 5DD4A 3ZGKA 4BE0A 1BOAA 4L0YB 3U9GA 3OYCA 3M3YJ 3CD6I 1ZG1A 4M71A 1H88C 4KJZA 4DZPA 3J81Z 2KZVA 4AVPA 1OCZH 3S1RJ 2NVUB 1V5FA 2ZJQF 1Z7LA 3D5LA 1SVOA 2Y48A 3PO3J 2W4SA 4F7ZA 1WJFA 3HC7A 3JREA 2KHMA 3BPVA 5D8KB 1M1EB 1XPXA 1WH5A 1IN8A 1VQ9I 3K70C 1QHGA 3ERMA 3ECHA 1K4TA 2X51A 3N05A 4B47A 2H8RA 2CWEA 5EEAA 2ZFUA 5FKLA 1W7PA 2JZYA 4ZH4F 1YE9A 2KJCA 1ZELA 4IHWA 2V1NA 4PJJA 5CQGA 4DOZA 2IVMA 5FRMA 3LSKA 3QODA 5FJ8J 1XMKA 3DP7A 3DPLC 1X4OA 3K4MA 1P4XA 3M1EA 3W2AA 4E7LA 3OYJA 1G3SA 4AIKA 4MGRA 4GYIA 1D0YA 2ZJRF 4D1QA 2M1BA 4MQ9F 3V8JA 1JKQC 1JGGA 4XLPF 4D5FA 2XUBA 2JSPA 4IOCF 2FXAA 3K4LA 4ZJZA 1YW7A 3CJRB 2MC3A 2IA0A 3ZQIA 1TW3A 3J81K 3S2HJ 3PUBA 1IUYA 2BXZA 3I58A 5FB2A 3IRQA 1RIOH 3SZTA 4CUGA 1D1AA 3T8RA 4HQMA 5GTIC 1NTCA 5DYMA 1KA8A 4A12A 4A93J 3ZPLA 3QYEA 3FXUA 2CW8A 1VQ7I 1WRJA 5M5XJ 2HDWA 5DCMB 3WGHA 3G6EI 1XX5A 5M3MJ 3NQOA 3BZ6A 3HOZJ 3LWFA 1S7AA 3K2ZA 3KZZA 1YS6A 3FISA 3Q0WA 3A0HC 3E0JB 2BW3B 2IRFG 2F2EA 3MKWB 1X1PA 1NK2P 2E5ZA 3L7WA 4EQQA 2NVYJ 3T1BA 2DK8A 3CCMI 2E5NA 3CCQI 1G59A 2L5QA 1DPRA 4HRIA 2GXBA 5B1AH 1Z6RA 3NAUA 3A01A 4A3JJ 2R0QC 5GAEJ 4G6DA 2QQBA 3C2BA 2JRTA 1BR1A 5HDNA 2A69F 1D0XA 5FD5A 1JT6A 2FF4A 2MFZA 4Y52J 5A2QK 1HDPA 2GWRA 2MD5A 2QF7A 1GV2A 2B7EA 2BHZA 5FKOA 3LSRA 3OS2A 1GV5A 4BXFA 3FKJA 4U0YA 3WTWC 2RDPA 1JUPA 4OOIA 3RTRA 2E1CA 4LLGF 2WB1N 2Y75A 3H5NA 4A3IJ 3U2RA 3C1DA 1TNTA 1XD7A 3KLNA 3HRSA 3W6VA 3L2RA 3F9KA 2HS5A 2UUZA 3E5XA 3F3XA 1ZREA 3JTGA 5ICFA 2HEOA 4C3IJ 4B4CA 4C3HJ 3K6GA 1QNTA 2EWNA 3FM3A 4C30A 3T0YA 2CYYA 2STTA 2KFDA 3VYUB 1PUFA 2MG4A 4BE2A 4HX8A 3Q3SA 4F52A 2DCEA 3OIPA 3TEDA 2M9HA 1J5YA 1B9NA 3GEZA 4J01A 1F1ZA 2FD5A 2MABA 4QLCU 3OS0A 2P0WA 1ETQA 4H4KC 4C2TA 2F5CA 3WTVC 2UZKA 2H27A 3FK7A 2R7XA 2JN6A 4A3EJ 3BTIA 2CUEA 3L9FA 4MO7A 1ZR2A 1UCRA 3RPUD 1DUXC 4L5IA 2DYRH 2DK5A 3MVPA 1XDUA 1KONA 1WJBA 3AG3H 2CUZA 1PVEA 2OA4A 3F21A 3WODF 2WAFA 3M4OJ 2JA7J 2PLYA 1ETWA 5TGTA 5IP6A 3LFKA 3QAHA 2LBFB 3I4PA 3L00A 3H0DA 2IW5A 4EM0B 4O3MA 4YEJA 2OJED 1KU3A 5HVQC 3F72A 2FBIA 2IXSA 2Y0SN 3LNQA 4X6AJ 3K1NA 2ZBKA 4AWXB 2EINH 2FBHA 2VASA 5LGNA 5E8GA 5ILSA 2K5CA 4KUMA 1I3QJ 1H8AC 4XLNF 4IRHA 2IGKA 2NVXJ 3W3CA 2ETHA 3IHUA 3KP7A 4M9ZA 4XKVA 3TOBA 1IGNA 3FDYA 4U7DA 2EB7A 2VC0A 5EDNA 2ZB9A 2W1OA 1KQ0A 3DF8A 4KIBA 1YRNA 2QGUA 1SFOJ 4UB8C 1GLNA 3EPZA 2D5VA 1YJWI 1FMWA 3WTTC 4ENJA 3IWZA 3DEUA 2GM4A 1FX7A 3BCBA 1PP8F 4KNYA 4BHBA 4E7HA 1OKRA 1U5TC 2XROA 4NC7A 4V2GA 4ESBA 1V55H 1FOWA 2VJJA 3ELKA 1HSJA 3LSGA 1T95A 3CO6C 2Y0SA 4NBQA 3GW2A 3V8LA 4A69C 2MBFA 2VBYA 3FWEA 2E60A 3SJMA 4IVNA 2OTLI 5HS9A 1UB9A 2X4HA 1WJDA 2QEXI 5D4SA 5LHIA 3FMRA 5B3SH 2VONA 4UHTA 3P9KA 1SMTA 2JPCA 4DGWB 2L9NA 1Z7UA 4QSHA 1YI2I 4N0BA 4BEHA 4I09A 1B72A 3ASOH 4Y4RA 2DOAA 1YW8A 3G73A 4HF0A 4UXNA 3BJOA 5F1RA 4OIOF 5BQTA 3M8JA 3M8EA 1ZG3A 3CCRI 2QZ8A 4RGXA 2PFBA 3TDZC 2O03A 1T39A 4KIGA 5KAFC 1Z67A 4FCYA 3U1KA 3I5UA 3EUHA 3SHFA 3J7ZI 2XV4S 3A0BC 1ZG5A 2KIUA 4XLEA 1W7PB 1ZQ3P 1XDSA 4R8HA 2YX4A 2K4JA 3LQRA 1IRXA 2LKPA 3F8BA 1R7JA 2VT2A 3F22A 4UUTA 3C3WA 3E6DA 1WQ2A 4I02A 3KEQA 1KZHA 1V3FA 1W7PD 1HXDA 2KRFA 4QPQA 2YX7A 4PJLA 2TCTA 3RKQA 4LJZF 1X19A 1FEXA 3OSFA 2WB1A 3KETA 2X6OA 4XRSA 5J47A 2JUGA 2Y9ZA 4LK0F 5L3DA 3FHNA 4LG0A 3WTZA 2A5WA 1ZLKA 1MMDA 2ZC2A 2WV0A 1HSTA 1X2MA 2R7FA 1RRJA 1G3WA 1GDTA 3FZVA 3DBHB 2LRDA 3H35A 1S29A 5EJCA 3CQZJ 4UNOA 2RVCA 4BBSJ 1YW9A 3ZMZA 1REPC 1YS7A 1QZEA 3BJAA 1FWZA 2RV8A 3ZMUA 2QBYA 3DLLF 5E1WA 3A03A 1OYYA 4DW6A 2KL4A 2BVLA 3HTSB 2DJIA 1CF7A 2XVCA 2ZNYA 1ZH5A 1H9TA 4BQNA 4H0EA 4U87A 3AAFA 1QHHD 3L2QA 1DPUA 1B9MA 2YPRA 3GTMJ 2LR8A 3VFZA 3VSLA 4S0HB 3HGYA 3FXLA 1LJ9A 2Q8KA 2E7WA 1SFUA 2GXAA 4UV8A 1LFBA 5EF6A 3LSJA 4ZYAA 1TZLA 1TWHJ 2YSRA 2FUG2 1ACIA 1PDNC 1UJ8A 4Y17A 3NARA 1B1BA 3S32A 2VT3A 4P5OA 2IS4A 2A5YB 4BEHB 1JE8A 1GXQA 3ZRGA 2EA2A 4CDGA 2XASA 3R0JA 4BDYA 2KIFA 1HCRA 4ZYGA 3ZMDA 3ZQ7A 2HPIA 2CO5A 5FFXA 2K02A 2XRNA 1Q1VA 3FHZA 2I5UA 2RREA 3OYDA 1VQ6I 4CZZA 2ME0A 3D0SA 2JSCA 3DTIA 2CUFA 1MNMC 4JX6A 2OBPA 2HPMA 1GUUA 2M0CA 4N9HA 1FOXA 4A3FJ 3SDGA 3E6BA 4IL6C 5C4JJ 4LG0B 3BTLA 4AUXA 2K9SA 4KISA 2M8GX 3ZMVA 3BDDA 1HW5A 1BI3A 3BQYA 2V9VA 4JP0A 1IO2A 4IQJA 4JX4A 1X3ZB 2OCEA 3DPUA 3P7NA 1UHWA 1RPWA 1ZAOA 1OQYA 3HG9A 3RCOA 4EATA 1R71A 2VQCA 1VNDA 2HFHA 4RAZA 3S3NA 1W1WE 1T6SA 1QQIA 1Z21A 2HKXA 1RR8C 3OL3A 1FMVA 2COBA 3H5AA 1BR4A 1XSVA 3VYRB 3Q9SA 5D8LB 5FRNA 2KRCA 3HOSA 1R36A 4RLFA 3LSIA 1D1BA 4JQFA 4EM2A 1G4DA 1HF0A 1CQTA 3D5SC 5H20A 5LRSA 3GFIA 1JJ6C 3QP5A 3HSEA 2DA2A 4A2UA 1IV6A 3QOPA 2EFOA 3RPUA 5IYCJ 5K5QA 4QWQA 3FBNB 1FTTA 3I3LA 1HKTA 2ECBA 2NVQJ 3HOWJ 1RR7A 4GO1A 3KIOA 4PJNA 2PJRA 3M07A 4GYGA 4OIPF 2GAUA 4OU0A 2CSOA 4Q4ZF 5CQEA 1FLIA 3TP0A 4E4HA 1MJ9A 1IDYA 4M6VA 3GTKJ 3VDXA 5LRRA 3KZYA 4ZTJA 2JVGA 2CRGA 4EV0A 4MNUA 2YU9J 4FT8A 4HPQA 1TL8A 1PUFB 1BOBA 3H9QA 2H1KA 3O8GA 2ZXWH 3G1LA 3MZYA 4Q47A 4ZDLA 3K10A 1FTZA 1P4WA 1R23A 5IYDJ 1I6HJ 1X1CA 2DO7A 4B1RA 1FT9A 2HTSA 4G6QA 2QKMB 4PZJA 5DCFA 3RKYA 3SFZA 1H89C 3I54A 1JHHA 4FASD 2XRLA 4XKBA 4LLLA 3PFIA 3EUKL 4OIQF 2ISZA 1YIOA 3IUOA 1RETA 2IEKA 2VBZA 1C0WA 4IHTA 3W6KB 2R7RA 2YS9A 5HDKA 5F04A 4ENMA 4BS9A 4DBQA 1FOKA 1WSUA 1B6AA 1HDDC 2DFIA 1MMSA 1V5GA 2IT0A 3GO5A 4BJ5C 4NC8A 3PUFA 2CW7A 2LSOA 4R1HA 2R7ZJ 5J4VA 2VQHA 4OINF 3D5RC 2VPLA 4A3KJ 2H94A 1EH7A 3B6CA 1FP1D 1QBJA 4M6XA 4XLAA 2M3AA 3GTPJ 4G9YA 4M9SA 2F5EA 5H2FC 4HV6A 4MFDA 4R79A 1F43A 1BL0A 2DOFA 2R5ZB 4E7ZA 2HVRA 4ON0A 5E79C 2K3FA 3FXJA 3BZKA 2DTZA 4K2EA 2XAJA 2Y69H 2OV7A 2KRHA 3KP2A 5F0HA 3W2VA 1FYMA 1E3HA 5FROA 4CCJA 2R5YA 4WK8F 4HA8A 4CCLA 5GAGJ 4ENKA 5LD2C 2LG4A 1T08B 2FNPA 3GUDA 4I0BA 1YTYA 3WHCA 2HDDA 4YRVA 1UG2A 3E97A 3S3MA 3KP6A 3CCYA 3O3KA 4WXDA 1SVMA 2VJIA 4RB1A 1ZRFA 4E7IA 2M45A 1SD7A 2OTJI 3DLAA 1Z3YA 1BR2A 2XGCA 5BNGA 2B0LA 4HZFA 4XONA 2QCOA 2M4KA 2XAGA 4RS8A 3OMYA 2V9PA 2HQNA 2R7DA 2H6BA 4LOCA 2PJPA 1OCCH 4CA0A 3QPLA 1I27A 4CH7A 1N77A 3BLYA 3KYCB 4NC6A 2CMPA 2E1OA 4DQ2A 1Y1VJ 1LQ1A 1QVTA 2MLKA 2VC1A 3ZXSA 1NK3P 4FE4A 2WBMA 2XF5A 3C2HA 5ILVA 2W82A 2EFPA 1U0JA 3CTAA 1YQAA 2JJ7A 5FKKA 3TO6A 1P9QC 2BXYA 3CMEI 3ABLH 2IAIA 1NG7A 4I01A 3D1NI 2MC4A 3OYMA 2QWWA 2NXNB 5EEHA 3T5XA 1F5TA 3L2WA 1U9NA 3F6VA 4D5CA 2BY2A 1IW7F 3L2UA 3IKTA 1Z77A 3KZIC 1WH7A 1MH3A 2VBWA 1MBFA 3KPHA 2LTPA 3I9V2 4EGYA 2O0YA 4HNUA 2OZUA 1O7FA 1NH3A 2HOAA 2DQRA 3GWZA 2W7NA 1ERDA 1RUOA 3KX2A 1TWAJ 3BG3A 1ZR4A 3CF2A 2EV0A 9ANTA 4HYEA 4Q5SF 1FJLA 4L9VA 5EG0B 3QQAA 3HOYJ 5L3CA 3S1QJ 2ZMEB 4G12A 4XL9A 1MMNA 1LE8A 3B73A 5HS7A 2LLKA 4QIWN 2E34A 5TRDA 5J1YA 3ZQQA 3E1SA 2CFOA 4XR6A 2PJRB 2UXNA 3TO9A 1R4NB 4RMNA 2K7LA 2LDUA 4NQWA 1USTA 1XCVA 2FSWA 1Y8RB 4M6YA 3VYSB 3Q5FA 3NWTA 2Z5UA 4HSRA 3KP3A 4XQFA 1LVKA 1K6YA 4XK4A 2EFWA 3R6SA 5M3FJ 1POGA 5LHHA 5M5YJ 3O2PE 4OAYA 5FO5A 2VLAA 4PJMA 3OYLA 5CVUA 3BR0A 4RM2A 3RZOJ 4I7HA 3GX4X 1K83J 4ETSA 4M74A 2L7MP 3BR3A 3HPHA 2OZ6A 3L2VA 4OWRB 2PN6A 3FXMA 1ZYRF 2G7HA 3E6MA 2E2JJ 2CV2A 2M7AA 3CMYA 5E3OA 1MGTA 2VOPA 2Z2SB 2EPFA 1MNEA 3BWGA 3HSRA 3WGIA 1IAWA 5K7ZA 1J09A 2Q1ZB 4RGUA 4P9FA 2O8KA 4CHUA 1X1BA 1YJNI 2DBBA 4B43A 5E3LA 1Y6IA 2Y30A 2JA6J 3CCLI 1CF7B 2PX9A 1JGSA 3GFLA 3W2WA 1ETXA 2JT1A 1N75A 2RC4A 1V5EA 2NAZA 2VKEA 5E1XA 3VOEA 1VQPI 1W0TA 2W00A 5B1BH 3R61A 1R1VA 4L5JA 5TISC 3LSTA 2O61A 1IRFA 2V9KA 1AKHB 3HSFA 4PFPA 1SMYF 2F4OB 2GQQA 4LFUA 2FU4A 2HZDA 4KN7X 1VTNC 2KJBA 3G3ZA 4ZC3A 1FIAA 2V6EA 3QPSA 5ICEA 4M3DA 1MMGA 1Z9CA 3I4NJ 1LFPA 1S7OA 2DMTA 4A6EA 2J5OA 1OJLA 1UFMA 2JTVA 2L9RA 1WI9A 5IOYA 5J8FA 2DQLA 5LGUA 3TW7A 4A3CJ 3KFWX 2QBYB 2G9WA 1G6NA 4BYYA 3CUQB 4EJVA 4A3BJ 4ESFA 2W84A 1U3EM 2KMUA 4WXHA 1XGSA 4A0XA 3JRIA 2EA4A 2BYVE 3IWFA 4P9UA 1LEAA 1BW6A 2IGNA 3DKWA 3IC7A 5E1ZB 4RDUA 4ABZA 1A6QA 3TOAA 3OYKA 5J8CA 3TMOA 2QUFA 1FIPA 2R92J 1LDJA 3E6CC 1XGMA 3MKZA 2VN2A 2KKOA 1WJAA 2XGDA 3FM5A 4FISA 1HQCA 3DKXA 1F4KA 4U0WA 3IH4A 3F8MA 1QPMA 1U6GA 2W24A 3CDLA 3ULQB 2CFXA 1S9HA 2IS6A 2OQGA 2J5PA 3C2GA 3GFJA 4HDUA 2DDBA 1EKEA 2MH9A 3HYIA 3ZMTA 4IZZA 5HLGA 2FEZA 1YG2A 1XG1A 3H5RA 3H9JA 1SFXA 3FX3A 1MBEA 1GHCA 2E71A 1GVJA 4YG2F 4FX0A 3GTOJ 2QQ9A 1ZGAA 3EDPA 4F3QA 4EJTA 4M72A 2HXIA 2MD0A 4PK4A 1TWCJ 3G4SI 1IN4A 2D1HA 4DYQA 2HOTA 1XGOA 3S15J 4HNTA 1FBUA 3GFMA 1R1TA 2V1DA 1T98A 2CQ7A 3QYFA 2P4WA 2JPBA 1UZCA 5HODA 3EUHC 5TJJA 3K70D 2ZCWA 1UELB 2DA4A 4KMUX 3UR3C 3CESA 5E3NA 3LSHA 3JRAA 1S7EA 4IXAA 1BI2A 4O5VA 5J6XA 2BY1A 2GIVA 3KLOA 5D5UB 4KYWA 5DM7F 2A05A 3F8CA 4HSTA 1I1SA 3ABUA 5IOZA 1P2FA 3UKGA 4F93B 2KIMA 3OS1A 1XS9A 3RQ4A 4AIHA 3DFGA 1I5ZA 3R0AA 1VQKI 1EF4A 1WHUA 1MBHA 5LHGA 1VQOI 4C2MJ 3HRMA 4N4OB 1UMQA 2MA3A 5CYVA 1G8XA 1SVLA 2I10A 3ZQFA 3PNTA 1DGWY 2K40A 4FQGA 3ZP5A 3HM5A 2K9NA 3A02A 2X6XA 2KZGA 2VXZA 2QA4I 1D5YA 5K5RA 1R00A 5CVJA 4UV9A 1N78A 4XKCA 4WCGA 1VQ4I 4Q48A 2L02A 2DJNA 5FLMJ 3JR9A 3EYIA 2A3SA 2F4MB 1MH4A 4ASNA 3S17J 2GA1A 2VI6A 3OV8A 4EM1A 2V26A 3B02A 4B44A 1I3AA 2HQAA 2PEXA 5FKNA 2ZJ2A 3CUQC 3PQKA 3H1CA 3SDBA 1AOYA 3MQ0A 3TBIA 3EETA 1LE8B 1FBSA 2DU9A 1RC9A 2PMZN 3EYYA 2BY0A 5K5OA 3CCSI 2RNJA 5ICCA 4HDVA 1LPQA 3HBLA 3PIPF 3PIOF 2MH2A 3KE2A 2OUMA 2XF7A 4E70A 1JTXA 2BHYA 1TQPA 2FQ4A 2Z1DA 3F23A 2HYFA 2K3PA 3ABKH 4RGRA 4XRFA 4BBRJ 3HOXJ 3DCFA 1MSFC 3I4MJ 2XSJC 2K4BA 1DP3A 2DFHA 3HRUA 2LD5A 2R93J 4J00A 1TNSA 3ESWB 3G2BA 3GZ6A 4PFOA 2R7WA 5ERIA 1T2KA 2JVHA 4IOAF 3EUAA 3I53A 1TC3C 3V7SA 2WV1A 2WC2A 5DM6F 1YX3A 2F5DA 2OAZA 3E3VA 1WVRA 1W5SA 4YIRX 3JAMZ 1K79A 3FK6A 5LEJA 2GLOA 2DA7A 3BT9A 3OYIA 2ZO4A 1A35A 2B63J 3S2WA 2VL8A 2R3SA 4Y3OA 4CCKA 3E7LA 5ILUA 1Z05A 2W85A 5DUIA 1OYWA 2ESNA 3QPHA 4UB6C 2F6CA 3IKVA 2HQ5A 3JRGA 4AYBA 2O8XA 1WFXA 3HTUA 4B09A 3HIFA 1IXRC 3JSOA 2E1MB 1B59A 4B3XA 3OYEA 2W48A 1NHAA 1RUNA 2PG4A 3CP8A 2V1UA 2XPWA 2L9VA 2KQRA 5FD6A 3J80Z 5LGTA 1S3JA 3CZ6A 3MN2A 2QSFX 1ODDA 2LY2A 3QYBA 2KDZA 3LAPA 3FBIB 2HKOA 4A6DA 1ONVA 2DPDA 3H9GA 2EIKH 1ZKGA 3CCVI 3DQVC 4DJAA 4OIRF 3V8KA 2EZHA 2O5RA 1VQNI 1J0RA 3ROUA 2MYSA 3CO7C 2ZMEA 5IT9K 3PSFA 4UVCA 4GRIA 3CUOA 4A0YA 1ETKA 4N4NB 2EJRA 1R58A 3PNVA 2GA2A 3CUQA 1SFKA 1EH8A 2ZXIA 1TTYA 5C4XJ 3H36A 1AKHA 3MCZA 1DQUA 2DFEA 4LLNA 1KQ8A 2BE5F 4LITA 5L3FA 1P92A 2DA3A 5K1YA 2ZFWA 4BHPA 4J19A 3ONQA 4IRGA 1U2WA 4MTDA 1UHMA 5KCMA 2STWA 2GOXB 3J7AY 2WADA 1MJBA 1AWCA 1O3TA 1O57A 1R5HA 3JRBA 2H6CA 3HPGA 1BJZA 2QSHX 3ISPA 3HL2A 2Q2EB 2EZKA 3HXLA 3Q9VA 4HX7A 2JUCA 2BVMA 5IT9Z 4XM3A 4PUSA 4PSWA 2WY7Q 1HC8A 2LF7A 2K85A 2K9MA 2KP6A 1XN7A 3OYHA 4ZZLA 1TT5B 1T8IA 1W5TA 2AQEA 4GXOA 3BTJA 1R4MB 2K27A 3TW6A 1Z6TA 2CH0A 2MW8A 2YUSA 5KNLA 4HF1A 1ZRCA 5A2QZ 1XB4A 4FE7A 3U1DA 2JWTA 2VQLA 3S2DJ 4IEJA 2HXOA 4HG2A 4ZDPA 5BOXA 2EZIA 4N9IA 4XSXF 5D4RA 5EZHA 3OL4A 2HTJA 2DMQA 3S3OA 2HGCA 4DYRA 2X9DA 2LYCA 2IA2A 2XPVA 4CICA 5E3MA 3GMEA 2R7UA 3HOUJ 1QO0D 4WXCA 1Z1DA 2DT6A 3AG4H 2M2EA 3BQZA 3MWMA 3SFIA 1KU7A 2A68F 1H0MA 3VB2A 3DWLE 5EG0A 3LMMA 2RAEA 1KU9A 3LA2A 1I50J 2HYJA 3MZ8A 2D45A 2R5ZA 4CXFA 2XF6A 2DPUA 4EVIA 1SD5A 4XLHA 4G7HF 4LMYA 2XKOA 3PQJA 3ZN1A 1BIBA 3DU5A 3O6BB 2VB6A 3QPTA 3GZNB 4BGDA 3AG1H 4GFBA 4UVAA 2A6EF 2E19A 1YIJI 4KDPA 3OIOA 4A3DJ 1R22A 4HF2A 2P7VB 4XIDA 4RGSA 3OR2C 3QU3A 2Y2ZA 2ZXJA 3HKZA 5KK1A 4W1UA 3ZQGA 1JKPC 3G1MA 1VF9A 1X3UA 2DT5A 2QVOA 4AC0A 4F91B 5DS9A 5EZGA 3MMYB 4EJWA 3QP6A 4ZYDA 2AXTC 3BP8A 3RI4A 5GPAA 2HVQA 2FRHA 1T38A 5CKTA 2ZXHA 1QA6A 2RQQA 5H6QA 2DXIA 2LK2A 2DYSH 4KMFA 1D8KA 2LKXA 3LA7A 2CQQA 2W25A 5F1JA 3GLXA 4QTRA 3N4MA 4DZJA 4FHTA 2XGXA 2E2HJ 2MSYA 5BS6A 1XGNA 2XHKA 3QRFF 4CZCA 4YFKF 2NS7A 3CJTB 4E7KA 3HEFA 1TW2A 2BY3A 4E7JA 5GADJ 2EK5A 2IPQX 1OPCA 3JRCA 1I6XA 1L0OC 3K4CA 2ZSHB 2V4JC 1USSA 3H3UA 3O8HA 2PMZA 2X1DA 2ELKA 2NNNA 2MGQA 2CGPA 2BV6A 4NNJA 2O7OA 3QOEA 5F6FA 2ZNZA 4PGHA 1MD0A 2XAFA 1A5JA 1V4RA 3GTQJ 5ED4A 4EEFG
chains in the Genus database with same CATH topology
2O6GE 3K1PA 4HAMA 4DNCA 2PQ8A 5E17F 5CVVA 4RB0A 3IL2A 3V7CA 4YFXF 2PMUA 2VOOA 2EV5A 2GXGA 4M9XA 2Y0MA 4HW0A 2A6HF 3REOA 4G8XA 2P5LC 5ICGA 4L9NA 1SFEA 2UXXA 4A5NA 2V6CA 4BH9A 4RB2C 4RB3C 3WG9A 4G7OF 2L3DA 3E5UA 3LA3A 2EV6A 4BNCA 1TLHB 3FXQA 1J9IA 1Q1HA 5DV5A 1KYZA 3KP5A 3HRTA 4B8XA 1XSXA 1IN7A 1ZN2A 4G94A 3MFKA 1PP7U 4U88A 5BMZA 3JSPA 2GZWA 5CVIA 5LBQA 1FSHA 2Z3YA 3WTYC 2OU2A 4PGGA 2X0LA 5E20A 5IT3A 4YIIA 1PUEE 1K78A 4CYDA 3HHHA 5HLHA 1G3YA 2VODA 3I64A 4LGWA 4GCVA 2HYGD 2RQPA 2NRAC 5BPDA 4PDKA 2NYXA 5AONA 3ZMSA 2QQAA 1MZBA 3K1MA 4KFCA 1HW1A 3WTXC 2DAOA 4KICA 4MEXF 3K69A 4A5MA 3NEUA 4HOBA 1JHFA 4LD5A 2RGVA 1RI7A 3C18A 3COAC 1QGPA 1OMIA 1WWXA 1MKMA 1TQMA 5HS8A 3GYHX 1D5VA 5FFZA 1FSEA 3JAMK 3GVAA 3KCCA 3BJ6A 2XIGA 1FYLA 3ZN0A 1JXSA 3KP4A 2V1XA 3TKYA 2HQRA 5CLSA 1D3YA 1P6RA 3VEPA 3M9AA 5AIQA 4XSZF 4RAYA 4HV5A 2HDCA 3P9CA 1MDMA 2RN7A 2Z9OA 2TDXA 3WE2A 1SD6A 4XBFA 2PI0A 2NS0A 3SQNA 3EQLF 1QZYA 2EFNA 1ZLJA 3H3ZA 2YU3A 2P8TA 4CGZA 3F6OA 2VE9A 4KIFA 2BBYA 5HLIA 3LAJA 2D2WA 4IJAA 3C7JA 3HUGA 1J2XA 2WWYA 4WX9A 1BBYA 1IRGA 1MJAA 4NHJA 1O3RA 5CVRA 1Z91A 1T0FA 1QZZA 1IN6A 3RPQA 4U7BA 3GXOA 4ESJA 2V79A 5JR3A 1XCBA 4S05A 1BN5A 1IZ1A 2G7UA 2DLLA 4JBAA 1U5TB 1HW2A 2E7XA 3JW4A 2QYOA 4U0VA 1FP2A 5DUKA 3I71A 4BQAA 3F8NA 1FYKA 1J59A 3LQQA 5FGMA 4YFNF 4CO8A 3I59A 1IXCA 1FZPB 1J75A 1KGSA 2K86A 3V4GA 3J7AO 5LLQA 2E1NA 1OR7A 1KU2A 3RYPA 2OQRA 3ML6A 2ZKZA 1FBQA 1DDNA 1U78A 1D8JA 3OOPA 4L0ZB 2ADUA 4LB5A 2XAQA 1G3TA 2QENA 3MAJA 1A04A 1HKQA 5JHUA 4YIFA 3SZPA 3I59B 4EGZA 2HWVA 1SD4A 2UWMA 1E17A 1FC3A 4MTEA 4IRIA 4GGGA 2PMHA 2EFQA 1H9GA 4IPAA 3BROA 4BXUA 4UVBA 1LDDA 1EV7A 4WF2A 5E8IA 2P5KA 3HOTA 4MEYF 4Y13A 3R60A 1KQ9A 3H92A 2Z99A 3JTHA 2VE8A 3CDHA 1U5TA 2M87A 5AIPA 5LEKA 2BGCA 3TO7A 4TV7A 4L18B 4G7ZF 2CG4A 1B4AA 3V7RA 1SAXA 1GXPA 4O6JA 4P55A 1W4MA 2XKPA 2L54A 1ZRDA 2RKHA 2COMA 2P6TA 3W6JB 2MLGA 4EJOA 1YO5C 1LVAA 3DPTA 4LB6B 1ZHFA 3ECOA 4KA4A 3P9IA 3RKXA 3WTSC 4HBLA 3MEXA 2DTRA 2CQKA 5H6RA 5HOOA 2FMLA 3NRVA 2NNYA 3L2CA 1L3LA 3T8TA 1BC7C 1STZA 3CJNA 1FNNA 4PCQA 2L01A 4IHSA 4KT5C 4KN4X 1U8RA 1K78B 2P7CB 1I1GA 2Q2EA 5D5XB 3WGGA 1BJAA 5L3GA 1XSDA 1YLFA 1O7LA 1K7AA 4AD9A 2M5WA 2Q0OA 1ON1A 2QLZA 2WTEA 5D5WB 4ZZDA 2FA5A 1ULYA 2HZTA 5E18F 3M7GA 3KEOA 1BI0A 4MHGA 4I98B 5F64A 2AS5F 2DI3A 1MDMB 1TBXA 4ZYEA 5L3EA 5KVRA 2VBXA 1LB2A 1IF1A 3FMQA 2M8EA 2O3FA 4UUVA 2FBKA 3RIRA 2XAHA 1YFHA 4AIJA 4BAYA 2QM3A 4NB5A 4S04A 2ISYA 3FXRA 2FQ3A 3GZ5A 4L9TA 2M30A 2P5VA 3N97A 4ENNA 5JVTA 4Y15A 3RYRA 3K9TA 5L3BA 4I2OA 1XMAA 4EJUA 2PBIA 3QU6A 2ACJA 4FX4A 2FMYA 5D5VB 1WKMA 4M73A 5BPIA 2HR3A 5DD8A 2YR2A 4OMYA 1FY7A 4IF4A 1IXSB 3RDIA 1S6LA 3BPXA 4Z2YA 1J7KA 3FMSA 4D0PA 2ELHA 2L4MA 3L09A 4BHCA 3HHGA 3GF2A 4LK1F 2C6YA 4HX4A 3TGNA 3BY6A 2DW4A 1F9NA 5DCMA 1CGPA 2H09A 3TDUC 4WWCA 5DEQA 5D6FA 3CLOA 1P4AA 2A61A 5JFRA 2FOKA 3WU0A 3ERED 3BOQA 3IRRA 2A07F 2ESHA 4I0AA 4L9JA 4JK1X 1TQIA 3RKWA 2LF8A 4EMSA 1RZ4A 3I0TA 5EEGA 1IN5A 5FLXZ 3ABTA 5CJ9A 1FPQA 1HBXG 3WE3A 2FNAA 1BI1A 3TQNA 1LNWA 2FE3A 1ZARA 1E2XA 1K6OA 2HOEA 1OYIA 3F8FA 2D1VA 3DV8A 2L4AA 1LEBA 5HDGA 1EH6A 2F5FA 5DDGA 2IA1A 1R5GA 1RNLA 2W57A 3FF5A 3R4KA 2Z33A 1LDKB 4HLYA 3WTUC 4HQEA 3M8FA 5FLXK 3WU1B 1BM9A 3VODA 2IP2A 4A0ZA 3MZHA 4P96A 2LNBA 2AXLA 4HLXA 5JI6A 6PAXA 2OD5A 1BIAA 4ZYHA 3E5QA 2P6SA 3J80K 4OMZA 1KYWA 1ZGJA 1BC8C 1DP7P 1O3SA 3RJPA 3SXYA 3K0LA 2BEOA 1YYVA 2IJLA 1O3QA 4MQVA 1R1UA 1ON2A 5D6EA 1Y0UA 1S8NA 2CW0F 3DXJF 1HKSA 5DD4A 1BOAA 4L0YB 3U9GA 1ZG1A 4M71A 3J81Z 4AVPA 3D5LA 2Y48A 4F7ZA 3BPVA 5D8KB 1IN8A 3ECHA 2CWEA 4ZH4F 1W7PA 2JZYA 2KJCA 2IVMA 1XMKA 3DP7A 3DPLC 1P4XA 3M1EA 1G3SA 4AIKA 4MGRA 4GYIA 2M1BA 4MQ9F 3V8JA 4XLPF 2XUBA 2FXAA 1YW7A 2MC3A 2IA0A 1TW3A 3J81K 1IUYA 3I58A 5FB2A 3IRQA 1RIOH 3SZTA 3T8RA 4HQMA 5DYMA 1KA8A 4A12A 3ZPLA 3FXUA 1WRJA 5DCMB 3WGHA 3NQOA 3BZ6A 3LWFA 1S7AA 3K2ZA 3KZZA 1YS6A 2IRFG 2F2EA 3L7WA 4EQQA 3T1BA 2DK8A 2GXBA 1DPRA 1Z6RA 4G6DA 2QQBA 2JRTA 5HDNA 2A69F 5FD5A 2FF4A 5A2QK 2GWRA 2MD5A 4U0YA 3WTWC 2RDPA 4OOIA 3RTRA 2E1CA 4LLGF 2Y75A 3U2RA 3C1DA 1TNTA 1XD7A 3KLNA 3HRSA 2HS5A 3E5XA 3F3XA 1ZREA 3JTGA 5ICFA 2HEOA 1QNTA 2EWNA 3FM3A 2STTA 3T0YA 2CYYA 4HX8A 1J5YA 1B9NA 3GEZA 1F1ZA 4QLCU 2F5CA 3WTVC 2UZKA 2H27A 3L9FA 1UCRA 1DUXC 4L5IA 2DK5A 1XDUA 2OA4A 3F21A 3WODF 2PLYA 3LFKA 3QAHA 3I4PA 3L00A 2IW5A 4EM0B 4O3MA 1KU3A 5HVQC 3F72A 2FBIA 3K1NA 2ZBKA 4AWXB 2FBHA 5LGNA 5E8GA 5ILSA 4KUMA 4XLNF 4IRHA 2ETHA 3IHUA 3KP7A 4M9ZA 3TOBA 4U7DA 2EB7A 2VC0A 1KQ0A 3DF8A 4KIBA 3WTTC 4ENJA 3IWZA 3DEUA 1FX7A 1PP8F 4KNYA 4BHBA 1OKRA 1U5TC 2XROA 4ESBA 3ELKA 1HSJA 3CO6C 3GW2A 3V8LA 2MBFA 2VBYA 3FWEA 4IVNA 5HS9A 1UB9A 2X4HA 5D4SA 5LHIA 3FMRA 2VONA 4UHTA 3P9KA 1SMTA 2JPCA 1Z7UA 4N0BA 4I09A 3G73A 1YW8A 4HF0A 4UXNA 3BJOA 5F1RA 4OIOF 5BQTA 3M8EA 1ZG3A 2QZ8A 4RGXA 2PFBA 3TDZC 2O03A 1T39A 4KIGA 3I5UA 3EUHA 3SHFA 2XV4S 1ZG5A 2KIUA 1W7PB 1XDSA 4R8HA 2YX4A 2K4JA 3LQRA 2LKPA 3F8BA 1R7JA 2VT2A 3F22A 3C3WA 3E6DA 1WQ2A 4I02A 3KEQA 1V3FA 1W7PD 1HXDA 2KRFA 2YX7A 4LJZF 3KETA 4LK0F 5L3DA 4LG0A 3WTZA 1ZLKA 2WV0A 1HSTA 2R7FA 1G3WA 3FZVA 1S29A 4UNOA 2RVCA 1YW9A 3ZMZA 1REPC 1YS7A 3BJAA 1FWZA 2RV8A 3ZMUA 2QBYA 5E1WA 1OYYA 3HTSB 1CF7A 2XVCA 2ZNYA 1ZH5A 1H9TA 4H0EA 3AAFA 1DPUA 1B9MA 2YPRA 3VFZA 1LJ9A 2Q8KA 2E7WA 1SFUA 4UV8A 2YSRA 1PDNC 4Y17A 1B1BA 2VT3A 4P5OA 2A5YB 1JE8A 1GXQA 2EA2A 4CDGA 2XASA 3R0JA 2KIFA 4ZYGA 3ZMDA 3ZQ7A 2CO5A 5FFXA 2K02A 2XRNA 3FHZA 4CZZA 3D0SA 2JSCA 2OBPA 4N9HA 3E6BA 4LG0B 3ZMVA 3BDDA 1HW5A 1BI3A 2V9VA 3P7NA 1UHWA 1ZAOA 2HFHA 4RAZA 1T6SA 1QQIA 2HKXA 5D8LB 1XSVA 3Q9SA 3HOSA 1R36A 4JQFA 4EM2A 1G4DA 5H20A 5LRSA 3GFIA 3QP5A 3HSEA 4A2UA 3QOPA 2EFOA 3RPUA 5K5QA 4QWQA 1HKTA 4GO1A 4GYGA 4OIPF 2GAUA 4OU0A 2CSOA 4Q4ZF 1FLIA 1MJ9A 5LRRA 3KZYA 4EV0A 4MNUA 4FT8A 3MZYA 4Q47A 1P4WA 1R23A 2DO7A 1FT9A 2HTSA 4G6QA 5DCFA 4PZJA 3RKYA 3SFZA 3I54A 1JHHA 4LLLA 3PFIA 4OIQF 2ISZA 1YIOA 2VBZA 1C0WA 4IHTA 3W6KB 5HDKA 4ENMA 1FOKA 1WSUA 1B6AA 2DFIA 2IT0A 3GO5A 2LSOA 4R1HA 4OINF 2H94A 1EH7A 1FP1D 1QBJA 4M6XA 4G9YA 4M9SA 2F5EA 4HV6A 4R79A 4ON0A 4K2EA 2XAJA 3KP2A 1FYMA 4WK8F 4HA8A 4ENKA 2FNPA 3GUDA 4I0BA 1YTYA 3E97A 3KP6A 3O3KA 4WXDA 4RB1A 1ZRFA 2M45A 1SD7A 2B0LA 4HZFA 2XAGA 4RS8A 2HQNA 2R7DA 2H6BA 2PJPA 1I27A 1LQ1A 4DQ2A 2MLKA 2VC1A 5ILVA 2EFPA 3CTAA 1YQAA 3TO6A 4I01A 2QWWA 5EEHA 3T5XA 1F5TA 3F6VA 1IW7F 3IKTA 2VBWA 4EGYA 2O0YA 2OZUA 1O7FA 2DQRA 3GWZA 1RUOA 2EV0A 4HYEA 4Q5SF 4L9VA 5L3CA 2ZMEB 3B73A 5HS7A 5TRDA 2UXNA 3TO9A 2K7LA 2LDUA 4NQWA 1USTA 1XCVA 2FSWA 4M6YA 3Q5FA 2Z5UA 3KP3A 2EFWA 3R6SA 5LHHA 3O2PE 5FO5A 5CVUA 4I7HA 3GX4X 4ETSA 4M74A 2OZ6A 2PN6A 1ZYRF 2G7HA 3E6MA 2VOPA 1MGTA 3BWGA 3HSRA 3WGIA 1IAWA 4RGUA 4P9FA 4CHUA 2DBBA 1CF7B 1JGSA 3GFLA 2JT1A 2RC4A 2NAZA 5E1XA 3VOEA 3R61A 1R1VA 4L5JA 3LSTA 2O61A 1IRFA 3HSFA 1SMYF 4LFUA 2GQQA 2FU4A 4KN7X 1VTNC 2KJBA 3G3ZA 5ICEA 1Z9CA 1S7OA 4A6EA 2J5OA 1UFMA 2JTVA 1WI9A 5J8FA 2DQLA 5LGUA 3KFWX 2G9WA 1G6NA 4BYYA 3CUQB 4EJVA 4ESFA 2W84A 1U3EM 4WXHA 1XGSA 4A0XA 2EA4A 2BYVE 3IWFA 4P9UA 1LEAA 3DKWA 3IC7A 5E1ZB 3TOAA 5J8CA 2QUFA 1LDJA 3E6CC 1XGMA 2VN2A 2KKOA 3FM5A 1HQCA 1F4KA 4U0WA 3F8MA 1QPMA 1U6GA 2W24A 3ULQB 2CFXA 2OQGA 2J5PA 3GFJA 4HDUA 2MH9A 3HYIA 3ZMTA 5HLGA 2FEZA 1YG2A 1SFXA 3FX3A 1GHCA 1GVJA 4YG2F 4FX0A 2QQ9A 1ZGAA 3EDPA 4EJTA 4M72A 1IN4A 2D1HA 1XGOA 1FBUA 3GFMA 1R1TA 2V1DA 1T98A 2P4WA 2JPBA 5TJJA 2ZCWA 4KMUX 4IXAA 1BI2A 4O5VA 5J6XA 2GIVA 3KLOA 5D5UB 4KYWA 3F8CA 1I1SA 3ABUA 1P2FA 2KIMA 4AIHA 3DFGA 1I5ZA 3R0AA 5LHGA 3HRMA 2MA3A 5CYVA 3ZP5A 2VXZA 5K5RA 1R00A 5CVJA 4UV9A 4WCGA 4Q48A 2L02A 3EYIA 2A3SA 4ASNA 2GA1A 3OV8A 4EM1A 3B02A 2PEXA 2ZJ2A 3CUQC 3PQKA 1AOYA 3MQ0A 3EETA 1FBSA 2DU9A 4HDVA 5K5OA 3EYYA 2RNJA 5ICCA 2MH2A 3KE2A 4E70A 1TQPA 3F23A 2HYFA 4RGRA 4XRFA 2K4BA 3HRUA 1TNSA 3GZ6A 5ERIA 1T2KA 3I53A 3V7SA 2WC2A 2F5DA 2OAZA 3E3VA 1W5SA 3JAMZ 1K79A 5LEJA 2ZO4A 3S2WA 2R3SA 5ILUA 1Z05A 2W85A 5DUIA 1OYWA 2ESNA 3QPHA 3IKVA 2O8XA 3HTUA 4B09A 3HIFA 1IXRC 3JSOA 1B59A 1NHAA 1RUNA 2PG4A 2V1UA 5FD6A 3J80Z 5LGTA 1S3JA 1ODDA 3LAPA 2HKOA 4A6DA 1ONVA 2DPDA 3DQVC 4OIRF 3V8KA 1J0RA 3ROUA 3CO7C 2ZMEA 5IT9K 4UVCA 3CUOA 4A0YA 2EJRA 1R58A 2GA2A 3CUQA 1EH8A 1TTYA 3MCZA 4LLNA 1KQ8A 2BE5F 5L3FA 1P92A 5K1YA 2ZFWA 4BHPA 4IRGA 1U2WA 4MTDA 1UHMA 2STWA 1MJBA 1AWCA 1O3TA 1O57A 1R5HA 2H6CA 3ISPA 3Q9VA 4HX7A 5IT9Z 2LF7A 1XN7A 4ZZLA 1W5TA 4GXOA 2K27A 1Z6TA 4HF1A 1ZRCA 5A2QZ 1XB4A 3U1DA 5BOXA 4N9IA 4XSXF 5D4RA 2HTJA 2HGCA 4CICA 2IA2A 1QO0D 4WXCA 1Z1DA 3MWMA 1KU7A 2A68F 1H0MA 3VB2A 1KU9A 3LA2A 2D45A 4CXFA 2DPUA 4EVIA 1SD5A 4G7HF 4LMYA 2XKOA 3PQJA 3ZN1A 1BIBA 3QPTA 3O6BB 4UVAA 2A6EF 4KDPA 1R22A 4HF2A 2P7VB 4RGSA 3QU3A 2ZXJA 5KK1A 1X3UA 2DT5A 2QVOA 4EJWA 3QP6A 3RI4A 4ZYDA 3BP8A 2FRHA 1T38A 5H6QA 4KMFA 1D8KA 3LA7A 2W25A 3GLXA 3N4MA 4FHTA 2XGXA 5BS6A 1XGNA 2XHKA 3QRFF 4YFKF 1TW2A 2EK5A 2IPQX 1OPCA 1I6XA 1L0OC 1USSA 3H3UA 2CGPA 2NNNA 2BV6A 5F6FA 2ZNZA 4PGHA 1MD0A 2XAFA 1V4RA 5ED4A 2QBYB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O6G E;  3K1P A;  4HAM A;  4DNC A;  2PQ8 A;  5E17 F;  5CVV A;  4RB0 A;  3IL2 A;  3V7C A;  4YFX F;  2PMU A;  2VOO A;  2EV5 A;  2GXG A;  4M9X A;  2Y0M A;  4HW0 A;  2A6H F;  3REO A;  4G8X A;  2P5L C;  5ICG A;  4L9N A;  1SFE A;  2UXX A;  4A5N A;  2V6C A;  4BH9 A;  4RB2 C;  4RB3 C;  3WG9 A;  4G7O F;  2L3D A;  3E5U A;  3LA3 A;  2EV6 A;  4BNC A;  1TLH B;  3FXQ A;  1J9I A;  1Q1H A;  5DV5 A;  1KYZ A;  3KP5 A;  3HRT A;  4B8X A;  1XSX A;  1IN7 A;  1ZN2 A;  4G94 A;  3MFK A;  1PP7 U;  4U88 A;  5BMZ A;  3JSP A;  2GZW A;  5CVI A;  5LBQ A;  1FSH A;  2Z3Y A;  3WTY C;  2OU2 A;  4PGG A;  2X0L A;  5E20 A;  5IT3 A;  4YII A;  1PUE E;  1K78 A;  4CYD A;  3HHH A;  5HLH A;  1G3Y A;  2VOD A;  3I64 A;  4LGW A;  4GCV A;  2HYG D;  2RQP A;  2NRA C;  5BPD A;  4PDK A;  2NYX A;  5AON A;  3ZMS A;  2QQA A;  1MZB A;  3K1M A;  4KFC A;  1HW1 A;  3WTX C;  2DAO A;  4KIC A;  4MEX F;  3K69 A;  4A5M A;  3NEU A;  4HOB A;  1JHF A;  4LD5 A;  2RGV A;  1RI7 A;  3C18 A;  3COA C;  1QGP A;  1OMI A;  1WWX A;  1MKM A;  1TQM A;  5HS8 A;  3GYH X;  1D5V A;  5FFZ A;  1FSE A;  3JAM K;  3GVA A;  3KCC A;  3BJ6 A;  2XIG A;  1FYL A;  3ZN0 A;  1JXS A;  3KP4 A;  2V1X A;  3TKY A;  2HQR A;  5CLS A;  1D3Y A;  1P6R A;  3VEP A;  3M9A A;  5AIQ A;  4XSZ F;  4RAY A;  4HV5 A;  2HDC A;  3P9C A;  1MDM A;  2RN7 A;  2Z9O A;  2TDX A;  3WE2 A;  1SD6 A;  4XBF A;  2PI0 A;  2NS0 A;  3SQN A;  3EQL F;  1QZY A;  2EFN A;  1ZLJ A;  3H3Z A;  2YU3 A;  2P8T A;  4CGZ A;  3F6O A;  2VE9 A;  4KIF A;  2BBY A;  5HLI A;  3LAJ A;  2D2W A;  4IJA A;  3C7J A;  3HUG A;  1J2X A;  2WWY A;  4WX9 A;  1BBY A;  1IRG A;  1MJA A;  4NHJ A;  1O3R A;  5CVR A;  1Z91 A;  1T0F A;  1QZZ A;  1IN6 A;  3RPQ A;  4U7B A;  3GXO A;  4ESJ A;  2V79 A;  5JR3 A;  1XCB A;  4S05 A;  1BN5 A;  1IZ1 A;  2G7U A;  2DLL A;  4JBA A;  1U5T B;  1HW2 A;  2E7X A;  3JW4 A;  2QYO A;  4U0V A;  1FP2 A;  5DUK A;  3I71 A;  4BQA A;  3F8N A;  1FYK A;  1J59 A;  3LQQ A;  5FGM A;  4YFN F;  4CO8 A;  3I59 A;  1IXC A;  1FZP B;  1J75 A;  1KGS A;  2K86 A;  3V4G A;  3J7A O;  5LLQ A;  2E1N A;  1OR7 A;  1KU2 A;  3RYP A;  2OQR A;  3ML6 A;  2ZKZ A;  1FBQ A;  1DDN A;  1U78 A;  1D8J A;  3OOP A;  4L0Z B;  2ADU A;  4LB5 A;  2XAQ A;  1G3T A;  2QEN A;  3MAJ A;  1A04 A;  1HKQ A;  5JHU A;  4YIF A;  3SZP A;  3I59 B;  4EGZ A;  2HWV A;  1SD4 A;  2UWM A;  1E17 A;  1FC3 A;  4MTE A;  4IRI A;  4GGG A;  2PMH A;  2EFQ A;  1H9G A;  4IPA A;  3BRO A;  4BXU A;  4UVB A;  1LDD A;  1EV7 A;  4WF2 A;  5E8I A;  2P5K A;  3HOT A;  4MEY F;  4Y13 A;  3R60 A;  1KQ9 A;  3H92 A;  2Z99 A;  3JTH A;  2VE8 A;  3CDH A;  1U5T A;  2M87 A;  5AIP A;  5LEK A;  2BGC A;  3TO7 A;  4TV7 A;  4L18 B;  4G7Z F;  2CG4 A;  1B4A A;  3V7R A;  1SAX A;  1GXP A;  4O6J A;  4P55 A;  1W4M A;  2XKP A;  2L54 A;  1ZRD A;  2RKH A;  2COM A;  2P6T A;  3W6J B;  2MLG A;  4EJO A;  1YO5 C;  1LVA A;  3DPT A;  4LB6 B;  1ZHF A;  3ECO A;  4KA4 A;  3P9I A;  3RKX A;  3WTS C;  4HBL A;  3MEX A;  2DTR A;  2CQK A;  5H6R A;  5HOO A;  2FML A;  3NRV A;  2NNY A;  3L2C A;  1L3L A;  3T8T A;  1BC7 C;  1STZ A;  3CJN A;  1FNN A;  4PCQ A;  2L01 A;  4IHS A;  4KT5 C;  4KN4 X;  1U8R A;  1K78 B;  2P7C B;  1I1G A;  2Q2E A;  5D5X B;  3WGG A;  1BJA A;  5L3G A;  1XSD A;  1YLF A;  1O7L A;  1K7A A;  4AD9 A;  2M5W A;  2Q0O A;  1ON1 A;  2QLZ A;  2WTE A;  5D5W B;  4ZZD A;  2FA5 A;  1ULY A;  2HZT A;  5E18 F;  3M7G A;  3KEO A;  1BI0 A;  4MHG A;  4I98 B;  5F64 A;  2AS5 F;  2DI3 A;  1MDM B;  1TBX A;  4ZYE A;  5L3E A;  5KVR A;  2VBX A;  1LB2 A;  1IF1 A;  3FMQ A;  2M8E A;  2O3F A;  4UUV A;  2FBK A;  3RIR A;  2XAH A;  1YFH A;  4AIJ A;  4BAY A;  2QM3 A;  4NB5 A;  4S04 A;  2ISY A;  3FXR A;  2FQ3 A;  3GZ5 A;  4L9T A;  2M30 A;  2P5V A;  3N97 A;  4ENN A;  5JVT A;  4Y15 A;  3RYR A;  3K9T A;  5L3B A;  4I2O A;  1XMA A;  4EJU A;  2PBI A;  3QU6 A;  2ACJ A;  4FX4 A;  2FMY A;  5D5V B;  1WKM A;  4M73 A;  5BPI A;  2HR3 A;  5DD8 A;  2YR2 A;  4OMY A;  1FY7 A;  4IF4 A;  1IXS B;  3RDI A;  1S6L A;  3BPX A;  4Z2Y A;  1J7K A;  3FMS A;  4D0P A;  2ELH A;  2L4M A;  3L09 A;  4BHC A;  3HHG A;  3GF2 A;  4LK1 F;  2C6Y A;  4HX4 A;  3TGN A;  3BY6 A;  2DW4 A;  1F9N A;  5DCM A;  1CGP A;  2H09 A;  3TDU C;  4WWC A;  5DEQ A;  5D6F A;  3CLO A;  1P4A A;  2A61 A;  5JFR A;  2FOK A;  3WU0 A;  3ERE D;  3BOQ A;  3IRR A;  2A07 F;  2ESH A;  4I0A A;  4L9J A;  4JK1 X;  1TQI A;  3RKW A;  2LF8 A;  4EMS A;  1RZ4 A;  3I0T A;  5EEG A;  1IN5 A;  5FLX Z;  3ABT A;  5CJ9 A;  1FPQ A;  1HBX G;  3WE3 A;  2FNA A;  1BI1 A;  3TQN A;  1LNW A;  2FE3 A;  1ZAR A;  1E2X A;  1K6O A;  2HOE A;  1OYI A;  3F8F A;  2D1V A;  3DV8 A;  2L4A A;  1LEB A;  5HDG A;  1EH6 A;  2F5F A;  5DDG A;  2IA1 A;  1R5G A;  1RNL A;  2W57 A;  3FF5 A;  3R4K A;  2Z33 A;  1LDK B;  4HLY A;  3WTU C;  4HQE A;  3M8F A;  5FLX K;  3WU1 B;  1BM9 A;  3VOD A;  2IP2 A;  4A0Z A;  3MZH A;  4P96 A;  2LNB A;  2AXL A;  4HLX A;  5JI6 A;  6PAX A;  2OD5 A;  1BIA A;  4ZYH A;  3E5Q A;  2P6S A;  3J80 K;  4OMZ A;  1KYW A;  1ZGJ A;  1BC8 C;  1DP7 P;  1O3S A;  3RJP A;  3SXY A;  3K0L A;  2BEO A;  1YYV A;  2IJL A;  1O3Q A;  4MQV A;  1R1U A;  1ON2 A;  5D6E A;  1Y0U A;  1S8N A;  2CW0 F;  3DXJ F;  1HKS A;  5DD4 A;  1BOA A;  4L0Y B;  3U9G A;  1ZG1 A;  4M71 A;  3J81 Z;  4AVP A;  3D5L A;  2Y48 A;  4F7Z A;  3BPV A;  5D8K B;  1IN8 A;  3ECH A;  2CWE A;  4ZH4 F;  1W7P A;  2JZY A;  2KJC A;  2IVM A;  1XMK A;  3DP7 A;  3DPL C;  1P4X A;  3M1E A;  1G3S A;  4AIK A;  4MGR A;  4GYI A;  2M1B A;  4MQ9 F;  3V8J A;  4XLP F;  2XUB A;  2FXA A;  1YW7 A;  2MC3 A;  2IA0 A;  1TW3 A;  3J81 K;  1IUY A;  3I58 A;  5FB2 A;  3IRQ A;  1RIO H;  3SZT A;  3T8R A;  4HQM A;  5DYM A;  1KA8 A;  4A12 A;  3ZPL A;  3FXU A;  1WRJ A;  5DCM B;  3WGH A;  3NQO A;  3BZ6 A;  3LWF A;  1S7A A;  3K2Z A;  3KZZ A;  1YS6 A;  2IRF G;  2F2E A;  3L7W A;  4EQQ A;  3T1B A;  2DK8 A;  2GXB A;  1DPR A;  1Z6R A;  4G6D A;  2QQB A;  2JRT A;  5HDN A;  2A69 F;  5FD5 A;  2FF4 A;  5A2Q K;  2GWR A;  2MD5 A;  4U0Y A;  3WTW C;  2RDP A;  4OOI A;  3RTR A;  2E1C A;  4LLG F;  2Y75 A;  3U2R A;  3C1D A;  1TNT A;  1XD7 A;  3KLN A;  3HRS A;  2HS5 A;  3E5X A;  3F3X A;  1ZRE A;  3JTG A;  5ICF A;  2HEO A;  1QNT A;  2EWN A;  3FM3 A;  2STT A;  3T0Y A;  2CYY A;  4HX8 A;  1J5Y A;  1B9N A;  3GEZ A;  1F1Z A;  4QLC U;  2F5C A;  3WTV C;  2UZK A;  2H27 A;  3L9F A;  1UCR A;  1DUX C;  4L5I A;  2DK5 A;  1XDU A;  2OA4 A;  3F21 A;  3WOD F;  2PLY A;  3LFK A;  3QAH A;  3I4P A;  3L00 A;  2IW5 A;  4EM0 B;  4O3M A;  1KU3 A;  5HVQ C;  3F72 A;  2FBI A;  3K1N A;  2ZBK A;  4AWX B;  2FBH A;  5LGN A;  5E8G A;  5ILS A;  4KUM A;  4XLN F;  4IRH A;  2ETH A;  3IHU A;  3KP7 A;  4M9Z A;  3TOB A;  4U7D A;  2EB7 A;  2VC0 A;  1KQ0 A;  3DF8 A;  4KIB A;  3WTT C;  4ENJ A;  3IWZ A;  3DEU A;  1FX7 A;  1PP8 F;  4KNY A;  4BHB A;  1OKR A;  1U5T C;  2XRO A;  4ESB A;  3ELK A;  1HSJ A;  3CO6 C;  3GW2 A;  3V8L A;  2MBF A;  2VBY A;  3FWE A;  4IVN A;  5HS9 A;  1UB9 A;  2X4H A;  5D4S A;  5LHI A;  3FMR A;  2VON A;  4UHT A;  3P9K A;  1SMT A;  2JPC A;  1Z7U A;  4N0B A;  4I09 A;  3G73 A;  1YW8 A;  4HF0 A;  4UXN A;  3BJO A;  5F1R A;  4OIO F;  5BQT A;  3M8E A;  1ZG3 A;  2QZ8 A;  4RGX A;  2PFB A;  3TDZ C;  2O03 A;  1T39 A;  4KIG A;  3I5U A;  3EUH A;  3SHF A;  2XV4 S;  1ZG5 A;  2KIU A;  1W7P B;  1XDS A;  4R8H A;  2YX4 A;  2K4J A;  3LQR A;  2LKP A;  3F8B A;  1R7J A;  2VT2 A;  3F22 A;  3C3W A;  3E6D A;  1WQ2 A;  4I02 A;  3KEQ A;  1V3F A;  1W7P D;  1HXD A;  2KRF A;  2YX7 A;  4LJZ F;  3KET A;  4LK0 F;  5L3D A;  4LG0 A;  3WTZ A;  1ZLK A;  2WV0 A;  1HST A;  2R7F A;  1G3W A;  3FZV A;  1S29 A;  4UNO A;  2RVC A;  1YW9 A;  3ZMZ A;  1REP C;  1YS7 A;  3BJA A;  1FWZ A;  2RV8 A;  3ZMU A;  2QBY A;  5E1W A;  1OYY A;  3HTS B;  1CF7 A;  2XVC A;  2ZNY A;  1ZH5 A;  1H9T A;  4H0E A;  3AAF A;  1DPU A;  1B9M A;  2YPR A;  3VFZ A;  1LJ9 A;  2Q8K A;  2E7W A;  1SFU A;  4UV8 A;  2YSR A;  1PDN C;  4Y17 A;  1B1B A;  2VT3 A;  4P5O A;  2A5Y B;  1JE8 A;  1GXQ A;  2EA2 A;  4CDG A;  2XAS A;  3R0J A;  2KIF A;  4ZYG A;  3ZMD A;  3ZQ7 A;  2CO5 A;  5FFX A;  2K02 A;  2XRN A;  3FHZ A;  4CZZ A;  3D0S A;  2JSC A;  2OBP A;  4N9H A;  3E6B A;  4LG0 B;  3ZMV A;  3BDD A;  1HW5 A;  1BI3 A;  2V9V A;  3P7N A;  1UHW A;  1ZAO A;  2HFH A;  4RAZ A;  1T6S A;  1QQI A;  2HKX A;  5D8L B;  1XSV A;  3Q9S A;  3HOS A;  1R36 A;  4JQF A;  4EM2 A;  1G4D A;  5H20 A;  5LRS A;  3GFI A;  3QP5 A;  3HSE A;  4A2U A;  3QOP A;  2EFO A;  3RPU A;  5K5Q A;  4QWQ A;  1HKT A;  4GO1 A;  4GYG A;  4OIP F;  2GAU A;  4OU0 A;  2CSO A;  4Q4Z F;  1FLI A;  1MJ9 A;  5LRR A;  3KZY A;  4EV0 A;  4MNU A;  4FT8 A;  3MZY A;  4Q47 A;  1P4W A;  1R23 A;  2DO7 A;  1FT9 A;  2HTS A;  4G6Q A;  5DCF A;  4PZJ A;  3RKY A;  3SFZ A;  3I54 A;  1JHH A;  4LLL A;  3PFI A;  4OIQ F;  2ISZ A;  1YIO A;  2VBZ A;  1C0W A;  4IHT A;  3W6K B;  5HDK A;  4ENM A;  1FOK A;  1WSU A;  1B6A A;  2DFI A;  2IT0 A;  3GO5 A;  2LSO A;  4R1H A;  4OIN F;  2H94 A;  1EH7 A;  1FP1 D;  1QBJ A;  4M6X A;  4G9Y A;  4M9S A;  2F5E A;  4HV6 A;  4R79 A;  4ON0 A;  4K2E A;  2XAJ A;  3KP2 A;  1FYM A;  4WK8 F;  4HA8 A;  4ENK A;  2FNP A;  3GUD A;  4I0B A;  1YTY A;  3E97 A;  3KP6 A;  3O3K A;  4WXD A;  4RB1 A;  1ZRF A;  2M45 A;  1SD7 A;  2B0L A;  4HZF A;  2XAG A;  4RS8 A;  2HQN A;  2R7D A;  2H6B A;  2PJP A;  1I27 A;  1LQ1 A;  4DQ2 A;  2MLK A;  2VC1 A;  5ILV A;  2EFP A;  3CTA A;  1YQA A;  3TO6 A;  4I01 A;  2QWW A;  5EEH A;  3T5X A;  1F5T A;  3F6V A;  1IW7 F;  3IKT A;  2VBW A;  4EGY A;  2O0Y A;  2OZU A;  1O7F A;  2DQR A;  3GWZ A;  1RUO A;  2EV0 A;  4HYE A;  4Q5S F;  4L9V A;  5L3C A;  2ZME B;  3B73 A;  5HS7 A;  5TRD A;  2UXN A;  3TO9 A;  2K7L A;  2LDU A;  4NQW A;  1UST A;  1XCV A;  2FSW A;  4M6Y A;  3Q5F A;  2Z5U A;  3KP3 A;  2EFW A;  3R6S A;  5LHH A;  3O2P E;  5FO5 A;  5CVU A;  4I7H A;  3GX4 X;  4ETS A;  4M74 A;  2OZ6 A;  2PN6 A;  1ZYR F;  2G7H A;  3E6M A;  2VOP A;  1MGT A;  3BWG A;  3HSR A;  3WGI A;  1IAW A;  4RGU A;  4P9F A;  4CHU A;  2DBB A;  1CF7 B;  1JGS A;  3GFL A;  2JT1 A;  2RC4 A;  2NAZ A;  5E1X A;  3VOE A;  3R61 A;  1R1V A;  4L5J A;  3LST A;  2O61 A;  1IRF A;  3HSF A;  1SMY F;  4LFU A;  2GQQ A;  2FU4 A;  4KN7 X;  1VTN C;  2KJB A;  3G3Z A;  5ICE A;  1Z9C A;  1S7O A;  4A6E A;  2J5O A;  1UFM A;  2JTV A;  1WI9 A;  5J8F A;  2DQL A;  5LGU A;  3KFW X;  2G9W A;  1G6N A;  4BYY A;  3CUQ B;  4EJV A;  4ESF A;  2W84 A;  1U3E M;  4WXH A;  1XGS A;  4A0X A;  2EA4 A;  2BYV E;  3IWF A;  4P9U A;  1LEA A;  3DKW A;  3IC7 A;  5E1Z B;  3TOA A;  5J8C A;  2QUF A;  1LDJ A;  3E6C C;  1XGM A;  2VN2 A;  2KKO A;  3FM5 A;  1HQC A;  1F4K A;  4U0W A;  3F8M A;  1QPM A;  1U6G A;  2W24 A;  3ULQ B;  2CFX A;  2OQG A;  2J5P A;  3GFJ A;  4HDU A;  2MH9 A;  3HYI A;  3ZMT A;  5HLG A;  2FEZ A;  1YG2 A;  1SFX A;  3FX3 A;  1GHC A;  1GVJ A;  4YG2 F;  4FX0 A;  2QQ9 A;  1ZGA A;  3EDP A;  4EJT A;  4M72 A;  1IN4 A;  2D1H A;  1XGO A;  1FBU A;  3GFM A;  1R1T A;  2V1D A;  1T98 A;  2P4W A;  2JPB A;  5TJJ A;  2ZCW A;  4KMU X;  4IXA A;  1BI2 A;  4O5V A;  5J6X A;  2GIV A;  3KLO A;  5D5U B;  4KYW A;  3F8C A;  1I1S A;  3ABU A;  1P2F A;  2KIM A;  4AIH A;  3DFG A;  1I5Z A;  3R0A A;  5LHG A;  3HRM A;  2MA3 A;  5CYV A;  3ZP5 A;  2VXZ A;  5K5R A;  1R00 A;  5CVJ A;  4UV9 A;  4WCG A;  4Q48 A;  2L02 A;  3EYI A;  2A3S A;  4ASN A;  2GA1 A;  3OV8 A;  4EM1 A;  3B02 A;  2PEX A;  2ZJ2 A;  3CUQ C;  3PQK A;  1AOY A;  3MQ0 A;  3EET A;  1FBS A;  2DU9 A;  4HDV A;  5K5O A;  3EYY A;  2RNJ A;  5ICC A;  2MH2 A;  3KE2 A;  4E70 A;  1TQP A;  3F23 A;  2HYF A;  4RGR A;  4XRF A;  2K4B A;  3HRU A;  1TNS A;  3GZ6 A;  5ERI A;  1T2K A;  3I53 A;  3V7S A;  2WC2 A;  2F5D A;  2OAZ A;  3E3V A;  1W5S A;  3JAM Z;  1K79 A;  5LEJ A;  2ZO4 A;  3S2W A;  2R3S A;  5ILU A;  1Z05 A;  2W85 A;  5DUI A;  1OYW A;  2ESN A;  3QPH A;  3IKV A;  2O8X A;  3HTU A;  4B09 A;  3HIF A;  1IXR C;  3JSO A;  1B59 A;  1NHA A;  1RUN A;  2PG4 A;  2V1U A;  5FD6 A;  3J80 Z;  5LGT A;  1S3J A;  1ODD A;  3LAP A;  2HKO A;  4A6D A;  1ONV A;  2DPD A;  3DQV C;  4OIR F;  3V8K A;  1J0R A;  3ROU A;  3CO7 C;  2ZME A;  5IT9 K;  4UVC A;  3CUO A;  4A0Y A;  2EJR A;  1R58 A;  2GA2 A;  3CUQ A;  1EH8 A;  1TTY A;  3MCZ A;  4LLN A;  1KQ8 A;  2BE5 F;  5L3F A;  1P92 A;  5K1Y A;  2ZFW A;  4BHP A;  4IRG A;  1U2W A;  4MTD A;  1UHM A;  2STW A;  1MJB A;  1AWC A;  1O3T A;  1O57 A;  1R5H A;  2H6C A;  3ISP A;  3Q9V A;  4HX7 A;  5IT9 Z;  2LF7 A;  1XN7 A;  4ZZL A;  1W5T A;  4GXO A;  2K27 A;  1Z6T A;  4HF1 A;  1ZRC A;  5A2Q Z;  1XB4 A;  3U1D A;  5BOX A;  4N9I A;  4XSX F;  5D4R A;  2HTJ A;  2HGC A;  4CIC A;  2IA2 A;  1QO0 D;  4WXC A;  1Z1D A;  3MWM A;  1KU7 A;  2A68 F;  1H0M A;  3VB2 A;  1KU9 A;  3LA2 A;  2D45 A;  4CXF A;  2DPU A;  4EVI A;  1SD5 A;  4G7H F;  4LMY A;  2XKO A;  3PQJ A;  3ZN1 A;  1BIB A;  3QPT A;  3O6B B;  4UVA A;  2A6E F;  4KDP A;  1R22 A;  4HF2 A;  2P7V B;  4RGS A;  3QU3 A;  2ZXJ A;  5KK1 A;  1X3U A;  2DT5 A;  2QVO A;  4EJW A;  3QP6 A;  3RI4 A;  4ZYD A;  3BP8 A;  2FRH A;  1T38 A;  5H6Q A;  4KMF A;  1D8K A;  3LA7 A;  2W25 A;  3GLX A;  3N4M A;  4FHT A;  2XGX A;  5BS6 A;  1XGN A;  2XHK A;  3QRF F;  4YFK F;  1TW2 A;  2EK5 A;  2IPQ X;  1OPC A;  1I6X A;  1L0O C;  1USS A;  3H3U A;  2CGP A;  2NNN A;  2BV6 A;  5F6F A;  2ZNZ A;  4PGH A;  1MD0 A;  2XAF A;  1V4R A;  5ED4 A;  2QBY B; 
#chains in the Genus database with same CATH topology
 3VYT B;  2O6G E;  3K1P A;  4HAM A;  3BG7 A;  4I76 A;  4GDF A;  3RQI A;  4DNC A;  2PQ8 A;  5HLT A;  5CVV A;  5E17 F;  1ETV A;  4RB0 A;  3IL2 A;  3V7C A;  3DEW A;  4YFX F;  2PMU A;  2VOO A;  2EV5 A;  5J1U A;  2GXG A;  3OYG A;  4C3J J;  2QQ8 A;  3FXK A;  4M9X A;  1IJW C;  2Y0M A;  4HW0 A;  2A6H F;  2R5Y B;  3REO A;  1S5L C;  3OY9 A;  1Y56 A;  2GOM A;  2R7Q A;  4G6T B;  4AYB N;  2IGM A;  4G8X A;  5IP9 J;  2P5L C;  1ZTR A;  3HUG B;  5ICG A;  2OCC H;  1U8B A;  1JI8 A;  4IHX A;  5GTH C;  1W5C C;  4CCO A;  2CV0 A;  2JQ7 A;  2AO9 A;  4L9N A;  2LMD A;  4W97 A;  2X85 A;  4LG3 A;  1SFE A;  2UXX A;  2XB5 A;  4A5N A;  5J4Y A;  1MSE C;  3U21 A;  1A36 A;  2V6C A;  2CUJ A;  4BH9 A;  4RB2 C;  4RB3 C;  4B3A A;  3WHB A;  3WG9 A;  4G7O F;  2DOD A;  2X1E A;  2L7F P;  2CJJ A;  2L3D A;  4XN3 A;  1OCP A;  4XRM A;  1Y8Q B;  3E5U A;  3H3V K;  3LA3 A;  2EV6 A;  4BNC A;  1TLH B;  3FXQ A;  1J9I A;  1ENH A;  5IP7 J;  1Q1H A;  3OSG A;  1WJC A;  5F27 A;  5DV5 A;  3HB9 A;  3BTC A;  1KYZ A;  3KP5 A;  3HRT A;  4B8X A;  3RZD J;  1XSX A;  1IN7 A;  1ZN2 A;  4G94 A;  3MFK A;  1PP7 U;  1W36 C;  4U88 A;  5BMZ A;  1K4S A;  1IRZ A;  3JSP A;  2GZW A;  3ZQL A;  5CVI A;  5LBQ A;  1FSH A;  1OFC X;  2Z3Y A;  3WTY C;  1JUM A;  2OU2 A;  3X2Q H;  4PGG A;  3PL8 A;  1VQM I;  2X0L A;  1PJR A;  5E20 A;  4LIV A;  3A1Y A;  5IT3 A;  1OCO H;  5FKM A;  1VQL I;  2DMN A;  2DMP A;  4YII A;  1PUE E;  4QPO A;  3CCJ I;  1K78 A;  1E3P A;  3ZR8 X;  4CYD A;  2K9L A;  2M4G A;  3HHH A;  4I99 C;  4RLQ A;  1G3Y A;  5HLH A;  3AG2 H;  3I64 A;  4LGW A;  1UAA A;  2VOD A;  1R9T J;  4GCV A;  2HYG D;  1APL C;  3BCA A;  2RQP A;  2NRA C;  5BPD A;  4PDK A;  2IS2 A;  4PJ0 C;  2GBY A;  1F36 A;  2CU7 A;  1W0U A;  2NYX A;  5AON A;  2WAE A;  3ZMS A;  2B9S A;  1OLT A;  2QQA A;  1MBJ A;  1MZB A;  1X1A A;  2DT7 B;  3K1M A;  4X1E A;  1HW1 A;  3WTX C;  4KFC A;  2DAO A;  5JLX A;  4KIC A;  2E35 A;  2KIQ A;  3K4J A;  1B8I A;  4MEX F;  1QRY A;  3K69 A;  1WCM J;  4KIT B;  4A5M A;  3NEU A;  4HOB A;  1JHF A;  2R4G A;  4ANJ A;  2EIM H;  4LD5 A;  2A6T A;  2RGV A;  4BL0 B;  1Z0X A;  4I6Z A;  1DU6 A;  1RI7 A;  2WAQ N;  3C18 A;  3COA C;  4JYK A;  1QGP A;  2VUM J;  3FIW A;  1OMI A;  2DDA A;  1WWX A;  1VFC A;  5J1R A;  3OYA A;  1YIT I;  1MKM A;  1E0E A;  3KEY A;  1TQM A;  5HS8 A;  3GYH X;  1D5V A;  5FFZ A;  1FSE A;  3JAM K;  3GVA A;  3KCC A;  1G2H A;  3BJ6 A;  4ZTF A;  2XIG A;  1FYL A;  3ZN0 A;  1JXS A;  3GTG J;  1QVU A;  1TP4 A;  3KP4 A;  4IO9 F;  2VJ4 A;  2V1X A;  3PM1 A;  3TKY A;  5K7F A;  2HQR A;  4ITV A;  3P5J A;  5CLS A;  4BUP A;  1D3Y A;  3UNG C;  4IHY A;  3DTK A;  5LFA A;  1OCT C;  3IH3 A;  1P6R A;  4DBR A;  3VEP A;  2HOS A;  1Y1W J;  4Z6Y A;  4D9J A;  2IBD A;  3M9A A;  5AIQ A;  3KYD B;  4XSZ F;  4RAY A;  3QWL A;  3K7A J;  4HV5 A;  3P9C A;  2HDC A;  1RES A;  4II2 A;  1MDM A;  1B72 B;  2XB0 X;  2RN7 A;  4MIM A;  2Z9O A;  2KDO A;  4C9Y A;  4D7N A;  1WI3 A;  4XOR A;  3G1O A;  4A3G J;  2TDX A;  3WE2 A;  1SD6 A;  4XBF A;  4DYC A;  1MBK A;  3I56 I;  2PI0 A;  1X1D A;  2NS0 A;  4XLF A;  3SQN A;  1NG6 A;  1QZY A;  3EQL F;  1HOM A;  2EFN A;  1ZLJ A;  3H3Z A;  2YU3 A;  2XPU A;  2P8T A;  4AID A;  3F6O A;  1T56 A;  2VE9 A;  4CGZ A;  4KIF A;  2BBY A;  1IUF A;  5HLI A;  2ELJ A;  3LAJ A;  2D2W A;  5HNH A;  2XGE A;  4IJA A;  4RAG A;  2NOJ B;  3C7J A;  3HUG A;  1J2X A;  4F55 A;  2WWY A;  2IS1 A;  4WX9 A;  2FOW A;  1BBY A;  1IRG A;  1MJA A;  4RBO A;  1O3R A;  4NHJ A;  5CVR A;  3I55 I;  3VSK A;  1Z91 A;  1T0F A;  2F4I A;  3M1C A;  1ETY A;  2M0M A;  3S14 J;  1GVD A;  1QZZ A;  1IN6 A;  3RPQ A;  4U7B A;  1IC8 A;  3CP2 A;  3GXO A;  2GIZ A;  4ESJ A;  2LOO A;  4BY7 J;  2V79 A;  2KT0 A;  4RAF A;  5JR3 A;  1XCB A;  1O4X A;  4S05 A;  1BN5 A;  3NWS A;  1IZ1 A;  2G7U A;  2DLL A;  2ECC A;  2DMU A;  4JBA A;  1U5T B;  1HW2 A;  2CQN A;  2E7X A;  4NDL A;  3JW4 A;  1WZ2 A;  2QYO A;  4U0V A;  4A3M J;  2ICW G;  1FP2 A;  5DUK A;  3I71 A;  4BQA A;  1BW5 A;  3F8N A;  2AHQ A;  5IY5 H;  4YEL A;  1FYK A;  1J59 A;  3LQQ A;  3DTE A;  2E36 A;  3GLL A;  5FGM A;  4YFN F;  4FTH A;  4CO8 A;  3I59 A;  4UUS B;  3AL0 C;  1IXC A;  3MKY B;  3AFH A;  4KT6 A;  1FOY A;  1FZP B;  2LBF A;  1J75 A;  1D1C A;  3ZCO A;  3K4B A;  1KGS A;  2Z16 A;  2K86 A;  3V4G A;  3J7A O;  5LLQ A;  2E1N A;  1OR7 A;  2JK3 A;  1KU2 A;  3ABM H;  2LKS A;  3RYP A;  1A31 A;  2LY9 A;  1RKT A;  5B66 C;  3CMA I;  2ID6 A;  2OQR A;  3SEZ A;  3ML6 A;  2ZKZ A;  3ASN H;  1FBQ A;  2G0E A;  1U78 A;  1DDN A;  1D8J A;  3OOP A;  4IKF A;  4L0Z B;  2ADU A;  3BR2 A;  4F92 B;  4LB5 A;  1HA8 A;  3V42 A;  2R7S A;  1N25 A;  3AKZ A;  2XAQ A;  1G3T A;  2QEN A;  3MAJ A;  4MLO A;  3VPR A;  1A04 A;  1HKQ A;  3FXO A;  3HGG A;  2JA8 J;  5JHU A;  4YIF A;  3SZP A;  1X2N A;  1WJ5 A;  3I59 B;  4UUS A;  4EGZ A;  4CCM A;  2HWV A;  3GCM A;  2EH3 A;  4AVZ A;  1SD4 A;  2UWM A;  3OYF A;  1E17 A;  5GAH J;  1FC3 A;  4MTE A;  4IRI A;  4V2F A;  3JRF A;  3LL7 A;  2IGO A;  4GGG A;  3FKI J;  2PMH A;  2EFQ A;  1H9G A;  4IPA A;  2LY1 A;  3BRO A;  4X0G A;  4BXU A;  2RNG A;  3IV5 A;  1JJ8 C;  5J40 A;  4UVB A;  3TP3 A;  4D7M A;  1LDD A;  1EV7 A;  4WF2 A;  5E8I A;  3L1P A;  2P5K A;  3HOT A;  3H0G J;  4BE1 A;  3OR1 C;  4MEY F;  4Y13 A;  3R60 A;  1KQ9 A;  3K4K A;  4XN0 A;  2EQR A;  4XRS G;  3G71 I;  2VPR A;  3H92 A;  2DA6 A;  1LFU P;  3GBG A;  2E2I J;  2Z99 A;  1DU0 A;  3JTH A;  4HEA 2;  2VE8 A;  3CDH A;  1U5T A;  2M87 A;  3LFU A;  5AIP A;  5LEK A;  3B6A A;  2BGC A;  2K9Q A;  3TO7 A;  4TV7 A;  4L18 B;  4G7Z F;  2CG4 A;  3HZJ A;  5JVG F;  1B4A A;  3J7Y J;  4C2U A;  3HDD A;  1ETO A;  3CC2 I;  3SEQ A;  3V7R A;  4BKX A;  3S1M J;  1SAX A;  4NUB A;  1GXP A;  3TL4 X;  4O6J A;  4P55 A;  2EIJ H;  4CSW A;  1W4M A;  1JTY A;  2XKP A;  2L54 A;  2KIS A;  1ZRD A;  5EGO A;  2RKH A;  2FX0 A;  2COM A;  5IPA A;  1W36 D;  2P6T A;  3IAS 2;  3S93 A;  3W6J B;  1XTA A;  2MLG A;  4EJO A;  1Y0N A;  1WPK A;  2BZT A;  5C44 J;  1YO5 C;  1LVA A;  5GPC A;  4M3G A;  3DPT A;  3ZQC A;  3S16 J;  4LB6 B;  1ZHF A;  3ECO A;  4BJ6 C;  2H1L A;  2Y9Y A;  4KA4 A;  3DBR B;  1B8I B;  3P9I A;  3RKX A;  2LP0 A;  2FJ1 A;  3WTS C;  5DTD A;  4HBL A;  1ZK8 A;  1Y39 A;  3CC4 I;  3PJR A;  3MEX A;  2DTR A;  2V7F A;  2CQK A;  3Q0U A;  5H6R A;  5HOO A;  3IP4 B;  2ZJP F;  2FML A;  1IG7 A;  3NRV A;  2NNY A;  1U9O A;  3L2C A;  1L3L A;  3T8T A;  1BC7 C;  1STZ A;  3ZOB A;  3CJN A;  4HNV A;  1FNN A;  4PCQ A;  2LRE A;  2L01 A;  3HJE A;  3VWB A;  4IHS A;  4KT5 C;  4KN4 X;  1TWF J;  1U8R A;  2ZME C;  1K78 B;  2P7C B;  1I1G A;  1ORK A;  3SZG A;  1R6R A;  3PO2 J;  2XAU A;  4A3L J;  2Q2E A;  2L9S A;  2R7V A;  3DBL B;  5D5X B;  3WGG A;  1BJA A;  5L3G A;  1XSD A;  2VKV A;  1YLF A;  3RSN A;  1DGR M;  1EA3 A;  1O7L A;  1K7A A;  4AD9 A;  3CDI A;  2M5W A;  2Q0O A;  2H8W A;  4OAZ A;  1GT0 C;  2LVS A;  3PNY A;  1YRN B;  1ON1 A;  4BQQ A;  3BR5 A;  2QLZ A;  2WTE A;  5D5W B;  1MIJ A;  4ZZD A;  1LKX A;  2N8G A;  2FA5 A;  1ULY A;  3BZC A;  3CMM A;  2HZT A;  1IV8 A;  2R7O A;  4L5E A;  5E18 F;  3M7G A;  4BAC A;  3AL0 B;  2L7Z A;  4II3 A;  3KEO A;  2L7K A;  5FLV A;  1MBG A;  1BI0 A;  3LOC A;  4MHG A;  2HNH A;  4I98 B;  3DKY A;  1VQ8 I;  5K7H A;  2XSD C;  1OIS A;  2CQX A;  2X6Y A;  2M7B A;  3PSI A;  5F64 A;  2JMW A;  4BDZ A;  2AS5 F;  3WG7 H;  2DI3 A;  1MDM B;  1TBX A;  4ZYE A;  5L3E A;  1X58 A;  5KVR A;  2VBX A;  1RKW A;  5HNF A;  1LB2 A;  3FMQ A;  4CYC A;  1IF1 A;  2M8E A;  2DA1 A;  2O3F A;  1OCR H;  1A6I A;  3IH2 A;  4UUV A;  2R7T A;  2FBK A;  4AU7 A;  3RIR A;  4P1W A;  4XLC A;  2VIX A;  2XAH A;  1YFH A;  3CJQ B;  4M3E A;  4AIJ A;  1XC5 A;  2HI3 A;  3ZQH A;  5C3E J;  2ME6 A;  2OC6 A;  4XOP A;  2CS3 A;  4JOM A;  3S8P A;  4RM3 A;  4BAY A;  2QM3 A;  2CV1 A;  3BR1 A;  4NB5 A;  4S04 A;  2F5V A;  2ISY A;  3FXR A;  1SEU A;  2FQ3 A;  3GZ5 A;  4L9T A;  5J3L A;  2M30 A;  2EZL A;  1SAU A;  4CCN A;  2DFF A;  3BG5 A;  1PYV A;  2P5V A;  3N97 A;  1MMA A;  5GP9 A;  4ENN A;  1ZGW A;  5B5E C;  4E7S A;  4BXX J;  5JVT A;  1SC7 A;  1Z3X A;  4Y15 A;  3RYR A;  1JKR C;  3K9T A;  5L3B A;  3A4C A;  4I2O A;  2VKD A;  1XMA A;  4EJU A;  2PBI A;  1BA5 A;  2O9L A;  3QU6 A;  2ACJ A;  4FX4 A;  5M5W J;  3GTL J;  2FMY A;  1QPI A;  5D5V B;  2XC7 A;  1JKO C;  1WKM A;  3OOU A;  1P7I A;  4M73 A;  2BW3 A;  5BPI A;  2HR3 A;  5DD8 A;  3CC7 I;  3SYT A;  2YR2 A;  1AHD P;  4OMY A;  3Q0V A;  1S72 I;  1FY7 A;  4XOT A;  4BY1 J;  4Y7N J;  5F0F A;  4DIQ A;  3BR6 A;  1X4P A;  4BJT A;  4IF4 A;  3DU6 A;  4IHV A;  2JA2 A;  1R49 A;  4PSX A;  1HLV A;  2HU9 A;  2LFB A;  3CLQ A;  1IXS B;  3RDI A;  1S6L A;  2X6W A;  3BPX A;  4Z2Y A;  1J7K A;  1ITY A;  1MW7 A;  2WAQ A;  1D0Z A;  3FMS A;  4D0P A;  2ELH A;  3MKL A;  2L4M A;  2X1C A;  4RA2 A;  4JX5 A;  3MD2 A;  2DN0 A;  3BC8 A;  2WA0 A;  2NOG A;  3L09 A;  3OYB A;  2ZSI B;  4BHC A;  3HHG A;  3GF2 A;  1QU3 A;  4LK1 F;  1X3W B;  3JCU C;  1K61 A;  2C6Y A;  4IQ4 A;  1YJ9 I;  4HX4 A;  4V19 K;  3TGN A;  3BY6 A;  2DW4 A;  1F9N A;  5DCM A;  3K4N A;  4IX7 A;  1CGP A;  3A2K A;  1XMX A;  2H09 A;  3A01 B;  3TDU C;  4WWC A;  5DEQ A;  5D6F A;  3WU2 C;  4CYC B;  3CLO A;  5KAI C;  2AQF A;  1P4A A;  2A61 A;  4E6K G;  2P81 A;  5JFR A;  3CCU I;  2FOK A;  3WU0 A;  3ERE D;  3BOQ A;  3IRR A;  5JHF A;  2A07 F;  3OYN A;  2ESH A;  4I0A A;  1YOV B;  4L9J A;  4JK1 X;  1TQI A;  5EGO B;  3RKW A;  2LF8 A;  4EMS A;  2NVT J;  3HOV J;  2DOE A;  2WY8 Q;  1RZ4 A;  3HKZ N;  3I0T A;  2LH9 A;  3PFY A;  5EEG A;  2KPM A;  1IN5 A;  5FLX Z;  2L2O A;  2E1M C;  3ABT A;  5CJ9 A;  1FPQ A;  1HBX G;  3WE3 A;  2FNA A;  1BI1 A;  3TQN A;  1LNW A;  2DA5 A;  2X48 A;  3CF5 F;  1AU7 A;  4XNF A;  1P7J A;  1YHQ I;  2M34 A;  2FE3 A;  4MFE A;  1VQ5 I;  3JRD A;  1ZAR A;  1LUJ B;  3K2A A;  1E2X A;  1R5I D;  3IAM 2;  4Y33 A;  1TWG J;  3OWT A;  1K6O A;  2LC2 A;  4NQW B;  4XKW A;  1AA7 A;  2HOE A;  3OIQ A;  1OYI A;  1MND A;  1JT0 A;  3F8F A;  3LSP A;  2D1V A;  5F08 A;  3DV8 A;  2EIL H;  2L4A A;  2VKH A;  1LEB A;  2Y31 A;  3KYL A;  5HDG A;  1EH6 A;  2QSG X;  2NS8 A;  2F5F A;  3BG6 A;  5DDG A;  2KLO A;  3JRH A;  2IA1 A;  3DEE A;  2HVS A;  1R5G A;  1RNL A;  1SAN A;  2VQG A;  2W57 A;  5F0C A;  3FF5 A;  2F48 A;  4B48 A;  3R4K A;  2Z33 A;  1LDK B;  4HLY A;  2OPT A;  5CPR B;  3WTU C;  4HQE A;  1TT0 A;  1WJE A;  1WGX A;  4XIC A;  3M8F A;  5FLX K;  3WU1 B;  1BM9 A;  3VOD A;  1I39 A;  3LSM A;  1UHS A;  2IP2 A;  4A0Z A;  3MZH A;  4P96 A;  2LNB A;  2VJ5 A;  2AXL A;  1VZ0 A;  3BG9 A;  4HLX A;  4M3F A;  5JI6 A;  4BU2 A;  6PAX A;  2OD5 A;  4FET A;  4M3B A;  2JA5 J;  1VI0 A;  1BIA A;  1YX5 A;  4ZYH A;  2XDV A;  3E5Q A;  2P6S A;  1IDZ A;  2OF7 A;  2EBI A;  1T33 A;  3J80 K;  2TRT A;  4OMZ A;  2BOL A;  1KYW A;  5JLW A;  1ZGJ A;  1BC8 C;  1DP7 P;  3S1N J;  3GTJ J;  2QKL B;  4BQO A;  1JUS A;  1O3S A;  4AM3 A;  3RJP A;  1OR7 C;  2I8D A;  3SXY A;  3K0L A;  2BEO A;  1E3O C;  3CCE I;  1YYV A;  2IJL A;  1UG0 A;  1EJ9 A;  1O3Q A;  4MQV A;  1R1U A;  1ON2 A;  1T0F C;  5KHD A;  5D6E A;  3F0C A;  1Y0U A;  1S8N A;  2CW0 F;  2UV1 A;  5IYB J;  3DXJ F;  1HKS A;  4LIU A;  4XMY A;  1V54 H;  2ID3 A;  2JRM A;  2VXD A;  5EYR A;  4ZDO A;  4UY8 I;  2L0K A;  5DD4 A;  3ZGK A;  4BE0 A;  1BOA A;  4L0Y B;  3U9G A;  3OYC A;  3M3Y J;  3CD6 I;  1ZG1 A;  4M71 A;  1H88 C;  4KJZ A;  4DZP A;  3J81 Z;  2KZV A;  4AVP A;  1OCZ H;  3S1R J;  2NVU B;  1V5F A;  2ZJQ F;  1Z7L A;  3D5L A;  1SVO A;  2Y48 A;  3PO3 J;  2W4S A;  4F7Z A;  1WJF A;  3HC7 A;  3JRE A;  2KHM A;  3BPV A;  5D8K B;  1M1E B;  1XPX A;  1WH5 A;  1IN8 A;  1VQ9 I;  3K70 C;  1QHG A;  3ERM A;  3ECH A;  1K4T A;  2X51 A;  3N05 A;  4B47 A;  2H8R A;  2CWE A;  5EEA A;  2ZFU A;  5FKL A;  1W7P A;  2JZY A;  4ZH4 F;  1YE9 A;  2KJC A;  1ZEL A;  4IHW A;  2V1N A;  4PJJ A;  5CQG A;  4DOZ A;  2IVM A;  5FRM A;  3LSK A;  3QOD A;  5FJ8 J;  1XMK A;  3DP7 A;  3DPL C;  1X4O A;  3K4M A;  1P4X A;  3M1E A;  3W2A A;  4E7L A;  3OYJ A;  1G3S A;  4AIK A;  4MGR A;  4GYI A;  1D0Y A;  2ZJR F;  4D1Q A;  2M1B A;  4MQ9 F;  3V8J A;  1JKQ C;  1JGG A;  4XLP F;  4D5F A;  2XUB A;  2JSP A;  4IOC F;  2FXA A;  3K4L A;  4ZJZ A;  1YW7 A;  3CJR B;  2MC3 A;  2IA0 A;  3ZQI A;  1TW3 A;  3J81 K;  3S2H J;  3PUB A;  1IUY A;  2BXZ A;  3I58 A;  5FB2 A;  3IRQ A;  1RIO H;  3SZT A;  4CUG A;  1D1A A;  3T8R A;  4HQM A;  5GTI C;  1NTC A;  5DYM A;  1KA8 A;  4A12 A;  4A93 J;  3ZPL A;  3QYE A;  3FXU A;  2CW8 A;  1VQ7 I;  1WRJ A;  5M5X J;  2HDW A;  5DCM B;  3WGH A;  3G6E I;  1XX5 A;  5M3M J;  3NQO A;  3BZ6 A;  3HOZ J;  3LWF A;  1S7A A;  3K2Z A;  3KZZ A;  1YS6 A;  3FIS A;  3Q0W A;  3A0H C;  3E0J B;  2BW3 B;  2IRF G;  2F2E A;  3MKW B;  1X1P A;  1NK2 P;  2E5Z A;  3L7W A;  4EQQ A;  2NVY J;  3T1B A;  2DK8 A;  3CCM I;  2E5N A;  3CCQ I;  1G59 A;  2L5Q A;  1DPR A;  4HRI A;  2GXB A;  5B1A H;  1Z6R A;  3NAU A;  3A01 A;  4A3J J;  2R0Q C;  5GAE J;  4G6D A;  2QQB A;  3C2B A;  2JRT A;  1BR1 A;  5HDN A;  2A69 F;  1D0X A;  5FD5 A;  1JT6 A;  2FF4 A;  2MFZ A;  4Y52 J;  5A2Q K;  1HDP A;  2GWR A;  2MD5 A;  2QF7 A;  1GV2 A;  2B7E A;  2BHZ A;  5FKO A;  3LSR A;  3OS2 A;  1GV5 A;  4BXF A;  3FKJ A;  4U0Y A;  3WTW C;  2RDP A;  1JUP A;  4OOI A;  3RTR A;  2E1C A;  4LLG F;  2WB1 N;  2Y75 A;  3H5N A;  4A3I J;  3U2R A;  3C1D A;  1TNT A;  1XD7 A;  3KLN A;  3HRS A;  3W6V A;  3L2R A;  3F9K A;  2HS5 A;  2UUZ A;  3E5X A;  3F3X A;  1ZRE A;  3JTG A;  5ICF A;  2HEO A;  4C3I J;  4B4C A;  4C3H J;  3K6G A;  1QNT A;  2EWN A;  3FM3 A;  4C30 A;  3T0Y A;  2CYY A;  2STT A;  2KFD A;  3VYU B;  1PUF A;  2MG4 A;  4BE2 A;  4HX8 A;  3Q3S A;  4F52 A;  2DCE A;  3OIP A;  3TED A;  2M9H A;  1J5Y A;  1B9N A;  3GEZ A;  4J01 A;  1F1Z A;  2FD5 A;  2MAB A;  4QLC U;  3OS0 A;  2P0W A;  1ETQ A;  4H4K C;  4C2T A;  2F5C A;  3WTV C;  2UZK A;  2H27 A;  3FK7 A;  2R7X A;  2JN6 A;  4A3E J;  3BTI A;  2CUE A;  3L9F A;  4MO7 A;  1ZR2 A;  1UCR A;  3RPU D;  1DUX C;  4L5I A;  2DYR H;  2DK5 A;  3MVP A;  1XDU A;  1KON A;  1WJB A;  3AG3 H;  2CUZ A;  1PVE A;  2OA4 A;  3F21 A;  3WOD F;  2WAF A;  3M4O J;  2JA7 J;  2PLY A;  1ETW A;  5TGT A;  5IP6 A;  3LFK A;  3QAH A;  2LBF B;  3I4P A;  3L00 A;  3H0D A;  2IW5 A;  4EM0 B;  4O3M A;  4YEJ A;  2OJE D;  1KU3 A;  5HVQ C;  3F72 A;  2FBI A;  2IXS A;  2Y0S N;  3LNQ A;  4X6A J;  3K1N A;  2ZBK A;  4AWX B;  2EIN H;  2FBH A;  2VAS A;  5LGN A;  5E8G A;  5ILS A;  2K5C A;  4KUM A;  1I3Q J;  1H8A C;  4XLN F;  4IRH A;  2IGK A;  2NVX J;  3W3C A;  2ETH A;  3IHU A;  3KP7 A;  4M9Z A;  4XKV A;  3TOB A;  1IGN A;  3FDY A;  4U7D A;  2EB7 A;  2VC0 A;  5EDN A;  2ZB9 A;  2W1O A;  1KQ0 A;  3DF8 A;  4KIB A;  1YRN A;  2QGU A;  1SFO J;  4UB8 C;  1GLN A;  3EPZ A;  2D5V A;  1YJW I;  1FMW A;  3WTT C;  4ENJ A;  3IWZ A;  3DEU A;  2GM4 A;  1FX7 A;  3BCB A;  1PP8 F;  4KNY A;  4BHB A;  4E7H A;  1OKR A;  1U5T C;  2XRO A;  4NC7 A;  4V2G A;  4ESB A;  1V55 H;  1FOW A;  2VJJ A;  3ELK A;  1HSJ A;  3LSG A;  1T95 A;  3CO6 C;  2Y0S A;  4NBQ A;  3GW2 A;  3V8L A;  4A69 C;  2MBF A;  2VBY A;  3FWE A;  2E60 A;  3SJM A;  4IVN A;  2OTL I;  5HS9 A;  1UB9 A;  2X4H A;  1WJD A;  2QEX I;  5D4S A;  5LHI A;  3FMR A;  5B3S H;  2VON A;  4UHT A;  3P9K A;  1SMT A;  2JPC A;  4DGW B;  2L9N A;  1Z7U A;  4QSH A;  1YI2 I;  4N0B A;  4BEH A;  4I09 A;  1B72 A;  3ASO H;  4Y4R A;  2DOA A;  1YW8 A;  3G73 A;  4HF0 A;  4UXN A;  3BJO A;  5F1R A;  4OIO F;  5BQT A;  3M8J A;  3M8E A;  1ZG3 A;  3CCR I;  2QZ8 A;  4RGX A;  2PFB A;  3TDZ C;  2O03 A;  1T39 A;  4KIG A;  5KAF C;  1Z67 A;  4FCY A;  3U1K A;  3I5U A;  3EUH A;  3SHF A;  3J7Z I;  2XV4 S;  3A0B C;  1ZG5 A;  2KIU A;  4XLE A;  1W7P B;  1ZQ3 P;  1XDS A;  4R8H A;  2YX4 A;  2K4J A;  3LQR A;  1IRX A;  2LKP A;  3F8B A;  1R7J A;  2VT2 A;  3F22 A;  4UUT A;  3C3W A;  3E6D A;  1WQ2 A;  4I02 A;  3KEQ A;  1KZH A;  1V3F A;  1W7P D;  1HXD A;  2KRF A;  4QPQ A;  2YX7 A;  4PJL A;  2TCT A;  3RKQ A;  4LJZ F;  1X19 A;  1FEX A;  3OSF A;  2WB1 A;  3KET A;  2X6O A;  4XRS A;  5J47 A;  2JUG A;  2Y9Z A;  4LK0 F;  5L3D A;  3FHN A;  4LG0 A;  3WTZ A;  2A5W A;  1ZLK A;  1MMD A;  2ZC2 A;  2WV0 A;  1HST A;  1X2M A;  2R7F A;  1RRJ A;  1G3W A;  1GDT A;  3FZV A;  3DBH B;  2LRD A;  3H35 A;  1S29 A;  5EJC A;  3CQZ J;  4UNO A;  2RVC A;  4BBS J;  1YW9 A;  3ZMZ A;  1REP C;  1YS7 A;  1QZE A;  3BJA A;  1FWZ A;  2RV8 A;  3ZMU A;  2QBY A;  3DLL F;  5E1W A;  3A03 A;  1OYY A;  4DW6 A;  2KL4 A;  2BVL A;  3HTS B;  2DJI A;  1CF7 A;  2XVC A;  2ZNY A;  1ZH5 A;  1H9T A;  4BQN A;  4H0E A;  4U87 A;  3AAF A;  1QHH D;  3L2Q A;  1DPU A;  1B9M A;  2YPR A;  3GTM J;  2LR8 A;  3VFZ A;  3VSL A;  4S0H B;  3HGY A;  3FXL A;  1LJ9 A;  2Q8K A;  2E7W A;  1SFU A;  2GXA A;  4UV8 A;  1LFB A;  5EF6 A;  3LSJ A;  4ZYA A;  1TZL A;  1TWH J;  2YSR A;  2FUG 2;  1ACI A;  1PDN C;  1UJ8 A;  4Y17 A;  3NAR A;  1B1B A;  3S32 A;  2VT3 A;  4P5O A;  2IS4 A;  2A5Y B;  4BEH B;  1JE8 A;  1GXQ A;  3ZRG A;  2EA2 A;  4CDG A;  2XAS A;  3R0J A;  4BDY A;  2KIF A;  1HCR A;  4ZYG A;  3ZMD A;  3ZQ7 A;  2HPI A;  2CO5 A;  5FFX A;  2K02 A;  2XRN A;  1Q1V A;  3FHZ A;  2I5U A;  2RRE A;  3OYD A;  1VQ6 I;  4CZZ A;  2ME0 A;  3D0S A;  2JSC A;  3DTI A;  2CUF A;  1MNM C;  4JX6 A;  2OBP A;  2HPM A;  1GUU A;  2M0C A;  4N9H A;  1FOX A;  4A3F J;  3SDG A;  3E6B A;  4IL6 C;  5C4J J;  4LG0 B;  3BTL A;  4AUX A;  2K9S A;  4KIS A;  2M8G X;  3ZMV A;  3BDD A;  1HW5 A;  1BI3 A;  3BQY A;  2V9V A;  4JP0 A;  1IO2 A;  4IQJ A;  4JX4 A;  1X3Z B;  2OCE A;  3DPU A;  3P7N A;  1UHW A;  1RPW A;  1ZAO A;  1OQY A;  3HG9 A;  3RCO A;  4EAT A;  1R71 A;  2VQC A;  1VND A;  2HFH A;  4RAZ A;  3S3N A;  1W1W E;  1T6S A;  1QQI A;  1Z21 A;  2HKX A;  1RR8 C;  3OL3 A;  1FMV A;  2COB A;  3H5A A;  1BR4 A;  1XSV A;  3VYR B;  3Q9S A;  5D8L B;  5FRN A;  2KRC A;  3HOS A;  1R36 A;  4RLF A;  3LSI A;  1D1B A;  4JQF A;  4EM2 A;  1G4D A;  1HF0 A;  1CQT A;  3D5S C;  5H20 A;  5LRS A;  3GFI A;  1JJ6 C;  3QP5 A;  3HSE A;  2DA2 A;  4A2U A;  1IV6 A;  3QOP A;  2EFO A;  3RPU A;  5IYC J;  5K5Q A;  4QWQ A;  3FBN B;  1FTT A;  3I3L A;  1HKT A;  2ECB A;  2NVQ J;  3HOW J;  1RR7 A;  4GO1 A;  3KIO A;  4PJN A;  2PJR A;  3M07 A;  4GYG A;  4OIP F;  2GAU A;  4OU0 A;  2CSO A;  4Q4Z F;  5CQE A;  1FLI A;  3TP0 A;  4E4H A;  1MJ9 A;  1IDY A;  4M6V A;  3GTK J;  3VDX A;  5LRR A;  3KZY A;  4ZTJ A;  2JVG A;  2CRG A;  4EV0 A;  4MNU A;  2YU9 J;  4FT8 A;  4HPQ A;  1TL8 A;  1PUF B;  1BOB A;  3H9Q A;  2H1K A;  3O8G A;  2ZXW H;  3G1L A;  3MZY A;  4Q47 A;  4ZDL A;  3K10 A;  1FTZ A;  1P4W A;  1R23 A;  5IYD J;  1I6H J;  1X1C A;  2DO7 A;  4B1R A;  1FT9 A;  2HTS A;  4G6Q A;  2QKM B;  4PZJ A;  5DCF A;  3RKY A;  3SFZ A;  1H89 C;  3I54 A;  1JHH A;  4FAS D;  2XRL A;  4XKB A;  4LLL A;  3PFI A;  3EUK L;  4OIQ F;  2ISZ A;  1YIO A;  3IUO A;  1RET A;  2IEK A;  2VBZ A;  1C0W A;  4IHT A;  3W6K B;  2R7R A;  2YS9 A;  5HDK A;  5F04 A;  4ENM A;  4BS9 A;  4DBQ A;  1FOK A;  1WSU A;  1B6A A;  1HDD C;  2DFI A;  1MMS A;  1V5G A;  2IT0 A;  3GO5 A;  4BJ5 C;  4NC8 A;  3PUF A;  2CW7 A;  2LSO A;  4R1H A;  2R7Z J;  5J4V A;  2VQH A;  4OIN F;  3D5R C;  2VPL A;  4A3K J;  2H94 A;  1EH7 A;  3B6C A;  1FP1 D;  1QBJ A;  4M6X A;  4XLA A;  2M3A A;  3GTP J;  4G9Y A;  4M9S A;  2F5E A;  5H2F C;  4HV6 A;  4MFD A;  4R79 A;  1F43 A;  1BL0 A;  2DOF A;  2R5Z B;  4E7Z A;  2HVR A;  4ON0 A;  5E79 C;  2K3F A;  3FXJ A;  3BZK A;  2DTZ A;  4K2E A;  2XAJ A;  2Y69 H;  2OV7 A;  2KRH A;  3KP2 A;  5F0H A;  3W2V A;  1FYM A;  1E3H A;  5FRO A;  4CCJ A;  2R5Y A;  4WK8 F;  4HA8 A;  4CCL A;  5GAG J;  4ENK A;  5LD2 C;  2LG4 A;  1T08 B;  2FNP A;  3GUD A;  4I0B A;  1YTY A;  3WHC A;  2HDD A;  4YRV A;  1UG2 A;  3E97 A;  3S3M A;  3KP6 A;  3CCY A;  3O3K A;  4WXD A;  1SVM A;  2VJI A;  4RB1 A;  1ZRF A;  4E7I A;  2M45 A;  1SD7 A;  2OTJ I;  3DLA A;  1Z3Y A;  1BR2 A;  2XGC A;  5BNG A;  2B0L A;  4HZF A;  4XON A;  2QCO A;  2M4K A;  2XAG A;  4RS8 A;  3OMY A;  2V9P A;  2HQN A;  2R7D A;  2H6B A;  4LOC A;  2PJP A;  1OCC H;  4CA0 A;  3QPL A;  1I27 A;  4CH7 A;  1N77 A;  3BLY A;  3KYC B;  4NC6 A;  2CMP A;  2E1O A;  4DQ2 A;  1Y1V J;  1LQ1 A;  1QVT A;  2MLK A;  2VC1 A;  3ZXS A;  1NK3 P;  4FE4 A;  2WBM A;  2XF5 A;  3C2H A;  5ILV A;  2W82 A;  2EFP A;  1U0J A;  3CTA A;  1YQA A;  2JJ7 A;  5FKK A;  3TO6 A;  1P9Q C;  2BXY A;  3CME I;  3ABL H;  2IAI A;  1NG7 A;  4I01 A;  3D1N I;  2MC4 A;  3OYM A;  2QWW A;  2NXN B;  5EEH A;  3T5X A;  1F5T A;  3L2W A;  1U9N A;  3F6V A;  4D5C A;  2BY2 A;  1IW7 F;  3L2U A;  3IKT A;  1Z77 A;  3KZI C;  1WH7 A;  1MH3 A;  2VBW A;  1MBF A;  3KPH A;  2LTP A;  3I9V 2;  4EGY A;  2O0Y A;  4HNU A;  2OZU A;  1O7F A;  1NH3 A;  2HOA A;  2DQR A;  3GWZ A;  2W7N A;  1ERD A;  1RUO A;  3KX2 A;  1TWA J;  3BG3 A;  1ZR4 A;  3CF2 A;  2EV0 A;  9ANT A;  4HYE A;  4Q5S F;  1FJL A;  4L9V A;  5EG0 B;  3QQA A;  3HOY J;  5L3C A;  3S1Q J;  2ZME B;  4G12 A;  4XL9 A;  1MMN A;  1LE8 A;  3B73 A;  5HS7 A;  2LLK A;  4QIW N;  2E34 A;  5TRD A;  5J1Y A;  3ZQQ A;  3E1S A;  2CFO A;  4XR6 A;  2PJR B;  2UXN A;  3TO9 A;  1R4N B;  4RMN A;  2K7L A;  2LDU A;  4NQW A;  1UST A;  1XCV A;  2FSW A;  1Y8R B;  4M6Y A;  3VYS B;  3Q5F A;  3NWT A;  2Z5U A;  4HSR A;  3KP3 A;  4XQF A;  1LVK A;  1K6Y A;  4XK4 A;  2EFW A;  3R6S A;  5M3F J;  1POG A;  5LHH A;  5M5Y J;  3O2P E;  4OAY A;  5FO5 A;  2VLA A;  4PJM A;  3OYL A;  5CVU A;  3BR0 A;  4RM2 A;  3RZO J;  4I7H A;  3GX4 X;  1K83 J;  4ETS A;  4M74 A;  2L7M P;  3BR3 A;  3HPH A;  2OZ6 A;  3L2V A;  4OWR B;  2PN6 A;  3FXM A;  1ZYR F;  2G7H A;  3E6M A;  2E2J J;  2CV2 A;  2M7A A;  3CMY A;  5E3O A;  1MGT A;  2VOP A;  2Z2S B;  2EPF A;  1MNE A;  3BWG A;  3HSR A;  3WGI A;  1IAW A;  5K7Z A;  1J09 A;  2Q1Z B;  4RGU A;  4P9F A;  2O8K A;  4CHU A;  1X1B A;  1YJN I;  2DBB A;  4B43 A;  5E3L A;  1Y6I A;  2Y30 A;  2JA6 J;  3CCL I;  1CF7 B;  2PX9 A;  1JGS A;  3GFL A;  3W2W A;  1ETX A;  2JT1 A;  1N75 A;  2RC4 A;  1V5E A;  2NAZ A;  2VKE A;  5E1X A;  3VOE A;  1VQP I;  1W0T A;  2W00 A;  5B1B H;  3R61 A;  1R1V A;  4L5J A;  5TIS C;  3LST A;  2O61 A;  1IRF A;  2V9K A;  1AKH B;  3HSF A;  4PFP A;  1SMY F;  2F4O B;  2GQQ A;  4LFU A;  2FU4 A;  2HZD A;  4KN7 X;  1VTN C;  2KJB A;  3G3Z A;  4ZC3 A;  1FIA A;  2V6E A;  3QPS A;  5ICE A;  4M3D A;  1MMG A;  1Z9C A;  3I4N J;  1LFP A;  1S7O A;  2DMT A;  4A6E A;  2J5O A;  1OJL A;  1UFM A;  2JTV A;  2L9R A;  1WI9 A;  5IOY A;  5J8F A;  2DQL A;  5LGU A;  3TW7 A;  4A3C J;  3KFW X;  2QBY B;  2G9W A;  1G6N A;  4BYY A;  3CUQ B;  4EJV A;  4A3B J;  4ESF A;  2W84 A;  1U3E M;  2KMU A;  4WXH A;  1XGS A;  4A0X A;  3JRI A;  2EA4 A;  2BYV E;  3IWF A;  4P9U A;  1LEA A;  1BW6 A;  2IGN A;  3DKW A;  3IC7 A;  5E1Z B;  4RDU A;  4ABZ A;  1A6Q A;  3TOA A;  3OYK A;  5J8C A;  3TMO A;  2QUF A;  1FIP A;  2R92 J;  1LDJ A;  3E6C C;  1XGM A;  3MKZ A;  2VN2 A;  2KKO A;  1WJA A;  2XGD A;  3FM5 A;  4FIS A;  1HQC A;  3DKX A;  1F4K A;  4U0W A;  3IH4 A;  3F8M A;  1QPM A;  1U6G A;  2W24 A;  3CDL A;  3ULQ B;  2CFX A;  1S9H A;  2IS6 A;  2OQG A;  2J5P A;  3C2G A;  3GFJ A;  4HDU A;  2DDB A;  1EKE A;  2MH9 A;  3HYI A;  3ZMT A;  4IZZ A;  5HLG A;  2FEZ A;  1YG2 A;  1XG1 A;  3H5R A;  3H9J A;  1SFX A;  3FX3 A;  1MBE A;  1GHC A;  2E71 A;  1GVJ A;  4YG2 F;  4FX0 A;  3GTO J;  2QQ9 A;  1ZGA A;  3EDP A;  4F3Q A;  4EJT A;  4M72 A;  2HXI A;  2MD0 A;  4PK4 A;  1TWC J;  3G4S I;  1IN4 A;  2D1H A;  4DYQ A;  2HOT A;  1XGO A;  3S15 J;  4HNT A;  1FBU A;  3GFM A;  1R1T A;  2V1D A;  1T98 A;  2CQ7 A;  3QYF A;  2P4W A;  2JPB A;  1UZC A;  5HOD A;  3EUH C;  5TJJ A;  3K70 D;  2ZCW A;  1UEL B;  2DA4 A;  4KMU X;  3UR3 C;  3CES A;  5E3N A;  3LSH A;  3JRA A;  1S7E A;  4IXA A;  1BI2 A;  4O5V A;  5J6X A;  2BY1 A;  2GIV A;  3KLO A;  5D5U B;  4KYW A;  5DM7 F;  2A05 A;  3F8C A;  4HST A;  1I1S A;  3ABU A;  5IOZ A;  1P2F A;  3UKG A;  4F93 B;  2KIM A;  3OS1 A;  1XS9 A;  3RQ4 A;  4AIH A;  3DFG A;  1I5Z A;  3R0A A;  1VQK I;  1EF4 A;  1WHU A;  1MBH A;  5LHG A;  1VQO I;  4C2M J;  3HRM A;  4N4O B;  1UMQ A;  2MA3 A;  5CYV A;  1G8X A;  1SVL A;  2I10 A;  3ZQF A;  3PNT A;  1DGW Y;  2K40 A;  4FQG A;  3ZP5 A;  3HM5 A;  2K9N A;  3A02 A;  2X6X A;  2KZG A;  2VXZ A;  2QA4 I;  1D5Y A;  5K5R A;  1R00 A;  5CVJ A;  4UV9 A;  1N78 A;  4XKC A;  4WCG A;  1VQ4 I;  4Q48 A;  2L02 A;  2DJN A;  5FLM J;  3JR9 A;  3EYI A;  2A3S A;  2F4M B;  1MH4 A;  4ASN A;  3S17 J;  2GA1 A;  2VI6 A;  3OV8 A;  4EM1 A;  2V26 A;  3B02 A;  4B44 A;  1I3A A;  2HQA A;  2PEX A;  5FKN A;  2ZJ2 A;  3CUQ C;  3PQK A;  3H1C A;  3SDB A;  1AOY A;  3MQ0 A;  3TBI A;  3EET A;  1LE8 B;  1FBS A;  2DU9 A;  1RC9 A;  2PMZ N;  3EYY A;  2BY0 A;  5K5O A;  3CCS I;  2RNJ A;  5ICC A;  4HDV A;  1LPQ A;  3HBL A;  3PIP F;  3PIO F;  2MH2 A;  3KE2 A;  2OUM A;  2XF7 A;  4E70 A;  1JTX A;  2BHY A;  1TQP A;  2FQ4 A;  2Z1D A;  3F23 A;  2HYF A;  2K3P A;  3ABK H;  4RGR A;  4XRF A;  4BBR J;  3HOX J;  3DCF A;  1MSF C;  3I4M J;  2XSJ C;  2K4B A;  1DP3 A;  2DFH A;  3HRU A;  2LD5 A;  2R93 J;  4J00 A;  1TNS A;  3ESW B;  3G2B A;  3GZ6 A;  4PFO A;  2R7W A;  5ERI A;  1T2K A;  2JVH A;  4IOA F;  3EUA A;  3I53 A;  1TC3 C;  3V7S A;  2WV1 A;  2WC2 A;  5DM6 F;  1YX3 A;  2F5D A;  2OAZ A;  3E3V A;  1WVR A;  1W5S A;  4YIR X;  3JAM Z;  1K79 A;  3FK6 A;  5LEJ A;  2GLO A;  2DA7 A;  3BT9 A;  3OYI A;  2ZO4 A;  1A35 A;  2B63 J;  3S2W A;  2VL8 A;  2R3S A;  4Y3O A;  4CCK A;  3E7L A;  5ILU A;  1Z05 A;  2W85 A;  5DUI A;  1OYW A;  2ESN A;  3QPH A;  4UB6 C;  2F6C A;  3IKV A;  2HQ5 A;  3JRG A;  4AYB A;  2O8X A;  1WFX A;  3HTU A;  4B09 A;  3HIF A;  1IXR C;  3JSO A;  2E1M B;  1B59 A;  4B3X A;  3OYE A;  2W48 A;  1NHA A;  1RUN A;  2PG4 A;  3CP8 A;  2V1U A;  2XPW A;  2L9V A;  2KQR A;  5FD6 A;  3J80 Z;  5LGT A;  1S3J A;  3CZ6 A;  3MN2 A;  2QSF X;  1ODD A;  2LY2 A;  3QYB A;  2KDZ A;  3LAP A;  3FBI B;  2HKO A;  4A6D A;  1ONV A;  2DPD A;  3H9G A;  2EIK H;  1ZKG A;  3CCV I;  3DQV C;  4DJA A;  4OIR F;  3V8K A;  2EZH A;  2O5R A;  1VQN I;  1J0R A;  3ROU A;  2MYS A;  3CO7 C;  2ZME A;  5IT9 K;  3PSF A;  4UVC A;  4GRI A;  3CUO A;  4A0Y A;  1ETK A;  4N4N B;  2EJR A;  1R58 A;  3PNV A;  2GA2 A;  3CUQ A;  1SFK A;  1EH8 A;  2ZXI A;  1TTY A;  5C4X J;  3H36 A;  1AKH A;  3MCZ A;  1DQU A;  2DFE A;  4LLN A;  1KQ8 A;  2BE5 F;  4LIT A;  5L3F A;  1P92 A;  2DA3 A;  5K1Y A;  2ZFW A;  4BHP A;  4J19 A;  3ONQ A;  4IRG A;  1U2W A;  4MTD A;  1UHM A;  5KCM A;  2STW A;  2GOX B;  3J7A Y;  2WAD A;  1MJB A;  1AWC A;  1O3T A;  1O57 A;  1R5H A;  3JRB A;  2H6C A;  3HPG A;  1BJZ A;  2QSH X;  3ISP A;  3HL2 A;  2Q2E B;  2EZK A;  3HXL A;  3Q9V A;  4HX7 A;  2JUC A;  2BVM A;  5IT9 Z;  4XM3 A;  4PUS A;  4PSW A;  2WY7 Q;  1HC8 A;  2LF7 A;  2K85 A;  2K9M A;  2KP6 A;  1XN7 A;  3OYH A;  4ZZL A;  1TT5 B;  1T8I A;  1W5T A;  2AQE A;  4GXO A;  3BTJ A;  1R4M B;  2K27 A;  3TW6 A;  1Z6T A;  2CH0 A;  2MW8 A;  2YUS A;  5KNL A;  4HF1 A;  1ZRC A;  5A2Q Z;  1XB4 A;  4FE7 A;  3U1D A;  2JWT A;  2VQL A;  3S2D J;  4IEJ A;  2HXO A;  4HG2 A;  4ZDP A;  5BOX A;  2EZI A;  4N9I A;  4XSX F;  5D4R A;  5EZH A;  3OL4 A;  2HTJ A;  2DMQ A;  3S3O A;  2HGC A;  4DYR A;  2X9D A;  2LYC A;  2IA2 A;  2XPV A;  4CIC A;  5E3M A;  3GME A;  2R7U A;  3HOU J;  1QO0 D;  4WXC A;  1Z1D A;  2DT6 A;  3AG4 H;  2M2E A;  3BQZ A;  3MWM A;  3SFI A;  1KU7 A;  2A68 F;  1H0M A;  3VB2 A;  3DWL E;  5EG0 A;  3LMM A;  2RAE A;  1KU9 A;  3LA2 A;  1I50 J;  2HYJ A;  3MZ8 A;  2D45 A;  2R5Z A;  4CXF A;  2XF6 A;  2DPU A;  4EVI A;  1SD5 A;  4XLH A;  4G7H F;  4LMY A;  2XKO A;  3PQJ A;  3ZN1 A;  1BIB A;  3DU5 A;  3O6B B;  2VB6 A;  3QPT A;  3GZN B;  4BGD A;  3AG1 H;  4GFB A;  4UVA A;  2A6E F;  2E19 A;  1YIJ I;  4KDP A;  3OIO A;  4A3D J;  1R22 A;  4HF2 A;  2P7V B;  4XID A;  4RGS A;  3OR2 C;  3QU3 A;  2Y2Z A;  2ZXJ A;  3HKZ A;  5KK1 A;  4W1U A;  3ZQG A;  1JKP C;  3G1M A;  1VF9 A;  1X3U A;  2DT5 A;  2QVO A;  4AC0 A;  4F91 B;  5DS9 A;  5EZG A;  3MMY B;  4EJW A;  3QP6 A;  4ZYD A;  2AXT C;  3BP8 A;  3RI4 A;  5GPA A;  2HVQ A;  2FRH A;  1T38 A;  5CKT A;  2ZXH A;  1QA6 A;  2RQQ A;  5H6Q A;  2DXI A;  2LK2 A;  2DYS H;  4KMF A;  1D8K A;  2LKX A;  3LA7 A;  2CQQ A;  2W25 A;  5F1J A;  3GLX A;  4QTR A;  3N4M A;  4DZJ A;  4FHT A;  2XGX A;  2E2H J;  2MSY A;  5BS6 A;  1XGN A;  2XHK A;  3QRF F;  4CZC A;  4YFK F;  2NS7 A;  3CJT B;  4E7K A;  3HEF A;  1TW2 A;  2BY3 A;  4E7J A;  5GAD J;  2EK5 A;  2IPQ X;  1OPC A;  3JRC A;  1I6X A;  1L0O C;  3K4C A;  2ZSH B;  2V4J C;  1USS A;  3H3U A;  3O8H A;  2PMZ A;  2X1D A;  2ELK A;  2NNN A;  2MGQ A;  2CGP A;  2BV6 A;  4NNJ A;  2O7O A;  3QOE A;  5F6F A;  2ZNZ A;  4PGH A;  1MD0 A;  2XAF A;  1A5J A;  1V4R A;  3GTQ J;  5ED4 A;  4EEF G; 
#chains in the Genus database with same CATH homology
 2O6G E;  3K1P A;  4HAM A;  4DNC A;  2PQ8 A;  5E17 F;  5CVV A;  4RB0 A;  3IL2 A;  3V7C A;  4YFX F;  2PMU A;  2VOO A;  2EV5 A;  2GXG A;  4M9X A;  2Y0M A;  4HW0 A;  2A6H F;  3REO A;  4G8X A;  2P5L C;  5ICG A;  4L9N A;  1SFE A;  2UXX A;  4A5N A;  2V6C A;  4BH9 A;  4RB2 C;  4RB3 C;  3WG9 A;  4G7O F;  2L3D A;  3E5U A;  3LA3 A;  2EV6 A;  4BNC A;  1TLH B;  3FXQ A;  1J9I A;  1Q1H A;  5DV5 A;  1KYZ A;  3KP5 A;  3HRT A;  4B8X A;  1XSX A;  1IN7 A;  1ZN2 A;  4G94 A;  3MFK A;  1PP7 U;  4U88 A;  5BMZ A;  3JSP A;  2GZW A;  5CVI A;  5LBQ A;  1FSH A;  2Z3Y A;  3WTY C;  2OU2 A;  4PGG A;  2X0L A;  5E20 A;  5IT3 A;  4YII A;  1PUE E;  1K78 A;  4CYD A;  3HHH A;  5HLH A;  1G3Y A;  2VOD A;  3I64 A;  4LGW A;  4GCV A;  2HYG D;  2RQP A;  2NRA C;  5BPD A;  4PDK A;  2NYX A;  5AON A;  3ZMS A;  2QQA A;  1MZB A;  3K1M A;  4KFC A;  1HW1 A;  3WTX C;  2DAO A;  4KIC A;  4MEX F;  3K69 A;  4A5M A;  3NEU A;  4HOB A;  1JHF A;  4LD5 A;  2RGV A;  1RI7 A;  3C18 A;  3COA C;  1QGP A;  1OMI A;  1WWX A;  1MKM A;  1TQM A;  5HS8 A;  3GYH X;  1D5V A;  5FFZ A;  1FSE A;  3JAM K;  3GVA A;  3KCC A;  3BJ6 A;  2XIG A;  1FYL A;  3ZN0 A;  1JXS A;  3KP4 A;  2V1X A;  3TKY A;  2HQR A;  5CLS A;  1D3Y A;  1P6R A;  3VEP A;  3M9A A;  5AIQ A;  4XSZ F;  4RAY A;  4HV5 A;  2HDC A;  3P9C A;  1MDM A;  2RN7 A;  2Z9O A;  2TDX A;  3WE2 A;  1SD6 A;  4XBF A;  2PI0 A;  2NS0 A;  3SQN A;  3EQL F;  1QZY A;  2EFN A;  1ZLJ A;  3H3Z A;  2YU3 A;  2P8T A;  4CGZ A;  3F6O A;  2VE9 A;  4KIF A;  2BBY A;  5HLI A;  3LAJ A;  2D2W A;  4IJA A;  3C7J A;  3HUG A;  1J2X A;  2WWY A;  4WX9 A;  1BBY A;  1IRG A;  1MJA A;  4NHJ A;  1O3R A;  5CVR A;  1Z91 A;  1T0F A;  1QZZ A;  1IN6 A;  3RPQ A;  4U7B A;  3GXO A;  4ESJ A;  2V79 A;  5JR3 A;  1XCB A;  4S05 A;  1BN5 A;  1IZ1 A;  2G7U A;  2DLL A;  4JBA A;  1U5T B;  1HW2 A;  2E7X A;  3JW4 A;  2QYO A;  4U0V A;  1FP2 A;  5DUK A;  3I71 A;  4BQA A;  3F8N A;  1FYK A;  1J59 A;  3LQQ A;  5FGM A;  4YFN F;  4CO8 A;  3I59 A;  1IXC A;  1FZP B;  1J75 A;  1KGS A;  2K86 A;  3V4G A;  3J7A O;  5LLQ A;  2E1N A;  1OR7 A;  1KU2 A;  3RYP A;  2OQR A;  3ML6 A;  2ZKZ A;  1FBQ A;  1DDN A;  1U78 A;  1D8J A;  3OOP A;  4L0Z B;  2ADU A;  4LB5 A;  2XAQ A;  1G3T A;  2QEN A;  3MAJ A;  1A04 A;  1HKQ A;  5JHU A;  4YIF A;  3SZP A;  3I59 B;  4EGZ A;  2HWV A;  1SD4 A;  2UWM A;  1E17 A;  1FC3 A;  4MTE A;  4IRI A;  4GGG A;  2PMH A;  2EFQ A;  1H9G A;  4IPA A;  3BRO A;  4BXU A;  4UVB A;  1LDD A;  1EV7 A;  4WF2 A;  5E8I A;  2P5K A;  3HOT A;  4MEY F;  4Y13 A;  3R60 A;  1KQ9 A;  3H92 A;  2Z99 A;  3JTH A;  2VE8 A;  3CDH A;  1U5T A;  2M87 A;  5AIP A;  5LEK A;  2BGC A;  3TO7 A;  4TV7 A;  4L18 B;  4G7Z F;  2CG4 A;  1B4A A;  3V7R A;  1SAX A;  1GXP A;  4O6J A;  4P55 A;  1W4M A;  2XKP A;  2L54 A;  1ZRD A;  2RKH A;  2COM A;  2P6T A;  3W6J B;  2MLG A;  4EJO A;  1YO5 C;  1LVA A;  3DPT A;  4LB6 B;  1ZHF A;  3ECO A;  4KA4 A;  3P9I A;  3RKX A;  3WTS C;  4HBL A;  3MEX A;  2DTR A;  2CQK A;  5H6R A;  5HOO A;  2FML A;  3NRV A;  2NNY A;  3L2C A;  1L3L A;  3T8T A;  1BC7 C;  1STZ A;  3CJN A;  1FNN A;  4PCQ A;  2L01 A;  4IHS A;  4KT5 C;  4KN4 X;  1U8R A;  1K78 B;  2P7C B;  1I1G A;  2Q2E A;  5D5X B;  3WGG A;  1BJA A;  5L3G A;  1XSD A;  1YLF A;  1O7L A;  1K7A A;  4AD9 A;  2M5W A;  2Q0O A;  1ON1 A;  2QLZ A;  2WTE A;  5D5W B;  4ZZD A;  2FA5 A;  1ULY A;  2HZT A;  5E18 F;  3M7G A;  3KEO A;  1BI0 A;  4MHG A;  4I98 B;  5F64 A;  2AS5 F;  2DI3 A;  1MDM B;  1TBX A;  4ZYE A;  5L3E A;  5KVR A;  2VBX A;  1LB2 A;  1IF1 A;  3FMQ A;  2M8E A;  2O3F A;  4UUV A;  2FBK A;  3RIR A;  2XAH A;  1YFH A;  4AIJ A;  4BAY A;  2QM3 A;  4NB5 A;  4S04 A;  2ISY A;  3FXR A;  2FQ3 A;  3GZ5 A;  4L9T A;  2M30 A;  2P5V A;  3N97 A;  4ENN A;  5JVT A;  4Y15 A;  3RYR A;  3K9T A;  5L3B A;  4I2O A;  1XMA A;  4EJU A;  2PBI A;  3QU6 A;  2ACJ A;  4FX4 A;  2FMY A;  5D5V B;  1WKM A;  4M73 A;  5BPI A;  2HR3 A;  5DD8 A;  2YR2 A;  4OMY A;  1FY7 A;  4IF4 A;  1IXS B;  3RDI A;  1S6L A;  3BPX A;  4Z2Y A;  1J7K A;  3FMS A;  4D0P A;  2ELH A;  2L4M A;  3L09 A;  4BHC A;  3HHG A;  3GF2 A;  4LK1 F;  2C6Y A;  4HX4 A;  3TGN A;  3BY6 A;  2DW4 A;  1F9N A;  5DCM A;  1CGP A;  2H09 A;  3TDU C;  4WWC A;  5DEQ A;  5D6F A;  3CLO A;  1P4A A;  2A61 A;  5JFR A;  2FOK A;  3WU0 A;  3ERE D;  3BOQ A;  3IRR A;  2A07 F;  2ESH A;  4I0A A;  4L9J A;  4JK1 X;  1TQI A;  3RKW A;  2LF8 A;  4EMS A;  1RZ4 A;  3I0T A;  5EEG A;  1IN5 A;  5FLX Z;  3ABT A;  5CJ9 A;  1FPQ A;  1HBX G;  3WE3 A;  2FNA A;  1BI1 A;  3TQN A;  1LNW A;  2FE3 A;  1ZAR A;  1E2X A;  1K6O A;  2HOE A;  1OYI A;  3F8F A;  2D1V A;  3DV8 A;  2L4A A;  1LEB A;  5HDG A;  1EH6 A;  2F5F A;  5DDG A;  2IA1 A;  1R5G A;  1RNL A;  2W57 A;  3FF5 A;  3R4K A;  2Z33 A;  1LDK B;  4HLY A;  3WTU C;  4HQE A;  3M8F A;  5FLX K;  3WU1 B;  1BM9 A;  3VOD A;  2IP2 A;  4A0Z A;  3MZH A;  4P96 A;  2LNB A;  2AXL A;  4HLX A;  5JI6 A;  6PAX A;  2OD5 A;  1BIA A;  4ZYH A;  3E5Q A;  2P6S A;  3J80 K;  4OMZ A;  1KYW A;  1ZGJ A;  1BC8 C;  1DP7 P;  1O3S A;  3RJP A;  3SXY A;  3K0L A;  2BEO A;  1YYV A;  2IJL A;  1O3Q A;  4MQV A;  1R1U A;  1ON2 A;  5D6E A;  1Y0U A;  1S8N A;  2CW0 F;  3DXJ F;  1HKS A;  5DD4 A;  1BOA A;  4L0Y B;  3U9G A;  1ZG1 A;  4M71 A;  3J81 Z;  4AVP A;  3D5L A;  2Y48 A;  4F7Z A;  3BPV A;  5D8K B;  1IN8 A;  3ECH A;  2CWE A;  4ZH4 F;  1W7P A;  2JZY A;  2KJC A;  2IVM A;  1XMK A;  3DP7 A;  3DPL C;  1P4X A;  3M1E A;  1G3S A;  4AIK A;  4MGR A;  4GYI A;  2M1B A;  4MQ9 F;  3V8J A;  4XLP F;  2XUB A;  2FXA A;  1YW7 A;  2MC3 A;  2IA0 A;  1TW3 A;  3J81 K;  1IUY A;  3I58 A;  5FB2 A;  3IRQ A;  1RIO H;  3SZT A;  3T8R A;  4HQM A;  5DYM A;  1KA8 A;  4A12 A;  3ZPL A;  3FXU A;  1WRJ A;  5DCM B;  3WGH A;  3NQO A;  3BZ6 A;  3LWF A;  1S7A A;  3K2Z A;  3KZZ A;  1YS6 A;  2IRF G;  2F2E A;  3L7W A;  4EQQ A;  3T1B A;  2DK8 A;  2GXB A;  1DPR A;  1Z6R A;  4G6D A;  2QQB A;  2JRT A;  5HDN A;  2A69 F;  5FD5 A;  2FF4 A;  5A2Q K;  2GWR A;  2MD5 A;  4U0Y A;  3WTW C;  2RDP A;  4OOI A;  3RTR A;  2E1C A;  4LLG F;  2Y75 A;  3U2R A;  3C1D A;  1TNT A;  1XD7 A;  3KLN A;  3HRS A;  2HS5 A;  3E5X A;  3F3X A;  1ZRE A;  3JTG A;  5ICF A;  2HEO A;  1QNT A;  2EWN A;  3FM3 A;  2STT A;  3T0Y A;  2CYY A;  4HX8 A;  1J5Y A;  1B9N A;  3GEZ A;  1F1Z A;  4QLC U;  2F5C A;  3WTV C;  2UZK A;  2H27 A;  3L9F A;  1UCR A;  1DUX C;  4L5I A;  2DK5 A;  1XDU A;  2OA4 A;  3F21 A;  3WOD F;  2PLY A;  3LFK A;  3QAH A;  3I4P A;  3L00 A;  2IW5 A;  4EM0 B;  4O3M A;  1KU3 A;  5HVQ C;  3F72 A;  2FBI A;  3K1N A;  2ZBK A;  4AWX B;  2FBH A;  5LGN A;  5E8G A;  5ILS A;  4KUM A;  4XLN F;  4IRH A;  2ETH A;  3IHU A;  3KP7 A;  4M9Z A;  3TOB A;  4U7D A;  2EB7 A;  2VC0 A;  1KQ0 A;  3DF8 A;  4KIB A;  3WTT C;  4ENJ A;  3IWZ A;  3DEU A;  1FX7 A;  1PP8 F;  4KNY A;  4BHB A;  1OKR A;  1U5T C;  2XRO A;  4ESB A;  3ELK A;  1HSJ A;  3CO6 C;  3GW2 A;  3V8L A;  2MBF A;  2VBY A;  3FWE A;  4IVN A;  5HS9 A;  1UB9 A;  2X4H A;  5D4S A;  5LHI A;  3FMR A;  2VON A;  4UHT A;  3P9K A;  1SMT A;  2JPC A;  1Z7U A;  4N0B A;  4I09 A;  3G73 A;  1YW8 A;  4HF0 A;  4UXN A;  3BJO A;  5F1R A;  4OIO F;  5BQT A;  3M8E A;  1ZG3 A;  2QZ8 A;  4RGX A;  2PFB A;  3TDZ C;  2O03 A;  1T39 A;  4KIG A;  3I5U A;  3EUH A;  3SHF A;  2XV4 S;  1ZG5 A;  2KIU A;  1W7P B;  1XDS A;  4R8H A;  2YX4 A;  2K4J A;  3LQR A;  2LKP A;  3F8B A;  1R7J A;  2VT2 A;  3F22 A;  3C3W A;  3E6D A;  1WQ2 A;  4I02 A;  3KEQ A;  1V3F A;  1W7P D;  1HXD A;  2KRF A;  2YX7 A;  4LJZ F;  3KET A;  4LK0 F;  5L3D A;  4LG0 A;  3WTZ A;  1ZLK A;  2WV0 A;  1HST A;  2R7F A;  1G3W A;  3FZV A;  1S29 A;  4UNO A;  2RVC A;  1YW9 A;  3ZMZ A;  1REP C;  1YS7 A;  3BJA A;  1FWZ A;  2RV8 A;  3ZMU A;  2QBY A;  5E1W A;  1OYY A;  3HTS B;  1CF7 A;  2XVC A;  2ZNY A;  1ZH5 A;  1H9T A;  4H0E A;  3AAF A;  1DPU A;  1B9M A;  2YPR A;  3VFZ A;  1LJ9 A;  2Q8K A;  2E7W A;  1SFU A;  4UV8 A;  2YSR A;  1PDN C;  4Y17 A;  1B1B A;  2VT3 A;  4P5O A;  2A5Y B;  1JE8 A;  1GXQ A;  2EA2 A;  4CDG A;  2XAS A;  3R0J A;  2KIF A;  4ZYG A;  3ZMD A;  3ZQ7 A;  2CO5 A;  5FFX A;  2K02 A;  2XRN A;  3FHZ A;  4CZZ A;  3D0S A;  2JSC A;  2OBP A;  4N9H A;  3E6B A;  4LG0 B;  3ZMV A;  3BDD A;  1HW5 A;  1BI3 A;  2V9V A;  3P7N A;  1UHW A;  1ZAO A;  2HFH A;  4RAZ A;  1T6S A;  1QQI A;  2HKX A;  5D8L B;  1XSV A;  3Q9S A;  3HOS A;  1R36 A;  4JQF A;  4EM2 A;  1G4D A;  5H20 A;  5LRS A;  3GFI A;  3QP5 A;  3HSE A;  4A2U A;  3QOP A;  2EFO A;  3RPU A;  5K5Q A;  4QWQ A;  1HKT A;  4GO1 A;  4GYG A;  4OIP F;  2GAU A;  4OU0 A;  2CSO A;  4Q4Z F;  1FLI A;  1MJ9 A;  5LRR A;  3KZY A;  4EV0 A;  4MNU A;  4FT8 A;  3MZY A;  4Q47 A;  1P4W A;  1R23 A;  2DO7 A;  1FT9 A;  2HTS A;  4G6Q A;  5DCF A;  4PZJ A;  3RKY A;  3SFZ A;  3I54 A;  1JHH A;  4LLL A;  3PFI A;  4OIQ F;  2ISZ A;  1YIO A;  2VBZ A;  1C0W A;  4IHT A;  3W6K B;  5HDK A;  4ENM A;  1FOK A;  1WSU A;  1B6A A;  2DFI A;  2IT0 A;  3GO5 A;  2LSO A;  4R1H A;  4OIN F;  2H94 A;  1EH7 A;  1FP1 D;  1QBJ A;  4M6X A;  4G9Y A;  4M9S A;  2F5E A;  4HV6 A;  4R79 A;  4ON0 A;  4K2E A;  2XAJ A;  3KP2 A;  1FYM A;  4WK8 F;  4HA8 A;  4ENK A;  2FNP A;  3GUD A;  4I0B A;  1YTY A;  3E97 A;  3KP6 A;  3O3K A;  4WXD A;  4RB1 A;  1ZRF A;  2M45 A;  1SD7 A;  2B0L A;  4HZF A;  2XAG A;  4RS8 A;  2HQN A;  2R7D A;  2H6B A;  2PJP A;  1I27 A;  1LQ1 A;  4DQ2 A;  2MLK A;  2VC1 A;  5ILV A;  2EFP A;  3CTA A;  1YQA A;  3TO6 A;  4I01 A;  2QWW A;  5EEH A;  3T5X A;  1F5T A;  3F6V A;  1IW7 F;  3IKT A;  2VBW A;  4EGY A;  2O0Y A;  2OZU A;  1O7F A;  2DQR A;  3GWZ A;  1RUO A;  2EV0 A;  4HYE A;  4Q5S F;  4L9V A;  5L3C A;  2ZME B;  3B73 A;  5HS7 A;  5TRD A;  2UXN A;  3TO9 A;  2K7L A;  2LDU A;  4NQW A;  1UST A;  1XCV A;  2FSW A;  4M6Y A;  3Q5F A;  2Z5U A;  3KP3 A;  2EFW A;  3R6S A;  5LHH A;  3O2P E;  5FO5 A;  5CVU A;  4I7H A;  3GX4 X;  4ETS A;  4M74 A;  2OZ6 A;  2PN6 A;  1ZYR F;  2G7H A;  3E6M A;  2VOP A;  1MGT A;  3BWG A;  3HSR A;  3WGI A;  1IAW A;  4RGU A;  4P9F A;  4CHU A;  2DBB A;  1CF7 B;  1JGS A;  3GFL A;  2JT1 A;  2RC4 A;  2NAZ A;  5E1X A;  3VOE A;  3R61 A;  1R1V A;  4L5J A;  3LST A;  2O61 A;  1IRF A;  3HSF A;  1SMY F;  4LFU A;  2GQQ A;  2FU4 A;  4KN7 X;  1VTN C;  2KJB A;  3G3Z A;  5ICE A;  1Z9C A;  1S7O A;  4A6E A;  2J5O A;  1UFM A;  2JTV A;  1WI9 A;  5J8F A;  2DQL A;  5LGU A;  3KFW X;  2G9W A;  1G6N A;  4BYY A;  3CUQ B;  4EJV A;  4ESF A;  2W84 A;  1U3E M;  4WXH A;  1XGS A;  4A0X A;  2EA4 A;  2BYV E;  3IWF A;  4P9U A;  1LEA A;  3DKW A;  3IC7 A;  5E1Z B;  3TOA A;  5J8C A;  2QUF A;  1LDJ A;  3E6C C;  1XGM A;  2VN2 A;  2KKO A;  3FM5 A;  1HQC A;  1F4K A;  4U0W A;  3F8M A;  1QPM A;  1U6G A;  2W24 A;  3ULQ B;  2CFX A;  2OQG A;  2J5P A;  3GFJ A;  4HDU A;  2MH9 A;  3HYI A;  3ZMT A;  5HLG A;  2FEZ A;  1YG2 A;  1SFX A;  3FX3 A;  1GHC A;  1GVJ A;  4YG2 F;  4FX0 A;  2QQ9 A;  1ZGA A;  3EDP A;  4EJT A;  4M72 A;  1IN4 A;  2D1H A;  1XGO A;  1FBU A;  3GFM A;  1R1T A;  2V1D A;  1T98 A;  2P4W A;  2JPB A;  5TJJ A;  2ZCW A;  4KMU X;  4IXA A;  1BI2 A;  4O5V A;  5J6X A;  2GIV A;  3KLO A;  5D5U B;  4KYW A;  3F8C A;  1I1S A;  3ABU A;  1P2F A;  2KIM A;  4AIH A;  3DFG A;  1I5Z A;  3R0A A;  5LHG A;  3HRM A;  2MA3 A;  5CYV A;  3ZP5 A;  2VXZ A;  5K5R A;  1R00 A;  5CVJ A;  4UV9 A;  4WCG A;  4Q48 A;  2L02 A;  3EYI A;  2A3S A;  4ASN A;  2GA1 A;  3OV8 A;  4EM1 A;  3B02 A;  2PEX A;  2ZJ2 A;  3CUQ C;  3PQK A;  1AOY A;  3MQ0 A;  3EET A;  1FBS A;  2DU9 A;  4HDV A;  5K5O A;  3EYY A;  2RNJ A;  5ICC A;  2MH2 A;  3KE2 A;  4E70 A;  1TQP A;  3F23 A;  2HYF A;  4RGR A;  4XRF A;  2K4B A;  3HRU A;  1TNS A;  3GZ6 A;  5ERI A;  1T2K A;  3I53 A;  3V7S A;  2WC2 A;  2F5D A;  2OAZ A;  3E3V A;  1W5S A;  3JAM Z;  1K79 A;  5LEJ A;  2ZO4 A;  3S2W A;  2R3S A;  5ILU A;  1Z05 A;  2W85 A;  5DUI A;  1OYW A;  2ESN A;  3QPH A;  3IKV A;  2O8X A;  3HTU A;  4B09 A;  3HIF A;  1IXR C;  3JSO A;  1B59 A;  1NHA A;  1RUN A;  2PG4 A;  2V1U A;  5FD6 A;  3J80 Z;  5LGT A;  1S3J A;  1ODD A;  3LAP A;  2HKO A;  4A6D A;  1ONV A;  2DPD A;  3DQV C;  4OIR F;  3V8K A;  1J0R A;  3ROU A;  3CO7 C;  2ZME A;  5IT9 K;  4UVC A;  3CUO A;  4A0Y A;  2EJR A;  1R58 A;  2GA2 A;  3CUQ A;  1EH8 A;  1TTY A;  3MCZ A;  4LLN A;  1KQ8 A;  2BE5 F;  5L3F A;  1P92 A;  5K1Y A;  2ZFW A;  4BHP A;  4IRG A;  1U2W A;  4MTD A;  1UHM A;  2STW A;  1MJB A;  1AWC A;  1O3T A;  1O57 A;  1R5H A;  2H6C A;  3ISP A;  3Q9V A;  4HX7 A;  5IT9 Z;  2LF7 A;  1XN7 A;  4ZZL A;  1W5T A;  4GXO A;  2K27 A;  1Z6T A;  4HF1 A;  1ZRC A;  5A2Q Z;  1XB4 A;  3U1D A;  5BOX A;  4N9I A;  4XSX F;  5D4R A;  2HTJ A;  2HGC A;  4CIC A;  2IA2 A;  1QO0 D;  4WXC A;  1Z1D A;  3MWM A;  1KU7 A;  2A68 F;  1H0M A;  3VB2 A;  1KU9 A;  3LA2 A;  2D45 A;  4CXF A;  2DPU A;  4EVI A;  1SD5 A;  4G7H F;  4LMY A;  2XKO A;  3PQJ A;  3ZN1 A;  1BIB A;  3QPT A;  3O6B B;  4UVA A;  2A6E F;  4KDP A;  1R22 A;  4HF2 A;  2P7V B;  4RGS A;  3QU3 A;  2ZXJ A;  5KK1 A;  1X3U A;  2DT5 A;  2QVO A;  4EJW A;  3QP6 A;  3RI4 A;  4ZYD A;  3BP8 A;  2FRH A;  1T38 A;  5H6Q A;  4KMF A;  1D8K A;  3LA7 A;  2W25 A;  3GLX A;  3N4M A;  4FHT A;  2XGX A;  5BS6 A;  1XGN A;  2XHK A;  3QRF F;  4YFK F;  1TW2 A;  2EK5 A;  2IPQ X;  1OPC A;  1I6X A;  1L0O C;  1USS A;  3H3U A;  2CGP A;  2NNN A;  2BV6 A;  5F6F A;  2ZNZ A;  4PGH A;  1MD0 A;  2XAF A;  1V4R A;  5ED4 A;  2QBY B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...