3QU6A

Crystal structure of irf-3 dbd free form
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
106
structure length
98
Chain Sequence
b'KPRILPWLVSQLDLGQLEGVAWVNKSRTRFRIPWKHEDFGIFQAWAEATGAYVPGRDKPDLPTWKRNFRSAMNRKEGLRLAEDRSKDPHDPHKIYEFV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IRF3 protein
publication title Structures of apo IRF-3 and IRF-7 DNA binding domains: effect of loop L1 on DNA binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 26
structure length 98
sequence length 106
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2011-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00605 IRF Interferon regulatory factor transcription factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3qu6A01
2HFHA 4G6DA 1DDNA 2ZNYA 2W57A 1BM9A 2HKXA 3M7GA 4EQQA 2P5KA 4M9ZA 3CDHA 3O3KA 1K78B 1P2FA 2RDPA 4M74A 3ZN0A 1ON1A 3CUQA 2B0LA 2HR3A 3W6KB 4R1HA 2BE5F 2RNJA 4KIGA 3ABUA 2W24A 2KIFA 5KK1A 3IHUA 4I98B 1KA8A 2P4WA 5F1RA 3WGHA 4ENMA 1HXDA 5DCFA 3J7AO 3QRFF 2QQAA 4I0AA 2FBKA 4EJOA 2K86A 5ICFA 2UZKA 3FXRA 2C6YA 3IRQA 1S29A 1ODDA 3KEOA 4BH9A 3DEUA 2IW5A 4I01A 2BV6A 2EFPA 4UHTA 1EV7A 4HV6A 3WE3A 1KYZA 3K9TA 2RGVA 4HQMA 3L9FA 1NHAA 2LF7A 4OIOF 2EFOA 1R1VA 3BPVA 3KCCA 4A6EA 1SMYF 1MJ9A 2OQGA 4OIQF 1J9IA 1U78A 1QPMA 2CFXA 2H09A 1W4MA 3ISPA 1RI7A 4AIKA 1Z9CA 2NNYA 4KA4A 1D8JA 2AS5F 2LDUA 1QBJA 3LFKA 2QLZA 3F72A 2HDCA 1BOAA 2HQNA 1FC3A 2OAZA 4B09A 3H3UA 3AAFA 4ZYEA 2IT0A 4A2UA 5E8GA 1V3FA 1H0MA 1UFMA 4ZH4F 3KETA 1B1BA 2VN2A 4P9UA 3RDIA 2A69F 1LQ1A 2K02A 1STZA 2V1UA 2COMA 1Z1DA 2L01A 5A2QK 4XSZF 4LJZF 1ON2A 2TDXA 2XAJA 2VT2A 3F22A 4IPAA 4K2EA 5LHIA 4KMUX 2M1BA 2IA2A 3I59A 5E18F 1G6NA 4ON0A 1SD5A 1D5VA 3GX4X 2FA5A 4YIIA 2AXLA 3GWZA 2V9VA 4N0BA 1P6RA 1G3YA 5DUKA 3BJAA 3E6BA 4WK8F 3DP7A 4KYWA 6PAXA 3GZ6A 4P9FA 2EV5A 5BQTA 3J81K 2BGCA 1TW3A 1I1GA 1R5HA 1Z6RA 3HRTA 2QQBA 4BNCA 2GXBA 1KGSA 4G94A 2QWWA 2Z5UA 2JPBA 1K7AA 4RGXA 3L7WA 2Q2EA 4AVPA 2STTA 4IRGA 2ISYA 1YS7A 5DUIA 2F5DA 3HSRA 1W5SA 1E2XA 1MDMB 1ZAOA 4KDPA 4Y17A 1YLFA 2K4JA 2Z9OA 3LSTA 5D4RA 1XMKA 5ICEA 4NHJA 3RYPA 3V8LA 2CG4A 2P6SA 4CXFA 3J80K 3QP5A 1O3SA 3ZMTA 1MZBA 3MZYA 4EV0A 1ZG1A 1QGPA 1FT9A 5L3BA 1XSDA 1OMIA 1TQIA 2Y0MA 3EUHA 4BHCA 2FRHA 1LNWA 4BHBA 1A04A 1JXSA 4L9VA 2NNNA 2XHKA 5D6FA 5ILUA 2P6TA 3KLNA 4UV8A 4L9TA 3QP6A 1X3UA 4U7BA 2A6EF 1OPCA 3IKTA 1ZN2A 3VEPA 1CF7B 4ENNA 4IJAA 5LLQA 4L0ZB 2ISZA 4D0PA 1EH8A 3H92A 4L9NA 5HDGA 3LAPA 4UVAA 2DO7A 5CLSA 1WSUA 3QPHA 3EYYA 5F64A 4Y15A 2OZUA 3KP4A 1F4KA 3BOQA 2FE3A 1IN5A 2FXAA 3VB2A 1ZLJA 2PBIA 1J7KA 1HSJA 2HZTA 2PFBA 1O3QA 4RGRA 3DFGA 2HGCA 2X0LA 2QBYB 1HW5A 5HOOA 1BI0A 3R61A 1K78A 1YFHA 5CVUA 3QU3A 3DPLC 1SD6A 4YFNF 4OMYA 3HOTA 5JI6A 4MNUA 5DD8A 4ESJA 3PQKA 2DQLA 5BS6A 1W5TA 3NQOA 2XROA 4M72A 4XLPF 4O3MA 3RKYA 4MTEA 1USSA 1B6AA 1FWZA 1KU9A 2ELHA 5CVIA 4R79A 1P4XA 3W6JB 2KIUA 4RAYA 2HYGD 2FNPA 2PMUA 4IRIA 1BI3A 2FQ3A 1R23A 3L2CA 4ENKA 2MLKA 4LG0B 1E17A 4JQFA 2G7UA 1IN6A 4ENJA 1UB9A 3ECHA 3DQVC 4M6XA 3WTYC 2FEZA 2R7FA 1R7JA 1ZG5A 2IRFG 2WC2A 1AOYA 2K7LA 3WODF 2H6BA 3FMSA 3BZ6A 2V79A 4S05A 4LFUA 3ECOA 2A6HF 4BHPA 3L09A 4XBFA 1XCBA 4RGSA 4XSXF 1YIOA 4A5NA 3K69A 3IWZA 4EJVA 1KQ9A 4WCGA 2L4AA 4G7HF 2MC3A 3TO9A 3GF2A 4Q4ZF 1B4AA 1H9GA 3WTWC 3U9GA 2F5CA 4ZYHA 3D5LA 5FD5A 2PLYA 3BDDA 3GFLA 1EH7A 2M87A 3ML6A 4HQEA 2KJBA 5HVQC 1U8RA 2D1VA 4I7HA 2RQPA 2W84A 2A3SA 2KKOA 5LHHA 4F7ZA 1YQAA 3HOSA 2P8TA 3KZZA 3QOPA 2LNBA 4HX8A 5D5XB 1PP8F 2JSCA 2CWEA 4HA8A 4WXHA 3COAC 4LGWA 2FF4A 1YG2A 2EK5A 3HTSB 5DYMA 4CYDA 4CDGA 4EGYA 2G7HA 2HTSA 1FNNA 3KP7A 4EJTA 2IA0A 1BC7C 1KU3A 1YTYA 1Q1HA 4LMYA 1XB4A 4XRFA 1ZGJA 3ZN1A 2L02A 4OOIA 4WWCA 3P9IA 1PDNC 5LGUA 1QZYA 3CTAA 4LB5A 3GUDA 3DF8A 4UVCA 1IN8A 2VXZA 1B9MA 1D8KA 4YFKF 2HEOA 1WI9A 1FBSA 4N9HA 4ZZDA 1HKSA 1I27A 1KU2A 2NYXA 1ONVA 4BYYA 2D45A 3Q5FA 3E5UA 5LEKA 1MDMA 1XSXA 2KJCA 1ZRCA 2RVCA 1BN5A 1LDJA 4A0ZA 5A2QZ 3JSOA 2A5YB 5ICCA 2EFNA 2E7WA 4KNYA 1XGNA 2Z33A 4MTDA 5BMZA 2ZNZA 4DNCA 3HRSA 4LD5A 4A0XA 1FBQA 1Y0UA 2DFIA 3SHFA 1U5TB 2FMLA 1Z05A 2DW4A 3FXUA 4NB5A 5LRRA 2GXGA 1MGTA 1U2WA 4ZYDA 1P4AA 3CUOA 3F8MA 2JTVA 3D0SA 1R1TA 4RB2C 5K5OA 2CGPA 3O2PE 3J81Z 4HZFA 4AWXB 5H6QA 2VT3A 1CF7A 1W7PD 2OZ6A 3WTTC 2P7CB 4I02A 4KIBA 4YIFA 1LVAA 2XAQA 4IVNA 2M45A 5AIPA 2E7XA 1IRFA 3ELKA 1O7LA 4RS8A 4LB6B 1OYIA 1IUYA 1FSEA 1QQIA 4HLYA 3LWFA 2HWVA 1F9NA 1GXQA 2VOOA 1J2XA 2OQRA 1HW1A 3FXQA 3I71A 3T8TA 3I4PA 5K1YA 1Z91A 4GGGA 3C3WA 2QBYA 2ZKZA 4AIJA 3HRUA 4HOBA 3M8EA 3J80Z 2F5FA 4G7OF 2WTEA 1DPUA 3KE2A 3JTHA 4ESBA 3MEXA 2NRAC 1GVJA 4HLXA 3JW4A 4A0YA 3GO5A 4UXNA 3DXJF 1ZHFA 2JPCA 1XGOA 2F5EA 2M30A 2A61A 5FD6A 4R8HA 4HV5A 2DLLA 1U6GA 1XMAA 3ZQ7A 1K79A 4LG0A 1IXRC 2IP2A 3KP2A 3JTGA 2Y48A 5IT3A 2DU9A 2PMHA 4YG2F 4WXCA 1I5ZA 3E6DA 3TQNA 3SFZA 4KN4X 3WTUC 4KICA 2G9WA 2O0YA 2RV8A 3MFKA 3V8JA 2OU2A 4HX4A 3U1DA 2XVCA 3JAMZ 1IZ1A 2UXXA 1JHFA 3EQLF 3G3ZA 2QZ8A 4OMZA 5JHUA 2VE9A 3T5XA 1WRJA 1AWCA 2FNAA 2YPRA 3WU1B 4PZJA 3ULQB 3F6OA 4PGGA 3RPUA 1DP7P 2PJPA 5HS9A 2W25A 4L18B 2QENA 3I64A 4U7DA 3GXOA 2VODA 4OIRF 2D2WA 1HKQA 3P9KA 4EM0B 1WQ2A 1FZPB 5BOXA 1UHMA 4O6JA 4GXOA 2E1NA 2QYOA 4EM2A 1C0WA 2GA1A 3TOAA 5HLHA 2HYFA 3E6MA 4U0YA 3R6SA 4GYIA 5CJ9A 2VBZA 5H20A 3WU0A 5D4SA 3GVAA 2J5PA 2CO5A 4Q5SF 3JAMK 2ZMEB 2K27A 2CYYA 5AIQA 2R7DA 2XAFA 2YSRA 2DPUA 1S3JA 1OYYA 4ETSA 1L3LA 3DPTA 3R60A 2PG4A 3T1BA 4Q48A 5K5QA 5FFZA 3OV8A 3RKWA 5DDGA 1IAWA 4LK0F 2XV4S 1SFXA 2L4MA 3NRVA 2YR2A 2O8XA 2EWNA 3KFWX 2DQRA 3TDZC 1IRGA 1D3YA 1R22A 3TDUC 3F6VA 1TW2A 1GHCA 1MKMA 5TRDA 2DAOA 1U5TC 1HW2A 2QUFA 1J75A 3ZPLA 5KVRA 4DQ2A 2X4HA 3T8RA 3LAJA 4TV7A 4HDUA 3IWFA 3C18A 2MA3A 1FLIA 1YS6A 5CVJA 2EJRA 4Z2YA 3K1PA 3G73A 1G3SA 2Z99A 3GLXA 3V7SA 1ULYA 4P96A 2CSOA 1XSVA 4EJWA 3HYIA 4CHUA 5FFXA 2GQQA 4I09A 4EGZA 3K1NA 3M8FA 3CO6C 1XDSA 3ZMZA 3SQNA 2HTJA 2ADUA 5EEHA 2PQ8A 2IPQX 1RIOH 1ZRFA 1YYVA 3RYRA 5D5WB 1FSHA 1REPC 4IHSA 2JT1A 2EV0A 2PI0A 3DV8A 1PP7U 3R0AA 1W7PB 1WWXA 3IC7A 1U5TA 4MQ9F 5D5UB 5HDNA 4L9JA 2EA4A 3F8NA 5CYVA 1KQ8A 1JHHA 3NEUA 1L0OC 4RAZA 1RNLA 1Z7UA 3ZMUA 1BI1A 4G9YA 1FP1D 1LEBA 1VTNC 4JBAA 1LEAA 1PUEE 1O57A 4G8XA 2DBBA 1XCVA 2PN6A 4RB3C 1T39A 2Y75A 2WWYA 3F8BA 4KFCA 4UV9A 1H9TA 2RKHA 3RI4A 4EJUA 2V6CA 1JE8A 4KMFA 3GW2A 2DTRA 2VOPA 3N97A 3V4GA 1ZGAA 3FF5A 5TJJA 2GAUA 3O6BB 3WG9A 2STWA 4CZZA 2MLGA 1P92A 2OBPA 5DEQA 1LJ9A 1SFEA 4HF0A 3RKXA 3CJNA 4KIFA 2RN7A 1UHWA 5FLXK 2GA2A 4OINF 3HHGA 4WX9A 2XIGA 2KIMA 1TQPA 3VOEA 5D8KB 5ILVA 2IJLA 4L0YB 3SXYA 1I1SA 1J5YA 5LBQA 1IN4A 1TNSA 2H94A 3RIRA 5JVTA 1DPRA 2HKOA 3LA7A 4WXDA 3QU6A 5E1ZB 2ZBKA 4KUMA 2OD5A 1R00A 4N9IA 3ERED 4M9SA 2A68F 1F1ZA 1V4RA 2D1HA 1HBXG 2ZXJA 2XUBA 3LA2A 4Q47A 2QVOA 3BY6A 3RTRA 4YFXF 3HUGA 3SZTA 2EV6A 3I0TA 1ZYRF 3P7NA 1T6SA 2ACJA 4H0EA 2YX7A 4FX4A 2VC0A 3K0LA 3LQRA 5LHGA 2XAGA 2P5VA 2H27A 2O03A 4LLGF 4RGUA 4UUVA 2M8EA 4HF2A 2P7VB 4L5IA 3GFIA 1B9NA 4NQWA 1OR7A 5JR3A 2O6GE 3V7RA 4FT8A 4M73A 1S7OA 5J6XA 2MH9A 5FGMA 2PEXA 3HIFA 3KP3A 5HLGA 1LB2A 3GFMA 4A5MA 3R4KA 4UNOA 3IL2A 5FO5A 1MJBA 4AD9A 1TBXA 4CO8A 1YW7A 1FYKA 1Z6TA 4O5VA 3EDPA 3VODA 3F8FA 1ZH5A 1T98A 1QO0D 3FM5A 2ZO4A 3LQQA 1G3WA 4FX0A 2Z3YA 3WTXC 4HDVA 1K6OA 2VBXA 2LSOA 2FBIA 5LEJA 2FBHA 2YX4A 3TKYA 1ZREA 5E20A 1ZLKA 4A12A 1RUOA 2GZWA 2Q8KA 2XAHA 5JFRA 4E70A 4GYGA 4BQAA 3K1MA 4HYEA 2V1XA 3FWEA 5DCMB 2O3FA 1ZRDA 1DUXC 4KT5C 3QAHA 2ZMEA 4G6QA 3VFZA 1OYWA 1BJAA 4KN7X 5L3CA 4QLCU 1LDDA 4A6DA 3S2WA 1TLHB 2YU3A 2EFQA 1FOKA 1WKMA 3C7JA 4JK1X 3Q9SA 2BYVE 1SAXA 2BEOA 3IRRA 2L54A 2FMYA 5HDKA 4ESFA 3Q9VA 4HW0A 4RB1A 4U88A 1HQCA 1BIAA 4M71A 2F2EA 2ESNA 3QPTA 1O7FA 1HSTA 2XRNA 4ZYGA 1OKRA 4L5JA 2DK8A 4MQVA 2EFWA 3GYHX 3BROA 3R0JA 2O61A 1S6LA 2W85A 3C1DA 5DV5A 3CO7C 1BI2A 2BBYA 3PQJA 5EEGA 4ASNA 4U0WA 3FX3A 2CW0F 3CUQB 3GZ5A 2A07F 5H6RA 4MEXF 3FM3A 2M5WA 4HAMA 2GWRA 4P5OA 3L00A 4HBLA 3I53A 5D5VB 2DI3A 4RB0A 2FOKA 4WF2A 5J8FA 3KP5A 4EVIA 2HOEA 3F8CA 3HHHA 2IVMA 4EM1A 3TO7A 4MGRA 2ZCWA 2HQRA 2IA1A 3V8KA 4IXAA 3HTUA 5D6EA 3RJPA 3FMQA 1R58A 1J59A 1TNTA 5FB2A 5ILSA 2UXNA 1R1UA 4U0VA 3TGNA 1W7PA 2VC1A 1KYWA 5BPDA 1SD4A 5ED4A 4LLNA 3TO6A 3B02A 3K2ZA 2LKPA 1SD7A 3E3VA 3FHZA 3WE2A 2XKPA 2V1DA 4IF4A 2E1CA 1S8NA 2ZJ2A 1MD0A 3MWMA 1XD7A 3P9CA 5LGNA 5F6FA 2VBYA 2NS0A 1RUNA 5D8LB 2VBWA 3PFIA 1I6XA 3WTSC 1BBYA 4OIPF 3MQ0A 5E17F 3BP8A 3GEZA 2ETHA 1YW8A 1P4WA 1FYMA 1IW7F 1BC8C 5IT9Z 4BXUA 3ZP5A 2XKOA 4CGZA 4PGHA 2NAZA 1BIBA 5L3EA 1XDUA 1QNTA 1JGSA 2H6CA 1ZARA 3M9AA 1KU7A 3HSFA 1T2KA 4HF1A 3WGIA 3EYIA 2XASA 4I2OA 2WV0A 3EETA 3BWGA 1SFUA 2JZYA 4HX7A 2XGXA 4CICA 1MJAA 3KZYA 3I5UA 2ZFWA 3FMRA 5HLIA 1FYLA 3CLOA 1U3EM 3I59B 3F23A 3KLOA 4IRHA 2QM3A 1RZ4A 1G4DA 1QZZA 4I0BA 3WGGA 4AIHA 2FSWA 2VE8A 5DD4A 4MEYF 3HSEA 3OOPA 2RC4A 1J0RA 3KP6A 2Q0OA 1XGSA 2DK5A 1B59A 2FU4A 1T38A 3WTVC 3RPQA 1EH6A 2J5OA 3HRMA 3ROUA 4B8XA 1O3TA 3BPXA 2HS5A 2MD5A 5IT9K 5ERIA 3F3XA 1YW9A 1XGMA 1HKTA 3ZMSA 2MH2A 2VONA 3N4MA 3E5XA 3I54A 2JRTA 1LDKB 2EB7A 2OA4A 3BJ6A 1ZG3A 1USTA 3MAJA 1IN7A 2L3DA 2LF8A 3ZMDA 1IF1A 4M9XA 1UCRA 2ESHA 4UVBA 1F5TA 3ZMVA 5L3DA 5LRSA 4MHGA 1SMTA 4EMSA 1R36A 4M6YA 1O3RA 1S7AA 3B73A 5FLXZ 5HS8A 3LA3A 3T0YA 4BAYA 5E1XA 2UWMA 1FX7A 4PDKA 1TTYA 3H3ZA 3M1EA 1G3TA 4GO1A 1FP2A 1IXSB 2K4BA 2QQ9A 1TQMA 2CQKA 4PCQA 3IKVA 3WTZA 2DT5A 1YO5C 1T0FA 5E8IA 4QWQA 1CGPA 3E97A 4LK1F 3V7CA 4S04A 4ZZLA 2DPDA 5L3FA 5L3GA 4FHTA 4P55A 3FZVA 5ICGA 3MZHA 5AONA 1FBUA 3CUQC 3KEQA 3I58A 4Y13A 1GXPA 3MCZA 2R3SA 5DCMA 3ABTA 5BPIA 3JSPA 2EA2A 2GIVA 5HS7A 3E5QA 3GFJA 3E6CC 4XLNF 4LLLA 5LGTA 3F21A 1XN7A 1FPQA 3U2RA 4OU0A 5J8CA 1KQ0A 1IXCA 4G7ZF 5E1WA 3SZPA 5CVRA 5CVVA 1FY7A 2MBFA 3TOBA 2KRFA 4IHTA 4GCVA 1R5GA 3REOA 5K5RA 2P5LC 3DKWA 3BJOA
chains in the Genus database with same CATH superfamily
1S9HA 4E7HA 1VQPI 2HFHA 3L2WA 3IUOA 3DTKA 2LKSA 3HXLA 1Y1WJ 4G6DA 1DDNA 2ZNYA 2W57A 1BM9A 2LY9A 2JA7J 4JX6A 4C2TA 2HKXA 3M7GA 4EQQA 2P5KA 4M9ZA 4CCLA 3CDHA 2XPUA 5DS9A 1XC5A 3O3KA 1P2FA 1K78B 5B5EC 3VSKA 2ZJRF 1AA7A 2RDPA 4EATA 5IP6A 2EPFA 4A3LJ 4M74A 3ZN0A 1ON1A 3S3OA 3CUQA 2B0LA 2HR3A 3W6KB 2L7MP 3OIQA 5TGTA 4R1HA 2BE5F 4CZCA 2L7ZA 2RNJA 2Y30A 2NOJB 3K4NA 1EJ9A 2GXAA 1ETXA 4KIGA 3N05A 3ABUA 2W24A 2KIFA 4QIWN 5KK1A 3IHUA 4I98B 1KA8A 2P4WA 4IOAF 3IAS2 4XLEA 5F1RA 3WGHA 4ENMA 1MIJA 3OL4A 3DBRB 3FDYA 4XLCA 2M2EA 1HXDA 5DCFA 3J7AO 3QRFF 2QQAA 4I0AA 2FBKA 4W1UA 2K86A 3SDBA 4EJOA 1MBKA 5ICFA 2UZKA 2RREA 2XSDC 2Y31A 3RQIA 3FXRA 2C6YA 3IRQA 1S29A 1Y0NA 2P81A 1ODDA 3S32A 3I3LA 3KEOA 4BH9A 3LMMA 3DEUA 2IW5A 4I01A 1X3ZB 2BV6A 2EFPA 3S93A 2DYSH 2CQXA 4UHTA 1EV7A 4HV6A 1X1AA 3GTPJ 3WE3A 4A3DJ 3AL0B 1KYZA 3K9TA 1FIAA 2RGVA 4HQMA 1FIPA 2W00A 4RMNA 2BVLA 1E3PA 3ZOBA 2R0QC 3L9FA 3PJRA 4EEFG 1NHAA 2LF7A 2K3PA 4OIOF 2EFOA 1R1VA 3BPVA 3VPRA 4YIRX 2QSFX 3ERMA 1NK2P 2Z2SB 3I4MJ 3KCCA 4XMYA 2EZIA 2DMPA 4A6EA 4PUSA 3OS0A 5IYBJ 3LSPA 1SMYF 5F04A 1V5FA 2NVTJ 1Y39A 1MNDA 3BR2A 1MJ9A 2OQGA 4OIQF 3G6EI 4S0HB 1J9IA 1U78A 2ID3A 5JLWA 2DA4A 2KIQA 1LE8A 1QPMA 2WAQA 2CFXA 2H09A 1W4MA 3ISPA 4DZJA 3K70D 3FBNB 4NNJA 1RI7A 1G59A 4AIKA 2X6WA 2ECCA 2I8DA 1PVEA 1Z9CA 3MKLA 3L1PA 2NNYA 4KA4A 1D8JA 3HKZN 2LDUA 3JCUC 2AS5F 3AFHA 2ZXHA 1QBJA 3OSGA 3LFKA 2QLZA 2HPMA 3F72A 1YX3A 1N25A 1BOAA 2HDCA 2GM4A 2HQNA 1FC3A 1YIJI 2OAZA 4B09A 2KT0A 2COBA 3GTQJ 3H3UA 3HG9A 2MGQA 3AAFA 1BL0A 1JT0A 4ZYEA 2IT0A 4A2UA 5E8GA 4IL6C 1V3FA 2BZTA 1H88C 3S1NJ 1H0MA 1UFMA 4ZH4F 3KETA 1B1BA 4BQOA 2VN2A 4P9UA 3RDIA 1FMVA 2A69F 1LQ1A 2DXIA 2K02A 1STZA 4C2MJ 2VQLA 1ZTRA 4HNUA 2V1UA 1V5EA 2COMA 2NVUB 3W3CA 3OS1A 4XONA 2R7RA 1Z1DA 2L01A 2QKMB 1R49A 5A2QK 1S7EA 2DA6A 4XSZF 1W0TA 1DGRM 4KITB 5EDNA 5LD2C 3P5JA 4LJZF 3O8GA 3OL3A 1VQOI 3PUBA 3OYFA 2EH3A 1ON2A 1Y1VJ 2TDXA 2IAIA 2VT2A 2XAJA 3RPUD 3F22A 4IPAA 4CCMA 4K2EA 9ANTA 2DOAA 4BJTA 5LHIA 4PJLA 2V26A 2NVQJ 4KMUX 3L2UA 4GFBA 2LP0A 2M1BA 2IA2A 3I59A 5E18F 1G6NA 2KRCA 3LL7A 1OFCX 1TC3C 3DU6A 1SD5A 4ON0A 1D5VA 3GX4X 2E19A 4M3FA 5IP9J 4A3KJ 1IRZA 2FA5A 4YIIA 1UMQA 5EZGA 3DTIA 1NK3P 2IS2A 2AXLA 3GMEA 3IH2A 1FMWA 3VWBA 2LOOA 3GWZA 1W36D 2E2JJ 2V9VA 4XORA 4N0BA 1OCZH 1P6RA 1G3YA 5DUKA 2JWTA 3BJAA 2QGUA 3E6BA 3CCLI 4WK8F 3DP7A 1IDYA 4KYWA 1VQMI 6PAXA 2LVSA 1ZR4A 3W2AA 3GZ6A 4P9FA 1RETA 2VB6A 2EV5A 3KPHA 4C3HJ 5BQTA 3J81K 3GTJJ 5DM7F 3FKJA 2BGCA 5FROA 3KYDB 1TW3A 1K4SA 1I1GA 1VQKI 1R5HA 3CCMI 1Z6RA 2DMNA 1VQLI 4NC8A 3HRTA 2QQBA 4BNCA 2K9SA 2GXBA 1KGSA 2DYRH 3MKWB 3EUAA 4G94A 3RQ4A 2QWWA 2Z5UA 1BW5A 2JPBA 3MVPA 3ZQCA 1K7AA 3LSKA 1FJLA 4RGXA 3L7WA 4JOMA 4LITA 1E3HA 2Q2EA 1R5ID 4X1EA 4AVPA 1JKRC 2STTA 4IRGA 4XL9A 2ISYA 4ZYAA 2L7FP 1OCTC 1YS7A 5DUIA 2DTZA 2MD0A 4PK4A 2F5DA 3E1SA 3HSRA 1W5SA 3OIOA 2M0CA 1E2XA 1MDMB 1ZAOA 1R4NB 2VKDA 4KDPA 1RESA 5FKKA 2HYJA 1Z77A 3CP8A 4Y17A 1YLFA 2K4JA 2R7QA 1WVRA 2Z9OA 3H3VK 4HSTA 3LSTA 3CMYA 2DFHA 3M07A 4HRIA 5D4RA 4RM3A 1XMKA 4MLOA 5ICEA 4NHJA 3RYPA 1LPQA 4DBQA 1A36A 3V8LA 2CG4A 2P6SA 1WPKA 4CXFA 1DU0A 2QF7A 2CW8A 3J80K 3QP5A 2XC7A 1O3SA 1ERDA 2L0KA 2XB0X 3VYRB 3ZMTA 1MZBA 2XDVA 3MZYA 2CQ7A 3H0GJ 4EV0A 3QYFA 4UB6C 3CMMA 1ZG1A 1QGPA 3DKXA 1FT9A 5L3BA 2E5ZA 1XSDA 1OMIA 1TQIA 3FIWA 2Y0MA 5DM6F 2EIKH 3EUHA 2ECBA 3KEYA 4BHCA 2FRHA 3MKYB 1ORKA 1LNWA 4BHBA 1A04A 1JXSA 1A6QA 4L9VA 1JI8A 2NNNA 2XHKA 1A31A 3UKGA 5D6FA 5ILUA 2P6TA 4C2UA 4FCYA 2HXOA 3KLNA 4UV8A 4L9TA 3JRHA 2HVRA 3JRDA 1KONA 3BG6A 3Q0UA 3QP6A 5CKTA 2VQHA 1X3UA 1XTAA 4U7BA 1YE9A 4II2A 2A6EF 1OPCA 1NH3A 3J7ZI 3IKTA 1ZN2A 3VEPA 4BBSJ 4E7ZA 3JRAA 3A02A 1CF7B 4ENNA 1Q1VA 4IJAA 5LLQA 4XLAA 4BQNA 4L0ZB 4KISA 3QYEA 2ISZA 4D0PA 2XPVA 3U21A 1EH8A 3H92A 4L9NA 5HDGA 3LAPA 4A3BJ 4UVAA 5B3SH 2DO7A 1U8BA 2QCOA 5CLSA 1WSUA 3TEDA 4D9JA 3K4KA 3QPHA 3EYYA 5F64A 4Y15A 2OZUA 3KP4A 3HEFA 1F4KA 3BOQA 2F4MB 2FE3A 3Q0VA 1QRYA 3BR0A 1IN5A 1SVOA 3KYCB 3D5SC 4DZPA 3AL0C 2FXAA 2V9PA 1RR7A 3VB2A 3OY9A 3ZQIA 1ZLJA 4M3GA 2PBIA 1HA8A 4IEJA 1J7KA 4CUGA 1HSJA 2HZTA 2WB1A 3ZGKA 3GTLJ 2OCCH 2PFBA 1YJNI 3H9GA 1O3QA 2AO9A 3CF5F 4RGRA 3DFGA 2HGCA 3FXKA 4A3IJ 2X0LA 2DMQA 4DYQA 2QBYB 1HW5A 5HOOA 3PSIA 1BI0A 1U0JA 2ZC2A 3R61A 1K78A 2XF7A 4NC6A 1YFHA 5CVUA 3QU3A 3DPLC 1SD6A 1SEUA 1ZKGA 4YFNF 4OMYA 3K6GA 1F36A 3HOTA 4Y3OA 5JI6A 1WJ5A 4MNUA 3A01B 2RNGA 3S1MJ 1OCCH 5DD8A 4ESJA 3PQKA 2CUFA 2OCEA 5C44J 2DQLA 1TL8A 5BS6A 2QKLB 1W5TA 3NQOA 5EJCA 1X58A 2XROA 3GTKJ 1HOMA 4M72A 1SANA 4XLPF 4O3MA 3RKYA 1UG0A 3DBHB 4MTEA 1USSA 2ME0A 1B6AA 3TP3A 1FWZA 1KU9A 2E36A 2ELHA 3S16J 5CVIA 1IO2A 4R79A 1P4XA 3VYSB 3W6JB 2X6YA 1RR8C 1AKHB 2BW3B 2KIUA 4RAYA 2WAFA 2HYGD 1Z7LA 2WADA 1ZGWA 4M6VA 2FNPA 2PMUA 2CU7A 3CP2A 4UY8I 3MZ8A 3QWLA 2JA5J 2XPWA 4IRIA 2IGNA 1BI3A 2FQ3A 1R23A 1SVLA 1GT0C 2EINH 3L2CA 4ENKA 3BLYA 2MLKA 2BOLA 4LG0B 1E17A 4C3JJ 3FBIB 3LFUA 2G7UA 4JQFA 4XRSG 3OYHA 2EBIA 1IN6A 4ENJA 1UB9A 1Y8RB 3ECHA 4C9YA 3DQVC 4Z6YA 4M6XA 2KZVA 3WTYC 5IPAA 2FEZA 1SAUA 2R7FA 1R7JA 1ZG5A 2IRFG 2WC2A 2X1CA 1AOYA 4M3DA 5FLMJ 4PFOA 3JRFA 3PO2J 1NG6A 2K7LA 3G1OA 2O7OA 3WODF 5CPRB 3FK7A 2M4GA 1DP3A 1O4XA 4M3BA 1UJ8A 2H6BA 3FMSA 3IH3A 2DJIA 3ZQHA 2LY1A 3EPZA 3BZ6A 3TW6A 1X3WB 2V79A 4S05A 3W2WA 4LFUA 2AQEA 3ECOA 1WZ2A 4RAGA 3ZXSA 2A6HF 4ZC3A 3AG1H 3DEEA 3BTIA 4BHPA 5FKMA 1EF4A 3L09A 4CYCB 4XBFA 1XCBA 3S15J 1HDDC 4D1QA 4RGSA 4FISA 2IBDA 1YIOA 2KFDA 3K69A 4XSXF 4A5NA 3IWZA 2NVXJ 4EJVA 1KQ9A 4WCGA 2L4AA 4BE0A 3PSFA 4G7HF 4D5FA 2MC3A 3TO9A 3GF2A 2DT6A 4Q4ZF 4BY1J 1B4AA 1H9GA 3WTWC 2LD5A 3U9GA 3Q3SA 2F5CA 4ZYHA 1YX5A 1WFXA 1OCOH 2H8WA 3D5LA 1TP4A 5FD5A 2VLAA 2PLYA 3I4NJ 1Z3YA 2VI6A 3BDDA 3GFLA 4IZZA 5H2FC 4NBQA 1EH7A 2M87A 3ML6A 4HQEA 4Y33A 2KJBA 1PUFB 1TT0A 3DCFA 5HVQC 3AKZA 3OYMA 3HKZA 1U8RA 2D1VA 1S72I 4I7HA 2R7SA 2RQPA 4XQFA 1P7JA 2GBYA 2W84A 5JLXA 1VQ7I 1MMGA 1T95A 2WB1N 2A3SA 2KKOA 2NVYJ 1W5CC 4ZTJA 3BTCA 1T33A 3ABLH 5LHHA 4RAFA 4F7ZA 1YQAA 1TT5B 3HOSA 4RM2A 2P8TA 4II3A 4DBRA 2KHMA 3KZZA 3QOPA 4JX5A 4A69C 4DIQA 5IOYA 2LNBA 4HX8A 2H1KA 5D5XB 1PP8F 2JSCA 2CWEA 4HA8A 5KAIC 1IV6A 3BTLA 4WXHA 2QQ8A 3S1RJ 3DLAA 1BA5A 3COAC 3FXMA 1VQ8I 4LGWA 2Y9ZA 2FF4A 4E7IA 1YG2A 2EK5A 3HTSB 5J47A 2CH0A 2V4JC 4DGWB 5DYMA 3CC2I 4CYDA 4CDGA 4EGYA 3PNVA 1HC8A 1MH3A 2G7HA 2HTSA 5KCMA 5J3LA 3GBGA 1FNNA 3KP7A 1FTTA 1K83J 1OR7C 3DWLE 4EJTA 3FHNA 3A1YA 2IA0A 1BC7C 1KU3A 2VQGA 4BXFA 3PIPF 1YTYA 1Q1HA 4LMYA 1XB4A 4XRFA 1ZGJA 2R93J 3ZN1A 2B63J 2L02A 4OOIA 3CCYA 4WWCA 2CV1A 2DA5A 2MYSA 3K4JA 3P9IA 3H1CA 5J1UA 1PDNC 1LVKA 2WY8Q 2HU9A 4LIUA 3ZQLA 2MW8A 5LGUA 2FX0A 3AG4H 1QZYA 3LSRA 1YITI 2L5QA 3CTAA 4LB5A 3DKYA 3GUDA 2M7AA 3DF8A 2AHQA 4UVCA 5FRNA 4BU2A 2W82A 2JQ7A 1IN8A 4XIDA 4BDYA 2VXZA 2O9LA 1B9MA 2O5RA 1D8KA 4YFKF 3C2GA 1AU7A 4RLQA 4BJ5C 1WI9A 2HEOA 1FBSA 4ITVA 4N9HA 2E5NA 2JSPA 2LBFB 4ZZDA 1HKSA 1I27A 1KU2A 2NYXA 2RAEA 1ONVA 4BYYA 2D45A 1VQ9I 2GIZA 2IGKA 3Q5FA 2VJ4A 3ONQA 3E5UA 1BR2A 5LEKA 1MDMA 3H5RA 4ANJA 5F27A 5GAEJ 3A0BC 1IGNA 3D1NI 3BQYA 4I76A 3ESWB 1XSXA 2K85A 3OIPA 2KJCA 4I6ZA 1ZRCA 3CJRB 2EQRA 2RVCA 1BN5A 1LDJA 4A0ZA 1D1AA 5A2QZ 3JSOA 3OMYA 5KHDA 2HQ5A 2JJ7A 3OOUA 2A5YB 1X1DA 5ICCA 1WJAA 1ZQ3P 2FUG2 2EFNA 2E7WA 3PO3J 1JKPC 5KAFC 4KNYA 4H4KC 1XGNA 4AIDA 2Z33A 4MTDA 1IC8A 1JUSA 1UAAA 2DA1A 2FJ1A 5BMZA 3PUFA 3OYDA 3IV5A 2ZNZA 4IKFA 1FOXA 4DNCA 2I5UA 4BKXA 3JREA 2ELKA 2HOAA 3HRSA 4LD5A 4A0XA 5BNGA 2ZXIA 3G1LA 1FBQA 4CSWA 2VIXA 1Y0UA 2DFIA 3SHFA 1MMSA 1U5TB 1ZR2A 2L2OA 4ZDPA 1MBHA 2FMLA 3K4LA 1Z05A 4YEJA 2QSGX 2TCTA 4AC0A 2DW4A 3FXUA 4NB5A 5CQEA 3CCEI 3VYUB 5LRRA 2MG4A 2BY3A 2GXGA 3HC7A 1MGTA 1U2WA 4ZYDA 1P4AA 3CUOA 2BXZA 2JTVA 3F8MA 3D0SA 1R1TA 2R92J 4RB2C 5K5OA 2CGPA 3O2PE 3J81Z 2ID6A 1N78A 4HZFA 4AWXB 4FETA 5H6QA 2VT3A 2JK3A 1CF7A 3HDDA 3F9KA 2VQCA 3BCBA 2EZKA 3G4SI 1W7PD 2OZ6A 4BACA 3DTEA 3WTTC 3SFIA 2P7CB 1JTXA 4I02A 3CF2A 4KIBA 4YIFA 1JKQC 2DA2A 1LVAA 1JUMA 2HZDA 3ABKH 2XAQA 4IVNA 2R5ZB 2M45A 5AIPA 4J00A 2E7XA 1IRFA 3ELKA 3HB9A 2R5YB 1O7LA 4RS8A 2W7NA 4LB6B 1OYIA 1IUYA 2DOEA 4GRIA 1FSEA 1QQIA 4HLYA 3LWFA 3K70C 2HWVA 2F4OB 2XGCA 3H0DA 1F9NA 3HJEA 1GXQA 2VOOA 2NXNB 1J2XA 2OQRA 2VASA 3BG7A 3IP4B 1APLC 1HW1A 3FK6A 2VUMJ 2FOWA 3OYKA 3H9QA 5M3FJ 3FXQA 3I71A 4YELA 3WG7H 3A03A 3T8TA 3I4PA 5K1YA 5JHFA 1Z91A 2DDAA 4GGGA 5K7ZA 3PIOF 3C3WA 3MMYB 2QBYA 2ZKZA 4AIJA 2DJNA 2M4KA 3HRUA 4HOBA 1RKTA 3M8EA 2K3FA 3IAM2 3J80Z 2F5FA 4Y4RA 4G7OF 2KISA 2BVMA 2WTEA 5F1JA 4BDZA 4AM3A 1DPUA 1IV8A 3NAUA 3KE2A 3JTHA 3A01A 4E7LA 2JN6A 1WH7A 3Q0WA 4ESBA 1MBFA 1YI2I 3MEXA 2H8RA 3SYTA 3DLLF 1Y8QB 3CMEI 2NRAC 4MO7A 1GVJA 5M5WJ 1MBEA 2HPIA 4HLXA 4AUXA 2HI3A 3JW4A 5EF6A 4PJJA 4HG2A 4A0YA 3GO5A 2E2HJ 3K2AA 4UXNA 1DGWY 3DXJF 1Z0XA 1ZHFA 4E7SA 2JPCA 1XGOA 3I56I 1AKHA 2BW3A 2F5EA 2CUEA 2M30A 1XX5A 1MSFC 2A61A 5FD6A 3A2KA 1EKEA 3L2QA 2RQQA 5E3LA 4R8HA 3HUGB 5GAHJ 4HV5A 2DLLA 1U6GA 1MBJA 1XMAA 1VQ5I 3KIOA 3ZQ7A 1K79A 4LG0A 1ETYA 1IXRC 4C3IJ 4D7MA 2IP2A 3OYJA 3KP2A 4F92B 3ASOH 3JTGA 4A3CJ 2Y48A 5IT3A 1VFCA 2DU9A 2PMHA 3H35A 1JGGA 4FASD 4YG2F 3BZCA 1I5ZA 3E6DA 4WXCA 3TQNA 3CCVI 2JRMA 3SFZA 4A3EJ 4RLFA 4B4CA 4DYRA 1W36C 4KN4X 3I55I 4MIMA 3WTUC 4KICA 4IHWA 2G9WA 4LG3A 3GLLA 2XB5A 4D5CA 1D0ZA 4NQWB 4IOCF 2F4IA 3HZJA 2F5VA 2O0YA 2RV8A 4XM3A 5J1YA 5TISC 2L9SA 3MFKA 3NWSA 2WA0A 3V8JA 2OU2A 4HX4A 3U1DA 2XVCA 4PJ0C 1H8AC 2VPRA 3J7YJ 3JAMZ 1FOYA 1IZ1A 4PFPA 2UXXA 1NG7A 1JHFA 1HCRA 3EQLF 3QPLA 2AXTC 4CYCA 3G3ZA 2QZ8A 2FD5A 2ZJPF 4OMZA 1B72B 5JHUA 4KJZA 2VE9A 2CJJA 3T5XA 2E2IJ 3OYAA 1T8IA 1WRJA 1AWCA 2FNAA 2YPRA 4A3JJ 5C4JJ 3K4CA 3WU1B 4PZJA 3ULQB 5EG0B 1X2MA 3F6OA 4PGGA 3RPUA 4JX4A 2E1OA 3W2VA 1DP7P 2PJPA 3GTOJ 5HS9A 2W25A 4XRMA 4L18B 3ZR8X 2QENA 2DOFA 3I64A 1YOVB 1WJFA 2R7TA 4U7DA 3GXOA 1PUFA 2VODA 5B1AH 2BHZA 4OIRF 4XICA 2D2WA 3RSNA 1HKQA 4IQJA 3P9KA 5GP9A 4EM0B 1WQ2A 1WI3A 4UUSB 1FZPB 4HNTA 5E3OA 4YRVA 5BOXA 3HOWJ 1UHMA 4O6JA 1IUFA 4GXOA 5M3MJ 3HOZJ 3GZNB 2CV2A 5GPAA 1RRJA 2E1NA 2LTPA 1ACIA 2QYOA 4EM2A 5IOZA 1C0WA 2CQNA 2Y9YA 4ZDLA 2GA1A 3TOAA 3CCRI 4OAYA 5HLHA 2HYFA 3E6MA 4U0YA 3CD6I 3R6SA 4GYIA 5CJ9A 4XR6A 3OS2A 2VBZA 5H20A 3BTJA 1QHGA 3TBIA 3GVAA 2LK2A 3WU0A 5D4SA 4ZTFA 3HOUJ 4IQ4A 1G8XA 2DT7B 2P0WA 2J5PA 4QPOA 4B3AA 2CO5A 2R7XA 1ITYA 4Q5SF 3JAMK 2ZMEB 3CCSI 2K27A 2CYYA 3ZCOA 5IYCJ 5AIQA 3OYBA 2R7DA 2A5WA 2XAFA 2YSRA 3BT9A 2DPUA 1S3JA 2CMPA 3B6AA 1OYYA 4ETSA 1ETVA 2ZXWH 1L3LA 3DPTA 1PYVA 1WGXA 3R60A 2PG4A 1ETWA 4JYKA 4Q48A 3T1BA 5K5QA 3PFYA 3S2HJ 2MC4A 5FFZA 1OCRH 3OV8A 3RKWA 2ZSIB 5DDGA 1IAWA 4LK0F 2XV4S 1SFXA 2L4MA 3NRVA 2YR2A 2DFFA 4RBOA 4CCOA 1N77A 2O8XA 2R7VA 2EWNA 2HNHA 4LOCA 1YHQI 2LC2A 3O8HA 3KFWX 2DQRA 3TDZC 3LSGA 1IRGA 1R71A 1D3YA 4V19K 1R22A 3TDUC 3TL4X 3OR2C 3F6VA 1TW2A 4ABZA 4DYCA 1GHCA 5K7HA 1OLTA 1MKMA 5TRDA 3JR9A 2DAOA 1U5TC 1HW2A 2HOSA 2QUFA 2B9SA 1J75A 1SFKA 3ZPLA 2M8GX 1WJCA 2A05A 4PSXA 5KVRA 2X4HA 4V2GA 4DQ2A 3T8RA 3LAJA 4TV7A 3BG9A 1MSEC 1YRNB 1A35A 3MD2A 2LBFA 4B3XA 5IY5H 4HDUA 3IWFA 2HXIA 5GADJ 4CCKA 3C18A 2MA3A 1FLIA 4M3EA 1YS6A 3ZQQA 5CVJA 2EJRA 4Z2YA 3RCOA 1UZCA 3FKIJ 3K1PA 3G73A 5E3MA 2X1DA 1G3SA 2KP6A 4F3QA 2Z99A 3GLXA 1TWAJ 2F6CA 3V7SA 5HNHA 1ULYA 4CA0A 4P96A 2CSOA 3HM5A 1LFPA 1XSVA 1UELB 4EJWA 3HYIA 1B8IB 3ZQGA 4CHUA 2E34A 5FFXA 2GQQA 1I39A 4I09A 4EGZA 3K1NA 3M8FA 2ME6A 5J4VA 5CQGA 3CO6C 1XDSA 4PJNA 2DMTA 3S8PA 1X2NA 4BEHB 2E35A 3ZMZA 3HL2A 3UR3C 3SQNA 4FTHA 3GTMJ 2HTJA 3CCUI 3S1QJ 3BG3A 2ADUA 2V9KA 5EEHA 2MABA 2PQ8A 1RPWA 2IPQX 4A3MJ 2W1OA 3QQAA 4NDLA 1RIOH 2OTLI 1ZRFA 2YU9J 1YYVA 2CV0A 3RYRA 4CCNA 1XMXA 1OISA 5D5WB 4NUBA 1FSHA 2R4GA 1REPC 4N4OB 1D0XA 1UHSA 4IHSA 5J1RA 3OYLA 1GDTA 2EZHA 2JT1A 4IHVA 2EV0A 2PI0A 2OV7A 2OC6A 3DV8A 1PP7U 3R0AA 1W7PB 2VKHA 1JJ6C 1WWXA 3IC7A 5LFAA 1U5TA 3J7AY 4MQ9F 5D5UB 5HDNA 3QOEA 4L9JA 2EA4A 1MMNA 1I3AA 3CC7I 3F8NA 1MNEA 4XLHA 5CYVA 2UUZA 3B6CA 4XLFA 2R7UA 2E1MC 1KQ8A 1JHHA 3SEQA 3SZGA 5EZHA 3NEUA 1L0OC 4RAZA 1RNLA 1Z7UA 3ZMUA 1BI1A 4G9YA 1FP1D 4JP0A 1LEBA 1VTNC 4JBAA 5IYDJ 1LEAA 1K61A 1HF0A 1PUEE 1O57A 2V7FA 4B48A 4G8XA 2DBBA 1XCVA 1JTYA 1VQ6I 1X1PA 2PN6A 4RB3C 1T39A 2Y75A 2WWYA 3AG3H 3F8BA 4E4HA 4KFCA 4GDFA 2VJIA 4XK4A 4UV9A 4XN0A 1H9TA 3OR1C 2RKHA 3CCJI 3BR5A 2CRGA 2JVGA 4EJUA 3VDXA 2R5ZA 3RI4A 5GTHC 2V6CA 1JE8A 4KMFA 3GW2A 2LYCA 1GUUA 2DTRA 5F0HA 2R5YA 2VOPA 1FTZA 3N97A 3V4GA 1ZGAA 3FF5A 4B43A 2VKEA 5TJJA 2GAUA 1K4TA 2ZSHB 2V1NA 3X2QH 2M34A 3O6BB 3WG9A 2STWA 4CZZA 4DW6A 2MLGA 1P92A 2OBPA 1P7IA 5DEQA 1LJ9A 1W0UA 1SFEA 3BZKA 4HF0A 3RKXA 3CJNA 2LLKA 4KIFA 4F55A 3HOXJ 3CMAI 1Y56A 2RN7A 1UHWA 2PJRB 2V6EA 1Z21A 4ZJZA 5FLXK 4XKBA 2GA2A 4OINF 3HHGA 2H1LA 4WX9A 4X0GA 1P9QC 2KIMA 2XIGA 4D7NA 1TQPA 2VL8A 3CJTB 3VOEA 1M1EB 1A5JA 5D8KB 5ILVA 1DU6A 2IJLA 4L0YB 3SXYA 3M3YJ 5FLVA 1I1SA 3H5NA 1J5YA 3A0HC 5LBQA 1IN4A 1TNSA 2H94A 2X1EA 3RIRA 4XKCA 5JVTA 4QPQA 1DPRA 2HKOA 2IGMA 1SFOJ 3LA7A 4WXDA 3QU6A 5E1ZB 2KDZA 1OQYA 2HQAA 2ZBKA 2IGOA 2X6XA 4KUMA 1ENHA 2LG4A 4QTRA 2OD5A 2OF7A 1R00A 2K9QA 4N9IA 1LUJB 2JA8J 3ERED 4M9SA 2A68F 4FE4A 1F1ZA 5DTDA 1V4RA 3PNYA 3E7LA 3CJQB 2D1HA 1HBXG 2ZXJA 2XUBA 3LA2A 4Q47A 2QVOA 5KNLA 2CQQA 1LFBA 3BY6A 3RTRA 5F08A 3ZQFA 2W48A 2DN0A 1X1BA 2QA4I 1VNDA 4YFXF 2XF6A 3KZIC 3HUGA 3SZTA 1XPXA 4RA2A 2EV6A 3I0TA 1ZYRF 3P7NA 1T6SA 2ACJA 3CZ6A 4H0EA 2YX7A 4FX4A 2VC0A 4XKVA 3K0LA 3LQRA 3MN2A 5LHGA 2XAGA 2P5VA 3RZOJ 3BQZA 2H27A 3CDLA 2O03A 3OYEA 1D5YA 2G0EA 4LLGF 3VYTB 4RGUA 4UUVA 1RC9A 4G12A 2M8EA 4DJAA 3JRIA 4HF2A 2NS7A 3C2HA 2P7VB 2K40A 3OYIA 4L5IA 3GFIA 4Y7NJ 1RKWA 3M8JA 5E3NA 2K9NA 1B9NA 4NQWA 1I3QJ 4QSHA 1OR7A 2Y0SN 3BC8A 5JR3A 4PSWA 2O6GE 3V7RA 4FT8A 4G6TB 4M73A 2BXYA 4BL0B 1S7OA 5J6XA 2MH9A 5FGMA 2PEXA 3HIFA 3KP3A 5HLGA 1LB2A 2ZMEC 3GFMA 4A5MA 2IS4A 3E0JB 4IX7A 1VQNI 3R4KA 1R4MB 1WHUA 1IJWC 4UNOA 3IL2A 5FO5A 1MJBA 4N4NB 4AD9A 1TBXA 1KZHA 4CO8A 1YW7A 1FYKA 1Z6TA 3WHCA 4O5VA 3EDPA 3VODA 1ZK8A 3F8FA 3LSMA 4HPQA 1ZH5A 2X51A 3RZDJ 1T98A 5J40A 1B72A 2VJ5A 1QO0D 3FM5A 2ZO4A 2M0MA 3LQQA 5M5YJ 2VPLA 1G3WA 4FX0A 3KX2A 2Z3YA 3WTXC 5EG0A 4HDVA 4BBRJ 1K6OA 2VBXA 2LSOA 2NOGA 2FBIA 5LEJA 2KMUA 2FBHA 2YX4A 3TKYA 1GVDA 5EEAA 3C2BA 1ZREA 1R9TJ 5E20A 1ZLKA 4CH7A 4DOZA 4A12A 1RUOA 4UUSA 1CQTA 2GZWA 2Q8KA 2XAHA 1SVMA 1HDPA 3A4CA 4AU7A 5EGOB 5JFRA 3FXOA 4A93J 3HOYJ 3NWTA 3CDIA 4E70A 1BOBA 4GYGA 2DA7A 4XRSA 3LNQA 4BQAA 3H9JA 3K1MA 4HYEA 1WJDA 3CLQA 4J01A 1TWGJ 1ETQA 2V1XA 3FWEA 5DCMB 2KLOA 2E71A 2O3FA 1ZRDA 3OSFA 3NARA 1DUXC 3H36A 3VSLA 1OJLA 4V2FA 2AQFA 1JUPA 2CW7A 4KT5C 4AYBN 1QVUA 2PMZA 3QAHA 2ZMEA 4G6QA 3VFZA 3CQZJ 5FKLA 2WV1A 2Q1ZB 1OYWA 3FISA 5F0CA 1BJAA 2D5VA 4KN7X 5L3CA 5FRMA 4QLCU 1LDDA 1PJRA 4XNFA 4A6DA 3S2WA 1TLHB 2YU3A 2EFQA 1ZELA 1IRXA 1FOKA 1WKMA 4UB8C 5IP7J 1Z3XA 3C7JA 4JK1X 3Q9SA 2XGEA 2M3AA 2BYVE 5HNFA 1SAXA 5C3EJ 2BEOA 3IRRA 2L54A 1S5LC 4F93B 3RKQA 2FMYA 5HDKA 1POGA 2DODA 4ESFA 3Q9VA 1VF9A 4HW0A 4RB1A 2BY1A 2LRDA 4U88A 2LKXA 1HQCA 1BIAA 1OCPA 1H89C 4U87A 2VJJA 4HSRA 4M71A 4BS9A 1F43A 2F2EA 2ESNA 2E1MB 3OYCA 3QPTA 1O7FA 2KL4A 3S2DJ 1HSTA 2XRNA 4ZYGA 1OKRA 3PL8A 4L5JA 2DK8A 4MQVA 2EFWA 3GYHX 1JT6A 2VKVA 3BROA 3R0JA 4FQGA 2O61A 1S6LA 2W85A 5C4XJ 2XRLA 3C1DA 4F52A 3HPHA 5DV5A 1FOWA 2OUMA 3ASNH 3CO7C 1BI2A 2BBYA 3PQJA 1V54H 4BQQA 5EEGA 1YRNA 4ASNA 4LIVA 1E0EA 4U0WA 3FX3A 2CW0F 1TWFJ 4MFDA 3CUQB 3GZ5A 1AHDP 2EIMH 2A07F 3EUHC 2E60A 5H6RA 4MEXF 2GOMA 1GLNA 1MMAA 3L2RA 4BGDA 3EUKL 4HEA2 3G71I 3FM3A 5HODA 2M5WA 4HAMA 5FKNA 3SJMA 2GWRA 2HDDA 4P5OA 1JKOC 5EYRA 2X48A 3L00A 1ETKA 1B8IA 2JA6J 4PJMA 1XG1A 2JMWA 2XAUA 3LSHA 1I6HJ 4HBLA 3ZRGA 1U9OA 3I53A 5D5VB 2DI3A 3L2VA 4RB0A 1WJEA 1MNMC 2FOKA 4WF2A 4BEHA 2F48A 4IHXA 3LSJA 3CCQI 5J8FA 3KP5A 4EVIA 1QVTA 2HOEA 3OWTA 1X19A 2JUGA 3SEZA 3F8CA 3BR3A 5FKOA 3HHHA 2IVMA 3ABMH 4EM1A 1DQUA 3TO7A 5GTIC 2WAQN 2IEKA 3I9V2 2W4SA 4MGRA 2ZCWA 2HQRA 2IA1A 1MH4A 3V8KA 3LOCA 2ZFUA 1YJWI 4IXAA 3HTUA 5D6EA 3RJPA 3FMQA 1R58A 1J59A 1TNTA 4IHYA 5FB2A 5ILSA 5GPCA 2YUSA 4E6KG 2UXNA 4BXXJ 1R1UA 4U0VA 3W6VA 3TGNA 4X6AJ 3TMOA 1W7PA 4A3FJ 2VC1A 2JA2A 1KYWA 2WBMA 2L7KA 5BPDA 1SD4A 4OAZA 5ED4A 4LLNA 3TO6A 1D1CA 2X6OA 3B02A 3K2ZA 2LKPA 1SD7A 2X9DA 3E3VA 3FHZA 1LE8B 3WE2A 2XKPA 2V1DA 3HGGA 4IF4A 4CCJA 2E1CA 1S8NA 2ZJ2A 2M7BA 1MD0A 3U1KA 2I10A 2LY2A 3MWMA 1XD7A 3P9CA 5LGNA 1G2HA 5F6FA 1I50J 2CUJA 2VBYA 2NS0A 3DU5A 4AVZA 1RUNA 4A3GJ 1MBGA 2R7ZJ 1NTCA 1BJZA 5D8LB 4J19A 2Y69H 2VBWA 2QEXI 2M9HA 2PMZN 1T56A 3PFIA 1I6XA 3WTSC 2LR8A 1BBYA 2KPMA 4OIPF 1YJ9I 3MQ0A 5E17F 2PX9A 3AG2H 3BP8A 3LSIA 3GEZA 1LFUP 2BHYA 2ETHA 4B1RA 1YW8A 1VQ4I 1P4WA 4C30A 4F91B 5HLTA 2DCEA 1IW7F 1FYMA 1BC8C 1QA6A 5IT9Z 2K9MA 1TWHJ 4BXUA 1QHHD 3ZP5A 2XKOA 1EA3A 5M5XJ 5FJ8J 4PGHA 3HBLA 4CGZA 2Z16A 2YS9A 1D1BA 2HOTA 2IXSA 2NAZA 1BIBA 5L3EA 1XDUA 1QNTA 1JGSA 5B1BH 4XOPA 2H6CA 1Y6IA 2PJRA 1ZARA 1V55H 3JRCA 3DBLB 3M9AA 3QPSA 1KU7A 3BR6A 4FE7A 3HSFA 2ZJQF 1T2KA 4HF1A 3WGIA 1JJ8C 3EYIA 2XASA 2OTJI 1BW6A 4NC7A 2WV0A 3EETA 4I2OA 3QYBA 3BWGA 2MSYA 2VXDA 2KQRA 1SFUA 4XKWA 2JZYA 4HX7A 2XGXA 4CICA 1MJAA 3KZYA 3DEWA 3I5UA 4L5EA 2ZFWA 1BR1A 2N8GA 3K4MA 2CFOA 3FMRA 5HLIA 1FYLA 3CLOA 3GCMA 5E79C 1U3EM 1U9NA 3I59B 3F23A 3KLOA 4IRHA 2BY2A 3M4OJ 4P1WA 1MMDA 3K10A 2QM3A 2KDOA 2LH9A 1HLVA 1RZ4A 1G4DA 1QZZA 4I0BA 3WGGA 4AIHA 2CUZA 2FSWA 1QU3A 2VE8A 2DMUA 5DD4A 2KZGA 4MEYF 1WJBA 2XSJC 1XS9A 5K7FA 2R7WA 4BE1A 3HSEA 2JUCA 3OOPA 2RC4A 3JRBA 1QPIA 2TRTA 1J0RA 3KP6A 2Q0OA 1XGSA 2DK5A 1B59A 2FU4A 1T38A 3WTVC 3DPUA 2X85A 1T0FC 3RPQA 1QZEA 1EH6A 2J5OA 3HRMA 3ROUA 4B8XA 1O3TA 3WHBA 3BPXA 2HS5A 2MD5A 5IT9K 3BCAA 2HVSA 2L9RA 5ERIA 3F3XA 4BE2A 3S14J 2B7EA 1IDZA 1YW9A 3F0CA 1XGMA 4RDUA 1HKTA 4OWRB 3ZMSA 2MH2A 2VONA 3N4MA 3E5XA 3PNTA 4KT6A 3I54A 3FXLA 1E3OC 2HVQA 2JRTA 1LDKB 2JVHA 2EB7A 3OYGA 2OA4A 3BJ6A 1ZG3A 1USTA 1VZ0A 2IS6A 1UG2A 3TW7A 1N75A 2EILH 2FQ4A 2Q2EB 3MAJA 1IN7A 2L3DA 3HGYA 2DA3A 3D5RC 2LF8A 3ZMDA 2KRHA 3MKZA 4XN3A 4ZDOA 4B47A 2WAEA 1IF1A 4Y52J 3M1CA 1WH5A 1V5GA 4M9XA 1UCRA 3H5AA 2MFZA 1BR4A 2ESHA 4UVBA 4MFEA 1F5TA 3GTGJ 3ZMVA 5L3DA 5LRSA 1D0YA 2ICWG 2Y2ZA 1SMTA 1MW7A 4MHGA 3V42A 4EMSA 1R36A 1VI0A 4M6YA 1X4PA 1O3RA 1S7AA 3B73A 5FLXZ 3JRGA 2LREA 1X4OA 5HS8A 2GOXB 3LA3A 3T0YA 4BAYA 1R6RA 3S3NA 5E1XA 2UWMA 1FEXA 4IO9F 1J09A 2A6TA 3G2BA 1FX7A 4PDKA 2GLOA 2ZB9A 3PM1A 1TTYA 3H3ZA 3M1EA 1G3TA 2Y0SA 4GO1A 1FP2A 1IXSB 2K4BA 2LMDA 2QQ9A 1Z67A 1IG7A 1TQMA 2BY0A 5GAGJ 2UV1A 2CQKA 2NS8A 4PCQA 4XOTA 1X1CA 3IKVA 5F0FA 3WTZA 2DFEA 5JVGF 2DT5A 1YO5C 1T0FA 5E8IA 4QWQA 3OYNA 2Z1DA 4BJ6C 2HDWA 3G1MA 1CGPA 3E97A 4LK1F 3V7CA 4S04A 3BG5A 2EZLA 4ZZLA 2DPDA 4HNVA 2XGDA 1WCMJ 5L3FA 5L3GA 5B66C 3S3MA 2DDBA 4FHTA 4P55A 2OJED 4UUTA 5EGOA 3FZVA 1K6YA 5ICGA 2LFBA 3MZHA 5AONA 1FBUA 2XF5A 3CUQC 3BR1A 1TZLA 3KEQA 1T08B 3I58A 4Y13A 1GXPA 3MCZA 2R3SA 1A6IA 1W1WE 3K4BA 1GV2A 3QODA 4I99C 3IH4A 5DCMA 3SDGA 3HPGA 3CESA 3ABTA 5BPIA 3JSPA 2K5CA 2R7OA 2EA2A 2L9NA 1LKXA 2GIVA 4W97A 2L9VA 3K7AJ 4BY7J 5HS7A 3E5QA 3GFJA 3E6CC 1GV5A 3FXJA 4XLNF 4B44A 4E7JA 2QSHX 1TWCJ 5J4YA 3TP0A 4LLLA 4BUPA 3S17J 5LGTA 3CC4I 3F21A 1XN7A 2WY7Q 2IS1A 2EIJH 1FPQA 3UNGC 3WU2C 1ETOA 2OPTA 4OU0A 3U2RA 5J8CA 1KQ0A 1IXCA 4G7ZF 5E1WA 3SZPA 2ELJA 1SC7A 2O8KA 4E7KA 5CVRA 5CVVA 1FY7A 2MBFA 2K9LA 3TOBA 2KRFA 4IHTA 4GCVA 3KYLA 1R5GA 3REOA 4AYBA 2CS3A 5K5RA 2P5LC 3DKWA 3HOVJ 3BJOA
chains in the Genus database with same CATH topology
2HFHA 4G6DA 1DDNA 2ZNYA 2W57A 1BM9A 2HKXA 3M7GA 4EQQA 2P5KA 4M9ZA 3CDHA 3O3KA 1K78B 1P2FA 2RDPA 4M74A 3ZN0A 1ON1A 3CUQA 2B0LA 2HR3A 3W6KB 4R1HA 2BE5F 2RNJA 4KIGA 3ABUA 2W24A 2KIFA 5KK1A 3IHUA 4I98B 1KA8A 2P4WA 5F1RA 3WGHA 4ENMA 1HXDA 5DCFA 3J7AO 3QRFF 2QQAA 4I0AA 2FBKA 4EJOA 2K86A 5ICFA 2UZKA 3FXRA 2C6YA 3IRQA 1S29A 1ODDA 3KEOA 4BH9A 3DEUA 2IW5A 4I01A 2BV6A 2EFPA 4UHTA 1EV7A 4HV6A 3WE3A 1KYZA 3K9TA 2RGVA 4HQMA 3L9FA 1NHAA 2LF7A 4OIOF 2EFOA 1R1VA 3BPVA 3KCCA 4A6EA 1SMYF 1MJ9A 2OQGA 4OIQF 1J9IA 1U78A 1QPMA 2CFXA 2H09A 1W4MA 3ISPA 1RI7A 4AIKA 1Z9CA 2NNYA 4KA4A 1D8JA 2AS5F 2LDUA 1QBJA 3LFKA 2QLZA 3F72A 2HDCA 1BOAA 2HQNA 1FC3A 2OAZA 4B09A 3H3UA 3AAFA 4ZYEA 2IT0A 4A2UA 5E8GA 1V3FA 1H0MA 1UFMA 4ZH4F 3KETA 1B1BA 2VN2A 4P9UA 3RDIA 2A69F 1LQ1A 2K02A 1STZA 2V1UA 2COMA 1Z1DA 2L01A 5A2QK 4XSZF 4LJZF 1ON2A 2TDXA 2XAJA 2VT2A 3F22A 4IPAA 4K2EA 5LHIA 4KMUX 2M1BA 2IA2A 3I59A 5E18F 1G6NA 4ON0A 1SD5A 1D5VA 3GX4X 2FA5A 4YIIA 2AXLA 3GWZA 2V9VA 4N0BA 1P6RA 1G3YA 5DUKA 3BJAA 3E6BA 4WK8F 3DP7A 4KYWA 6PAXA 3GZ6A 4P9FA 2EV5A 5BQTA 3J81K 2BGCA 1TW3A 1I1GA 1R5HA 1Z6RA 3HRTA 2QQBA 4BNCA 2GXBA 1KGSA 4G94A 2QWWA 2Z5UA 2JPBA 1K7AA 4RGXA 3L7WA 2Q2EA 4AVPA 2STTA 4IRGA 2ISYA 1YS7A 5DUIA 2F5DA 3HSRA 1W5SA 1E2XA 1MDMB 1ZAOA 4KDPA 4Y17A 1YLFA 2K4JA 2Z9OA 3LSTA 5D4RA 1XMKA 5ICEA 4NHJA 3RYPA 3V8LA 2CG4A 2P6SA 4CXFA 3J80K 3QP5A 1O3SA 3ZMTA 1MZBA 3MZYA 4EV0A 1ZG1A 1QGPA 1FT9A 5L3BA 1XSDA 1OMIA 1TQIA 2Y0MA 3EUHA 4BHCA 2FRHA 1LNWA 4BHBA 1A04A 1JXSA 4L9VA 2NNNA 2XHKA 5D6FA 5ILUA 2P6TA 3KLNA 4UV8A 4L9TA 3QP6A 1X3UA 4U7BA 2A6EF 1OPCA 3IKTA 1ZN2A 3VEPA 1CF7B 4ENNA 4IJAA 5LLQA 4L0ZB 2ISZA 4D0PA 1EH8A 3H92A 4L9NA 5HDGA 3LAPA 4UVAA 2DO7A 5CLSA 1WSUA 3QPHA 3EYYA 5F64A 4Y15A 2OZUA 3KP4A 1F4KA 3BOQA 2FE3A 1IN5A 2FXAA 3VB2A 1ZLJA 2PBIA 1J7KA 1HSJA 2HZTA 2PFBA 1O3QA 4RGRA 3DFGA 2HGCA 2X0LA 2QBYB 1HW5A 5HOOA 1BI0A 3R61A 1K78A 1YFHA 5CVUA 3QU3A 3DPLC 1SD6A 4YFNF 4OMYA 3HOTA 5JI6A 4MNUA 5DD8A 4ESJA 3PQKA 2DQLA 5BS6A 1W5TA 3NQOA 2XROA 4M72A 4XLPF 4O3MA 3RKYA 4MTEA 1USSA 1B6AA 1FWZA 1KU9A 2ELHA 5CVIA 4R79A 1P4XA 3W6JB 2KIUA 4RAYA 2HYGD 2FNPA 2PMUA 4IRIA 1BI3A 2FQ3A 1R23A 3L2CA 4ENKA 2MLKA 4LG0B 1E17A 4JQFA 2G7UA 1IN6A 4ENJA 1UB9A 3ECHA 3DQVC 4M6XA 3WTYC 2FEZA 2R7FA 1R7JA 1ZG5A 2IRFG 2WC2A 1AOYA 2K7LA 3WODF 2H6BA 3FMSA 3BZ6A 2V79A 4S05A 4LFUA 3ECOA 2A6HF 4BHPA 3L09A 4XBFA 1XCBA 4RGSA 4XSXF 1YIOA 4A5NA 3K69A 3IWZA 4EJVA 1KQ9A 4WCGA 2L4AA 4G7HF 2MC3A 3TO9A 3GF2A 4Q4ZF 1B4AA 1H9GA 3WTWC 3U9GA 2F5CA 4ZYHA 3D5LA 5FD5A 2PLYA 3BDDA 3GFLA 1EH7A 2M87A 3ML6A 4HQEA 2KJBA 5HVQC 1U8RA 2D1VA 4I7HA 2RQPA 2W84A 2A3SA 2KKOA 5LHHA 4F7ZA 1YQAA 3HOSA 2P8TA 3KZZA 3QOPA 2LNBA 4HX8A 5D5XB 1PP8F 2JSCA 2CWEA 4HA8A 4WXHA 3COAC 4LGWA 2FF4A 1YG2A 2EK5A 3HTSB 5DYMA 4CYDA 4CDGA 4EGYA 2G7HA 2HTSA 1FNNA 3KP7A 4EJTA 2IA0A 1BC7C 1KU3A 1YTYA 1Q1HA 4LMYA 1XB4A 4XRFA 1ZGJA 3ZN1A 2L02A 4OOIA 4WWCA 3P9IA 1PDNC 5LGUA 1QZYA 3CTAA 4LB5A 3GUDA 3DF8A 4UVCA 1IN8A 2VXZA 1B9MA 1D8KA 4YFKF 2HEOA 1WI9A 1FBSA 4N9HA 4ZZDA 1HKSA 1I27A 1KU2A 2NYXA 1ONVA 4BYYA 2D45A 3Q5FA 3E5UA 5LEKA 1MDMA 1XSXA 2KJCA 1ZRCA 2RVCA 1BN5A 1LDJA 4A0ZA 5A2QZ 3JSOA 2A5YB 5ICCA 2EFNA 2E7WA 4KNYA 1XGNA 2Z33A 4MTDA 5BMZA 2ZNZA 4DNCA 3HRSA 4LD5A 4A0XA 1FBQA 1Y0UA 2DFIA 3SHFA 1U5TB 2FMLA 1Z05A 2DW4A 3FXUA 4NB5A 5LRRA 2GXGA 1MGTA 1U2WA 4ZYDA 1P4AA 3CUOA 3F8MA 2JTVA 3D0SA 1R1TA 4RB2C 5K5OA 2CGPA 3O2PE 3J81Z 4HZFA 4AWXB 5H6QA 2VT3A 1CF7A 1W7PD 2OZ6A 3WTTC 2P7CB 4I02A 4KIBA 4YIFA 1LVAA 2XAQA 4IVNA 2M45A 5AIPA 2E7XA 1IRFA 3ELKA 1O7LA 4RS8A 4LB6B 1OYIA 1IUYA 1FSEA 1QQIA 4HLYA 3LWFA 2HWVA 1F9NA 1GXQA 2VOOA 1J2XA 2OQRA 1HW1A 3FXQA 3I71A 3T8TA 3I4PA 5K1YA 1Z91A 4GGGA 3C3WA 2QBYA 2ZKZA 4AIJA 3HRUA 4HOBA 3M8EA 3J80Z 2F5FA 4G7OF 2WTEA 1DPUA 3KE2A 3JTHA 4ESBA 3MEXA 2NRAC 1GVJA 4HLXA 3JW4A 4A0YA 3GO5A 4UXNA 3DXJF 1ZHFA 2JPCA 1XGOA 2F5EA 2M30A 2A61A 5FD6A 4R8HA 4HV5A 2DLLA 1U6GA 1XMAA 3ZQ7A 1K79A 4LG0A 1IXRC 2IP2A 3KP2A 3JTGA 2Y48A 5IT3A 2DU9A 2PMHA 4YG2F 4WXCA 1I5ZA 3E6DA 3TQNA 3SFZA 4KN4X 3WTUC 4KICA 2G9WA 2O0YA 2RV8A 3MFKA 3V8JA 2OU2A 4HX4A 3U1DA 2XVCA 3JAMZ 1IZ1A 2UXXA 1JHFA 3EQLF 3G3ZA 2QZ8A 4OMZA 5JHUA 2VE9A 3T5XA 1WRJA 1AWCA 2FNAA 2YPRA 3WU1B 4PZJA 3ULQB 3F6OA 4PGGA 3RPUA 1DP7P 2PJPA 5HS9A 2W25A 4L18B 2QENA 3I64A 4U7DA 3GXOA 2VODA 4OIRF 2D2WA 1HKQA 3P9KA 4EM0B 1WQ2A 1FZPB 5BOXA 1UHMA 4O6JA 4GXOA 2E1NA 2QYOA 4EM2A 1C0WA 2GA1A 3TOAA 5HLHA 2HYFA 3E6MA 4U0YA 3R6SA 4GYIA 5CJ9A 2VBZA 5H20A 3WU0A 5D4SA 3GVAA 2J5PA 2CO5A 4Q5SF 3JAMK 2ZMEB 2K27A 2CYYA 5AIQA 2R7DA 2XAFA 2YSRA 2DPUA 1S3JA 1OYYA 4ETSA 1L3LA 3DPTA 3R60A 2PG4A 3T1BA 4Q48A 5K5QA 5FFZA 3OV8A 3RKWA 5DDGA 1IAWA 4LK0F 2XV4S 1SFXA 2L4MA 3NRVA 2YR2A 2O8XA 2EWNA 3KFWX 2DQRA 3TDZC 1IRGA 1D3YA 1R22A 3TDUC 3F6VA 1TW2A 1GHCA 1MKMA 5TRDA 2DAOA 1U5TC 1HW2A 2QUFA 1J75A 3ZPLA 5KVRA 4DQ2A 2X4HA 3T8RA 3LAJA 4TV7A 4HDUA 3IWFA 3C18A 2MA3A 1FLIA 1YS6A 5CVJA 2EJRA 4Z2YA 3K1PA 3G73A 1G3SA 2Z99A 3GLXA 3V7SA 1ULYA 4P96A 2CSOA 1XSVA 4EJWA 3HYIA 4CHUA 5FFXA 2GQQA 4I09A 4EGZA 3K1NA 3M8FA 3CO6C 1XDSA 3ZMZA 3SQNA 2HTJA 2ADUA 5EEHA 2PQ8A 2IPQX 1RIOH 1ZRFA 1YYVA 3RYRA 5D5WB 1FSHA 1REPC 4IHSA 2JT1A 2EV0A 2PI0A 3DV8A 1PP7U 3R0AA 1W7PB 1WWXA 3IC7A 1U5TA 4MQ9F 5D5UB 5HDNA 4L9JA 2EA4A 3F8NA 5CYVA 1KQ8A 1JHHA 3NEUA 1L0OC 4RAZA 1RNLA 1Z7UA 3ZMUA 1BI1A 4G9YA 1FP1D 1LEBA 1VTNC 4JBAA 1LEAA 1PUEE 1O57A 4G8XA 2DBBA 1XCVA 2PN6A 4RB3C 1T39A 2Y75A 2WWYA 3F8BA 4KFCA 4UV9A 1H9TA 2RKHA 3RI4A 4EJUA 2V6CA 1JE8A 4KMFA 3GW2A 2DTRA 2VOPA 3N97A 3V4GA 1ZGAA 3FF5A 5TJJA 2GAUA 3O6BB 3WG9A 2STWA 4CZZA 2MLGA 1P92A 2OBPA 5DEQA 1LJ9A 1SFEA 4HF0A 3RKXA 3CJNA 4KIFA 2RN7A 1UHWA 5FLXK 2GA2A 4OINF 3HHGA 4WX9A 2XIGA 2KIMA 1TQPA 3VOEA 5D8KB 5ILVA 2IJLA 4L0YB 3SXYA 1I1SA 1J5YA 5LBQA 1IN4A 1TNSA 2H94A 3RIRA 5JVTA 1DPRA 2HKOA 3LA7A 4WXDA 3QU6A 5E1ZB 2ZBKA 4KUMA 2OD5A 1R00A 4N9IA 3ERED 4M9SA 2A68F 1F1ZA 1V4RA 2D1HA 1HBXG 2ZXJA 2XUBA 3LA2A 4Q47A 2QVOA 3BY6A 3RTRA 4YFXF 3HUGA 3SZTA 2EV6A 3I0TA 1ZYRF 3P7NA 1T6SA 2ACJA 4H0EA 2YX7A 4FX4A 2VC0A 3K0LA 3LQRA 5LHGA 2XAGA 2P5VA 2H27A 2O03A 4LLGF 4RGUA 4UUVA 2M8EA 4HF2A 2P7VB 4L5IA 3GFIA 1B9NA 4NQWA 1OR7A 5JR3A 2O6GE 3V7RA 4FT8A 4M73A 1S7OA 5J6XA 2MH9A 5FGMA 2PEXA 3HIFA 3KP3A 5HLGA 1LB2A 3GFMA 4A5MA 3R4KA 4UNOA 3IL2A 5FO5A 1MJBA 4AD9A 1TBXA 4CO8A 1YW7A 1FYKA 1Z6TA 4O5VA 3EDPA 3VODA 3F8FA 1ZH5A 1T98A 1QO0D 3FM5A 2ZO4A 3LQQA 1G3WA 4FX0A 2Z3YA 3WTXC 4HDVA 1K6OA 2VBXA 2LSOA 2FBIA 5LEJA 2FBHA 2YX4A 3TKYA 1ZREA 5E20A 1ZLKA 4A12A 1RUOA 2GZWA 2Q8KA 2XAHA 5JFRA 4E70A 4GYGA 4BQAA 3K1MA 4HYEA 2V1XA 3FWEA 5DCMB 2O3FA 1ZRDA 1DUXC 4KT5C 3QAHA 2ZMEA 4G6QA 3VFZA 1OYWA 1BJAA 4KN7X 5L3CA 4QLCU 1LDDA 4A6DA 3S2WA 1TLHB 2YU3A 2EFQA 1FOKA 1WKMA 3C7JA 4JK1X 3Q9SA 2BYVE 1SAXA 2BEOA 3IRRA 2L54A 2FMYA 5HDKA 4ESFA 3Q9VA 4HW0A 4RB1A 4U88A 1HQCA 1BIAA 4M71A 2F2EA 2ESNA 3QPTA 1O7FA 1HSTA 2XRNA 4ZYGA 1OKRA 4L5JA 2DK8A 4MQVA 2EFWA 3GYHX 3BROA 3R0JA 2O61A 1S6LA 2W85A 3C1DA 5DV5A 3CO7C 1BI2A 2BBYA 3PQJA 5EEGA 4ASNA 4U0WA 3FX3A 2CW0F 3CUQB 3GZ5A 2A07F 5H6RA 4MEXF 3FM3A 2M5WA 4HAMA 2GWRA 4P5OA 3L00A 4HBLA 3I53A 5D5VB 2DI3A 4RB0A 2FOKA 4WF2A 5J8FA 3KP5A 4EVIA 2HOEA 3F8CA 3HHHA 2IVMA 4EM1A 3TO7A 4MGRA 2ZCWA 2HQRA 2IA1A 3V8KA 4IXAA 3HTUA 5D6EA 3RJPA 3FMQA 1R58A 1J59A 1TNTA 5FB2A 5ILSA 2UXNA 1R1UA 4U0VA 3TGNA 1W7PA 2VC1A 1KYWA 5BPDA 1SD4A 5ED4A 4LLNA 3TO6A 3B02A 3K2ZA 2LKPA 1SD7A 3E3VA 3FHZA 3WE2A 2XKPA 2V1DA 4IF4A 2E1CA 1S8NA 2ZJ2A 1MD0A 3MWMA 1XD7A 3P9CA 5LGNA 5F6FA 2VBYA 2NS0A 1RUNA 5D8LB 2VBWA 3PFIA 1I6XA 3WTSC 1BBYA 4OIPF 3MQ0A 5E17F 3BP8A 3GEZA 2ETHA 1YW8A 1P4WA 1FYMA 1IW7F 1BC8C 5IT9Z 4BXUA 3ZP5A 2XKOA 4CGZA 4PGHA 2NAZA 1BIBA 5L3EA 1XDUA 1QNTA 1JGSA 2H6CA 1ZARA 3M9AA 1KU7A 3HSFA 1T2KA 4HF1A 3WGIA 3EYIA 2XASA 4I2OA 2WV0A 3EETA 3BWGA 1SFUA 2JZYA 4HX7A 2XGXA 4CICA 1MJAA 3KZYA 3I5UA 2ZFWA 3FMRA 5HLIA 1FYLA 3CLOA 1U3EM 3I59B 3F23A 3KLOA 4IRHA 2QM3A 1RZ4A 1G4DA 1QZZA 4I0BA 3WGGA 4AIHA 2FSWA 2VE8A 5DD4A 4MEYF 3HSEA 3OOPA 2RC4A 1J0RA 3KP6A 2Q0OA 1XGSA 2DK5A 1B59A 2FU4A 1T38A 3WTVC 3RPQA 1EH6A 2J5OA 3HRMA 3ROUA 4B8XA 1O3TA 3BPXA 2HS5A 2MD5A 5IT9K 5ERIA 3F3XA 1YW9A 1XGMA 1HKTA 3ZMSA 2MH2A 2VONA 3N4MA 3E5XA 3I54A 2JRTA 1LDKB 2EB7A 2OA4A 3BJ6A 1ZG3A 1USTA 3MAJA 1IN7A 2L3DA 2LF8A 3ZMDA 1IF1A 4M9XA 1UCRA 2ESHA 4UVBA 1F5TA 3ZMVA 5L3DA 5LRSA 4MHGA 1SMTA 4EMSA 1R36A 4M6YA 1O3RA 1S7AA 3B73A 5FLXZ 5HS8A 3LA3A 3T0YA 4BAYA 5E1XA 2UWMA 1FX7A 4PDKA 1TTYA 3H3ZA 3M1EA 1G3TA 4GO1A 1FP2A 1IXSB 2K4BA 2QQ9A 1TQMA 2CQKA 4PCQA 3IKVA 3WTZA 2DT5A 1YO5C 1T0FA 5E8IA 4QWQA 1CGPA 3E97A 4LK1F 3V7CA 4S04A 4ZZLA 2DPDA 5L3FA 5L3GA 4FHTA 4P55A 3FZVA 5ICGA 3MZHA 5AONA 1FBUA 3CUQC 3KEQA 3I58A 4Y13A 1GXPA 3MCZA 2R3SA 5DCMA 3ABTA 5BPIA 3JSPA 2EA2A 2GIVA 5HS7A 3E5QA 3GFJA 3E6CC 4XLNF 4LLLA 5LGTA 3F21A 1XN7A 1FPQA 3U2RA 4OU0A 5J8CA 1KQ0A 1IXCA 4G7ZF 5E1WA 3SZPA 5CVRA 5CVVA 1FY7A 2MBFA 3TOBA 2KRFA 4IHTA 4GCVA 1R5GA 3REOA 5K5RA 2P5LC 3DKWA 3BJOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HFH A;  4G6D A;  1DDN A;  2ZNY A;  2W57 A;  1BM9 A;  2HKX A;  3M7G A;  4EQQ A;  2P5K A;  4M9Z A;  3CDH A;  3O3K A;  1K78 B;  1P2F A;  2RDP A;  4M74 A;  3ZN0 A;  1ON1 A;  3CUQ A;  2B0L A;  2HR3 A;  3W6K B;  4R1H A;  2BE5 F;  2RNJ A;  4KIG A;  3ABU A;  2W24 A;  2KIF A;  5KK1 A;  3IHU A;  4I98 B;  1KA8 A;  2P4W A;  5F1R A;  3WGH A;  4ENM A;  1HXD A;  5DCF A;  3J7A O;  3QRF F;  2QQA A;  4I0A A;  2FBK A;  4EJO A;  2K86 A;  5ICF A;  2UZK A;  3FXR A;  2C6Y A;  3IRQ A;  1S29 A;  1ODD A;  3KEO A;  4BH9 A;  3DEU A;  2IW5 A;  4I01 A;  2BV6 A;  2EFP A;  4UHT A;  1EV7 A;  4HV6 A;  3WE3 A;  1KYZ A;  3K9T A;  2RGV A;  4HQM A;  3L9F A;  1NHA A;  2LF7 A;  4OIO F;  2EFO A;  1R1V A;  3BPV A;  3KCC A;  4A6E A;  1SMY F;  1MJ9 A;  2OQG A;  4OIQ F;  1J9I A;  1U78 A;  1QPM A;  2CFX A;  2H09 A;  1W4M A;  3ISP A;  1RI7 A;  4AIK A;  1Z9C A;  2NNY A;  4KA4 A;  1D8J A;  2AS5 F;  2LDU A;  1QBJ A;  3LFK A;  2QLZ A;  3F72 A;  2HDC A;  1BOA A;  2HQN A;  1FC3 A;  2OAZ A;  4B09 A;  3H3U A;  3AAF A;  4ZYE A;  2IT0 A;  4A2U A;  5E8G A;  1V3F A;  1H0M A;  1UFM A;  4ZH4 F;  3KET A;  1B1B A;  2VN2 A;  4P9U A;  3RDI A;  2A69 F;  1LQ1 A;  2K02 A;  1STZ A;  2V1U A;  2COM A;  1Z1D A;  2L01 A;  5A2Q K;  4XSZ F;  4LJZ F;  1ON2 A;  2TDX A;  2XAJ A;  2VT2 A;  3F22 A;  4IPA A;  4K2E A;  5LHI A;  4KMU X;  2M1B A;  2IA2 A;  3I59 A;  5E18 F;  1G6N A;  4ON0 A;  1SD5 A;  1D5V A;  3GX4 X;  2FA5 A;  4YII A;  2AXL A;  3GWZ A;  2V9V A;  4N0B A;  1P6R A;  1G3Y A;  5DUK A;  3BJA A;  3E6B A;  4WK8 F;  3DP7 A;  4KYW A;  6PAX A;  3GZ6 A;  4P9F A;  2EV5 A;  5BQT A;  3J81 K;  2BGC A;  1TW3 A;  1I1G A;  1R5H A;  1Z6R A;  3HRT A;  2QQB A;  4BNC A;  2GXB A;  1KGS A;  4G94 A;  2QWW A;  2Z5U A;  2JPB A;  1K7A A;  4RGX A;  3L7W A;  2Q2E A;  4AVP A;  2STT A;  4IRG A;  2ISY A;  1YS7 A;  5DUI A;  2F5D A;  3HSR A;  1W5S A;  1E2X A;  1MDM B;  1ZAO A;  4KDP A;  4Y17 A;  1YLF A;  2K4J A;  2Z9O A;  3LST A;  5D4R A;  1XMK A;  5ICE A;  4NHJ A;  3RYP A;  3V8L A;  2CG4 A;  2P6S A;  4CXF A;  3J80 K;  3QP5 A;  1O3S A;  3ZMT A;  1MZB A;  3MZY A;  4EV0 A;  1ZG1 A;  1QGP A;  1FT9 A;  5L3B A;  1XSD A;  1OMI A;  1TQI A;  2Y0M A;  3EUH A;  4BHC A;  2FRH A;  1LNW A;  4BHB A;  1A04 A;  1JXS A;  4L9V A;  2NNN A;  2XHK A;  5D6F A;  5ILU A;  2P6T A;  3KLN A;  4UV8 A;  4L9T A;  3QP6 A;  1X3U A;  4U7B A;  2A6E F;  1OPC A;  3IKT A;  1ZN2 A;  3VEP A;  1CF7 B;  4ENN A;  4IJA A;  5LLQ A;  4L0Z B;  2ISZ A;  4D0P A;  1EH8 A;  3H92 A;  4L9N A;  5HDG A;  3LAP A;  4UVA A;  2DO7 A;  5CLS A;  1WSU A;  3QPH A;  3EYY A;  5F64 A;  4Y15 A;  2OZU A;  3KP4 A;  1F4K A;  3BOQ A;  2FE3 A;  1IN5 A;  2FXA A;  3VB2 A;  1ZLJ A;  2PBI A;  1J7K A;  1HSJ A;  2HZT A;  2PFB A;  1O3Q A;  4RGR A;  3DFG A;  2HGC A;  2X0L A;  2QBY B;  1HW5 A;  5HOO A;  1BI0 A;  3R61 A;  1K78 A;  1YFH A;  5CVU A;  3QU3 A;  3DPL C;  1SD6 A;  4YFN F;  4OMY A;  3HOT A;  5JI6 A;  4MNU A;  5DD8 A;  4ESJ A;  3PQK A;  2DQL A;  5BS6 A;  1W5T A;  3NQO A;  2XRO A;  4M72 A;  4XLP F;  4O3M A;  3RKY A;  4MTE A;  1USS A;  1B6A A;  1FWZ A;  1KU9 A;  2ELH A;  5CVI A;  4R79 A;  1P4X A;  3W6J B;  2KIU A;  4RAY A;  2HYG D;  2FNP A;  2PMU A;  4IRI A;  1BI3 A;  2FQ3 A;  1R23 A;  3L2C A;  4ENK A;  2MLK A;  4LG0 B;  1E17 A;  4JQF A;  2G7U A;  1IN6 A;  4ENJ A;  1UB9 A;  3ECH A;  3DQV C;  4M6X A;  3WTY C;  2FEZ A;  2R7F A;  1R7J A;  1ZG5 A;  2IRF G;  2WC2 A;  1AOY A;  2K7L A;  3WOD F;  2H6B A;  3FMS A;  3BZ6 A;  2V79 A;  4S05 A;  4LFU A;  3ECO A;  2A6H F;  4BHP A;  3L09 A;  4XBF A;  1XCB A;  4RGS A;  4XSX F;  1YIO A;  4A5N A;  3K69 A;  3IWZ A;  4EJV A;  1KQ9 A;  4WCG A;  2L4A A;  4G7H F;  2MC3 A;  3TO9 A;  3GF2 A;  4Q4Z F;  1B4A A;  1H9G A;  3WTW C;  3U9G A;  2F5C A;  4ZYH A;  3D5L A;  5FD5 A;  2PLY A;  3BDD A;  3GFL A;  1EH7 A;  2M87 A;  3ML6 A;  4HQE A;  2KJB A;  5HVQ C;  1U8R A;  2D1V A;  4I7H A;  2RQP A;  2W84 A;  2A3S A;  2KKO A;  5LHH A;  4F7Z A;  1YQA A;  3HOS A;  2P8T A;  3KZZ A;  3QOP A;  2LNB A;  4HX8 A;  5D5X B;  1PP8 F;  2JSC A;  2CWE A;  4HA8 A;  4WXH A;  3COA C;  4LGW A;  2FF4 A;  1YG2 A;  2EK5 A;  3HTS B;  5DYM A;  4CYD A;  4CDG A;  4EGY A;  2G7H A;  2HTS A;  1FNN A;  3KP7 A;  4EJT A;  2IA0 A;  1BC7 C;  1KU3 A;  1YTY A;  1Q1H A;  4LMY A;  1XB4 A;  4XRF A;  1ZGJ A;  3ZN1 A;  2L02 A;  4OOI A;  4WWC A;  3P9I A;  1PDN C;  5LGU A;  1QZY A;  3CTA A;  4LB5 A;  3GUD A;  3DF8 A;  4UVC A;  1IN8 A;  2VXZ A;  1B9M A;  1D8K A;  4YFK F;  2HEO A;  1WI9 A;  1FBS A;  4N9H A;  4ZZD A;  1HKS A;  1I27 A;  1KU2 A;  2NYX A;  1ONV A;  4BYY A;  2D45 A;  3Q5F A;  3E5U A;  5LEK A;  1MDM A;  1XSX A;  2KJC A;  1ZRC A;  2RVC A;  1BN5 A;  1LDJ A;  4A0Z A;  5A2Q Z;  3JSO A;  2A5Y B;  5ICC A;  2EFN A;  2E7W A;  4KNY A;  1XGN A;  2Z33 A;  4MTD A;  5BMZ A;  2ZNZ A;  4DNC A;  3HRS A;  4LD5 A;  4A0X A;  1FBQ A;  1Y0U A;  2DFI A;  3SHF A;  1U5T B;  2FML A;  1Z05 A;  2DW4 A;  3FXU A;  4NB5 A;  5LRR A;  2GXG A;  1MGT A;  1U2W A;  4ZYD A;  1P4A A;  3CUO A;  3F8M A;  2JTV A;  3D0S A;  1R1T A;  4RB2 C;  5K5O A;  2CGP A;  3O2P E;  3J81 Z;  4HZF A;  4AWX B;  5H6Q A;  2VT3 A;  1CF7 A;  1W7P D;  2OZ6 A;  3WTT C;  2P7C B;  4I02 A;  4KIB A;  4YIF A;  1LVA A;  2XAQ A;  4IVN A;  2M45 A;  5AIP A;  2E7X A;  1IRF A;  3ELK A;  1O7L A;  4RS8 A;  4LB6 B;  1OYI A;  1IUY A;  1FSE A;  1QQI A;  4HLY A;  3LWF A;  2HWV A;  1F9N A;  1GXQ A;  2VOO A;  1J2X A;  2OQR A;  1HW1 A;  3FXQ A;  3I71 A;  3T8T A;  3I4P A;  5K1Y A;  1Z91 A;  4GGG A;  3C3W A;  2QBY A;  2ZKZ A;  4AIJ A;  3HRU A;  4HOB A;  3M8E A;  3J80 Z;  2F5F A;  4G7O F;  2WTE A;  1DPU A;  3KE2 A;  3JTH A;  4ESB A;  3MEX A;  2NRA C;  1GVJ A;  4HLX A;  3JW4 A;  4A0Y A;  3GO5 A;  4UXN A;  3DXJ F;  1ZHF A;  2JPC A;  1XGO A;  2F5E A;  2M30 A;  2A61 A;  5FD6 A;  4R8H A;  4HV5 A;  2DLL A;  1U6G A;  1XMA A;  3ZQ7 A;  1K79 A;  4LG0 A;  1IXR C;  2IP2 A;  3KP2 A;  3JTG A;  2Y48 A;  5IT3 A;  2DU9 A;  2PMH A;  4YG2 F;  4WXC A;  1I5Z A;  3E6D A;  3TQN A;  3SFZ A;  4KN4 X;  3WTU C;  4KIC A;  2G9W A;  2O0Y A;  2RV8 A;  3MFK A;  3V8J A;  2OU2 A;  4HX4 A;  3U1D A;  2XVC A;  3JAM Z;  1IZ1 A;  2UXX A;  1JHF A;  3EQL F;  3G3Z A;  2QZ8 A;  4OMZ A;  5JHU A;  2VE9 A;  3T5X A;  1WRJ A;  1AWC A;  2FNA A;  2YPR A;  3WU1 B;  4PZJ A;  3ULQ B;  3F6O A;  4PGG A;  3RPU A;  1DP7 P;  2PJP A;  5HS9 A;  2W25 A;  4L18 B;  2QEN A;  3I64 A;  4U7D A;  3GXO A;  2VOD A;  4OIR F;  2D2W A;  1HKQ A;  3P9K A;  4EM0 B;  1WQ2 A;  1FZP B;  5BOX A;  1UHM A;  4O6J A;  4GXO A;  2E1N A;  2QYO A;  4EM2 A;  1C0W A;  2GA1 A;  3TOA A;  5HLH A;  2HYF A;  3E6M A;  4U0Y A;  3R6S A;  4GYI A;  5CJ9 A;  2VBZ A;  5H20 A;  3WU0 A;  5D4S A;  3GVA A;  2J5P A;  2CO5 A;  4Q5S F;  3JAM K;  2ZME B;  2K27 A;  2CYY A;  5AIQ A;  2R7D A;  2XAF A;  2YSR A;  2DPU A;  1S3J A;  1OYY A;  4ETS A;  1L3L A;  3DPT A;  3R60 A;  2PG4 A;  3T1B A;  4Q48 A;  5K5Q A;  5FFZ A;  3OV8 A;  3RKW A;  5DDG A;  1IAW A;  4LK0 F;  2XV4 S;  1SFX A;  2L4M A;  3NRV A;  2YR2 A;  2O8X A;  2EWN A;  3KFW X;  2DQR A;  3TDZ C;  1IRG A;  1D3Y A;  1R22 A;  3TDU C;  3F6V A;  1TW2 A;  1GHC A;  1MKM A;  5TRD A;  2DAO A;  1U5T C;  1HW2 A;  2QUF A;  1J75 A;  3ZPL A;  5KVR A;  4DQ2 A;  2X4H A;  3T8R A;  3LAJ A;  4TV7 A;  4HDU A;  3IWF A;  3C18 A;  2MA3 A;  1FLI A;  1YS6 A;  5CVJ A;  2EJR A;  4Z2Y A;  3K1P A;  3G73 A;  1G3S A;  2Z99 A;  3GLX A;  3V7S A;  1ULY A;  4P96 A;  2CSO A;  1XSV A;  4EJW A;  3HYI A;  4CHU A;  5FFX A;  2GQQ A;  4I09 A;  4EGZ A;  3K1N A;  3M8F A;  3CO6 C;  1XDS A;  3ZMZ A;  3SQN A;  2HTJ A;  2ADU A;  5EEH A;  2PQ8 A;  2IPQ X;  1RIO H;  1ZRF A;  1YYV A;  3RYR A;  5D5W B;  1FSH A;  1REP C;  4IHS A;  2JT1 A;  2EV0 A;  2PI0 A;  3DV8 A;  1PP7 U;  3R0A A;  1W7P B;  1WWX A;  3IC7 A;  1U5T A;  4MQ9 F;  5D5U B;  5HDN A;  4L9J A;  2EA4 A;  3F8N A;  5CYV A;  1KQ8 A;  1JHH A;  3NEU A;  1L0O C;  4RAZ A;  1RNL A;  1Z7U A;  3ZMU A;  1BI1 A;  4G9Y A;  1FP1 D;  1LEB A;  1VTN C;  4JBA A;  1LEA A;  1PUE E;  1O57 A;  4G8X A;  2DBB A;  1XCV A;  2PN6 A;  4RB3 C;  1T39 A;  2Y75 A;  2WWY A;  3F8B A;  4KFC A;  4UV9 A;  1H9T A;  2RKH A;  3RI4 A;  4EJU A;  2V6C A;  1JE8 A;  4KMF A;  3GW2 A;  2DTR A;  2VOP A;  3N97 A;  3V4G A;  1ZGA A;  3FF5 A;  5TJJ A;  2GAU A;  3O6B B;  3WG9 A;  2STW A;  4CZZ A;  2MLG A;  1P92 A;  2OBP A;  5DEQ A;  1LJ9 A;  1SFE A;  4HF0 A;  3RKX A;  3CJN A;  4KIF A;  2RN7 A;  1UHW A;  5FLX K;  2GA2 A;  4OIN F;  3HHG A;  4WX9 A;  2XIG A;  2KIM A;  1TQP A;  3VOE A;  5D8K B;  5ILV A;  2IJL A;  4L0Y B;  3SXY A;  1I1S A;  1J5Y A;  5LBQ A;  1IN4 A;  1TNS A;  2H94 A;  3RIR A;  5JVT A;  1DPR A;  2HKO A;  3LA7 A;  4WXD A;  3QU6 A;  5E1Z B;  2ZBK A;  4KUM A;  2OD5 A;  1R00 A;  4N9I A;  3ERE D;  4M9S A;  2A68 F;  1F1Z A;  1V4R A;  2D1H A;  1HBX G;  2ZXJ A;  2XUB A;  3LA2 A;  4Q47 A;  2QVO A;  3BY6 A;  3RTR A;  4YFX F;  3HUG A;  3SZT A;  2EV6 A;  3I0T A;  1ZYR F;  3P7N A;  1T6S A;  2ACJ A;  4H0E A;  2YX7 A;  4FX4 A;  2VC0 A;  3K0L A;  3LQR A;  5LHG A;  2XAG A;  2P5V A;  2H27 A;  2O03 A;  4LLG F;  4RGU A;  4UUV A;  2M8E A;  4HF2 A;  2P7V B;  4L5I A;  3GFI A;  1B9N A;  4NQW A;  1OR7 A;  5JR3 A;  2O6G E;  3V7R A;  4FT8 A;  4M73 A;  1S7O A;  5J6X A;  2MH9 A;  5FGM A;  2PEX A;  3HIF A;  3KP3 A;  5HLG A;  1LB2 A;  3GFM A;  4A5M A;  3R4K A;  4UNO A;  3IL2 A;  5FO5 A;  1MJB A;  4AD9 A;  1TBX A;  4CO8 A;  1YW7 A;  1FYK A;  1Z6T A;  4O5V A;  3EDP A;  3VOD A;  3F8F A;  1ZH5 A;  1T98 A;  1QO0 D;  3FM5 A;  2ZO4 A;  3LQQ A;  1G3W A;  4FX0 A;  2Z3Y A;  3WTX C;  4HDV A;  1K6O A;  2VBX A;  2LSO A;  2FBI A;  5LEJ A;  2FBH A;  2YX4 A;  3TKY A;  1ZRE A;  5E20 A;  1ZLK A;  4A12 A;  1RUO A;  2GZW A;  2Q8K A;  2XAH A;  5JFR A;  4E70 A;  4GYG A;  4BQA A;  3K1M A;  4HYE A;  2V1X A;  3FWE A;  5DCM B;  2O3F A;  1ZRD A;  1DUX C;  4KT5 C;  3QAH A;  2ZME A;  4G6Q A;  3VFZ A;  1OYW A;  1BJA A;  4KN7 X;  5L3C A;  4QLC U;  1LDD A;  4A6D A;  3S2W A;  1TLH B;  2YU3 A;  2EFQ A;  1FOK A;  1WKM A;  3C7J A;  4JK1 X;  3Q9S A;  2BYV E;  1SAX A;  2BEO A;  3IRR A;  2L54 A;  2FMY A;  5HDK A;  4ESF A;  3Q9V A;  4HW0 A;  4RB1 A;  4U88 A;  1HQC A;  1BIA A;  4M71 A;  2F2E A;  2ESN A;  3QPT A;  1O7F A;  1HST A;  2XRN A;  4ZYG A;  1OKR A;  4L5J A;  2DK8 A;  4MQV A;  2EFW A;  3GYH X;  3BRO A;  3R0J A;  2O61 A;  1S6L A;  2W85 A;  3C1D A;  5DV5 A;  3CO7 C;  1BI2 A;  2BBY A;  3PQJ A;  5EEG A;  4ASN A;  4U0W A;  3FX3 A;  2CW0 F;  3CUQ B;  3GZ5 A;  2A07 F;  5H6R A;  4MEX F;  3FM3 A;  2M5W A;  4HAM A;  2GWR A;  4P5O A;  3L00 A;  4HBL A;  3I53 A;  5D5V B;  2DI3 A;  4RB0 A;  2FOK A;  4WF2 A;  5J8F A;  3KP5 A;  4EVI A;  2HOE A;  3F8C A;  3HHH A;  2IVM A;  4EM1 A;  3TO7 A;  4MGR A;  2ZCW A;  2HQR A;  2IA1 A;  3V8K A;  4IXA A;  3HTU A;  5D6E A;  3RJP A;  3FMQ A;  1R58 A;  1J59 A;  1TNT A;  5FB2 A;  5ILS A;  2UXN A;  1R1U A;  4U0V A;  3TGN A;  1W7P A;  2VC1 A;  1KYW A;  5BPD A;  1SD4 A;  5ED4 A;  4LLN A;  3TO6 A;  3B02 A;  3K2Z A;  2LKP A;  1SD7 A;  3E3V A;  3FHZ A;  3WE2 A;  2XKP A;  2V1D A;  4IF4 A;  2E1C A;  1S8N A;  2ZJ2 A;  1MD0 A;  3MWM A;  1XD7 A;  3P9C A;  5LGN A;  5F6F A;  2VBY A;  2NS0 A;  1RUN A;  5D8L B;  2VBW A;  3PFI A;  1I6X A;  3WTS C;  1BBY A;  4OIP F;  3MQ0 A;  5E17 F;  3BP8 A;  3GEZ A;  2ETH A;  1YW8 A;  1P4W A;  1FYM A;  1IW7 F;  1BC8 C;  5IT9 Z;  4BXU A;  3ZP5 A;  2XKO A;  4CGZ A;  4PGH A;  2NAZ A;  1BIB A;  5L3E A;  1XDU A;  1QNT A;  1JGS A;  2H6C A;  1ZAR A;  3M9A A;  1KU7 A;  3HSF A;  1T2K A;  4HF1 A;  3WGI A;  3EYI A;  2XAS A;  4I2O A;  2WV0 A;  3EET A;  3BWG A;  1SFU A;  2JZY A;  4HX7 A;  2XGX A;  4CIC A;  1MJA A;  3KZY A;  3I5U A;  2ZFW A;  3FMR A;  5HLI A;  1FYL A;  3CLO A;  1U3E M;  3I59 B;  3F23 A;  3KLO A;  4IRH A;  2QM3 A;  1RZ4 A;  1G4D A;  1QZZ A;  4I0B A;  3WGG A;  4AIH A;  2FSW A;  2VE8 A;  5DD4 A;  4MEY F;  3HSE A;  3OOP A;  2RC4 A;  1J0R A;  3KP6 A;  2Q0O A;  1XGS A;  2DK5 A;  1B59 A;  2FU4 A;  1T38 A;  3WTV C;  3RPQ A;  1EH6 A;  2J5O A;  3HRM A;  3ROU A;  4B8X A;  1O3T A;  3BPX A;  2HS5 A;  2MD5 A;  5IT9 K;  5ERI A;  3F3X A;  1YW9 A;  1XGM A;  1HKT A;  3ZMS A;  2MH2 A;  2VON A;  3N4M A;  3E5X A;  3I54 A;  2JRT A;  1LDK B;  2EB7 A;  2OA4 A;  3BJ6 A;  1ZG3 A;  1UST A;  3MAJ A;  1IN7 A;  2L3D A;  2LF8 A;  3ZMD A;  1IF1 A;  4M9X A;  1UCR A;  2ESH A;  4UVB A;  1F5T A;  3ZMV A;  5L3D A;  5LRS A;  4MHG A;  1SMT A;  4EMS A;  1R36 A;  4M6Y A;  1O3R A;  1S7A A;  3B73 A;  5FLX Z;  5HS8 A;  3LA3 A;  3T0Y A;  4BAY A;  5E1X A;  2UWM A;  1FX7 A;  4PDK A;  1TTY A;  3H3Z A;  3M1E A;  1G3T A;  4GO1 A;  1FP2 A;  1IXS B;  2K4B A;  2QQ9 A;  1TQM A;  2CQK A;  4PCQ A;  3IKV A;  3WTZ A;  2DT5 A;  1YO5 C;  1T0F A;  5E8I A;  4QWQ A;  1CGP A;  3E97 A;  4LK1 F;  3V7C A;  4S04 A;  4ZZL A;  2DPD A;  5L3F A;  5L3G A;  4FHT A;  4P55 A;  3FZV A;  5ICG A;  3MZH A;  5AON A;  1FBU A;  3CUQ C;  3KEQ A;  3I58 A;  4Y13 A;  1GXP A;  3MCZ A;  2R3S A;  5DCM A;  3ABT A;  5BPI A;  3JSP A;  2EA2 A;  2GIV A;  5HS7 A;  3E5Q A;  3GFJ A;  3E6C C;  4XLN F;  4LLL A;  5LGT A;  3F21 A;  1XN7 A;  1FPQ A;  3U2R A;  4OU0 A;  5J8C A;  1KQ0 A;  1IXC A;  4G7Z F;  5E1W A;  3SZP A;  5CVR A;  5CVV A;  1FY7 A;  2MBF A;  3TOB A;  2KRF A;  4IHT A;  4GCV A;  1R5G A;  3REO A;  5K5R A;  2P5L C;  3DKW A;  3BJO A; 
#chains in the Genus database with same CATH topology
 1S9H A;  4E7H A;  1VQP I;  2HFH A;  3L2W A;  3IUO A;  3DTK A;  2LKS A;  3HXL A;  1Y1W J;  4G6D A;  1DDN A;  2ZNY A;  2W57 A;  1BM9 A;  2LY9 A;  2JA7 J;  4JX6 A;  4C2T A;  2HKX A;  3M7G A;  4EQQ A;  2P5K A;  4M9Z A;  4CCL A;  3CDH A;  2XPU A;  5DS9 A;  1XC5 A;  3O3K A;  1P2F A;  1K78 B;  5B5E C;  3VSK A;  2ZJR F;  1AA7 A;  2RDP A;  4EAT A;  5IP6 A;  2EPF A;  4A3L J;  4M74 A;  3ZN0 A;  1ON1 A;  3S3O A;  3CUQ A;  2B0L A;  2HR3 A;  3W6K B;  2L7M P;  3OIQ A;  5TGT A;  4R1H A;  2BE5 F;  4CZC A;  2L7Z A;  2RNJ A;  2Y30 A;  2NOJ B;  3K4N A;  1EJ9 A;  2GXA A;  1ETX A;  4KIG A;  3N05 A;  3ABU A;  2W24 A;  2KIF A;  4QIW N;  5KK1 A;  3IHU A;  4I98 B;  1KA8 A;  2P4W A;  4IOA F;  3IAS 2;  4XLE A;  5F1R A;  3WGH A;  4ENM A;  1MIJ A;  3OL4 A;  3DBR B;  3FDY A;  4XLC A;  2M2E A;  1HXD A;  5DCF A;  3J7A O;  3QRF F;  2QQA A;  4I0A A;  2FBK A;  4W1U A;  2K86 A;  3SDB A;  4EJO A;  1MBK A;  5ICF A;  2UZK A;  2RRE A;  2XSD C;  2Y31 A;  3RQI A;  3FXR A;  2C6Y A;  3IRQ A;  1S29 A;  1Y0N A;  2P81 A;  1ODD A;  3S32 A;  3I3L A;  3KEO A;  4BH9 A;  3LMM A;  3DEU A;  2IW5 A;  4I01 A;  1X3Z B;  2BV6 A;  2EFP A;  3S93 A;  2DYS H;  2CQX A;  4UHT A;  1EV7 A;  4HV6 A;  1X1A A;  3GTP J;  3WE3 A;  4A3D J;  3AL0 B;  1KYZ A;  3K9T A;  1FIA A;  2RGV A;  4HQM A;  1FIP A;  2W00 A;  4RMN A;  2BVL A;  1E3P A;  3ZOB A;  2R0Q C;  3L9F A;  3PJR A;  4EEF G;  1NHA A;  2LF7 A;  2K3P A;  4OIO F;  2EFO A;  1R1V A;  3BPV A;  3VPR A;  4YIR X;  2QSF X;  3ERM A;  1NK2 P;  2Z2S B;  3I4M J;  3KCC A;  4XMY A;  2EZI A;  2DMP A;  4A6E A;  4PUS A;  3OS0 A;  5IYB J;  3LSP A;  1SMY F;  5F04 A;  1V5F A;  2NVT J;  1Y39 A;  1MND A;  3BR2 A;  1MJ9 A;  2OQG A;  4OIQ F;  3G6E I;  4S0H B;  1J9I A;  1U78 A;  2ID3 A;  5JLW A;  2DA4 A;  2KIQ A;  1LE8 A;  1QPM A;  2WAQ A;  2CFX A;  2H09 A;  1W4M A;  3ISP A;  4DZJ A;  3K70 D;  3FBN B;  4NNJ A;  1RI7 A;  1G59 A;  4AIK A;  2X6W A;  2ECC A;  2I8D A;  1PVE A;  1Z9C A;  3MKL A;  3L1P A;  2NNY A;  4KA4 A;  1D8J A;  3HKZ N;  2LDU A;  3JCU C;  2AS5 F;  3AFH A;  2ZXH A;  1QBJ A;  3OSG A;  3LFK A;  2QLZ A;  2HPM A;  3F72 A;  1YX3 A;  1N25 A;  1BOA A;  2HDC A;  2GM4 A;  2HQN A;  1FC3 A;  1YIJ I;  2OAZ A;  4B09 A;  2KT0 A;  2COB A;  3GTQ J;  3H3U A;  3HG9 A;  2MGQ A;  3AAF A;  1BL0 A;  1JT0 A;  4ZYE A;  2IT0 A;  4A2U A;  5E8G A;  4IL6 C;  1V3F A;  2BZT A;  1H88 C;  3S1N J;  1H0M A;  1UFM A;  4ZH4 F;  3KET A;  1B1B A;  4BQO A;  2VN2 A;  4P9U A;  3RDI A;  1FMV A;  2A69 F;  1LQ1 A;  2DXI A;  2K02 A;  1STZ A;  4C2M J;  2VQL A;  1ZTR A;  4HNU A;  2V1U A;  1V5E A;  2COM A;  2NVU B;  3W3C A;  3OS1 A;  4XON A;  2R7R A;  1Z1D A;  2L01 A;  2QKM B;  1R49 A;  5A2Q K;  1S7E A;  2DA6 A;  4XSZ F;  1W0T A;  1DGR M;  4KIT B;  5EDN A;  5LD2 C;  3P5J A;  4LJZ F;  3O8G A;  3OL3 A;  1VQO I;  3PUB A;  3OYF A;  2EH3 A;  1ON2 A;  1Y1V J;  2TDX A;  2IAI A;  2VT2 A;  2XAJ A;  3RPU D;  3F22 A;  4IPA A;  4CCM A;  4K2E A;  9ANT A;  2DOA A;  4BJT A;  5LHI A;  4PJL A;  2V26 A;  2NVQ J;  4KMU X;  3L2U A;  4GFB A;  2LP0 A;  2M1B A;  2IA2 A;  3I59 A;  5E18 F;  1G6N A;  2KRC A;  3LL7 A;  1OFC X;  1TC3 C;  3DU6 A;  1SD5 A;  4ON0 A;  1D5V A;  3GX4 X;  2E19 A;  4M3F A;  5IP9 J;  4A3K J;  1IRZ A;  2FA5 A;  4YII A;  1UMQ A;  5EZG A;  3DTI A;  1NK3 P;  2IS2 A;  2AXL A;  3GME A;  3IH2 A;  1FMW A;  3VWB A;  2LOO A;  3GWZ A;  1W36 D;  2E2J J;  2V9V A;  4XOR A;  4N0B A;  1OCZ H;  1P6R A;  1G3Y A;  5DUK A;  2JWT A;  3BJA A;  2QGU A;  3E6B A;  3CCL I;  4WK8 F;  3DP7 A;  1IDY A;  4KYW A;  1VQM I;  6PAX A;  2LVS A;  1ZR4 A;  3W2A A;  3GZ6 A;  4P9F A;  1RET A;  2VB6 A;  2EV5 A;  3KPH A;  4C3H J;  5BQT A;  3J81 K;  3GTJ J;  5DM7 F;  3FKJ A;  2BGC A;  5FRO A;  3KYD B;  1TW3 A;  1K4S A;  1I1G A;  1VQK I;  1R5H A;  3CCM I;  1Z6R A;  2DMN A;  1VQL I;  4NC8 A;  3HRT A;  2QQB A;  4BNC A;  2K9S A;  2GXB A;  1KGS A;  2DYR H;  3MKW B;  3EUA A;  4G94 A;  3RQ4 A;  2QWW A;  2Z5U A;  1BW5 A;  2JPB A;  3MVP A;  3ZQC A;  1K7A A;  3LSK A;  1FJL A;  4RGX A;  3L7W A;  4JOM A;  4LIT A;  1E3H A;  2Q2E A;  1R5I D;  4X1E A;  4AVP A;  1JKR C;  2STT A;  4IRG A;  4XL9 A;  2ISY A;  4ZYA A;  2L7F P;  1OCT C;  1YS7 A;  5DUI A;  2DTZ A;  2MD0 A;  4PK4 A;  2F5D A;  3E1S A;  3HSR A;  1W5S A;  3OIO A;  2M0C A;  1E2X A;  1MDM B;  1ZAO A;  1R4N B;  2VKD A;  4KDP A;  1RES A;  5FKK A;  2HYJ A;  1Z77 A;  3CP8 A;  4Y17 A;  1YLF A;  2K4J A;  2R7Q A;  1WVR A;  2Z9O A;  3H3V K;  4HST A;  3LST A;  3CMY A;  2DFH A;  3M07 A;  4HRI A;  5D4R A;  4RM3 A;  1XMK A;  4MLO A;  5ICE A;  4NHJ A;  3RYP A;  1LPQ A;  4DBQ A;  1A36 A;  3V8L A;  2CG4 A;  2P6S A;  1WPK A;  4CXF A;  1DU0 A;  2QF7 A;  2CW8 A;  3J80 K;  3QP5 A;  2XC7 A;  1O3S A;  1ERD A;  2L0K A;  2XB0 X;  3VYR B;  3ZMT A;  1MZB A;  2XDV A;  3MZY A;  2CQ7 A;  3H0G J;  4EV0 A;  3QYF A;  4UB6 C;  3CMM A;  1ZG1 A;  1QGP A;  3DKX A;  1FT9 A;  5L3B A;  2E5Z A;  1XSD A;  1OMI A;  1TQI A;  3FIW A;  2Y0M A;  5DM6 F;  2EIK H;  3EUH A;  2ECB A;  3KEY A;  4BHC A;  2FRH A;  3MKY B;  1ORK A;  1LNW A;  4BHB A;  1A04 A;  1JXS A;  1A6Q A;  4L9V A;  1JI8 A;  2NNN A;  2XHK A;  1A31 A;  3UKG A;  5D6F A;  5ILU A;  2P6T A;  4C2U A;  4FCY A;  2HXO A;  3KLN A;  4UV8 A;  4L9T A;  3JRH A;  2HVR A;  3JRD A;  1KON A;  3BG6 A;  3Q0U A;  3QP6 A;  5CKT A;  2VQH A;  1X3U A;  1XTA A;  4U7B A;  1YE9 A;  4II2 A;  2A6E F;  1OPC A;  1NH3 A;  3J7Z I;  3IKT A;  1ZN2 A;  3VEP A;  4BBS J;  4E7Z A;  3JRA A;  3A02 A;  1CF7 B;  4ENN A;  1Q1V A;  4IJA A;  5LLQ A;  4XLA A;  4BQN A;  4L0Z B;  4KIS A;  3QYE A;  2ISZ A;  4D0P A;  2XPV A;  3U21 A;  1EH8 A;  3H92 A;  4L9N A;  5HDG A;  3LAP A;  4A3B J;  4UVA A;  5B3S H;  2DO7 A;  1U8B A;  2QCO A;  5CLS A;  1WSU A;  3TED A;  4D9J A;  3K4K A;  3QPH A;  3EYY A;  5F64 A;  4Y15 A;  2OZU A;  3KP4 A;  3HEF A;  1F4K A;  3BOQ A;  2F4M B;  2FE3 A;  3Q0V A;  1QRY A;  3BR0 A;  1IN5 A;  1SVO A;  3KYC B;  3D5S C;  4DZP A;  3AL0 C;  2FXA A;  2V9P A;  1RR7 A;  3VB2 A;  3OY9 A;  3ZQI A;  1ZLJ A;  4M3G A;  2PBI A;  1HA8 A;  4IEJ A;  1J7K A;  4CUG A;  1HSJ A;  2HZT A;  2WB1 A;  3ZGK A;  3GTL J;  2OCC H;  2PFB A;  1YJN I;  3H9G A;  1O3Q A;  2AO9 A;  3CF5 F;  4RGR A;  3DFG A;  2HGC A;  3FXK A;  4A3I J;  2X0L A;  2DMQ A;  4DYQ A;  2QBY B;  1HW5 A;  5HOO A;  3PSI A;  1BI0 A;  1U0J A;  2ZC2 A;  3R61 A;  1K78 A;  2XF7 A;  4NC6 A;  1YFH A;  5CVU A;  3QU3 A;  3DPL C;  1SD6 A;  1SEU A;  1ZKG A;  4YFN F;  4OMY A;  3K6G A;  1F36 A;  3HOT A;  4Y3O A;  5JI6 A;  1WJ5 A;  4MNU A;  3A01 B;  2RNG A;  3S1M J;  1OCC H;  5DD8 A;  4ESJ A;  3PQK A;  2CUF A;  2OCE A;  5C44 J;  2DQL A;  1TL8 A;  5BS6 A;  2QKL B;  1W5T A;  3NQO A;  5EJC A;  1X58 A;  2XRO A;  3GTK J;  1HOM A;  4M72 A;  1SAN A;  4XLP F;  4O3M A;  3RKY A;  1UG0 A;  3DBH B;  4MTE A;  1USS A;  2ME0 A;  1B6A A;  3TP3 A;  1FWZ A;  1KU9 A;  2E36 A;  2ELH A;  3S16 J;  5CVI A;  1IO2 A;  4R79 A;  1P4X A;  3VYS B;  3W6J B;  2X6Y A;  1RR8 C;  1AKH B;  2BW3 B;  2KIU A;  4RAY A;  2WAF A;  2HYG D;  1Z7L A;  2WAD A;  1ZGW A;  4M6V A;  2FNP A;  2PMU A;  2CU7 A;  3CP2 A;  4UY8 I;  3MZ8 A;  3QWL A;  2JA5 J;  2XPW A;  4IRI A;  2IGN A;  1BI3 A;  2FQ3 A;  1R23 A;  1SVL A;  1GT0 C;  2EIN H;  3L2C A;  4ENK A;  3BLY A;  2MLK A;  2BOL A;  4LG0 B;  1E17 A;  4C3J J;  3FBI B;  3LFU A;  2G7U A;  4JQF A;  4XRS G;  3OYH A;  2EBI A;  1IN6 A;  4ENJ A;  1UB9 A;  1Y8R B;  3ECH A;  4C9Y A;  3DQV C;  4Z6Y A;  4M6X A;  2KZV A;  3WTY C;  5IPA A;  2FEZ A;  1SAU A;  2R7F A;  1R7J A;  1ZG5 A;  2IRF G;  2WC2 A;  2X1C A;  1AOY A;  4M3D A;  5FLM J;  4PFO A;  3JRF A;  3PO2 J;  1NG6 A;  2K7L A;  3G1O A;  2O7O A;  3WOD F;  5CPR B;  3FK7 A;  2M4G A;  1DP3 A;  1O4X A;  4M3B A;  1UJ8 A;  2H6B A;  3FMS A;  3IH3 A;  2DJI A;  3ZQH A;  2LY1 A;  3EPZ A;  3BZ6 A;  3TW6 A;  1X3W B;  2V79 A;  4S05 A;  3W2W A;  4LFU A;  2AQE A;  3ECO A;  1WZ2 A;  4RAG A;  3ZXS A;  2A6H F;  4ZC3 A;  3AG1 H;  3DEE A;  3BTI A;  4BHP A;  5FKM A;  1EF4 A;  3L09 A;  4CYC B;  4XBF A;  1XCB A;  3S15 J;  1HDD C;  4D1Q A;  4RGS A;  4FIS A;  2IBD A;  1YIO A;  2KFD A;  3K69 A;  4XSX F;  4A5N A;  3IWZ A;  2NVX J;  4EJV A;  1KQ9 A;  4WCG A;  2L4A A;  4BE0 A;  3PSF A;  4G7H F;  4D5F A;  2MC3 A;  3TO9 A;  3GF2 A;  2DT6 A;  4Q4Z F;  4BY1 J;  1B4A A;  1H9G A;  3WTW C;  2LD5 A;  3U9G A;  3Q3S A;  2F5C A;  4ZYH A;  1YX5 A;  1WFX A;  1OCO H;  2H8W A;  3D5L A;  1TP4 A;  5FD5 A;  2VLA A;  2PLY A;  3I4N J;  1Z3Y A;  2VI6 A;  3BDD A;  3GFL A;  4IZZ A;  5H2F C;  4NBQ A;  1EH7 A;  2M87 A;  3ML6 A;  4HQE A;  4Y33 A;  2KJB A;  1PUF B;  1TT0 A;  3DCF A;  5HVQ C;  3AKZ A;  3OYM A;  3HKZ A;  1U8R A;  2D1V A;  1S72 I;  4I7H A;  2R7S A;  2RQP A;  4XQF A;  1P7J A;  2GBY A;  2W84 A;  5JLX A;  1VQ7 I;  1MMG A;  1T95 A;  2WB1 N;  2A3S A;  2KKO A;  2NVY J;  1W5C C;  4ZTJ A;  3BTC A;  1T33 A;  3ABL H;  5LHH A;  4RAF A;  4F7Z A;  1YQA A;  1TT5 B;  3HOS A;  4RM2 A;  2P8T A;  4II3 A;  4DBR A;  2KHM A;  3KZZ A;  3QOP A;  4JX5 A;  4A69 C;  4DIQ A;  5IOY A;  2LNB A;  4HX8 A;  2H1K A;  5D5X B;  1PP8 F;  2JSC A;  2CWE A;  4HA8 A;  5KAI C;  1IV6 A;  3BTL A;  4WXH A;  2QQ8 A;  3S1R J;  3DLA A;  1BA5 A;  3COA C;  3FXM A;  1VQ8 I;  4LGW A;  2Y9Z A;  2FF4 A;  4E7I A;  1YG2 A;  2EK5 A;  3HTS B;  5J47 A;  2CH0 A;  2V4J C;  4DGW B;  5DYM A;  3CC2 I;  4CYD A;  4CDG A;  4EGY A;  3PNV A;  1HC8 A;  1MH3 A;  2G7H A;  2HTS A;  5KCM A;  5J3L A;  3GBG A;  1FNN A;  3KP7 A;  1FTT A;  1K83 J;  1OR7 C;  3DWL E;  4EJT A;  3FHN A;  3A1Y A;  2IA0 A;  1BC7 C;  1KU3 A;  2VQG A;  4BXF A;  3PIP F;  1YTY A;  1Q1H A;  4LMY A;  1XB4 A;  4XRF A;  1ZGJ A;  2R93 J;  3ZN1 A;  2B63 J;  2L02 A;  4OOI A;  3CCY A;  4WWC A;  2CV1 A;  2DA5 A;  2MYS A;  3K4J A;  3P9I A;  3H1C A;  5J1U A;  1PDN C;  1LVK A;  2WY8 Q;  2HU9 A;  4LIU A;  3ZQL A;  2MW8 A;  5LGU A;  2FX0 A;  3AG4 H;  1QZY A;  3LSR A;  1YIT I;  2L5Q A;  3CTA A;  4LB5 A;  3DKY A;  3GUD A;  2M7A A;  3DF8 A;  2AHQ A;  4UVC A;  5FRN A;  4BU2 A;  2W82 A;  2JQ7 A;  1IN8 A;  4XID A;  4BDY A;  2VXZ A;  2O9L A;  1B9M A;  2O5R A;  1D8K A;  4YFK F;  3C2G A;  1AU7 A;  4RLQ A;  4BJ5 C;  1WI9 A;  2HEO A;  1FBS A;  4ITV A;  4N9H A;  2E5N A;  2JSP A;  2LBF B;  4ZZD A;  1HKS A;  1I27 A;  1KU2 A;  2NYX A;  2RAE A;  1ONV A;  4BYY A;  2D45 A;  1VQ9 I;  2GIZ A;  2IGK A;  3Q5F A;  2VJ4 A;  3ONQ A;  3E5U A;  1BR2 A;  5LEK A;  1MDM A;  3H5R A;  4ANJ A;  5F27 A;  5GAE J;  3A0B C;  1IGN A;  3D1N I;  3BQY A;  4I76 A;  3ESW B;  1XSX A;  2K85 A;  3OIP A;  2KJC A;  4I6Z A;  1ZRC A;  3CJR B;  2EQR A;  2RVC A;  1BN5 A;  1LDJ A;  4A0Z A;  1D1A A;  5A2Q Z;  3JSO A;  3OMY A;  5KHD A;  2HQ5 A;  2JJ7 A;  3OOU A;  2A5Y B;  1X1D A;  5ICC A;  1WJA A;  1ZQ3 P;  2FUG 2;  2EFN A;  2E7W A;  3PO3 J;  1JKP C;  5KAF C;  4KNY A;  4H4K C;  1XGN A;  4AID A;  2Z33 A;  4MTD A;  1IC8 A;  1JUS A;  1UAA A;  2DA1 A;  2FJ1 A;  5BMZ A;  3PUF A;  3OYD A;  3IV5 A;  2ZNZ A;  4IKF A;  1FOX A;  4DNC A;  2I5U A;  4BKX A;  3JRE A;  2ELK A;  2HOA A;  3HRS A;  4LD5 A;  4A0X A;  5BNG A;  2ZXI A;  3G1L A;  1FBQ A;  4CSW A;  2VIX A;  1Y0U A;  2DFI A;  3SHF A;  1MMS A;  1U5T B;  1ZR2 A;  2L2O A;  4ZDP A;  1MBH A;  2FML A;  3K4L A;  1Z05 A;  4YEJ A;  2QSG X;  2TCT A;  4AC0 A;  2DW4 A;  3FXU A;  4NB5 A;  5CQE A;  3CCE I;  3VYU B;  5LRR A;  2MG4 A;  2BY3 A;  2GXG A;  3HC7 A;  1MGT A;  1U2W A;  4ZYD A;  1P4A A;  3CUO A;  2BXZ A;  2JTV A;  3F8M A;  3D0S A;  1R1T A;  2R92 J;  4RB2 C;  5K5O A;  2CGP A;  3O2P E;  3J81 Z;  2ID6 A;  1N78 A;  4HZF A;  4AWX B;  4FET A;  5H6Q A;  2VT3 A;  2JK3 A;  1CF7 A;  3HDD A;  3F9K A;  2VQC A;  3BCB A;  2EZK A;  3G4S I;  1W7P D;  2OZ6 A;  4BAC A;  3DTE A;  3WTT C;  3SFI A;  2P7C B;  1JTX A;  4I02 A;  3CF2 A;  4KIB A;  4YIF A;  1JKQ C;  2DA2 A;  1LVA A;  1JUM A;  2HZD A;  3ABK H;  2XAQ A;  4IVN A;  2R5Z B;  2M45 A;  5AIP A;  4J00 A;  2E7X A;  1IRF A;  3ELK A;  3HB9 A;  2R5Y B;  1O7L A;  4RS8 A;  2W7N A;  4LB6 B;  1OYI A;  1IUY A;  2DOE A;  4GRI A;  1FSE A;  1QQI A;  4HLY A;  3LWF A;  3K70 C;  2HWV A;  2F4O B;  2XGC A;  3H0D A;  1F9N A;  3HJE A;  1GXQ A;  2VOO A;  2NXN B;  1J2X A;  2OQR A;  2VAS A;  3BG7 A;  3IP4 B;  1APL C;  1HW1 A;  3FK6 A;  2VUM J;  2FOW A;  3OYK A;  3H9Q A;  5M3F J;  3FXQ A;  3I71 A;  4YEL A;  3WG7 H;  3A03 A;  3T8T A;  3I4P A;  5K1Y A;  5JHF A;  1Z91 A;  2DDA A;  4GGG A;  5K7Z A;  3PIO F;  3C3W A;  3MMY B;  2QBY A;  2ZKZ A;  4AIJ A;  2DJN A;  2M4K A;  3HRU A;  4HOB A;  1RKT A;  3M8E A;  2K3F A;  3IAM 2;  3J80 Z;  2F5F A;  4Y4R A;  4G7O F;  2KIS A;  2BVM A;  2WTE A;  5F1J A;  4BDZ A;  4AM3 A;  1DPU A;  1IV8 A;  3NAU A;  3KE2 A;  3JTH A;  3A01 A;  4E7L A;  2JN6 A;  1WH7 A;  3Q0W A;  4ESB A;  1MBF A;  1YI2 I;  3MEX A;  2H8R A;  3SYT A;  3DLL F;  1Y8Q B;  3CME I;  2NRA C;  4MO7 A;  1GVJ A;  5M5W J;  1MBE A;  2HPI A;  4HLX A;  4AUX A;  2HI3 A;  3JW4 A;  5EF6 A;  4PJJ A;  4HG2 A;  4A0Y A;  3GO5 A;  2E2H J;  3K2A A;  4UXN A;  1DGW Y;  3DXJ F;  1Z0X A;  1ZHF A;  4E7S A;  2JPC A;  1XGO A;  3I56 I;  1AKH A;  2BW3 A;  2F5E A;  2CUE A;  2M30 A;  1XX5 A;  1MSF C;  2A61 A;  5FD6 A;  3A2K A;  1EKE A;  3L2Q A;  2RQQ A;  5E3L A;  4R8H A;  3HUG B;  5GAH J;  4HV5 A;  2DLL A;  1U6G A;  1MBJ A;  1XMA A;  1VQ5 I;  3KIO A;  3ZQ7 A;  1K79 A;  4LG0 A;  1ETY A;  1IXR C;  4C3I J;  4D7M A;  2IP2 A;  3OYJ A;  3KP2 A;  4F92 B;  3ASO H;  3JTG A;  4A3C J;  2Y48 A;  5IT3 A;  1VFC A;  2DU9 A;  2PMH A;  3H35 A;  1JGG A;  4FAS D;  4YG2 F;  3BZC A;  1I5Z A;  3E6D A;  4WXC A;  3TQN A;  3CCV I;  2JRM A;  3SFZ A;  4A3E J;  4RLF A;  4B4C A;  4DYR A;  1W36 C;  4KN4 X;  3I55 I;  4MIM A;  3WTU C;  4KIC A;  4IHW A;  2G9W A;  4LG3 A;  3GLL A;  2XB5 A;  4D5C A;  1D0Z A;  4NQW B;  4IOC F;  2F4I A;  3HZJ A;  2F5V A;  2O0Y A;  2RV8 A;  4XM3 A;  5J1Y A;  5TIS C;  2L9S A;  3MFK A;  3NWS A;  2WA0 A;  3V8J A;  2OU2 A;  4HX4 A;  3U1D A;  2XVC A;  4PJ0 C;  1H8A C;  2VPR A;  3J7Y J;  3JAM Z;  1FOY A;  1IZ1 A;  4PFP A;  2UXX A;  1NG7 A;  1JHF A;  1HCR A;  3EQL F;  3QPL A;  2AXT C;  4CYC A;  3G3Z A;  2QZ8 A;  2FD5 A;  2ZJP F;  4OMZ A;  1B72 B;  5JHU A;  4KJZ A;  2VE9 A;  2CJJ A;  3T5X A;  2E2I J;  3OYA A;  1T8I A;  1WRJ A;  1AWC A;  2FNA A;  2YPR A;  4A3J J;  5C4J J;  3K4C A;  3WU1 B;  4PZJ A;  3ULQ B;  5EG0 B;  1X2M A;  3F6O A;  4PGG A;  3RPU A;  4JX4 A;  2E1O A;  3W2V A;  1DP7 P;  2PJP A;  3GTO J;  5HS9 A;  2W25 A;  4XRM A;  4L18 B;  3ZR8 X;  2QEN A;  2DOF A;  3I64 A;  1YOV B;  1WJF A;  2R7T A;  4U7D A;  3GXO A;  1PUF A;  2VOD A;  5B1A H;  2BHZ A;  4OIR F;  4XIC A;  2D2W A;  3RSN A;  1HKQ A;  4IQJ A;  3P9K A;  5GP9 A;  4EM0 B;  1WQ2 A;  1WI3 A;  4UUS B;  1FZP B;  4HNT A;  5E3O A;  4YRV A;  5BOX A;  3HOW J;  1UHM A;  4O6J A;  1IUF A;  4GXO A;  5M3M J;  3HOZ J;  3GZN B;  2CV2 A;  5GPA A;  1RRJ A;  2E1N A;  2LTP A;  1ACI A;  2QYO A;  4EM2 A;  5IOZ A;  1C0W A;  2CQN A;  2Y9Y A;  4ZDL A;  2GA1 A;  3TOA A;  3CCR I;  4OAY A;  5HLH A;  2HYF A;  3E6M A;  4U0Y A;  3CD6 I;  3R6S A;  4GYI A;  5CJ9 A;  4XR6 A;  3OS2 A;  2VBZ A;  5H20 A;  3BTJ A;  1QHG A;  3TBI A;  3GVA A;  2LK2 A;  3WU0 A;  5D4S A;  4ZTF A;  3HOU J;  4IQ4 A;  1G8X A;  2DT7 B;  2P0W A;  2J5P A;  4QPO A;  4B3A A;  2CO5 A;  2R7X A;  1ITY A;  4Q5S F;  3JAM K;  2ZME B;  3CCS I;  2K27 A;  2CYY A;  3ZCO A;  5IYC J;  5AIQ A;  3OYB A;  2R7D A;  2A5W A;  2XAF A;  2YSR A;  3BT9 A;  2DPU A;  1S3J A;  2CMP A;  3B6A A;  1OYY A;  4ETS A;  1ETV A;  2ZXW H;  1L3L A;  3DPT A;  1PYV A;  1WGX A;  3R60 A;  2PG4 A;  1ETW A;  4JYK A;  4Q48 A;  3T1B A;  5K5Q A;  3PFY A;  3S2H J;  2MC4 A;  5FFZ A;  1OCR H;  3OV8 A;  3RKW A;  2ZSI B;  5DDG A;  1IAW A;  4LK0 F;  2XV4 S;  1SFX A;  2L4M A;  3NRV A;  2YR2 A;  2DFF A;  4RBO A;  4CCO A;  1N77 A;  2O8X A;  2R7V A;  2EWN A;  2HNH A;  4LOC A;  1YHQ I;  2LC2 A;  3O8H A;  3KFW X;  2DQR A;  3TDZ C;  3LSG A;  1IRG A;  1R71 A;  1D3Y A;  4V19 K;  1R22 A;  3TDU C;  3TL4 X;  3OR2 C;  3F6V A;  1TW2 A;  4ABZ A;  4DYC A;  1GHC A;  5K7H A;  1OLT A;  1MKM A;  5TRD A;  3JR9 A;  2DAO A;  1U5T C;  1HW2 A;  2HOS A;  2QUF A;  2B9S A;  1J75 A;  1SFK A;  3ZPL A;  2M8G X;  1WJC A;  2A05 A;  4PSX A;  5KVR A;  2X4H A;  4V2G A;  4DQ2 A;  3T8R A;  3LAJ A;  4TV7 A;  3BG9 A;  1MSE C;  1YRN B;  1A35 A;  3MD2 A;  2LBF A;  4B3X A;  5IY5 H;  4HDU A;  3IWF A;  2HXI A;  5GAD J;  4CCK A;  3C18 A;  2MA3 A;  1FLI A;  4M3E A;  1YS6 A;  3ZQQ A;  5CVJ A;  2EJR A;  4Z2Y A;  3RCO A;  1UZC A;  3FKI J;  3K1P A;  3G73 A;  5E3M A;  2X1D A;  1G3S A;  2KP6 A;  4F3Q A;  2Z99 A;  3GLX A;  1TWA J;  2F6C A;  3V7S A;  5HNH A;  1ULY A;  4CA0 A;  4P96 A;  2CSO A;  3HM5 A;  1LFP A;  1XSV A;  1UEL B;  4EJW A;  3HYI A;  1B8I B;  3ZQG A;  4CHU A;  2E34 A;  5FFX A;  2GQQ A;  1I39 A;  4I09 A;  4EGZ A;  3K1N A;  3M8F A;  2ME6 A;  5J4V A;  5CQG A;  3CO6 C;  1XDS A;  4PJN A;  2DMT A;  3S8P A;  1X2N A;  4BEH B;  2E35 A;  3ZMZ A;  3HL2 A;  3UR3 C;  3SQN A;  4FTH A;  3GTM J;  2HTJ A;  3CCU I;  3S1Q J;  3BG3 A;  2ADU A;  2V9K A;  5EEH A;  2MAB A;  2PQ8 A;  1RPW A;  2IPQ X;  4A3M J;  2W1O A;  3QQA A;  4NDL A;  1RIO H;  2OTL I;  1ZRF A;  2YU9 J;  1YYV A;  2CV0 A;  3RYR A;  4CCN A;  1XMX A;  1OIS A;  5D5W B;  4NUB A;  1FSH A;  2R4G A;  1REP C;  4N4O B;  1D0X A;  1UHS A;  4IHS A;  5J1R A;  3OYL A;  1GDT A;  2EZH A;  2JT1 A;  4IHV A;  2EV0 A;  2PI0 A;  2OV7 A;  2OC6 A;  3DV8 A;  1PP7 U;  3R0A A;  1W7P B;  2VKH A;  1JJ6 C;  1WWX A;  3IC7 A;  5LFA A;  1U5T A;  3J7A Y;  4MQ9 F;  5D5U B;  5HDN A;  3QOE A;  4L9J A;  2EA4 A;  1MMN A;  1I3A A;  3CC7 I;  3F8N A;  1MNE A;  4XLH A;  5CYV A;  2UUZ A;  3B6C A;  4XLF A;  2R7U A;  2E1M C;  1KQ8 A;  1JHH A;  3SEQ A;  3SZG A;  5EZH A;  3NEU A;  1L0O C;  4RAZ A;  1RNL A;  1Z7U A;  3ZMU A;  1BI1 A;  4G9Y A;  1FP1 D;  4JP0 A;  1LEB A;  1VTN C;  4JBA A;  5IYD J;  1LEA A;  1K61 A;  1HF0 A;  1PUE E;  1O57 A;  2V7F A;  4B48 A;  4G8X A;  2DBB A;  1XCV A;  1JTY A;  1VQ6 I;  1X1P A;  2PN6 A;  4RB3 C;  1T39 A;  2Y75 A;  2WWY A;  3AG3 H;  3F8B A;  4E4H A;  4KFC A;  4GDF A;  2VJI A;  4XK4 A;  4UV9 A;  4XN0 A;  1H9T A;  3OR1 C;  2RKH A;  3CCJ I;  3BR5 A;  2CRG A;  2JVG A;  4EJU A;  3VDX A;  2R5Z A;  3RI4 A;  5GTH C;  2V6C A;  1JE8 A;  4KMF A;  3GW2 A;  2LYC A;  1GUU A;  2DTR A;  5F0H A;  2R5Y A;  2VOP A;  1FTZ A;  3N97 A;  3V4G A;  1ZGA A;  3FF5 A;  4B43 A;  2VKE A;  5TJJ A;  2GAU A;  1K4T A;  2ZSH B;  2V1N A;  3X2Q H;  2M34 A;  3O6B B;  3WG9 A;  2STW A;  4CZZ A;  4DW6 A;  2MLG A;  1P92 A;  2OBP A;  1P7I A;  5DEQ A;  1LJ9 A;  1W0U A;  1SFE A;  3BZK A;  4HF0 A;  3RKX A;  3CJN A;  2LLK A;  4KIF A;  4F55 A;  3HOX J;  3CMA I;  1Y56 A;  2RN7 A;  1UHW A;  2PJR B;  2V6E A;  1Z21 A;  4ZJZ A;  5FLX K;  4XKB A;  2GA2 A;  4OIN F;  3HHG A;  2H1L A;  4WX9 A;  4X0G A;  1P9Q C;  2KIM A;  2XIG A;  4D7N A;  1TQP A;  2VL8 A;  3CJT B;  3VOE A;  1M1E B;  1A5J A;  5D8K B;  5ILV A;  1DU6 A;  2IJL A;  4L0Y B;  3SXY A;  3M3Y J;  5FLV A;  1I1S A;  3H5N A;  1J5Y A;  3A0H C;  5LBQ A;  1IN4 A;  1TNS A;  2H94 A;  2X1E A;  3RIR A;  4XKC A;  5JVT A;  4QPQ A;  1DPR A;  2HKO A;  2IGM A;  1SFO J;  3LA7 A;  4WXD A;  3QU6 A;  5E1Z B;  2KDZ A;  1OQY A;  2HQA A;  2ZBK A;  2IGO A;  2X6X A;  4KUM A;  1ENH A;  2LG4 A;  4QTR A;  2OD5 A;  2OF7 A;  1R00 A;  2K9Q A;  4N9I A;  1LUJ B;  2JA8 J;  3ERE D;  4M9S A;  2A68 F;  4FE4 A;  1F1Z A;  5DTD A;  1V4R A;  3PNY A;  3E7L A;  3CJQ B;  2D1H A;  1HBX G;  2ZXJ A;  2XUB A;  3LA2 A;  4Q47 A;  2QVO A;  5KNL A;  2CQQ A;  1LFB A;  3BY6 A;  3RTR A;  5F08 A;  3ZQF A;  2W48 A;  2DN0 A;  1X1B A;  2QA4 I;  1VND A;  4YFX F;  2XF6 A;  3KZI C;  3HUG A;  3SZT A;  1XPX A;  4RA2 A;  2EV6 A;  3I0T A;  1ZYR F;  3P7N A;  1T6S A;  2ACJ A;  3CZ6 A;  4H0E A;  2YX7 A;  4FX4 A;  2VC0 A;  4XKV A;  3K0L A;  3LQR A;  3MN2 A;  5LHG A;  2XAG A;  2P5V A;  3RZO J;  3BQZ A;  2H27 A;  3CDL A;  2O03 A;  3OYE A;  1D5Y A;  2G0E A;  4LLG F;  3VYT B;  4RGU A;  4UUV A;  1RC9 A;  4G12 A;  2M8E A;  4DJA A;  3JRI A;  4HF2 A;  2NS7 A;  3C2H A;  2P7V B;  2K40 A;  3OYI A;  4L5I A;  3GFI A;  4Y7N J;  1RKW A;  3M8J A;  5E3N A;  2K9N A;  1B9N A;  4NQW A;  1I3Q J;  4QSH A;  1OR7 A;  2Y0S N;  3BC8 A;  5JR3 A;  4PSW A;  2O6G E;  3V7R A;  4FT8 A;  4G6T B;  4M73 A;  2BXY A;  4BL0 B;  1S7O A;  5J6X A;  2MH9 A;  5FGM A;  2PEX A;  3HIF A;  3KP3 A;  5HLG A;  1LB2 A;  2ZME C;  3GFM A;  4A5M A;  2IS4 A;  3E0J B;  4IX7 A;  1VQN I;  3R4K A;  1R4M B;  1WHU A;  1IJW C;  4UNO A;  3IL2 A;  5FO5 A;  1MJB A;  4N4N B;  4AD9 A;  1TBX A;  1KZH A;  4CO8 A;  1YW7 A;  1FYK A;  1Z6T A;  3WHC A;  4O5V A;  3EDP A;  3VOD A;  1ZK8 A;  3F8F A;  3LSM A;  4HPQ A;  1ZH5 A;  2X51 A;  3RZD J;  1T98 A;  5J40 A;  1B72 A;  2VJ5 A;  1QO0 D;  3FM5 A;  2ZO4 A;  2M0M A;  3LQQ A;  5M5Y J;  2VPL A;  1G3W A;  4FX0 A;  3KX2 A;  2Z3Y A;  3WTX C;  5EG0 A;  4HDV A;  4BBR J;  1K6O A;  2VBX A;  2LSO A;  2NOG A;  2FBI A;  5LEJ A;  2KMU A;  2FBH A;  2YX4 A;  3TKY A;  1GVD A;  5EEA A;  3C2B A;  1ZRE A;  1R9T J;  5E20 A;  1ZLK A;  4CH7 A;  4DOZ A;  4A12 A;  1RUO A;  4UUS A;  1CQT A;  2GZW A;  2Q8K A;  2XAH A;  1SVM A;  1HDP A;  3A4C A;  4AU7 A;  5EGO B;  5JFR A;  3FXO A;  4A93 J;  3HOY J;  3NWT A;  3CDI A;  4E70 A;  1BOB A;  4GYG A;  2DA7 A;  4XRS A;  3LNQ A;  4BQA A;  3H9J A;  3K1M A;  4HYE A;  1WJD A;  3CLQ A;  4J01 A;  1TWG J;  1ETQ A;  2V1X A;  3FWE A;  5DCM B;  2KLO A;  2E71 A;  2O3F A;  1ZRD A;  3OSF A;  3NAR A;  1DUX C;  3H36 A;  3VSL A;  1OJL A;  4V2F A;  2AQF A;  1JUP A;  2CW7 A;  4KT5 C;  4AYB N;  1QVU A;  2PMZ A;  3QAH A;  2ZME A;  4G6Q A;  3VFZ A;  3CQZ J;  5FKL A;  2WV1 A;  2Q1Z B;  1OYW A;  3FIS A;  5F0C A;  1BJA A;  2D5V A;  4KN7 X;  5L3C A;  5FRM A;  4QLC U;  1LDD A;  1PJR A;  4XNF A;  4A6D A;  3S2W A;  1TLH B;  2YU3 A;  2EFQ A;  1ZEL A;  1IRX A;  1FOK A;  1WKM A;  4UB8 C;  5IP7 J;  1Z3X A;  3C7J A;  4JK1 X;  3Q9S A;  2XGE A;  2M3A A;  2BYV E;  5HNF A;  1SAX A;  5C3E J;  2BEO A;  3IRR A;  2L54 A;  1S5L C;  4F93 B;  3RKQ A;  2FMY A;  5HDK A;  1POG A;  2DOD A;  4ESF A;  3Q9V A;  1VF9 A;  4HW0 A;  4RB1 A;  2BY1 A;  2LRD A;  4U88 A;  2LKX A;  1HQC A;  1BIA A;  1OCP A;  1H89 C;  4U87 A;  2VJJ A;  4HSR A;  4M71 A;  4BS9 A;  1F43 A;  2F2E A;  2ESN A;  2E1M B;  3OYC A;  3QPT A;  1O7F A;  2KL4 A;  3S2D J;  1HST A;  2XRN A;  4ZYG A;  1OKR A;  3PL8 A;  4L5J A;  2DK8 A;  4MQV A;  2EFW A;  3GYH X;  1JT6 A;  2VKV A;  3BRO A;  3R0J A;  4FQG A;  2O61 A;  1S6L A;  2W85 A;  5C4X J;  2XRL A;  3C1D A;  4F52 A;  3HPH A;  5DV5 A;  1FOW A;  2OUM A;  3ASN H;  3CO7 C;  1BI2 A;  2BBY A;  3PQJ A;  1V54 H;  4BQQ A;  5EEG A;  1YRN A;  4ASN A;  4LIV A;  1E0E A;  4U0W A;  3FX3 A;  2CW0 F;  1TWF J;  4MFD A;  3CUQ B;  3GZ5 A;  1AHD P;  2EIM H;  2A07 F;  3EUH C;  2E60 A;  5H6R A;  4MEX F;  2GOM A;  1GLN A;  1MMA A;  3L2R A;  4BGD A;  3EUK L;  4HEA 2;  3G71 I;  3FM3 A;  5HOD A;  2M5W A;  4HAM A;  5FKN A;  3SJM A;  2GWR A;  2HDD A;  4P5O A;  1JKO C;  5EYR A;  2X48 A;  3L00 A;  1ETK A;  1B8I A;  2JA6 J;  4PJM A;  1XG1 A;  2JMW A;  2XAU A;  3LSH A;  1I6H J;  4HBL A;  3ZRG A;  1U9O A;  3I53 A;  5D5V B;  2DI3 A;  3L2V A;  4RB0 A;  1WJE A;  1MNM C;  2FOK A;  4WF2 A;  4BEH A;  2F48 A;  4IHX A;  3LSJ A;  3CCQ I;  5J8F A;  3KP5 A;  4EVI A;  1QVT A;  2HOE A;  3OWT A;  1X19 A;  2JUG A;  3SEZ A;  3F8C A;  3BR3 A;  5FKO A;  3HHH A;  2IVM A;  3ABM H;  4EM1 A;  1DQU A;  3TO7 A;  5GTI C;  2WAQ N;  2IEK A;  3I9V 2;  2W4S A;  4MGR A;  2ZCW A;  2HQR A;  2IA1 A;  1MH4 A;  3V8K A;  3LOC A;  2ZFU A;  1YJW I;  4IXA A;  3HTU A;  5D6E A;  3RJP A;  3FMQ A;  1R58 A;  1J59 A;  1TNT A;  4IHY A;  5FB2 A;  5ILS A;  5GPC A;  2YUS A;  4E6K G;  2UXN A;  4BXX J;  1R1U A;  4U0V A;  3W6V A;  3TGN A;  4X6A J;  3TMO A;  1W7P A;  4A3F J;  2VC1 A;  2JA2 A;  1KYW A;  2WBM A;  2L7K A;  5BPD A;  1SD4 A;  4OAZ A;  5ED4 A;  4LLN A;  3TO6 A;  1D1C A;  2X6O A;  3B02 A;  3K2Z A;  2LKP A;  1SD7 A;  2X9D A;  3E3V A;  3FHZ A;  1LE8 B;  3WE2 A;  2XKP A;  2V1D A;  3HGG A;  4IF4 A;  4CCJ A;  2E1C A;  1S8N A;  2ZJ2 A;  2M7B A;  1MD0 A;  3U1K A;  2I10 A;  2LY2 A;  3MWM A;  1XD7 A;  3P9C A;  5LGN A;  1G2H A;  5F6F A;  1I50 J;  2CUJ A;  2VBY A;  2NS0 A;  3DU5 A;  4AVZ A;  1RUN A;  4A3G J;  1MBG A;  2R7Z J;  1NTC A;  1BJZ A;  5D8L B;  4J19 A;  2Y69 H;  2VBW A;  2QEX I;  2M9H A;  2PMZ N;  1T56 A;  3PFI A;  1I6X A;  3WTS C;  2LR8 A;  1BBY A;  2KPM A;  4OIP F;  1YJ9 I;  3MQ0 A;  5E17 F;  2PX9 A;  3AG2 H;  3BP8 A;  3LSI A;  3GEZ A;  1LFU P;  2BHY A;  2ETH A;  4B1R A;  1YW8 A;  1VQ4 I;  1P4W A;  4C30 A;  4F91 B;  5HLT A;  2DCE A;  1IW7 F;  1FYM A;  1BC8 C;  1QA6 A;  5IT9 Z;  2K9M A;  1TWH J;  4BXU A;  1QHH D;  3ZP5 A;  2XKO A;  1EA3 A;  5M5X J;  5FJ8 J;  4PGH A;  3HBL A;  4CGZ A;  2Z16 A;  2YS9 A;  1D1B A;  2HOT A;  2IXS A;  2NAZ A;  1BIB A;  5L3E A;  1XDU A;  1QNT A;  1JGS A;  5B1B H;  4XOP A;  2H6C A;  1Y6I A;  2PJR A;  1ZAR A;  1V55 H;  3JRC A;  3DBL B;  3M9A A;  3QPS A;  1KU7 A;  3BR6 A;  4FE7 A;  3HSF A;  2ZJQ F;  1T2K A;  4HF1 A;  3WGI A;  1JJ8 C;  3EYI A;  2XAS A;  2OTJ I;  1BW6 A;  4NC7 A;  2WV0 A;  3EET A;  4I2O A;  3QYB A;  3BWG A;  2MSY A;  2VXD A;  2KQR A;  1SFU A;  4XKW A;  2JZY A;  4HX7 A;  2XGX A;  4CIC A;  1MJA A;  3KZY A;  3DEW A;  3I5U A;  4L5E A;  2ZFW A;  1BR1 A;  2N8G A;  3K4M A;  2CFO A;  3FMR A;  5HLI A;  1FYL A;  3CLO A;  3GCM A;  5E79 C;  1U3E M;  1U9N A;  3I59 B;  3F23 A;  3KLO A;  4IRH A;  2BY2 A;  3M4O J;  4P1W A;  1MMD A;  3K10 A;  2QM3 A;  2KDO A;  2LH9 A;  1HLV A;  1RZ4 A;  1G4D A;  1QZZ A;  4I0B A;  3WGG A;  4AIH A;  2CUZ A;  2FSW A;  1QU3 A;  2VE8 A;  2DMU A;  5DD4 A;  2KZG A;  4MEY F;  1WJB A;  2XSJ C;  1XS9 A;  5K7F A;  2R7W A;  4BE1 A;  3HSE A;  2JUC A;  3OOP A;  2RC4 A;  3JRB A;  1QPI A;  2TRT A;  1J0R A;  3KP6 A;  2Q0O A;  1XGS A;  2DK5 A;  1B59 A;  2FU4 A;  1T38 A;  3WTV C;  3DPU A;  2X85 A;  1T0F C;  3RPQ A;  1QZE A;  1EH6 A;  2J5O A;  3HRM A;  3ROU A;  4B8X A;  1O3T A;  3WHB A;  3BPX A;  2HS5 A;  2MD5 A;  5IT9 K;  3BCA A;  2HVS A;  2L9R A;  5ERI A;  3F3X A;  4BE2 A;  3S14 J;  2B7E A;  1IDZ A;  1YW9 A;  3F0C A;  1XGM A;  4RDU A;  1HKT A;  4OWR B;  3ZMS A;  2MH2 A;  2VON A;  3N4M A;  3E5X A;  3PNT A;  4KT6 A;  3I54 A;  3FXL A;  1E3O C;  2HVQ A;  2JRT A;  1LDK B;  2JVH A;  2EB7 A;  3OYG A;  2OA4 A;  3BJ6 A;  1ZG3 A;  1UST A;  1VZ0 A;  2IS6 A;  1UG2 A;  3TW7 A;  1N75 A;  2EIL H;  2FQ4 A;  2Q2E B;  3MAJ A;  1IN7 A;  2L3D A;  3HGY A;  2DA3 A;  3D5R C;  2LF8 A;  3ZMD A;  2KRH A;  3MKZ A;  4XN3 A;  4ZDO A;  4B47 A;  2WAE A;  1IF1 A;  4Y52 J;  3M1C A;  1WH5 A;  1V5G A;  4M9X A;  1UCR A;  3H5A A;  2MFZ A;  1BR4 A;  2ESH A;  4UVB A;  4MFE A;  1F5T A;  3GTG J;  3ZMV A;  5L3D A;  5LRS A;  1D0Y A;  2ICW G;  2Y2Z A;  1SMT A;  1MW7 A;  4MHG A;  3V42 A;  4EMS A;  1R36 A;  1VI0 A;  4M6Y A;  1X4P A;  1O3R A;  1S7A A;  3B73 A;  5FLX Z;  3JRG A;  2LRE A;  1X4O A;  5HS8 A;  2GOX B;  3LA3 A;  3T0Y A;  4BAY A;  1R6R A;  3S3N A;  5E1X A;  2UWM A;  1FEX A;  4IO9 F;  1J09 A;  2A6T A;  3G2B A;  1FX7 A;  4PDK A;  2GLO A;  2ZB9 A;  3PM1 A;  1TTY A;  3H3Z A;  3M1E A;  1G3T A;  2Y0S A;  4GO1 A;  1FP2 A;  1IXS B;  2K4B A;  2LMD A;  2QQ9 A;  1Z67 A;  1IG7 A;  1TQM A;  2BY0 A;  5GAG J;  2UV1 A;  2CQK A;  2NS8 A;  4PCQ A;  4XOT A;  1X1C A;  3IKV A;  5F0F A;  3WTZ A;  2DFE A;  5JVG F;  2DT5 A;  1YO5 C;  1T0F A;  5E8I A;  4QWQ A;  3OYN A;  2Z1D A;  4BJ6 C;  2HDW A;  3G1M A;  1CGP A;  3E97 A;  4LK1 F;  3V7C A;  4S04 A;  3BG5 A;  2EZL A;  4ZZL A;  2DPD A;  4HNV A;  2XGD A;  1WCM J;  5L3F A;  5L3G A;  5B66 C;  3S3M A;  2DDB A;  4FHT A;  4P55 A;  2OJE D;  4UUT A;  5EGO A;  3FZV A;  1K6Y A;  5ICG A;  2LFB A;  3MZH A;  5AON A;  1FBU A;  2XF5 A;  3CUQ C;  3BR1 A;  1TZL A;  3KEQ A;  1T08 B;  3I58 A;  4Y13 A;  1GXP A;  3MCZ A;  2R3S A;  1A6I A;  1W1W E;  3K4B A;  1GV2 A;  3QOD A;  4I99 C;  3IH4 A;  5DCM A;  3SDG A;  3HPG A;  3CES A;  3ABT A;  5BPI A;  3JSP A;  2K5C A;  2R7O A;  2EA2 A;  2L9N A;  1LKX A;  2GIV A;  4W97 A;  2L9V A;  3K7A J;  4BY7 J;  5HS7 A;  3E5Q A;  3GFJ A;  3E6C C;  1GV5 A;  3FXJ A;  4XLN F;  4B44 A;  4E7J A;  2QSH X;  1TWC J;  5J4Y A;  3TP0 A;  4LLL A;  4BUP A;  3S17 J;  5LGT A;  3CC4 I;  3F21 A;  1XN7 A;  2WY7 Q;  2IS1 A;  2EIJ H;  1FPQ A;  3UNG C;  3WU2 C;  1ETO A;  2OPT A;  4OU0 A;  3U2R A;  5J8C A;  1KQ0 A;  1IXC A;  4G7Z F;  5E1W A;  3SZP A;  2ELJ A;  1SC7 A;  2O8K A;  4E7K A;  5CVR A;  5CVV A;  1FY7 A;  2MBF A;  2K9L A;  3TOB A;  2KRF A;  4IHT A;  4GCV A;  3KYL A;  1R5G A;  3REO A;  4AYB A;  2CS3 A;  5K5R A;  2P5L C;  3DKW A;  3HOV J;  3BJO A; 
#chains in the Genus database with same CATH homology
 2HFH A;  4G6D A;  1DDN A;  2ZNY A;  2W57 A;  1BM9 A;  2HKX A;  3M7G A;  4EQQ A;  2P5K A;  4M9Z A;  3CDH A;  3O3K A;  1K78 B;  1P2F A;  2RDP A;  4M74 A;  3ZN0 A;  1ON1 A;  3CUQ A;  2B0L A;  2HR3 A;  3W6K B;  4R1H A;  2BE5 F;  2RNJ A;  4KIG A;  3ABU A;  2W24 A;  2KIF A;  5KK1 A;  3IHU A;  4I98 B;  1KA8 A;  2P4W A;  5F1R A;  3WGH A;  4ENM A;  1HXD A;  5DCF A;  3J7A O;  3QRF F;  2QQA A;  4I0A A;  2FBK A;  4EJO A;  2K86 A;  5ICF A;  2UZK A;  3FXR A;  2C6Y A;  3IRQ A;  1S29 A;  1ODD A;  3KEO A;  4BH9 A;  3DEU A;  2IW5 A;  4I01 A;  2BV6 A;  2EFP A;  4UHT A;  1EV7 A;  4HV6 A;  3WE3 A;  1KYZ A;  3K9T A;  2RGV A;  4HQM A;  3L9F A;  1NHA A;  2LF7 A;  4OIO F;  2EFO A;  1R1V A;  3BPV A;  3KCC A;  4A6E A;  1SMY F;  1MJ9 A;  2OQG A;  4OIQ F;  1J9I A;  1U78 A;  1QPM A;  2CFX A;  2H09 A;  1W4M A;  3ISP A;  1RI7 A;  4AIK A;  1Z9C A;  2NNY A;  4KA4 A;  1D8J A;  2AS5 F;  2LDU A;  1QBJ A;  3LFK A;  2QLZ A;  3F72 A;  2HDC A;  1BOA A;  2HQN A;  1FC3 A;  2OAZ A;  4B09 A;  3H3U A;  3AAF A;  4ZYE A;  2IT0 A;  4A2U A;  5E8G A;  1V3F A;  1H0M A;  1UFM A;  4ZH4 F;  3KET A;  1B1B A;  2VN2 A;  4P9U A;  3RDI A;  2A69 F;  1LQ1 A;  2K02 A;  1STZ A;  2V1U A;  2COM A;  1Z1D A;  2L01 A;  5A2Q K;  4XSZ F;  4LJZ F;  1ON2 A;  2TDX A;  2XAJ A;  2VT2 A;  3F22 A;  4IPA A;  4K2E A;  5LHI A;  4KMU X;  2M1B A;  2IA2 A;  3I59 A;  5E18 F;  1G6N A;  4ON0 A;  1SD5 A;  1D5V A;  3GX4 X;  2FA5 A;  4YII A;  2AXL A;  3GWZ A;  2V9V A;  4N0B A;  1P6R A;  1G3Y A;  5DUK A;  3BJA A;  3E6B A;  4WK8 F;  3DP7 A;  4KYW A;  6PAX A;  3GZ6 A;  4P9F A;  2EV5 A;  5BQT A;  3J81 K;  2BGC A;  1TW3 A;  1I1G A;  1R5H A;  1Z6R A;  3HRT A;  2QQB A;  4BNC A;  2GXB A;  1KGS A;  4G94 A;  2QWW A;  2Z5U A;  2JPB A;  1K7A A;  4RGX A;  3L7W A;  2Q2E A;  4AVP A;  2STT A;  4IRG A;  2ISY A;  1YS7 A;  5DUI A;  2F5D A;  3HSR A;  1W5S A;  1E2X A;  1MDM B;  1ZAO A;  4KDP A;  4Y17 A;  1YLF A;  2K4J A;  2Z9O A;  3LST A;  5D4R A;  1XMK A;  5ICE A;  4NHJ A;  3RYP A;  3V8L A;  2CG4 A;  2P6S A;  4CXF A;  3J80 K;  3QP5 A;  1O3S A;  3ZMT A;  1MZB A;  3MZY A;  4EV0 A;  1ZG1 A;  1QGP A;  1FT9 A;  5L3B A;  1XSD A;  1OMI A;  1TQI A;  2Y0M A;  3EUH A;  4BHC A;  2FRH A;  1LNW A;  4BHB A;  1A04 A;  1JXS A;  4L9V A;  2NNN A;  2XHK A;  5D6F A;  5ILU A;  2P6T A;  3KLN A;  4UV8 A;  4L9T A;  3QP6 A;  1X3U A;  4U7B A;  2A6E F;  1OPC A;  3IKT A;  1ZN2 A;  3VEP A;  1CF7 B;  4ENN A;  4IJA A;  5LLQ A;  4L0Z B;  2ISZ A;  4D0P A;  1EH8 A;  3H92 A;  4L9N A;  5HDG A;  3LAP A;  4UVA A;  2DO7 A;  5CLS A;  1WSU A;  3QPH A;  3EYY A;  5F64 A;  4Y15 A;  2OZU A;  3KP4 A;  1F4K A;  3BOQ A;  2FE3 A;  1IN5 A;  2FXA A;  3VB2 A;  1ZLJ A;  2PBI A;  1J7K A;  1HSJ A;  2HZT A;  2PFB A;  1O3Q A;  4RGR A;  3DFG A;  2HGC A;  2X0L A;  2QBY B;  1HW5 A;  5HOO A;  1BI0 A;  3R61 A;  1K78 A;  1YFH A;  5CVU A;  3QU3 A;  3DPL C;  1SD6 A;  4YFN F;  4OMY A;  3HOT A;  5JI6 A;  4MNU A;  5DD8 A;  4ESJ A;  3PQK A;  2DQL A;  5BS6 A;  1W5T A;  3NQO A;  2XRO A;  4M72 A;  4XLP F;  4O3M A;  3RKY A;  4MTE A;  1USS A;  1B6A A;  1FWZ A;  1KU9 A;  2ELH A;  5CVI A;  4R79 A;  1P4X A;  3W6J B;  2KIU A;  4RAY A;  2HYG D;  2FNP A;  2PMU A;  4IRI A;  1BI3 A;  2FQ3 A;  1R23 A;  3L2C A;  4ENK A;  2MLK A;  4LG0 B;  1E17 A;  4JQF A;  2G7U A;  1IN6 A;  4ENJ A;  1UB9 A;  3ECH A;  3DQV C;  4M6X A;  3WTY C;  2FEZ A;  2R7F A;  1R7J A;  1ZG5 A;  2IRF G;  2WC2 A;  1AOY A;  2K7L A;  3WOD F;  2H6B A;  3FMS A;  3BZ6 A;  2V79 A;  4S05 A;  4LFU A;  3ECO A;  2A6H F;  4BHP A;  3L09 A;  4XBF A;  1XCB A;  4RGS A;  4XSX F;  1YIO A;  4A5N A;  3K69 A;  3IWZ A;  4EJV A;  1KQ9 A;  4WCG A;  2L4A A;  4G7H F;  2MC3 A;  3TO9 A;  3GF2 A;  4Q4Z F;  1B4A A;  1H9G A;  3WTW C;  3U9G A;  2F5C A;  4ZYH A;  3D5L A;  5FD5 A;  2PLY A;  3BDD A;  3GFL A;  1EH7 A;  2M87 A;  3ML6 A;  4HQE A;  2KJB A;  5HVQ C;  1U8R A;  2D1V A;  4I7H A;  2RQP A;  2W84 A;  2A3S A;  2KKO A;  5LHH A;  4F7Z A;  1YQA A;  3HOS A;  2P8T A;  3KZZ A;  3QOP A;  2LNB A;  4HX8 A;  5D5X B;  1PP8 F;  2JSC A;  2CWE A;  4HA8 A;  4WXH A;  3COA C;  4LGW A;  2FF4 A;  1YG2 A;  2EK5 A;  3HTS B;  5DYM A;  4CYD A;  4CDG A;  4EGY A;  2G7H A;  2HTS A;  1FNN A;  3KP7 A;  4EJT A;  2IA0 A;  1BC7 C;  1KU3 A;  1YTY A;  1Q1H A;  4LMY A;  1XB4 A;  4XRF A;  1ZGJ A;  3ZN1 A;  2L02 A;  4OOI A;  4WWC A;  3P9I A;  1PDN C;  5LGU A;  1QZY A;  3CTA A;  4LB5 A;  3GUD A;  3DF8 A;  4UVC A;  1IN8 A;  2VXZ A;  1B9M A;  1D8K A;  4YFK F;  2HEO A;  1WI9 A;  1FBS A;  4N9H A;  4ZZD A;  1HKS A;  1I27 A;  1KU2 A;  2NYX A;  1ONV A;  4BYY A;  2D45 A;  3Q5F A;  3E5U A;  5LEK A;  1MDM A;  1XSX A;  2KJC A;  1ZRC A;  2RVC A;  1BN5 A;  1LDJ A;  4A0Z A;  5A2Q Z;  3JSO A;  2A5Y B;  5ICC A;  2EFN A;  2E7W A;  4KNY A;  1XGN A;  2Z33 A;  4MTD A;  5BMZ A;  2ZNZ A;  4DNC A;  3HRS A;  4LD5 A;  4A0X A;  1FBQ A;  1Y0U A;  2DFI A;  3SHF A;  1U5T B;  2FML A;  1Z05 A;  2DW4 A;  3FXU A;  4NB5 A;  5LRR A;  2GXG A;  1MGT A;  1U2W A;  4ZYD A;  1P4A A;  3CUO A;  3F8M A;  2JTV A;  3D0S A;  1R1T A;  4RB2 C;  5K5O A;  2CGP A;  3O2P E;  3J81 Z;  4HZF A;  4AWX B;  5H6Q A;  2VT3 A;  1CF7 A;  1W7P D;  2OZ6 A;  3WTT C;  2P7C B;  4I02 A;  4KIB A;  4YIF A;  1LVA A;  2XAQ A;  4IVN A;  2M45 A;  5AIP A;  2E7X A;  1IRF A;  3ELK A;  1O7L A;  4RS8 A;  4LB6 B;  1OYI A;  1IUY A;  1FSE A;  1QQI A;  4HLY A;  3LWF A;  2HWV A;  1F9N A;  1GXQ A;  2VOO A;  1J2X A;  2OQR A;  1HW1 A;  3FXQ A;  3I71 A;  3T8T A;  3I4P A;  5K1Y A;  1Z91 A;  4GGG A;  3C3W A;  2QBY A;  2ZKZ A;  4AIJ A;  3HRU A;  4HOB A;  3M8E A;  3J80 Z;  2F5F A;  4G7O F;  2WTE A;  1DPU A;  3KE2 A;  3JTH A;  4ESB A;  3MEX A;  2NRA C;  1GVJ A;  4HLX A;  3JW4 A;  4A0Y A;  3GO5 A;  4UXN A;  3DXJ F;  1ZHF A;  2JPC A;  1XGO A;  2F5E A;  2M30 A;  2A61 A;  5FD6 A;  4R8H A;  4HV5 A;  2DLL A;  1U6G A;  1XMA A;  3ZQ7 A;  1K79 A;  4LG0 A;  1IXR C;  2IP2 A;  3KP2 A;  3JTG A;  2Y48 A;  5IT3 A;  2DU9 A;  2PMH A;  4YG2 F;  4WXC A;  1I5Z A;  3E6D A;  3TQN A;  3SFZ A;  4KN4 X;  3WTU C;  4KIC A;  2G9W A;  2O0Y A;  2RV8 A;  3MFK A;  3V8J A;  2OU2 A;  4HX4 A;  3U1D A;  2XVC A;  3JAM Z;  1IZ1 A;  2UXX A;  1JHF A;  3EQL F;  3G3Z A;  2QZ8 A;  4OMZ A;  5JHU A;  2VE9 A;  3T5X A;  1WRJ A;  1AWC A;  2FNA A;  2YPR A;  3WU1 B;  4PZJ A;  3ULQ B;  3F6O A;  4PGG A;  3RPU A;  1DP7 P;  2PJP A;  5HS9 A;  2W25 A;  4L18 B;  2QEN A;  3I64 A;  4U7D A;  3GXO A;  2VOD A;  4OIR F;  2D2W A;  1HKQ A;  3P9K A;  4EM0 B;  1WQ2 A;  1FZP B;  5BOX A;  1UHM A;  4O6J A;  4GXO A;  2E1N A;  2QYO A;  4EM2 A;  1C0W A;  2GA1 A;  3TOA A;  5HLH A;  2HYF A;  3E6M A;  4U0Y A;  3R6S A;  4GYI A;  5CJ9 A;  2VBZ A;  5H20 A;  3WU0 A;  5D4S A;  3GVA A;  2J5P A;  2CO5 A;  4Q5S F;  3JAM K;  2ZME B;  2K27 A;  2CYY A;  5AIQ A;  2R7D A;  2XAF A;  2YSR A;  2DPU A;  1S3J A;  1OYY A;  4ETS A;  1L3L A;  3DPT A;  3R60 A;  2PG4 A;  3T1B A;  4Q48 A;  5K5Q A;  5FFZ A;  3OV8 A;  3RKW A;  5DDG A;  1IAW A;  4LK0 F;  2XV4 S;  1SFX A;  2L4M A;  3NRV A;  2YR2 A;  2O8X A;  2EWN A;  3KFW X;  2DQR A;  3TDZ C;  1IRG A;  1D3Y A;  1R22 A;  3TDU C;  3F6V A;  1TW2 A;  1GHC A;  1MKM A;  5TRD A;  2DAO A;  1U5T C;  1HW2 A;  2QUF A;  1J75 A;  3ZPL A;  5KVR A;  4DQ2 A;  2X4H A;  3T8R A;  3LAJ A;  4TV7 A;  4HDU A;  3IWF A;  3C18 A;  2MA3 A;  1FLI A;  1YS6 A;  5CVJ A;  2EJR A;  4Z2Y A;  3K1P A;  3G73 A;  1G3S A;  2Z99 A;  3GLX A;  3V7S A;  1ULY A;  4P96 A;  2CSO A;  1XSV A;  4EJW A;  3HYI A;  4CHU A;  5FFX A;  2GQQ A;  4I09 A;  4EGZ A;  3K1N A;  3M8F A;  3CO6 C;  1XDS A;  3ZMZ A;  3SQN A;  2HTJ A;  2ADU A;  5EEH A;  2PQ8 A;  2IPQ X;  1RIO H;  1ZRF A;  1YYV A;  3RYR A;  5D5W B;  1FSH A;  1REP C;  4IHS A;  2JT1 A;  2EV0 A;  2PI0 A;  3DV8 A;  1PP7 U;  3R0A A;  1W7P B;  1WWX A;  3IC7 A;  1U5T A;  4MQ9 F;  5D5U B;  5HDN A;  4L9J A;  2EA4 A;  3F8N A;  5CYV A;  1KQ8 A;  1JHH A;  3NEU A;  1L0O C;  4RAZ A;  1RNL A;  1Z7U A;  3ZMU A;  1BI1 A;  4G9Y A;  1FP1 D;  1LEB A;  1VTN C;  4JBA A;  1LEA A;  1PUE E;  1O57 A;  4G8X A;  2DBB A;  1XCV A;  2PN6 A;  4RB3 C;  1T39 A;  2Y75 A;  2WWY A;  3F8B A;  4KFC A;  4UV9 A;  1H9T A;  2RKH A;  3RI4 A;  4EJU A;  2V6C A;  1JE8 A;  4KMF A;  3GW2 A;  2DTR A;  2VOP A;  3N97 A;  3V4G A;  1ZGA A;  3FF5 A;  5TJJ A;  2GAU A;  3O6B B;  3WG9 A;  2STW A;  4CZZ A;  2MLG A;  1P92 A;  2OBP A;  5DEQ A;  1LJ9 A;  1SFE A;  4HF0 A;  3RKX A;  3CJN A;  4KIF A;  2RN7 A;  1UHW A;  5FLX K;  2GA2 A;  4OIN F;  3HHG A;  4WX9 A;  2XIG A;  2KIM A;  1TQP A;  3VOE A;  5D8K B;  5ILV A;  2IJL A;  4L0Y B;  3SXY A;  1I1S A;  1J5Y A;  5LBQ A;  1IN4 A;  1TNS A;  2H94 A;  3RIR A;  5JVT A;  1DPR A;  2HKO A;  3LA7 A;  4WXD A;  3QU6 A;  5E1Z B;  2ZBK A;  4KUM A;  2OD5 A;  1R00 A;  4N9I A;  3ERE D;  4M9S A;  2A68 F;  1F1Z A;  1V4R A;  2D1H A;  1HBX G;  2ZXJ A;  2XUB A;  3LA2 A;  4Q47 A;  2QVO A;  3BY6 A;  3RTR A;  4YFX F;  3HUG A;  3SZT A;  2EV6 A;  3I0T A;  1ZYR F;  3P7N A;  1T6S A;  2ACJ A;  4H0E A;  2YX7 A;  4FX4 A;  2VC0 A;  3K0L A;  3LQR A;  5LHG A;  2XAG A;  2P5V A;  2H27 A;  2O03 A;  4LLG F;  4RGU A;  4UUV A;  2M8E A;  4HF2 A;  2P7V B;  4L5I A;  3GFI A;  1B9N A;  4NQW A;  1OR7 A;  5JR3 A;  2O6G E;  3V7R A;  4FT8 A;  4M73 A;  1S7O A;  5J6X A;  2MH9 A;  5FGM A;  2PEX A;  3HIF A;  3KP3 A;  5HLG A;  1LB2 A;  3GFM A;  4A5M A;  3R4K A;  4UNO A;  3IL2 A;  5FO5 A;  1MJB A;  4AD9 A;  1TBX A;  4CO8 A;  1YW7 A;  1FYK A;  1Z6T A;  4O5V A;  3EDP A;  3VOD A;  3F8F A;  1ZH5 A;  1T98 A;  1QO0 D;  3FM5 A;  2ZO4 A;  3LQQ A;  1G3W A;  4FX0 A;  2Z3Y A;  3WTX C;  4HDV A;  1K6O A;  2VBX A;  2LSO A;  2FBI A;  5LEJ A;  2FBH A;  2YX4 A;  3TKY A;  1ZRE A;  5E20 A;  1ZLK A;  4A12 A;  1RUO A;  2GZW A;  2Q8K A;  2XAH A;  5JFR A;  4E70 A;  4GYG A;  4BQA A;  3K1M A;  4HYE A;  2V1X A;  3FWE A;  5DCM B;  2O3F A;  1ZRD A;  1DUX C;  4KT5 C;  3QAH A;  2ZME A;  4G6Q A;  3VFZ A;  1OYW A;  1BJA A;  4KN7 X;  5L3C A;  4QLC U;  1LDD A;  4A6D A;  3S2W A;  1TLH B;  2YU3 A;  2EFQ A;  1FOK A;  1WKM A;  3C7J A;  4JK1 X;  3Q9S A;  2BYV E;  1SAX A;  2BEO A;  3IRR A;  2L54 A;  2FMY A;  5HDK A;  4ESF A;  3Q9V A;  4HW0 A;  4RB1 A;  4U88 A;  1HQC A;  1BIA A;  4M71 A;  2F2E A;  2ESN A;  3QPT A;  1O7F A;  1HST A;  2XRN A;  4ZYG A;  1OKR A;  4L5J A;  2DK8 A;  4MQV A;  2EFW A;  3GYH X;  3BRO A;  3R0J A;  2O61 A;  1S6L A;  2W85 A;  3C1D A;  5DV5 A;  3CO7 C;  1BI2 A;  2BBY A;  3PQJ A;  5EEG A;  4ASN A;  4U0W A;  3FX3 A;  2CW0 F;  3CUQ B;  3GZ5 A;  2A07 F;  5H6R A;  4MEX F;  3FM3 A;  2M5W A;  4HAM A;  2GWR A;  4P5O A;  3L00 A;  4HBL A;  3I53 A;  5D5V B;  2DI3 A;  4RB0 A;  2FOK A;  4WF2 A;  5J8F A;  3KP5 A;  4EVI A;  2HOE A;  3F8C A;  3HHH A;  2IVM A;  4EM1 A;  3TO7 A;  4MGR A;  2ZCW A;  2HQR A;  2IA1 A;  3V8K A;  4IXA A;  3HTU A;  5D6E A;  3RJP A;  3FMQ A;  1R58 A;  1J59 A;  1TNT A;  5FB2 A;  5ILS A;  2UXN A;  1R1U A;  4U0V A;  3TGN A;  1W7P A;  2VC1 A;  1KYW A;  5BPD A;  1SD4 A;  5ED4 A;  4LLN A;  3TO6 A;  3B02 A;  3K2Z A;  2LKP A;  1SD7 A;  3E3V A;  3FHZ A;  3WE2 A;  2XKP A;  2V1D A;  4IF4 A;  2E1C A;  1S8N A;  2ZJ2 A;  1MD0 A;  3MWM A;  1XD7 A;  3P9C A;  5LGN A;  5F6F A;  2VBY A;  2NS0 A;  1RUN A;  5D8L B;  2VBW A;  3PFI A;  1I6X A;  3WTS C;  1BBY A;  4OIP F;  3MQ0 A;  5E17 F;  3BP8 A;  3GEZ A;  2ETH A;  1YW8 A;  1P4W A;  1FYM A;  1IW7 F;  1BC8 C;  5IT9 Z;  4BXU A;  3ZP5 A;  2XKO A;  4CGZ A;  4PGH A;  2NAZ A;  1BIB A;  5L3E A;  1XDU A;  1QNT A;  1JGS A;  2H6C A;  1ZAR A;  3M9A A;  1KU7 A;  3HSF A;  1T2K A;  4HF1 A;  3WGI A;  3EYI A;  2XAS A;  4I2O A;  2WV0 A;  3EET A;  3BWG A;  1SFU A;  2JZY A;  4HX7 A;  2XGX A;  4CIC A;  1MJA A;  3KZY A;  3I5U A;  2ZFW A;  3FMR A;  5HLI A;  1FYL A;  3CLO A;  1U3E M;  3I59 B;  3F23 A;  3KLO A;  4IRH A;  2QM3 A;  1RZ4 A;  1G4D A;  1QZZ A;  4I0B A;  3WGG A;  4AIH A;  2FSW A;  2VE8 A;  5DD4 A;  4MEY F;  3HSE A;  3OOP A;  2RC4 A;  1J0R A;  3KP6 A;  2Q0O A;  1XGS A;  2DK5 A;  1B59 A;  2FU4 A;  1T38 A;  3WTV C;  3RPQ A;  1EH6 A;  2J5O A;  3HRM A;  3ROU A;  4B8X A;  1O3T A;  3BPX A;  2HS5 A;  2MD5 A;  5IT9 K;  5ERI A;  3F3X A;  1YW9 A;  1XGM A;  1HKT A;  3ZMS A;  2MH2 A;  2VON A;  3N4M A;  3E5X A;  3I54 A;  2JRT A;  1LDK B;  2EB7 A;  2OA4 A;  3BJ6 A;  1ZG3 A;  1UST A;  3MAJ A;  1IN7 A;  2L3D A;  2LF8 A;  3ZMD A;  1IF1 A;  4M9X A;  1UCR A;  2ESH A;  4UVB A;  1F5T A;  3ZMV A;  5L3D A;  5LRS A;  4MHG A;  1SMT A;  4EMS A;  1R36 A;  4M6Y A;  1O3R A;  1S7A A;  3B73 A;  5FLX Z;  5HS8 A;  3LA3 A;  3T0Y A;  4BAY A;  5E1X A;  2UWM A;  1FX7 A;  4PDK A;  1TTY A;  3H3Z A;  3M1E A;  1G3T A;  4GO1 A;  1FP2 A;  1IXS B;  2K4B A;  2QQ9 A;  1TQM A;  2CQK A;  4PCQ A;  3IKV A;  3WTZ A;  2DT5 A;  1YO5 C;  1T0F A;  5E8I A;  4QWQ A;  1CGP A;  3E97 A;  4LK1 F;  3V7C A;  4S04 A;  4ZZL A;  2DPD A;  5L3F A;  5L3G A;  4FHT A;  4P55 A;  3FZV A;  5ICG A;  3MZH A;  5AON A;  1FBU A;  3CUQ C;  3KEQ A;  3I58 A;  4Y13 A;  1GXP A;  3MCZ A;  2R3S A;  5DCM A;  3ABT A;  5BPI A;  3JSP A;  2EA2 A;  2GIV A;  5HS7 A;  3E5Q A;  3GFJ A;  3E6C C;  4XLN F;  4LLL A;  5LGT A;  3F21 A;  1XN7 A;  1FPQ A;  3U2R A;  4OU0 A;  5J8C A;  1KQ0 A;  1IXC A;  4G7Z F;  5E1W A;  3SZP A;  5CVR A;  5CVV A;  1FY7 A;  2MBF A;  3TOB A;  2KRF A;  4IHT A;  4GCV A;  1R5G A;  3REO A;  5K5R A;  2P5L C;  3DKW A;  3BJO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...