3QU6A

Crystal structure of irf-3 dbd free form
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
106
structure length
98
Chain Sequence
KPRILPWLVSQLDLGQLEGVAWVNKSRTRFRIPWKHEDFGIFQAWAEATGAYVPGRDKPDLPTWKRNFRSAMNRKEGLRLAEDRSKDPHDPHKIYEFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IRF3 protein
publication title Structures of apo IRF-3 and IRF-7 DNA binding domains: effect of loop L1 on DNA binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 26
structure length 98
sequence length 106
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2011-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00605 IRF Interferon regulatory factor transcription factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3qu6A01
2FNPA 1XSVA 5HLHA 3T0YA 1SMYF 1K79A 3DEUA 5DCMB 3ZP5A 2Q0OA 5DV5A 3BOQA 4A0ZA 1CF7A 3O6BB 4BNCA 4FX0A 1XDSA 4EM2A 2DPUA 4OIQF 4IHSA 3C3WA 4M72A 1HKSA 5F64A 1WRJA 1R36A 3FM5A 2WWYA 5E1XA 2DLLA 4M71A 1YW7A 4KMFA 3MCZA 4HF1A 2RNJA 2HOEA 2MBFA 3FXUA 2A07F 3RIRA 5A2QK 5D5VB 2Q2EA 3WTXC 5KVRA 4PZJA 1XGMA 1L3LA 2QLZA 3SHFA 1F1ZA 5HDGA 2RKHA 2KIFA 2L02A 3LA7A 4A6EA 5JI6A 1FP1D 1ON1A 4LK1F 3K1MA 1E2XA 4L0YB 1IN8A 4FT8A 2V1XA 1HBXG 1BI1A 3HUGA 4A5MA 2MC3A 3IL2A 2ZXJA 3V7RA 3VOEA 1ZYRF 1R23A 1O3RA 4EMSA 3WE2A 1ULYA 2HKOA 2QQBA 1B4AA 1IF1A 3DP7A 1HW1A 4HOBA 2RVCA 1J59A 5TRDA 2FQ3A 2HQNA 3HOSA 4B8XA 1YW8A 1FWZA 4L9NA 3T1BA 3F8FA 4LK0F 3E97A 3WTVC 5K5OA 2GXGA 2P8TA 2M1BA 2NNYA 1SFUA 1ZGJA 1YO5C 5D5UB 1O57A 4Q5SF 2A6EF 4G6DA 2CSOA 1R5GA 4ENNA 3HRUA 4UNOA 4MEYF 2HDCA 4BAYA 1FSEA 1ZG5A 2A61A 2GAUA 1ZRCA 4KUMA 5FFXA 3ABTA 1YS7A 4U0WA 2Z3YA 1FLIA 2ZMEB 4I0AA 1G4DA 4HF0A 4XSXF 4Z2YA 1ODDA 2YX7A 2D2WA 1KU9A 3K2ZA 3KE2A 3IC7A 1T0FA 1K78A 2JRTA 5DDGA 5J8CA 4CYDA 3DXJF 5IT3A 5ILUA 4HV6A 2EFNA 3F8CA 3W6KB 1O7LA 3EUHA 1B1BA 3TKYA 2G9WA 1FX7A 1ZRDA 2ESHA 2XAFA 5CVVA 3LAPA 3BJ6A 1QZZA 5FD6A 3WTYC 3LWFA 3V8LA 2Z9OA 4RS8A 2HZTA 2FXAA 1FNNA 2HTJA 1QQIA 1MZBA 5LBQA 3C1DA 3I59A 2ADUA 1T39A 1Z1DA 2WTEA 3MWMA 4R8HA 5LGTA 3ROUA 1UHMA 1X3UA 2Y0MA 2JSCA 3VEPA 1MDMB 1Y0UA 2WC2A 3EETA 5LHGA 4MTEA 1IW7F 3EQLF 4I7HA 2FMYA 4ZYEA 3F6OA 2OAZA 1P4XA 1D5VA 2DK8A 3FMQA 1AWCA 1DPRA 1YQAA 2L01A 5FO5A 3P7NA 4EM0B 3RKXA 4MQ9F 2BE5F 5F6FA 2CWEA 4L5IA 1XCVA 3H92A 5BMZA 2F5DA 1IXSB 1WKMA 2NAZA 3ZMDA 2Z33A 2H6CA 2QENA 3WGGA 4YG2F 3L00A 5A2QZ 2H09A 4MEXF 1O3QA 1IUYA 1SMTA 3IWFA 3ZN1A 3GO5A 1XMAA 3SXYA 3JAMK 5HS7A 4ENMA 1BC7C 1ZLJA 1FZPB 1TTYA 2ZNYA 2HGCA 1TQIA 1G3TA 3D0SA 2M30A 2A68F 3WTWC 4IF4A 4BXUA 3G73A 3L7WA 2MH2A 2QWWA 2A6HF 3DKWA 3BWGA 1LDDA 2W57A 1LDKB 6PAXA 3ZMTA 3F22A 5LHIA 1V4RA 2DT5A 1XD7A 1YFHA 4HX7A 1U2WA 2O8XA 1YYVA 4LMYA 1W5TA 1P6RA 4U7DA 4EJWA 2PQ8A 5BPIA 4OINF 4AD9A 3GVAA 2DPDA 3ZPLA 3QU6A 2RQPA 5ICFA 1FC3A 2JTVA 1U78A 4RAYA 5AIPA 3E5QA 3PQKA 2IA0A 1GXPA 4I2OA 4OOIA 5H20A 2K86A 1S8NA 3R0JA 5E8GA 2V6CA 1ZH5A 4TV7A 1I1GA 2VE8A 4HQMA 1R00A 1S3JA 4L5JA 5HS8A 1O3SA 2HFHA 5D4RA 1P4AA 4BQAA 2HWVA 2BEOA 2XAJA 5H6QA 1JHFA 1ON2A 3BPVA 5EEGA 3GEZA 3K1NA 2MLGA 1OMIA 1W7PB 2PI0A 3CUQC 1LEAA 4XRFA 5LRSA 1O3TA 1F4KA 3WU1B 3MQ0A 1Z91A 4M9ZA 2HQRA 4U7BA 2AXLA 2ESNA 4E70A 4G9YA 1BIBA 2E7WA 1TNTA 3G3ZA 2CYYA 4P55A 1BIAA 4ESFA 1TQMA 3DQVC 4WK8F 4XSZF 2G7UA 2VXZA 3ZMSA 2Q8KA 3R6SA 3M7GA 2A5YB 2RDPA 4WX9A 4MHGA 1Z6TA 3JSPA 1FSHA 2PFBA 1F9NA 3ZMZA 3FF5A 2RN7A 3F8NA 2FMLA 3HRMA 4HLYA 3KETA 3GX4X 5E1ZB 2V9VA 4UVAA 4P96A 4LLGF 4QLCU 5BQTA 5E20A 4AIHA 2ISYA 4M74A 1IZ1A 4LFUA 3KFWX 3I5UA 2KIMA 4A2UA 3RYPA 3I4PA 2GXBA 2P6TA 1HQCA 2PJPA 5KK1A 2ZMEA 1SD6A 1WQ2A 2EFOA 1JE8A 2DW4A 3ULQB 3WTSC 2QVOA 2VT2A 3P9IA 4ON0A 2L54A 2IVMA 1G3YA 5FB2A 2IJLA 2B0LA 4KIGA 1EH8A 1J5YA 3JAMZ 1RZ4A 4IRHA 3QPTA 3FHZA 4DNCA 1BJAA 2EFWA 1ZARA 3U2RA 4Y17A 3TQNA 4YFNF 2VODA 3KLOA 1Z9CA 4WXCA 4GCVA 1HXDA 2OD5A 1IXRC 3Q9SA 3FZVA 4HDUA 1IN7A 3CUQB 1P92A 1QZYA 1S29A 3LA3A 2HR3A 3ZMVA 4RB0A 4LJZF 3BPXA 2XRNA 3KP2A 3WODF 3N4MA 4CZZA 2YX4A 4ESBA 1T98A 4OIOF 2L3DA 4A0XA 5EEHA 1KU7A 4KIFA 5HLIA 2XAHA 3CLOA 2CFXA 5JR3A 4LB5A 2GA1A 4LG0A 2VONA 4Y15A 5LLQA 4A12A 2EJRA 5F1RA 2OQRA 2LKPA 3HHGA 1IN5A 4L18B 3GFIA 2K4BA 1OR7A 4EJUA 4WF2A 2RGVA 4F7ZA 1ZHFA 3RKWA 3F23A 3FWEA 2GZWA 3E6MA 1HSJA 2FA5A 4EJTA 1HKTA 4A0YA 2XAQA 1K7AA 1D3YA 4RB1A 4K2EA 1ZGAA 3GFLA 1MKMA 4G7OF 1XDUA 3WU0A 3FX3A 4P9FA 1FBQA 2OA4A 4YFXF 4RB3C 3I54A 4WXHA 3GFMA 2CO5A 3RI4A 2AS5F 2UWMA 5CVJA 5IT9K 3KEOA 4JQFA 1NHAA 2IW5A 3CDHA 4G7HF 1ZN2A 2OBPA 1STZA 1IRGA 3R61A 1XSDA 4N0BA 3BDDA 5DCFA 4Q4ZF 3H3UA 3I71A 2WV0A 1WSUA 2YPRA 2UZKA 4D0PA 5LHHA 2ZFWA 3QRFF 1JGSA 2DTRA 1BC8C 2P7CB 3HHHA 1BM9A 3F3XA 2IA2A 4KNYA 1KA8A 3IKTA 5DYMA 2DAOA 2PEXA 2F2EA 2W84A 2QBYB 2YR2A 4OIRF 2E1NA 3PQJA 4HX4A 1B59A 4CDGA 1SAXA 4EGYA 3GUDA 1G3SA 1V3FA 2EA4A 4NQWA 5D6EA 4GYGA 3QOPA 3Q5FA 1BI2A 3O3KA 4GYIA 2LDUA 1FT9A 5TJJA 1E17A 3HRTA 3FM3A 3HOTA 5FLXK 4UV9A 2HTSA 1QGPA 3CJNA 3MZYA 2JPCA 2BV6A 2DQRA 1HW2A 1FYLA 4M9SA 2J5OA 4ESJA 1I27A 2VC1A 5E17F 2JT1A 2Z5UA 4I02A 1ZG1A 3CTAA 3K69A 4BHBA 4ZH4F 4LB6B 3ERED 5JHUA 1TQPA 3QPHA 3WG9A 3KP4A 3NRVA 3U9GA 2V79A 2HYFA 4XLNF 3J80K 3TO6A 1CF7B 1K6OA 3TOBA 3KP5A 3ML6A 2O6GE 3RJPA 1W4MA 2IP2A 3ZN0A 2PLYA 4WXDA 1USSA 3E5XA 2YSRA 2XKPA 3NEUA 2QQAA 1SFEA 2FF4A 4ZZDA 3M1EA 1D8KA 1SD4A 1FBSA 3E6BA 5ICGA 2QM3A 3VODA 2IRFG 4YFKF 2D45A 1FPQA 1MJBA 2MLKA 2R3SA 4BYYA 4ASNA 3P9CA 1Z6RA 4ZYGA 3TO9A 3KCCA 1IRFA 1XB4A 5BS6A 5HDNA 3ZMUA 1U5TA 2XASA 4IHTA 3F72A 4O6JA 3LA2A 2RV8A 5HVQC 4M6YA 2FU4A 1SD5A 3CUQA 5CVUA 3HSFA 5CVRA 4ENKA 1QBJA 4PGHA 2JPBA 3R0AA 4L9TA 4M73A 3RYRA 4ZYHA 4IPAA 2M8EA 2K27A 2VN2A 2LF8A 3V8KA 5CLSA 1BOAA 3IWZA 2F5EA 2QZ8A 1KGSA 1B9MA 5DCMA 1YS6A 3GFJA 2O3FA 4M9XA 4HDVA 3SZTA 3RKYA 4OIPF 2LF7A 5L3BA 4LD5A 2P4WA 1BN5A 1GVJA 5FGMA 4KICA 2W24A 2UXNA 2CG4A 1USTA 2ZNZA 1S7AA 1C0WA 2GA2A 4HX8A 1MD0A 3MFKA 5JFRA 3HIFA 1LDJA 4R1HA 4I0BA 1KQ0A 2Y48A 4AWXB 2OQGA 4HYEA 1YIOA 4Q47A 4WCGA 1KU2A 5D5WB 4HV5A 1U3EM 5L3GA 3C18A 3Q9VA 3RPQA 4ENJA 4JBAA 3L9FA 1LVAA 3WTZA 3FMSA 2OZ6A 2ISZA 4XLPF 1JHHA 1REPC 3I59B 3H3ZA 2IA1A 3KLNA 3EDPA 4EJVA 4DQ2A 3MEXA 2F5FA 4NHJA 2O03A 3T5XA 1LJ9A 2FNAA 3F8MA 4EVIA 4CHUA 3GZ6A 5DD8A 3GYHX 4R79A 2J5PA 2MH9A 4I01A 3I0TA 4UHTA 5J8FA 3E6DA 3LFKA 3V4GA 1RUOA 2NNNA 1R22A 3CUOA 3ISPA 5ERIA 2PMHA 2VT3A 5D8KB 3J80Z 1EH7A 1RIOH 3T8RA 4BH9A 2XUBA 4M6XA 2FRHA 5HOOA 4RGRA 2NYXA 4CO8A 1UFMA 4UVBA 2FBIA 3VFZA 1PP8F 2L4AA 1BBYA 2E7XA 2LNBA 3WE3A 2QQ9A 5BOXA 1AOYA 2H94A 1F5TA 2LSOA 1EH6A 4IRGA 3KEQA 3E6CC 5E1WA 1KQ9A 2FE3A 3BROA 1HKQA 4FHTA 1U8RA 4HZFA 4O3MA 3C7JA 1Z7UA 2DU9A 5L3CA 3JW4A 3DV8A 3LSTA 5K5QA 1YLFA 3ECHA 3P9KA 4G7ZF 1LB2A 1G3WA 3REOA 3HSRA 4LGWA 2STTA 1PP7U 4U88A 4BHCA 4KYWA 1MDMA 2XIGA 2XAGA 2L4MA 4GGGA 2D1HA 1DDNA 3B02A 2P5KA 2DBBA 4PCQA 2ZO4A 4MGRA 5DEQA 4N9IA 1FYMA 1FBUA 4JK1X 4KMUX 4HF2A 2O61A 2COMA 4CICA 2TDXA 5K5RA 3WGHA 2IPQX 2QYOA 2EB7A 3F8BA 1J2XA 1I6XA 3LQQA 3GZ5A 2XROA 1YW9A 3I64A 2H27A 4HW0A 1RI7A 3E3VA 2EV6A 1XN7A 2BYVE 4EV0A 1HW5A 3COAC 5L3EA 2W85A 2VBXA 2P5LC 2ELHA 3TDZC 2O0YA 4YIIA 3VB2A 2R7DA 2CGPA 4ZZLA 4EGZA 1YG2A 2STWA 1B9NA 5D4SA 4IJAA 5D8LB 1RUNA 4FX4A 1BI0A 3OOPA 3IHUA 2D1VA 2CQKA 1HSTA 3BY6A 2M87A 4LLLA 3BJAA 2YU3A 4CGZA 3MZHA 5HS9A 4RAZA 3DF8A 2KRFA 4S05A 5DUIA 1G6NA 2Z99A 1OPCA 2DK5A 4N9HA 3IRRA 3KZYA 3IKVA 3E5UA 3KP6A 3ELKA 1D8JA 3ECOA 3M8FA 1H9TA 2DFIA 1ONVA 1P4WA 1QO0D 5BPDA 1J75A 1VTNC 1EV7A 1OYIA 2R7FA 1R1TA 4S04A 2EWNA 3HSEA 1ZRFA 2EFPA 3GW2A 3JSOA 5E18F 5AIQA 3AAFA 1H9GA 5FFZA 1LEBA 1FYKA 3CO7C 1UB9A 1LQ1A 4ZYDA 1R58A 2X4HA 4IXAA 3S2WA 2BGCA 2Y75A 4XBFA 3SQNA 5DD4A 2CW0F 4RGXA 4IVNA 4EJOA 4PGGA 1XGNA 5D6FA 3KZZA 4KT5C 4P5OA 1PUEE 1W7PA 1XGOA 2PBIA 3DPLC 4LLNA 5ICCA 4HLXA 3GWZA 1Z05A 5ICEA 2G7HA 5E8IA 2MA3A 3WTUC 4YIFA 3U1DA 1BI3A 3FXQA 2V1DA 4UV8A 2K7LA 2VBYA 1QNTA 2OZUA 2ZBKA 2HEOA 2A3SA 1I1SA 1S6LA 2FBKA 4L0ZB 2BBYA 3GF2A 4MTDA 2GQQA 3BZ6A 4GO1A 1T6SA 3M8EA 2HKXA 2ZCWA 1U6GA 3TOAA 1IN4A 1R1VA 1L0OC 1OKRA 1XCBA 2XGXA 4B09A 2EA2A 3SZPA 4CXFA 5LGNA 4UUVA 4I09A 3EYYA 2EV0A 3RTRA 3TO7A 3WTTC 1PDNC 5FD5A 1IAWA 1LNWA 2PG4A 1KQ8A 1T2KA 4G94A 5AONA 4LG0B 2VBWA 2XKOA 3BJOA 1J9IA 4MNUA 2VOPA 3N97A 5CJ9A 5HLGA 4I98B 4OU0A 2M5WA 3DPTA 5DUKA 4EM1A 1GXQA 3NQOA 1R5HA 1KYZA 4AVPA 1JXSA 4MQVA 2FOKA 2V1UA 2K4JA 1O7FA 2P7VB 3HTUA 4UXNA 5JVTA 2FSWA 3SFZA 4G8XA 3J81K 2EK5A 3TGNA 2HS5A 1UCRA 5L3DA 3K9TA 1XGSA 4KA4A 5CVIA 2XV4S 1OYWA 5H6RA 3F21A 1J0RA 3K1PA 5J6XA 1TW2A 1ZLKA 2C6YA 5IT9Z 1H0MA 3J7AO 1WWXA 3WGIA 3F6VA 5CYVA 3R60A 4P9UA 1W5SA 1TBXA 2DQLA 4OMZA 5L3FA 1RNLA 3L09A 2XHKA 1YTYA 4PDKA 2VBZA 4GXOA 5D5XB 4KN7X 4KDPA 1A04A 1T38A 5ILVA 5ED4A 2ZKZA 2F5CA 4U0VA 2MD5A 3QAHA 4L9JA 5LEKA 2X0LA 1OYYA 2GIVA 1R1UA 3CO6C 5HDKA 2OU2A 3FXRA 3ABUA 2M45A 3V7SA 1FP2A 1K78B 1IN6A 2KJCA 3HTSB 2FBHA 2P5VA 3L2CA 2VOOA 3KP7A 2XVCA 2PN6A 3KP3A 4H0EA 1ZREA 2PMUA 3OV8A 4IRIA 3W6JB 1U5TC 3GLXA 4KFCA 3V8JA 4A6DA 2KJBA 3RPUA 2K02A 3JTGA 4HA8A 4RB2C 4G6QA 5FLXZ 4AIJA 5LRRA 2NRAC 4L9VA 1IXCA 3QU3A 1KU3A 2H6BA 4KN4X 2E1CA 2RC4A 4QWQA 4WWCA 1S7OA 1ZG3A 2P6SA 3QP6A 4Y13A 2DI3A 1MJAA 3K0LA 3O2PE 2ACJA 1ZAOA 2UXXA 1TLHB 2KIUA 3QP5A 4HQEA 1FOKA 3HYIA 2KKOA 1J7KA 1P2FA 4EQQA 1DPUA 1B6AA 1DP7P 2EV5A 4U0YA 3RDIA 2DO7A 2FEZA 1XSXA 3B73A 2QUFA 4HAMA 4NB5A 1MGTA 5LGUA 3R4KA 4KIBA 4OMYA 1MJ9A 4HBLA 4Q48A 4A5NA 1DUXC 1TNSA 2EFQA 2ZJ2A 3GXOA 3D5LA 1XMKA 1SFXA 2HYGD 4UVCA 3I53A 5K1YA 1GHCA 4ETSA 1TW3A 3BP8A 3EYIA 1WI9A 4O5VA 4RGUA 3JTHA 4BHPA 2QBYA 1W7PD 3FMRA 2VC0A 3J81Z 3MAJA 2VE9A 4RGSA 1FY7A 3TDUC 1KYWA 3I58A 1R7JA 1SD7A 3M9AA 1QPMA 2ETHA 1Q1HA 2A69F 3HRSA 4AIKA 1CGPA 3PFIA 1I5ZA 2GWRA 2W25A 1UHWA 5LEJA 3T8TA 2NS0A 1U5TB 3IRQA 3LQRA 3ZQ7A 2IT0A 3V7CA 5ILSA 3DFGA 3LAJA 2JZYA
chains in the Genus database with same CATH superfamily
2FNPA 1XSVA 4Y4RA 5HLHA 4IHXA 2WB1N 3T0YA 2CV2A 1U9OA 3OYHA 2ZMEC 4HSTA 2VB6A 1ZR4A 1SMYF 2BZTA 2BW3B 3K4NA 1K79A 2JWTA 3DEUA 2CUJA 1HDDC 5DCMB 3PO2J 2E1MC 2ZFUA 3JRGA 3ZP5A 2Q0OA 5DV5A 3BOQA 4A0ZA 5IP9J 3CCJI 1CF7A 3O6BB 4CCMA 4BNCA 4FX0A 1XDSA 3DU5A 2L7ZA 3FK6A 3QPSA 3ZQQA 4BACA 4EM2A 4FE4A 5TGTA 2DPUA 4IHSA 3C3WA 4OIQF 4M72A 1HKSA 4HEA2 4DYRA 1SVLA 1WRJA 5F64A 4MIMA 1NTCA 2WADA 1FOWA 1R36A 3FM5A 2WWYA 2DMPA 5E1XA 2DLLA 4M71A 3HOYJ 1YW7A 2M2EA 4KMFA 3G1OA 3MCZA 2BY3A 1NG7A 2M4GA 4HF1A 1WJAA 2RNJA 1VQ8I 1MNEA 2HOEA 2V4JC 2MBFA 3FXUA 2A07F 3RIRA 5A2QK 1W1WE 4XR6A 5D5VB 3Q0VA 2Q2EA 5KVRA 3WTXC 4PZJA 1DU0A 5GTHC 1XGMA 1L3LA 2QLZA 3SHFA 3GBGA 4E7SA 1R4MB 1F1ZA 5HDGA 2RKHA 2KIFA 2L02A 1XG1A 2JA6J 3LA7A 3CQZJ 4A6EA 3BR5A 3RCOA 5JI6A 1FP1D 1ON1A 4LK1F 3K1MA 1E2XA 4L0YB 1IN8A 4JP0A 4FT8A 3H5AA 4CCKA 2V1XA 3PSIA 1HBXG 3ZXSA 2LBFB 1BI1A 3HUGA 3TMOA 1IGNA 1E3HA 4A5MA 2MC3A 3IL2A 4RDUA 1S7EA 3DEEA 4QPOA 2KZGA 2ZXJA 3V7RA 3VOEA 4CZCA 1MW7A 3HB9A 2V9KA 4AVZA 1ZYRF 1R23A 1O3RA 1W36D 4EMSA 5FKLA 3WE2A 1ULYA 2HKOA 2MSYA 4HRIA 2QQBA 1B4AA 1IF1A 5FLVA 3DP7A 1HW1A 4RLQA 4HOBA 2RVCA 4ZC3A 4HPQA 1J59A 3HKZN 5TRDA 2EILH 3FDYA 2FQ3A 2DMQA 1HDPA 2Y0SN 3ZQCA 5FKKA 2HOTA 5CPRB 2HQNA 3HOSA 2X6OA 4B8XA 2DJIA 1YW8A 1FWZA 4L9NA 3LOCA 3QWLA 3T1BA 3MD2A 2R5ZA 1U8BA 2JA2A 3F8FA 4M3BA 2XPWA 3K4JA 1T8IA 4LK0F 3E97A 3WTVC 1I39A 2NOGA 4LIVA 3OMYA 5K5OA 2GXGA 1IRXA 2P8TA 2M1BA 2NNYA 1SFUA 1IV6A 1ZGJA 4XLAA 1YO5C 5D5UB 1ORKA 3CC2I 1O57A 4Q5SF 4P1WA 1RC9A 2A6EF 1ZELA 2CSOA 4G6DA 1HCRA 1R5GA 2VJJA 4N4NB 1U0JA 4ENNA 2QKMB 3HRUA 3OYNA 4UNOA 4MEYF 4XM3A 2HDCA 3HEFA 4BAYA 2LOOA 1FSEA 1ZG5A 1X58A 5B3SH 2A61A 3DTIA 1OR7C 3AL0C 2GAUA 1ZRCA 1Z21A 2X9DA 4KUMA 5FFXA 3ABTA 2FQ4A 1YS7A 4U0WA 1S9HA 2Z3YA 2BY0A 1DQUA 1FLIA 2ZMEB 3S15J 3H35A 2KDZA 3N05A 4I0AA 2M4KA 3M4OJ 3WU2C 1G4DA 4HF0A 4XSXF 2KPMA 3HOZJ 4Z2YA 1ODDA 1ZKGA 4FQGA 2YX7A 2D2WA 1Z67A 4N4OB 1KU9A 3K2ZA 3BG7A 3KE2A 5IY5H 2E1MB 4CYCB 4X6AJ 3IC7A 2LY9A 1T0FA 2LRDA 1K78A 2JRTA 5DDGA 5J8CA 4CYDA 3DXJF 5IT3A 2X48A 5ILUA 4HV6A 2HNHA 2EFNA 3F8CA 3W6KB 1OCPA 2IXSA 3CCMI 1ETVA 4KITB 3S93A 1O7LA 2EIJH 1B72A 3EUHA 3TBIA 3OS2A 2R92J 1B1BA 2E5NA 1Y56A 2F4IA 2VIXA 2VKVA 3K10A 3TKYA 1TL8A 2G9WA 2VASA 4B48A 3CJRB 1FX7A 1ZRDA 2ESHA 2XAFA 3RPUD 5CVVA 3OYGA 3LAPA 1GVDA 3SZGA 3BJ6A 1QZZA 3H36A 5FD6A 3H0GJ 3LWFA 3WTYC 3SYTA 3V8LA 2Z9OA 4RS8A 2E71A 2HZTA 2DA5A 2FXAA 1FNNA 2BHYA 2HTJA 2L5QA 1QQIA 3HXLA 2QA4I 1ZTRA 1MZBA 5LBQA 3C1DA 3I59A 5FROA 2L7MP 2ADUA 3FISA 2V26A 1T39A 1Z1DA 2WTEA 3OYLA 2Z1DA 4FE7A 3MWMA 4R8HA 4ZJZA 5LGTA 3ROUA 4DBRA 1UHMA 2AXTC 4GRIA 4NC7A 5J47A 1X3UA 3G2BA 2Y0MA 2JSCA 3VEPA 1MDMB 1Y0UA 1Z7LA 2VPLA 2WC2A 3BG3A 1FIPA 3EETA 5LHGA 1AU7A 4MTEA 1IW7F 2CQXA 3EQLF 2IGKA 4I7HA 2CQNA 1V5EA 5FLMJ 4ZTFA 3OR1C 4F93B 3VPRA 3S3NA 2FMYA 3QYFA 3ONQA 4XLHA 4ZYEA 2JA5J 3F6OA 1AA7A 2OAZA 2HDDA 1P4XA 2VXDA 1D5VA 4C2TA 4JX4A 3CCUI 5F0CA 2KHMA 3PNYA 2DK8A 3FMQA 1K61A 2EH3A 4BKXA 1FMWA 1AWCA 5IP6A 1DPRA 1YQAA 1S72I 4A3CJ 4JX5A 3H0DA 2L01A 2LKXA 5FO5A 4I6ZA 2H8WA 1ERDA 3P7NA 4EM0B 3RKXA 3GCMA 4MQ9F 1H89C 2BE5F 2CS3A 5F6FA 2CWEA 1Y8RB 3E0JB 2E2JJ 2V9PA 2XF6A 4L5IA 1XCVA 5JHFA 4XRMA 5KAIC 3H92A 4BJ6C 3CMAI 3BQYA 1MBGA 3DLLF 2F5DA 2M0MA 3D5SC 5BMZA 1TWFJ 1IXSB 3TL4X 1WKMA 2NAZA 1VQKI 3ZMDA 2Z33A 2R7TA 2H6CA 2QENA 2QF7A 3WGGA 4YG2F 3L00A 1ETOA 5A2QZ 2H09A 4MEXF 1O3QA 4LG3A 2HOAA 1IUYA 1MNDA 2W1OA 1VQNI 1MSEC 3C2GA 2DCEA 1SMTA 3IWFA 3TP3A 3ZN1A 4E7LA 3GO5A 3BG6A 1XMAA 3SXYA 1N78A 3PUFA 3JAMK 5BNGA 5HS7A 4ENMA 3H9JA 4OAYA 2L7FP 1BC7C 1ZLJA 1FZPB 3FBNB 1T08B 2M7AA 1TTYA 2E1OA 3FXJA 2ZNYA 3OY9A 2HGCA 1R6RA 1TQIA 1JUPA 2UUZA 3K4CA 1ETXA 1G3TA 2ZJQF 1JT0A 3DBRB 3D0SA 2M30A 2CU7A 2A68F 3WTWC 4IF4A 4BXUA 3G73A 4FCYA 3L7WA 2MH2A 4PSWA 2QWWA 2A6HF 3DKWA 1UG2A 3CMYA 3BWGA 1LDDA 2K9NA 2W57A 1LDKB 6PAXA 3ZQGA 4DOZA 5B1BH 4CCLA 5LD2C 2MFZA 5IYCJ 3GTJJ 3S17J 1GLNA 3ZMTA 3F22A 5LHIA 1RR8C 2LP0A 2AO9A 3RZOJ 1V4RA 2DT5A 5DM7F 1D0ZA 1XD7A 4RM3A 4BDZA 3A4CA 1QVTA 1YFHA 2WV1A 4HX7A 2JJ7A 1U2WA 2O8XA 1YYVA 2VL8A 5F27A 2NVUB 4LMYA 1W5TA 1UG0A 2NVQJ 4BBSJ 1P6RA 2ZXWH 4U7DA 3S1RJ 4EJWA 3ESWB 3OYMA 2PQ8A 5BPIA 4BXXJ 4OINF 3HZJA 4AD9A 1JI8A 3GVAA 2DPDA 1Y39A 3ZQFA 3ZPLA 1FEXA 3QU6A 4D5CA 5EGOA 2RQPA 2Y30A 3V42A 2E5ZA 5ICFA 1SFKA 1FC3A 2JTVA 1U78A 3DBHB 4RAYA 5AIPA 3E5QA 1MBHA 2DA3A 4C30A 3PQKA 4RM2A 2IA0A 1GXPA 4I2OA 2K86A 1S8NA 3R0JA 4OOIA 5E8GA 5H20A 2V6CA 5GAHJ 4Z6YA 2HPIA 4CCJA 1ZH5A 3E1SA 4TV7A 3LSPA 1I1GA 1K4SA 5B5EC 1FJLA 2VE8A 2AQEA 5EJCA 3HDDA 4HQMA 1R00A 4PSXA 1S3JA 1E0EA 3O8GA 1JUSA 4L5JA 1APLC 5HS8A 1O3SA 1YJ9I 4B47A 3DCFA 2XGCA 5M5XJ 5EDNA 2HFHA 3HM5A 4NBQA 5D4RA 2OPTA 1YJNI 3CF2A 2ECCA 4UUSB 3QQAA 4CUGA 1WVRA 9ANTA 1P4AA 2DA4A 4BQAA 1MH3A 2BEOA 2HWVA 2NOJB 1JHFA 2XAJA 4NC8A 4XL9A 5H6QA 1ON2A 3OYCA 3BPVA 5EEGA 2DOAA 2KLOA 3GEZA 3K1NA 5F0HA 2MLGA 5JLWA 1VQOI 2X1EA 2EZKA 2E35A 2XRLA 4CCOA 2XSJC 1OMIA 1W7PB 1HF0A 4F92B 2QSFX 3FXKA 3PIOF 2A05A 5JLXA 2PI0A 3CUQC 1LEAA 3B6AA 3IH2A 4UUTA 4XRFA 5LRSA 4NQWB 1O3TA 3CJQB 1F4KA 3WU1B 4PFPA 1T95A 3MQ0A 1Z91A 4M9ZA 2HQRA 4A3KJ 2LBFA 1A6QA 1RKTA 2QCOA 2VJ4A 2X6YA 4IL6C 4BQNA 4HG2A 4U7BA 3JRAA 2AXLA 2ESNA 1RESA 1MMAA 2P0WA 4G9YA 4E70A 1BIBA 2E7WA 1N75A 1W0UA 2LREA 3I55I 1TNTA 3G3ZA 2MC4A 3CCYA 2CYYA 1WJCA 4P55A 1BIAA 4ESFA 4V2GA 2E34A 1TQMA 1WZ2A 3VYUB 3DQVC 4WK8F 3AKZA 4XSZF 1XS9A 2G7UA 2VXZA 3MKZA 3JRCA 3ZMSA 1X1AA 2Q8KA 3CDIA 3R6SA 2R0QC 4GDFA 2P81A 3M7GA 4XQFA 2A5YB 2RDPA 2VJIA 4WX9A 4MHGA 1Z6TA 3PIPF 3JSPA 1FSHA 2PFBA 5CQEA 1MBFA 1F9NA 3ZMZA 3FF5A 1F43A 2RN7A 2DOFA 2K40A 3K4BA 3BC8A 3F8NA 4BQOA 2FMLA 3HRMA 4HLYA 1UMQA 2OC6A 3KETA 3GX4X 3K4KA 5E1ZB 4HNUA 2V9VA 4UVAA 4P96A 4LLGF 4QLCU 3CJTB 5BQTA 2I5UA 3BG5A 1MMSA 5E20A 4AIHA 2ISYA 4M74A 1IZ1A 4LFUA 3KZIC 2HVQA 3KFWX 3I5UA 2KIMA 4A2UA 2L9VA 1OCRH 3RYPA 3JREA 3I4PA 2GXBA 3HGYA 4QSHA 2P6TA 1DGRM 1HQCA 2ZC2A 2PJPA 5KK1A 2ZMEA 1SD6A 3FXOA 1WQ2A 5F0FA 2EFOA 1JE8A 2DW4A 3ULQB 3WTSC 2QVOA 2VT2A 3P9IA 4ON0A 2L54A 3L1PA 3BR1A 2H8RA 2IVMA 1TP4A 4BL0B 4II2A 4A93J 1G3YA 3PL8A 2ELKA 5FB2A 1FIAA 2IJLA 5EG0B 2B0LA 2IGNA 4KIGA 1EH8A 1J5YA 2KRCA 4F52A 3JAMZ 1RZ4A 4Y7NJ 3BTLA 4KISA 3RQIA 4AYBN 4IRHA 4XKBA 5E3NA 2DJNA 3QPTA 3FHZA 3MMYB 1UELB 4DNCA 1BJAA 1PUFB 2EFWA 1ZARA 3U2RA 1UJ8A 1R49A 3I3LA 4Y17A 3G6EI 1TWGJ 2BY2A 3TQNA 4YFNF 2VODA 3KLOA 1Z9CA 3M1CA 4WXCA 2WAQA 3M07A 2RNGA 4GCVA 1HXDA 3K2AA 4DYQA 1IO2A 1IXRC 1GUUA 2OD5A 3FZVA 3Q9SA 3VDXA 4HDUA 1IN7A 1EA3A 3CUQB 2KQRA 4ZDLA 5IYBJ 4A3FJ 4XLEA 3AG1H 1P92A 4AM3A 3KEYA 2HDWA 1QZYA 1S29A 3LA3A 2HR3A 1HA8A 3ZMVA 1U9NA 2X6XA 3VSKA 3ABKH 4RB0A 3TW6A 4LJZF 5HLTA 3BPXA 1OJLA 2XRNA 3KP2A 2BOLA 3WODF 3CZ6A 3N4MA 2NVYJ 3DWLE 4CZZA 2YX4A 4CA0A 4YELA 3FXMA 2VPRA 2JA7J 2JA8J 4DJAA 4ESBA 1T98A 4OIOF 2L3DA 4A0XA 4A3DJ 2CJJA 5EEHA 3RQ4A 4KIFA 1KU7A 4DZJA 1VQ9I 5C4XJ 1X4PA 5HLIA 2XAHA 3CLOA 3JCUC 3I4NJ 2E60A 2CFXA 2EIMH 5JR3A 3PM1A 4LB5A 3BTJA 2GA1A 1SVOA 1BJZA 3PSFA 4LG0A 3GTOJ 3MKYB 2VONA 4Y15A 5LLQA 1XC5A 4A12A 2DA2A 2VKEA 3Q3SA 1F36A 2EJRA 2O5RA 3EUAA 3CLQA 5F1RA 3OIOA 3OYAA 1GV2A 4IHVA 3OIQA 1BW6A 1Z0XA 3AG4H 3NWTA 4UB6C 2XPUA 1BR1A 2OQRA 2LKPA 1HOMA 3TEDA 3HHGA 1IN5A 4L18B 3GFIA 2ZB9A 2K4BA 2ECBA 2W4SA 1OR7A 5JVGF 4EJUA 4WF2A 3JRDA 4A3LJ 2LH9A 2RGVA 4F3QA 3LNQA 4F7ZA 4FETA 1WJDA 3ABLH 1ZHFA 2Y69H 3RKWA 3CDLA 1PJRA 5E3LA 3F23A 3FWEA 2GZWA 4D7NA 3BCAA 3E6MA 1HSJA 2FA5A 4E7ZA 5DTDA 4EJTA 1DP3A 1HKTA 3OYIA 2HPMA 4BEHB 1VQ7I 3O8HA 4A0YA 5E3MA 2XAQA 1K7AA 3W6VA 1D3YA 4RB1A 2MGQA 4K2EA 1V5GA 1ZGAA 2GLOA 4E7HA 2A6TA 4B4CA 2IS6A 1I50J 2BXZA 3GFLA 2K85A 3SFIA 3PFYA 3FKIJ 1MKMA 1LE8A 4G7OF 1XDUA 3WU0A 1X1PA 3FX3A 4P9FA 1FBQA 2PJRB 3CMMA 2F6CA 2OA4A 3AFHA 4YFXF 2VKHA 1AKHB 4RB3C 2Y9YA 3PNVA 3I54A 2LMDA 1DGWY 2K9LA 1OLTA 1JJ6C 4WXHA 3ASNH 4ZDPA 3GFMA 2CO5A 3RI4A 5FRNA 2AS5F 3PJRA 2UWMA 5CVJA 3VSLA 5IT9K 3KEOA 1WH5A 4A69C 3W2AA 4JQFA 5EZHA 3I56I 3MVPA 1NHAA 2IW5A 3CDHA 4G7HF 1ZN2A 2BVMA 2OBPA 3NARA 1STZA 1A31A 1LFPA 1A6IA 1SC7A 1D0XA 2PMZN 1IRGA 4C2MJ 3R61A 1MMDA 1XSDA 4N0BA 3BDDA 3L2RA 3DPUA 2JVGA 5DCFA 2R7SA 4Q4ZF 5K7ZA 2BXYA 3EUKL 3H3UA 4PFOA 3I71A 2ZJRF 2WV0A 2VQHA 1WSUA 3OL4A 2YPRA 2UZKA 4D0PA 1BA5A 3ZQHA 5LHHA 3LSKA 1VQ5I 2LD5A 2ZFWA 3MKLA 3QRFF 3A01B 3X2QH 4BS9A 1JGSA 4RA2A 4M3EA 2DDBA 2DTRA 2MD0A 4XK4A 1WGXA 3KYCB 3BTCA 4XN3A 1BC8C 2P7CB 3HHHA 1BM9A 1YITI 2WY8Q 4H4KC 3F3XA 2IA2A 4JX6A 5IPAA 4KNYA 2F5VA 3OS0A 1KA8A 1PVEA 1WH7A 3IKTA 3CC7I 4DIQA 3K70D 3L2UA 5DYMA 4C2UA 2DAOA 2PEXA 2F2EA 2W84A 2QBYB 2YR2A 5LFAA 4OIRF 2E1NA 3PQJA 4HX4A 1B59A 4CDGA 1SAXA 4HSRA 4EGYA 2E36A 2ID6A 4IKFA 1AHDP 3GUDA 1G3SA 5GP9A 5FJ8J 1V3FA 1VI0A 2HXIA 2EA4A 4NQWA 3WHCA 5GAGJ 4MLOA 4GYGA 4PUSA 4RAFA 5D6EA 4XIDA 3QOPA 3Q5FA 1BI2A 1VZ0A 4M3FA 3M3YJ 3O3KA 4GYIA 2CW7A 2LDUA 1FT9A 2R7OA 5FKMA 5TJJA 3IUOA 1E17A 3HRTA 2HZDA 4DZPA 2CUZA 3FM3A 4YEJA 3HOTA 5FLXK 4UV9A 2HTSA 4E6KG 2A5WA 1QGPA 3CJNA 3MZYA 2K9QA 3LL7A 2R93J 2JPCA 2BV6A 5E79C 2DXIA 2DQRA 1HW2A 1FYLA 4M9SA 2J5OA 4ESJA 1I27A 1RETA 2DA6A 2VC1A 5KAFC 5E17F 4PJMA 2JT1A 2Z5UA 1BOBA 2JK3A 4I02A 1ZG1A 3CTAA 3K69A 4BHBA 4ZH4F 4LB6B 3ERED 3LSHA 1I3QJ 1P7IA 1TWHJ 3NAUA 5JHUA 4BDYA 4XLFA 2NS7A 1TQPA 4L5EA 2QKLB 2W7NA 3QPHA 3OR2C 3WG9A 3OYJA 4EEFG 1G8XA 3KP4A 1VNDA 2L9SA 1QHHD 3NRVA 3U9GA 2HVRA 2ZSHB 2V79A 1UZCA 4F91B 2HYFA 5CQGA 2QQ8A 4XLNF 3J80K 3TO6A 1CF7B 1K6OA 3TOBA 3KP5A 3ML6A 2O6GE 2XB5A 2FJ1A 4NNJA 4QPQA 1W4MA 1GV5A 2MW8A 3H5NA 2IP2A 2ZXIA 3RJPA 3ZN0A 3OOUA 2PLYA 3A1YA 4WXDA 1USSA 3E5XA 2JMWA 2YSRA 3EUHC 1ITYA 5F08A 2WAFA 3HOVJ 2XKPA 3NEUA 1JUMA 2QQAA 1SFEA 2FF4A 4ZZDA 3M1EA 4XICA 5M3FJ 1T33A 1D8KA 1YOVB 1FTTA 1SD4A 3VYRB 1BL0A 2WAQN 1FBSA 3OYBA 3E6BA 5ICGA 2I8DA 2QM3A 4IQ4A 2O7OA 2Q2EB 3DLAA 3VODA 5IP7J 2IRFG 4NUBA 3EPZA 1MBKA 3KYLA 1WPKA 2X85A 4YFKF 2D45A 3CD6I 1KONA 1FPQA 2B9SA 1MJBA 2W82A 2MLKA 2R3SA 4BYYA 3S2DJ 4AU7A 4ASNA 3FKJA 2COBA 2AQFA 1OCZH 3P9CA 1Z6RA 4ZYGA 2NS8A 3HUGB 3GTQJ 2VQCA 2R5YA 2IAIA 1BW5A 3TO9A 3KCCA 2QSHX 4XLCA 1B8IA 4DBQA 1IRFA 4W1UA 1XB4A 3BQZA 5BS6A 1GT0C 5HDNA 3ZMUA 4BXFA 3G1MA 1U5TA 2DMTA 2XASA 3AG3H 4IHTA 3F72A 3G1LA 4O6JA 3LSJA 5CKTA 1NK2P 4ZYAA 1D1BA 3LA2A 4JYKA 2RV8A 4XKVA 3OYFA 3CCLI 5HVQC 4M6YA 2FU4A 4F55A 1SD5A 3CUQA 3K7AJ 3S3OA 5CVUA 5K7FA 4PJLA 5C3EJ 1HLVA 3HSFA 4IEJA 2MG4A 2KDOA 4IOCF 5CVRA 2R5ZB 4ENKA 2EBIA 3FBIB 2EZHA 4MFDA 2XF5A 1QBJA 4PGHA 2JPBA 3R0AA 4L9TA 4M73A 3RYRA 4ZYHA 3ZQLA 4IPAA 2VKDA 2M8EA 2K27A 5DS9A 2VN2A 2LF8A 1BR4A 3Q0WA 3V8KA 5CLSA 1BOAA 4XRSA 3IV5A 2BW3A 3IWZA 1JJ8C 2F5EA 2HU9A 2QZ8A 1T56A 1KGSA 5J40A 4YIRX 4BBRJ 1B9MA 5DCMA 3OL3A 1YS6A 1TT0A 3GFJA 2Z2SB 3A2KA 2R4GA 1YIJI 2O3FA 4M9XA 4HDVA 3SZTA 3RKYA 3HOXJ 4OIPF 1IDYA 3U1KA 2LF7A 1UHSA 5L3BA 4LD5A 2P4WA 1BN5A 1GVJA 2XGEA 2QEXI 1Q1VA 2VQLA 5FGMA 4KICA 2W24A 4C3IJ 4QTRA 2UXNA 2CG4A 1USTA 2ZNZA 4PJ0C 1S7AA 1VQPI 1C0WA 2GA2A 3BR6A 4HX8A 1MD0A 3MFKA 3S16J 4DW6A 5J1YA 5JFRA 3HIFA 2R7QA 3JRFA 1IDZA 1LDJA 4R1HA 4A3JJ 2M3AA 4DYCA 1TC3C 4I0BA 1KQ0A 2Y48A 2GM4A 2HXOA 3TP0A 4AWXB 4B3XA 2L9NA 4W97A 5F04A 2OQGA 1XMXA 4I99C 4HYEA 1YIOA 4Q47A 4WCGA 2XC7A 1KU2A 3SDBA 2KL4A 3QYEA 5D5WB 1W36C 1B72B 2E2IJ 3A0BC 1BR2A 4HV5A 1U3EM 5L3GA 3C18A 3Q9VA 3RPQA 3OYKA 4ENJA 2CFOA 4JBAA 4ZTJA 3L9FA 3A0HC 1LVAA 5B66C 3WTZA 2LK2A 3FMSA 3CCQI 1YRNB 2K9SA 1JTXA 2OZ6A 1X2NA 4BE0A 2ISZA 4XLPF 1LFBA 3K6GA 1JHHA 1REPC 2ZSIB 2LYCA 3I59B 3H3ZA 1TZLA 2IA1A 2Y2ZA 3KLNA 3EDPA 4EJVA 4DQ2A 4RAGA 3MEXA 2F5FA 4PJNA 4NHJA 2O03A 3UKGA 3T5XA 1LJ9A 3DTKA 4IZZA 1K6YA 2FNAA 2KMUA 3CCRI 4A3IJ 4C3JJ 2K5CA 2EINH 4BJ5C 3F8MA 4V2FA 1P7JA 4EVIA 4CHUA 1ACIA 3W2WA 1E3OC 4Y33A 2B63J 3GZ6A 5HNHA 5DD8A 3GYHX 1ETYA 4R79A 5J3LA 2J5PA 2MH9A 4I01A 3I0TA 4UHTA 5J8FA 3E6DA 3LSGA 3LFKA 3MZ8A 3V4GA 4A3EJ 2NNNA 1RUOA 1R22A 3CUOA 3ISPA 5ERIA 2PMHA 2VT3A 5D8KB 3J80Z 3HOUJ 1EH7A 1RIOH 2DMNA 3T8RA 2X6WA 4BH9A 4C3HJ 2XUBA 3M8JA 4M6XA 2FRHA 1GDTA 5HOOA 4RGRA 2NYXA 4CO8A 1UFMA 4UVBA 3BT9A 2FBIA 4D5FA 3LSRA 3VFZA 3ZOBA 2L4AA 1BBYA 2E7XA 3W3CA 3F0CA 1PP8F 2LNBA 3WE3A 1K4TA 2QQ9A 3A01A 5BOXA 1AOYA 2H94A 1F5TA 2LSOA 1EH6A 4CYCA 2JN6A 1OISA 4IRGA 3K70C 2MABA 3DKYA 3KEQA 2E2HJ 3E6CC 4PK4A 2H1LA 5E1WA 1KQ9A 2FE3A 1M1EB 3BROA 1HKQA 4FHTA 1U8RA 1J09A 3S3MA 1MNMC 2Z16A 3K4LA 4HZFA 4IHYA 2Q1ZB 4O3MA 3C7JA 1PYVA 4ZDOA 2R7XA 4X1EA 1HC8A 1Z7UA 1DU6A 2DU9A 1LVKA 5L3CA 1JGGA 3JW4A 4UY8I 4J00A 1ETKA 1VF9A 3DV8A 3LSTA 1QHGA 5K5QA 2DA1A 3IAM2 1YLFA 3ECHA 3P9KA 4G7ZF 4EATA 1LB2A 4BUPA 2DFFA 1CQTA 1WCMJ 2ZXHA 2GIZA 1SANA 2LFBA 2ME0A 4IQJA 4DGWB 2HYJA 1G3WA 3REOA 3ASOH 3HSRA 4LGWA 4ITVA 2STTA 1PP7U 4U88A 4BGDA 2WBMA 4BHCA 4KYWA 2NVTJ 1MDMA 2XIGA 2XAGA 2L4MA 4I76A 4GGGA 2D1HA 1Z3XA 2OTLI 1DDNA 3GTPJ 3B02A 1K83J 2P5KA 3OSGA 2DBBA 4PCQA 2O9LA 2ZO4A 1NH3A 3JRBA 4MGRA 5DEQA 2VJ5A 4N9IA 1FYMA 2OTJI 1FBUA 2NXNB 4JK1X 4NC6A 4KMUX 2QGUA 2XB0X 4U87A 5M3MJ 1IG7A 4HF2A 1LKXA 2O61A 3D1NI 2CV1A 5EGOB 2COMA 5EZGA 4CICA 5C4JJ 2M7BA 1TWAJ 1XPXA 2RREA 3FXLA 2F4OB 2TDXA 3A02A 2LG4A 5K5RA 3WGHA 3H3VK 2M0CA 2EQRA 2IPQX 4OWRB 2QYOA 2EB7A 5EYRA 3F8BA 1J2XA 1I6XA 3H1CA 3LQQA 4XN0A 1R4NB 3GZ5A 5HODA 1R5ID 2XROA 3GTGJ 1YW9A 1SAUA 4NDLA 5B1AH 3I64A 2ME6A 4IX7A 4HW0A 2EZIA 2KISA 1ZGWA 1RI7A 1OCCH 2H27A 2K9MA 2KFDA 4BY7J 1Y1WJ 2N8GA 2EV6A 1XN7A 2EIKH 3E3VA 3FK7A 1FTZA 1JKRC 2O8KA 1Y1VJ 2BYVE 1ZK8A 5H2FC 4EV0A 1HW5A 4LIUA 2JRMA 1X1CA 1IUFA 1ZR2A 2LC2A 1IRZA 2XDVA 3COAC 2K3FA 5L3EA 2R7WA 3ZRGA 2DODA 3S8PA 4J19A 2W85A 2VBXA 3L2WA 2P5LC 1H8AC 2ELHA 5GADJ 4M3GA 2VI6A 3UNGC 2JSPA 3KX2A 2IS2A 3CCEI 3TDZC 2E19A 4BE2A 2O0YA 1MIJA 4YIIA 1Y8QB 2X1DA 4Y3OA 2FD5A 1QVUA 1R71A 4YRVA 1WHUA 3VB2A 2XGDA 1RR7A 2TRTA 2R7DA 3LSMA 1VFCA 2QSGX 1UAAA 1VQLI 5EEAA 2ZJPF 2CGPA 1YX5A 5E3OA 4ZZLA 3LSIA 4EGZA 1YG2A 1YJWI 2STWA 4II3A 2HQAA 1B9NA 2RAEA 5D4SA 4IJAA 2R7ZJ 5D8LB 1RUNA 4HNVA 4FX4A 1BI0A 3G71I 3OOPA 1LFUP 3IHUA 4AC0A 1EJ9A 2D1VA 2CQKA 1HSTA 3BY6A 2M87A 4A3BJ 4LLLA 3BJAA 2WAEA 2YU3A 4CGZA 2L0KA 3ZR8X 3MZHA 2HVSA 5HS9A 4RAZA 3DF8A 2KRFA 2ICWG 4S05A 3ABMH 5DUIA 1G6NA 2Z99A 1OPCA 2CMPA 2KRHA 1D1CA 2DK5A 4N9HA 3IRRA 4IOAF 3KZYA 3S1QJ 3IKVA 3RSNA 1WI3A 3IH3A 3J7ZI 3E5UA 3KP6A 3P5JA 3ELKA 3S14J 4RMNA 2L2OA 1D8JA 1X3WB 1WJFA 1JKPC 1N25A 4D7MA 3ECOA 4A3MJ 4BU2A 4XKWA 2YU9J 3M8FA 1H9TA 2DFIA 1ONVA 1P4WA 1QO0D 3H9QA 5BPDA 4E4HA 1J75A 1YE9A 4X0GA 1VTNC 3S2HJ 2X51A 2HQ5A 3UR3C 3PNTA 1EV7A 1OYIA 2R7FA 1R1TA 4S04A 1SVMA 2XSDC 2FX0A 2EWNA 3OWTA 1FMVA 1G2HA 2FUG2 3HSEA 3HJEA 1ZRFA 4M6VA 2EFPA 3PO3J 2Y9ZA 3IAS2 3RKQA 3GW2A 3SJMA 3JSOA 5AIQA 4JOMA 5E18F 3AAFA 1H9GA 5FFZA 1A36A 1LEBA 1D1AA 1LUJB 3GTLJ 1FYKA 3QOEA 2ID3A 3CO7C 1UB9A 1LQ1A 4ZYDA 1R58A 2X4HA 4IXAA 3S2WA 2BGCA 2Y75A 4UUSA 2OJED 4XBFA 3SQNA 2OF7A 5DD4A 1WJ5A 3ZGKA 3K4MA 2CW0F 4RGXA 2LKSA 3QYBA 4IVNA 4CSWA 4PGGA 4EJOA 4KT6A 1XGNA 5D6FA 3HOWJ 3KZZA 3BCBA 4KT5C 3GMEA 4P5OA 1PUEE 1Y0NA 3NWSA 2VLAA 1W7PA 1XGOA 2PBIA 3DPLC 4LLNA 3D5RC 3IP4B 3L2VA 5GPCA 2DMUA 5ICCA 4HLXA 3GWZA 1Z05A 5ICEA 2G7HA 5E8IA 2YS9A 2MA3A 3TW7A 2L9RA 3E7LA 1YRNA 1X1BA 1IJWC 3WTUC 3U1DA 4YIFA 1BI3A 3FXQA 2V1DA 4UV8A 2K7LA 3BR2A 2VBYA 1LPQA 1I6HJ 3I4MJ 4RLFA 2DYSH 1QNTA 2OZUA 2ZBKA 4E7JA 2WY7Q 2HEOA 3A03A 2A3SA 3CP8A 4LITA 1I1SA 1ETWA 5J1UA 2GBYA 1S6LA 4AYBA 1EKEA 3OSFA 3JR9A 1ZQ3P 2FBKA 4L0ZB 1N77A 2BBYA 3GF2A 3LMMA 1QA6A 4MTDA 2DOEA 2GQQA 3BZ6A 3DU6A 4D9JA 3C2HA 4GO1A 1MMNA 1T6SA 3M8EA 2HKXA 2ZCWA 1OCTC 1U6GA 3TOAA 1IN4A 1R1VA 1L0OC 1OKRA 3BR0A 1NK3P 1XCBA 2XGXA 3WG7H 4B09A 2EA2A 5KHDA 3RZDJ 3SZPA 4CXFA 5LGNA 4UUVA 4XNFA 4Y52J 4I09A 3EYYA 4B43A 2EV0A 3G4SI 3GTKJ 2GOMA 4XORA 3RTRA 3TO7A 3WTTC 4IO9F 1T0FC 2NVXJ 1PDNC 5FD5A 1IAWA 1LNWA 2PG4A 2H1KA 1KQ8A 1T2KA 4G94A 2HOSA 2CRGA 2KZVA 2BY1A 1W0TA 5AONA 2KT0A 4ANJA 4LG0B 2CQQA 2VBWA 2XKOA 1XTAA 3BJOA 2V7FA 2GOXB 1X3ZB 1J9IA 4MNUA 4S0HB 5K7HA 2VOPA 3N97A 1YX3A 5CJ9A 5HLGA 1SEUA 4I98B 2IEKA 4OU0A 1D5YA 2WB1A 2M5WA 3DPTA 5DUKA 4EM1A 3IH4A 1H88C 1JKOC 2IS1A 1GXQA 5F1JA 3NQOA 1R5HA 1KYZA 4AVPA 5EG0A 4IHWA 1JXSA 4MQVA 2FOKA 2V1UA 2K4JA 2XPVA 3HGGA 1O7FA 2P7VB 3HPGA 3AL0B 1OFCX 3HTUA 5C44J 2I10A 4G12A 4UXNA 1S5LC 5JVTA 1ETQA 1W5CC 3ERMA 4HNTA 2FSWA 3SFZA 3SEQA 4G8XA 3BZKA 1PUFA 2CV0A 3J81K 2G0EA 2EK5A 3TGNA 2GXAA 2JVHA 2CUFA 2HS5A 1UCRA 5KNLA 4LOCA 5L3DA 1VQMI 3K9TA 4XOPA 1XGSA 4KA4A 4E7IA 2TCTA 2L7KA 2IBDA 3BG9A 5CVIA 2MYSA 2XV4S 1OYWA 5H6RA 3F21A 5GPAA 2W00A 1Y6IA 2VUMJ 1I3AA 1J0RA 3K1PA 3U21A 3KPHA 4ABZA 4B44A 1VQ4I 5J6XA 1TW2A 1ZLKA 1YHQI 1X4OA 2LVSA 2C6YA 2DN0A 1LE8B 5IT9Z 1XX5A 3HG9A 1POGA 1H0MA 2OUMA 1RRJA 3J7AO 1WWXA 3WGIA 3F6VA 5CYVA 2WA0A 3R60A 5FKOA 4P9UA 1TT5B 1W5SA 5FRMA 3CP2A 1TBXA 2DFEA 3BR3A 3L2QA 3BLYA 3LFUA 4GFBA 2EPFA 2DQLA 4OMZA 3VYSB 1TWCJ 2XAUA 3ZCOA 5L3FA 1RNLA 3L09A 2RQQA 2XHKA 1YTYA 4PDKA 2VBZA 4GXOA 5D5XB 5DM6F 2CQ7A 4XONA 3KIOA 4KN7X 4KDPA 1A04A 1T38A 3HC7A 3FIWA 5ILVA 5ED4A 1Z3YA 4KJZA 2ZKZA 2F5CA 4U0VA 2YUSA 2KIQA 3JRIA 2MD5A 3HKZA 1MSFC 3VWBA 3QAHA 4L9JA 5FKNA 5LEKA 2X1CA 2X0LA 2Y0SA 4M3DA 1OYYA 1MBEA 3DTEA 2GIVA 1R1UA 1QZEA 3CO6C 1E3PA 4UB8C 5HDKA 2OU2A 4MFEA 2DFHA 3FXRA 1V55H 3KYDB 1KZHA 4XMYA 2R7UA 3ABUA 3QPLA 2M45A 3V7SA 1D0YA 1FP2A 1K78B 1IN6A 5IOZA 1QPIA 2KJCA 2W48A 3QODA 3HTSB 3Q0UA 2FBHA 3SEZA 4J01A 3S32A 4B3AA 2PMZA 2IGMA 2P5VA 3S1NJ 3L2CA 3H5RA 2V6EA 2LR8A 2M9HA 4AUXA 2VOOA 3KP7A 3HL2A 1G59A 2XVCA 1RKWA 3I9V2 3WHBA 2PN6A 5IOYA 4QIWN 3KP3A 4H0EA 1ZREA 2M8GX 2PMUA 1JTYA 3OV8A 2AHQA 3W6JB 3W2VA 3MKWB 4IRIA 1U5TC 1V54H 4E7KA 3GLXA 4KFCA 1R9TJ 3V8JA 4A6DA 2KJBA 4BEHA 1RPWA 3RPUA 2K02A 3JTGA 1JKQC 4HA8A 4RB2C 4G6QA 5FLXZ 4AIJA 5LRRA 5IYDJ 1QRYA 3SDGA 2NRAC 2XF7A 1IXCA 4L9VA 4XOTA 5GTIC 3QU3A 2DDAA 2JQ7A 1KU3A 2H6BA 3B6CA 4KN4X 5TISC 2RC4A 4QWQA 4WWCA 2E1CA 1Z77A 2PJRA 2Y31A 2OV7A 3H9GA 5HNFA 1AKHA 1S7OA 4B1RA 5J4VA 2KP6A 1ZG3A 2P6SA 3GZNB 3HBLA 3QP6A 4FASD 4V19K 4Y13A 1VQ6I 2DI3A 1MJAA 2UV1A 4OAZA 2CW8A 3K0LA 1EF4A 2FOWA 3O2PE 2ACJA 1ZAOA 2UXXA 1TLHB 2DYRH 2KIUA 5M5WJ 1SFOJ 2M34A 2IS4A 2D5VA 3QP5A 2BHZA 3OIPA 5GAEJ 3OS1A 4HQEA 4AIDA 1FOKA 3HYIA 3CCVI 2KKOA 3BZCA 3DKXA 2OCCH 1J7KA 1P2FA 4EQQA 1A35A 1DPUA 2LY2A 1FOXA 2LY1A 4G6TB 1B6AA 4BE1A 1DP7P 2EV5A 4U0YA 3RDIA 1MMGA 5EF6A 3CESA 2DO7A 3J7YJ 1A5JA 2F48A 2FEZA 2JUCA 1XSXA 3B73A 2ELJA 2QUFA 3DBLB 3CMEI 2DTZA 4HAMA 1O4XA 4NB5A 1MGTA 4CH7A 3C2BA 5LGUA 3DEWA 3OYEA 3R4KA 3CC4I 4KIBA 4FISA 4OMYA 1MJ9A 4HBLA 1FOYA 4Q48A 5J1RA 2JUGA 1P9QC 2K3PA 2LTPA 1YI2I 3MN2A 4A5NA 3S1MJ 2F4MB 3OYDA 1WFXA 2R7RA 1DUXC 2DT6A 1TNSA 2EFQA 3CF5F 2PX9A 2ZJ2A 1IV8A 3GXOA 4XRSG 1MH4A 3D5LA 4BY1J 1XMKA 1SFXA 2DA7A 2HI3A 2HYGD 3I53A 4UVCA 5K1YA 1GHCA 4ETSA 1TW3A 3BP8A 3EYIA 1WJBA 1OCOH 1WI9A 4FTHA 2IGOA 4O5VA 5M5YJ 1OQYA 3JTHA 4RGUA 4BHPA 2QBYA 1W7PD 3FMRA 2VC0A 4CCNA 3J81Z 3AG2H 1X1DA 4C9YA 3MAJA 5J4YA 4A3GJ 1X2MA 4XKCA 2VE9A 3ZQIA 1X19A 4RGSA 3VYTB 2BVLA 5KCMA 1FY7A 4MO7A 1IC8A 3TDUC 3J7AY 1KYWA 2OCEA 3I58A 4PJJA 1R7JA 1SD7A 2B7EA 2EZLA 3M9AA 2R7VA 1QPMA 2VQGA 3HPHA 2ETHA 3CCSI 3F9KA 2R5YB 2CH0A 2DT7B 1Q1HA 2A69F 3HRSA 4AIKA 1CGPA 1B8IB 1NG6A 3PFIA 1MBJA 4BQQA 3JRHA 1I5ZA 2GWRA 2W25A 1UHWA 5LEJA 3T8TA 2NS0A 1U5TB 3IRQA 2LLKA 4BJTA 2CUEA 3LQRA 3ZQ7A 4RBOA 3BTIA 2IT0A 1ENHA 3GTMJ 3V7CA 5ILSA 1JT6A 3DFGA 3LAJA 2V1NA 1QU3A 2JZYA 1V5FA 4D1QA 3GLLA 3PUBA 1WJEA 3FHNA
chains in the Genus database with same CATH topology
2FNPA 1XSVA 5HLHA 3T0YA 1SMYF 1K79A 3DEUA 5DCMB 3ZP5A 2Q0OA 5DV5A 3BOQA 4A0ZA 1CF7A 3O6BB 4BNCA 4FX0A 1XDSA 4EM2A 2DPUA 4OIQF 4IHSA 3C3WA 4M72A 1HKSA 5F64A 1WRJA 1R36A 3FM5A 2WWYA 5E1XA 2DLLA 4M71A 1YW7A 4KMFA 3MCZA 4HF1A 2RNJA 2HOEA 2MBFA 3FXUA 2A07F 3RIRA 5A2QK 5D5VB 2Q2EA 3WTXC 5KVRA 4PZJA 1XGMA 1L3LA 2QLZA 3SHFA 1F1ZA 5HDGA 2RKHA 2KIFA 2L02A 3LA7A 4A6EA 5JI6A 1FP1D 1ON1A 4LK1F 3K1MA 1E2XA 4L0YB 1IN8A 4FT8A 2V1XA 1HBXG 1BI1A 3HUGA 4A5MA 2MC3A 3IL2A 2ZXJA 3V7RA 3VOEA 1ZYRF 1R23A 1O3RA 4EMSA 3WE2A 1ULYA 2HKOA 2QQBA 1B4AA 1IF1A 3DP7A 1HW1A 4HOBA 2RVCA 1J59A 5TRDA 2FQ3A 2HQNA 3HOSA 4B8XA 1YW8A 1FWZA 4L9NA 3T1BA 3F8FA 4LK0F 3E97A 3WTVC 5K5OA 2GXGA 2P8TA 2M1BA 2NNYA 1SFUA 1ZGJA 1YO5C 5D5UB 1O57A 4Q5SF 2A6EF 4G6DA 2CSOA 1R5GA 4ENNA 3HRUA 4UNOA 4MEYF 2HDCA 4BAYA 1FSEA 1ZG5A 2A61A 2GAUA 1ZRCA 4KUMA 5FFXA 3ABTA 1YS7A 4U0WA 2Z3YA 1FLIA 2ZMEB 4I0AA 1G4DA 4HF0A 4XSXF 4Z2YA 1ODDA 2YX7A 2D2WA 1KU9A 3K2ZA 3KE2A 3IC7A 1T0FA 1K78A 2JRTA 5DDGA 5J8CA 4CYDA 3DXJF 5IT3A 5ILUA 4HV6A 2EFNA 3F8CA 3W6KB 1O7LA 3EUHA 1B1BA 3TKYA 2G9WA 1FX7A 1ZRDA 2ESHA 2XAFA 5CVVA 3LAPA 3BJ6A 1QZZA 5FD6A 3WTYC 3LWFA 3V8LA 2Z9OA 4RS8A 2HZTA 2FXAA 1FNNA 2HTJA 1QQIA 1MZBA 5LBQA 3C1DA 3I59A 2ADUA 1T39A 1Z1DA 2WTEA 3MWMA 4R8HA 5LGTA 3ROUA 1UHMA 1X3UA 2Y0MA 2JSCA 3VEPA 1MDMB 1Y0UA 2WC2A 3EETA 5LHGA 4MTEA 1IW7F 3EQLF 4I7HA 2FMYA 4ZYEA 3F6OA 2OAZA 1P4XA 1D5VA 2DK8A 3FMQA 1AWCA 1DPRA 1YQAA 2L01A 5FO5A 3P7NA 4EM0B 3RKXA 4MQ9F 2BE5F 5F6FA 2CWEA 4L5IA 1XCVA 3H92A 5BMZA 2F5DA 1IXSB 1WKMA 2NAZA 3ZMDA 2Z33A 2H6CA 2QENA 3WGGA 4YG2F 3L00A 5A2QZ 2H09A 4MEXF 1O3QA 1IUYA 1SMTA 3IWFA 3ZN1A 3GO5A 1XMAA 3SXYA 3JAMK 5HS7A 4ENMA 1BC7C 1ZLJA 1FZPB 1TTYA 2ZNYA 2HGCA 1TQIA 1G3TA 3D0SA 2M30A 2A68F 3WTWC 4IF4A 4BXUA 3G73A 3L7WA 2MH2A 2QWWA 2A6HF 3DKWA 3BWGA 1LDDA 2W57A 1LDKB 6PAXA 3ZMTA 3F22A 5LHIA 1V4RA 2DT5A 1XD7A 1YFHA 4HX7A 1U2WA 2O8XA 1YYVA 4LMYA 1W5TA 1P6RA 4U7DA 4EJWA 2PQ8A 5BPIA 4OINF 4AD9A 3GVAA 2DPDA 3ZPLA 3QU6A 2RQPA 5ICFA 1FC3A 2JTVA 1U78A 4RAYA 5AIPA 3E5QA 3PQKA 2IA0A 1GXPA 4I2OA 4OOIA 5H20A 2K86A 1S8NA 3R0JA 5E8GA 2V6CA 1ZH5A 4TV7A 1I1GA 2VE8A 4HQMA 1R00A 1S3JA 4L5JA 5HS8A 1O3SA 2HFHA 5D4RA 1P4AA 4BQAA 2HWVA 2BEOA 2XAJA 5H6QA 1JHFA 1ON2A 3BPVA 5EEGA 3GEZA 3K1NA 2MLGA 1OMIA 1W7PB 2PI0A 3CUQC 1LEAA 4XRFA 5LRSA 1O3TA 1F4KA 3WU1B 3MQ0A 1Z91A 4M9ZA 2HQRA 4U7BA 2AXLA 2ESNA 4E70A 4G9YA 1BIBA 2E7WA 1TNTA 3G3ZA 2CYYA 4P55A 1BIAA 4ESFA 1TQMA 3DQVC 4WK8F 4XSZF 2G7UA 2VXZA 3ZMSA 2Q8KA 3R6SA 3M7GA 2A5YB 2RDPA 4WX9A 4MHGA 1Z6TA 3JSPA 1FSHA 2PFBA 1F9NA 3ZMZA 3FF5A 2RN7A 3F8NA 2FMLA 3HRMA 4HLYA 3KETA 3GX4X 5E1ZB 2V9VA 4UVAA 4P96A 4LLGF 4QLCU 5BQTA 5E20A 4AIHA 2ISYA 4M74A 1IZ1A 4LFUA 3KFWX 3I5UA 2KIMA 4A2UA 3RYPA 3I4PA 2GXBA 2P6TA 1HQCA 2PJPA 5KK1A 2ZMEA 1SD6A 1WQ2A 2EFOA 1JE8A 2DW4A 3ULQB 3WTSC 2QVOA 2VT2A 3P9IA 4ON0A 2L54A 2IVMA 1G3YA 5FB2A 2IJLA 2B0LA 4KIGA 1EH8A 1J5YA 3JAMZ 1RZ4A 4IRHA 3QPTA 3FHZA 4DNCA 1BJAA 2EFWA 1ZARA 3U2RA 4Y17A 3TQNA 4YFNF 2VODA 3KLOA 1Z9CA 4WXCA 4GCVA 1HXDA 2OD5A 1IXRC 3Q9SA 3FZVA 4HDUA 1IN7A 3CUQB 1P92A 1QZYA 1S29A 3LA3A 2HR3A 3ZMVA 4RB0A 4LJZF 3BPXA 2XRNA 3KP2A 3WODF 3N4MA 4CZZA 2YX4A 4ESBA 1T98A 4OIOF 2L3DA 4A0XA 5EEHA 1KU7A 4KIFA 5HLIA 2XAHA 3CLOA 2CFXA 5JR3A 4LB5A 2GA1A 4LG0A 2VONA 4Y15A 5LLQA 4A12A 2EJRA 5F1RA 2OQRA 2LKPA 3HHGA 1IN5A 4L18B 3GFIA 2K4BA 1OR7A 4EJUA 4WF2A 2RGVA 4F7ZA 1ZHFA 3RKWA 3F23A 3FWEA 2GZWA 3E6MA 1HSJA 2FA5A 4EJTA 1HKTA 4A0YA 2XAQA 1K7AA 1D3YA 4RB1A 4K2EA 1ZGAA 3GFLA 1MKMA 4G7OF 1XDUA 3WU0A 3FX3A 4P9FA 1FBQA 2OA4A 4YFXF 4RB3C 3I54A 4WXHA 3GFMA 2CO5A 3RI4A 2AS5F 2UWMA 5CVJA 5IT9K 3KEOA 4JQFA 1NHAA 2IW5A 3CDHA 4G7HF 1ZN2A 2OBPA 1STZA 1IRGA 3R61A 1XSDA 4N0BA 3BDDA 5DCFA 4Q4ZF 3H3UA 3I71A 2WV0A 1WSUA 2YPRA 2UZKA 4D0PA 5LHHA 2ZFWA 3QRFF 1JGSA 2DTRA 1BC8C 2P7CB 3HHHA 1BM9A 3F3XA 2IA2A 4KNYA 1KA8A 3IKTA 5DYMA 2DAOA 2PEXA 2F2EA 2W84A 2QBYB 2YR2A 4OIRF 2E1NA 3PQJA 4HX4A 1B59A 4CDGA 1SAXA 4EGYA 3GUDA 1G3SA 1V3FA 2EA4A 4NQWA 5D6EA 4GYGA 3QOPA 3Q5FA 1BI2A 3O3KA 4GYIA 2LDUA 1FT9A 5TJJA 1E17A 3HRTA 3FM3A 3HOTA 5FLXK 4UV9A 2HTSA 1QGPA 3CJNA 3MZYA 2JPCA 2BV6A 2DQRA 1HW2A 1FYLA 4M9SA 2J5OA 4ESJA 1I27A 2VC1A 5E17F 2JT1A 2Z5UA 4I02A 1ZG1A 3CTAA 3K69A 4BHBA 4ZH4F 4LB6B 3ERED 5JHUA 1TQPA 3QPHA 3WG9A 3KP4A 3NRVA 3U9GA 2V79A 2HYFA 4XLNF 3J80K 3TO6A 1CF7B 1K6OA 3TOBA 3KP5A 3ML6A 2O6GE 3RJPA 1W4MA 2IP2A 3ZN0A 2PLYA 4WXDA 1USSA 3E5XA 2YSRA 2XKPA 3NEUA 2QQAA 1SFEA 2FF4A 4ZZDA 3M1EA 1D8KA 1SD4A 1FBSA 3E6BA 5ICGA 2QM3A 3VODA 2IRFG 4YFKF 2D45A 1FPQA 1MJBA 2MLKA 2R3SA 4BYYA 4ASNA 3P9CA 1Z6RA 4ZYGA 3TO9A 3KCCA 1IRFA 1XB4A 5BS6A 5HDNA 3ZMUA 1U5TA 2XASA 4IHTA 3F72A 4O6JA 3LA2A 2RV8A 5HVQC 4M6YA 2FU4A 1SD5A 3CUQA 5CVUA 3HSFA 5CVRA 4ENKA 1QBJA 4PGHA 2JPBA 3R0AA 4L9TA 4M73A 3RYRA 4ZYHA 4IPAA 2M8EA 2K27A 2VN2A 2LF8A 3V8KA 5CLSA 1BOAA 3IWZA 2F5EA 2QZ8A 1KGSA 1B9MA 5DCMA 1YS6A 3GFJA 2O3FA 4M9XA 4HDVA 3SZTA 3RKYA 4OIPF 2LF7A 5L3BA 4LD5A 2P4WA 1BN5A 1GVJA 5FGMA 4KICA 2W24A 2UXNA 2CG4A 1USTA 2ZNZA 1S7AA 1C0WA 2GA2A 4HX8A 1MD0A 3MFKA 5JFRA 3HIFA 1LDJA 4R1HA 4I0BA 1KQ0A 2Y48A 4AWXB 2OQGA 4HYEA 1YIOA 4Q47A 4WCGA 1KU2A 5D5WB 4HV5A 1U3EM 5L3GA 3C18A 3Q9VA 3RPQA 4ENJA 4JBAA 3L9FA 1LVAA 3WTZA 3FMSA 2OZ6A 2ISZA 4XLPF 1JHHA 1REPC 3I59B 3H3ZA 2IA1A 3KLNA 3EDPA 4EJVA 4DQ2A 3MEXA 2F5FA 4NHJA 2O03A 3T5XA 1LJ9A 2FNAA 3F8MA 4EVIA 4CHUA 3GZ6A 5DD8A 3GYHX 4R79A 2J5PA 2MH9A 4I01A 3I0TA 4UHTA 5J8FA 3E6DA 3LFKA 3V4GA 1RUOA 2NNNA 1R22A 3CUOA 3ISPA 5ERIA 2PMHA 2VT3A 5D8KB 3J80Z 1EH7A 1RIOH 3T8RA 4BH9A 2XUBA 4M6XA 2FRHA 5HOOA 4RGRA 2NYXA 4CO8A 1UFMA 4UVBA 2FBIA 3VFZA 1PP8F 2L4AA 1BBYA 2E7XA 2LNBA 3WE3A 2QQ9A 5BOXA 1AOYA 2H94A 1F5TA 2LSOA 1EH6A 4IRGA 3KEQA 3E6CC 5E1WA 1KQ9A 2FE3A 3BROA 1HKQA 4FHTA 1U8RA 4HZFA 4O3MA 3C7JA 1Z7UA 2DU9A 5L3CA 3JW4A 3DV8A 3LSTA 5K5QA 1YLFA 3ECHA 3P9KA 4G7ZF 1LB2A 1G3WA 3REOA 3HSRA 4LGWA 2STTA 1PP7U 4U88A 4BHCA 4KYWA 1MDMA 2XIGA 2XAGA 2L4MA 4GGGA 2D1HA 1DDNA 3B02A 2P5KA 2DBBA 4PCQA 2ZO4A 4MGRA 5DEQA 4N9IA 1FYMA 1FBUA 4JK1X 4KMUX 4HF2A 2O61A 2COMA 4CICA 2TDXA 5K5RA 3WGHA 2IPQX 2QYOA 2EB7A 3F8BA 1J2XA 1I6XA 3LQQA 3GZ5A 2XROA 1YW9A 3I64A 2H27A 4HW0A 1RI7A 3E3VA 2EV6A 1XN7A 2BYVE 4EV0A 1HW5A 3COAC 5L3EA 2W85A 2VBXA 2P5LC 2ELHA 3TDZC 2O0YA 4YIIA 3VB2A 2R7DA 2CGPA 4ZZLA 4EGZA 1YG2A 2STWA 1B9NA 5D4SA 4IJAA 5D8LB 1RUNA 4FX4A 1BI0A 3OOPA 3IHUA 2D1VA 2CQKA 1HSTA 3BY6A 2M87A 4LLLA 3BJAA 2YU3A 4CGZA 3MZHA 5HS9A 4RAZA 3DF8A 2KRFA 4S05A 5DUIA 1G6NA 2Z99A 1OPCA 2DK5A 4N9HA 3IRRA 3KZYA 3IKVA 3E5UA 3KP6A 3ELKA 1D8JA 3ECOA 3M8FA 1H9TA 2DFIA 1ONVA 1P4WA 1QO0D 5BPDA 1J75A 1VTNC 1EV7A 1OYIA 2R7FA 1R1TA 4S04A 2EWNA 3HSEA 1ZRFA 2EFPA 3GW2A 3JSOA 5E18F 5AIQA 3AAFA 1H9GA 5FFZA 1LEBA 1FYKA 3CO7C 1UB9A 1LQ1A 4ZYDA 1R58A 2X4HA 4IXAA 3S2WA 2BGCA 2Y75A 4XBFA 3SQNA 5DD4A 2CW0F 4RGXA 4IVNA 4EJOA 4PGGA 1XGNA 5D6FA 3KZZA 4KT5C 4P5OA 1PUEE 1W7PA 1XGOA 2PBIA 3DPLC 4LLNA 5ICCA 4HLXA 3GWZA 1Z05A 5ICEA 2G7HA 5E8IA 2MA3A 3WTUC 4YIFA 3U1DA 1BI3A 3FXQA 2V1DA 4UV8A 2K7LA 2VBYA 1QNTA 2OZUA 2ZBKA 2HEOA 2A3SA 1I1SA 1S6LA 2FBKA 4L0ZB 2BBYA 3GF2A 4MTDA 2GQQA 3BZ6A 4GO1A 1T6SA 3M8EA 2HKXA 2ZCWA 1U6GA 3TOAA 1IN4A 1R1VA 1L0OC 1OKRA 1XCBA 2XGXA 4B09A 2EA2A 3SZPA 4CXFA 5LGNA 4UUVA 4I09A 3EYYA 2EV0A 3RTRA 3TO7A 3WTTC 1PDNC 5FD5A 1IAWA 1LNWA 2PG4A 1KQ8A 1T2KA 4G94A 5AONA 4LG0B 2VBWA 2XKOA 3BJOA 1J9IA 4MNUA 2VOPA 3N97A 5CJ9A 5HLGA 4I98B 4OU0A 2M5WA 3DPTA 5DUKA 4EM1A 1GXQA 3NQOA 1R5HA 1KYZA 4AVPA 1JXSA 4MQVA 2FOKA 2V1UA 2K4JA 1O7FA 2P7VB 3HTUA 4UXNA 5JVTA 2FSWA 3SFZA 4G8XA 3J81K 2EK5A 3TGNA 2HS5A 1UCRA 5L3DA 3K9TA 1XGSA 4KA4A 5CVIA 2XV4S 1OYWA 5H6RA 3F21A 1J0RA 3K1PA 5J6XA 1TW2A 1ZLKA 2C6YA 5IT9Z 1H0MA 3J7AO 1WWXA 3WGIA 3F6VA 5CYVA 3R60A 4P9UA 1W5SA 1TBXA 2DQLA 4OMZA 5L3FA 1RNLA 3L09A 2XHKA 1YTYA 4PDKA 2VBZA 4GXOA 5D5XB 4KN7X 4KDPA 1A04A 1T38A 5ILVA 5ED4A 2ZKZA 2F5CA 4U0VA 2MD5A 3QAHA 4L9JA 5LEKA 2X0LA 1OYYA 2GIVA 1R1UA 3CO6C 5HDKA 2OU2A 3FXRA 3ABUA 2M45A 3V7SA 1FP2A 1K78B 1IN6A 2KJCA 3HTSB 2FBHA 2P5VA 3L2CA 2VOOA 3KP7A 2XVCA 2PN6A 3KP3A 4H0EA 1ZREA 2PMUA 3OV8A 4IRIA 3W6JB 1U5TC 3GLXA 4KFCA 3V8JA 4A6DA 2KJBA 3RPUA 2K02A 3JTGA 4HA8A 4RB2C 4G6QA 5FLXZ 4AIJA 5LRRA 2NRAC 4L9VA 1IXCA 3QU3A 1KU3A 2H6BA 4KN4X 2E1CA 2RC4A 4QWQA 4WWCA 1S7OA 1ZG3A 2P6SA 3QP6A 4Y13A 2DI3A 1MJAA 3K0LA 3O2PE 2ACJA 1ZAOA 2UXXA 1TLHB 2KIUA 3QP5A 4HQEA 1FOKA 3HYIA 2KKOA 1J7KA 1P2FA 4EQQA 1DPUA 1B6AA 1DP7P 2EV5A 4U0YA 3RDIA 2DO7A 2FEZA 1XSXA 3B73A 2QUFA 4HAMA 4NB5A 1MGTA 5LGUA 3R4KA 4KIBA 4OMYA 1MJ9A 4HBLA 4Q48A 4A5NA 1DUXC 1TNSA 2EFQA 2ZJ2A 3GXOA 3D5LA 1XMKA 1SFXA 2HYGD 4UVCA 3I53A 5K1YA 1GHCA 4ETSA 1TW3A 3BP8A 3EYIA 1WI9A 4O5VA 4RGUA 3JTHA 4BHPA 2QBYA 1W7PD 3FMRA 2VC0A 3J81Z 3MAJA 2VE9A 4RGSA 1FY7A 3TDUC 1KYWA 3I58A 1R7JA 1SD7A 3M9AA 1QPMA 2ETHA 1Q1HA 2A69F 3HRSA 4AIKA 1CGPA 3PFIA 1I5ZA 2GWRA 2W25A 1UHWA 5LEJA 3T8TA 2NS0A 1U5TB 3IRQA 3LQRA 3ZQ7A 2IT0A 3V7CA 5ILSA 3DFGA 3LAJA 2JZYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FNP A;  1XSV A;  5HLH A;  3T0Y A;  1SMY F;  1K79 A;  3DEU A;  5DCM B;  3ZP5 A;  2Q0O A;  5DV5 A;  3BOQ A;  4A0Z A;  1CF7 A;  3O6B B;  4BNC A;  4FX0 A;  1XDS A;  4EM2 A;  2DPU A;  4OIQ F;  4IHS A;  3C3W A;  4M72 A;  1HKS A;  5F64 A;  1WRJ A;  1R36 A;  3FM5 A;  2WWY A;  5E1X A;  2DLL A;  4M71 A;  1YW7 A;  4KMF A;  3MCZ A;  4HF1 A;  2RNJ A;  2HOE A;  2MBF A;  3FXU A;  2A07 F;  3RIR A;  5A2Q K;  5D5V B;  2Q2E A;  3WTX C;  5KVR A;  4PZJ A;  1XGM A;  1L3L A;  2QLZ A;  3SHF A;  1F1Z A;  5HDG A;  2RKH A;  2KIF A;  2L02 A;  3LA7 A;  4A6E A;  5JI6 A;  1FP1 D;  1ON1 A;  4LK1 F;  3K1M A;  1E2X A;  4L0Y B;  1IN8 A;  4FT8 A;  2V1X A;  1HBX G;  1BI1 A;  3HUG A;  4A5M A;  2MC3 A;  3IL2 A;  2ZXJ A;  3V7R A;  3VOE A;  1ZYR F;  1R23 A;  1O3R A;  4EMS A;  3WE2 A;  1ULY A;  2HKO A;  2QQB A;  1B4A A;  1IF1 A;  3DP7 A;  1HW1 A;  4HOB A;  2RVC A;  1J59 A;  5TRD A;  2FQ3 A;  2HQN A;  3HOS A;  4B8X A;  1YW8 A;  1FWZ A;  4L9N A;  3T1B A;  3F8F A;  4LK0 F;  3E97 A;  3WTV C;  5K5O A;  2GXG A;  2P8T A;  2M1B A;  2NNY A;  1SFU A;  1ZGJ A;  1YO5 C;  5D5U B;  1O57 A;  4Q5S F;  2A6E F;  4G6D A;  2CSO A;  1R5G A;  4ENN A;  3HRU A;  4UNO A;  4MEY F;  2HDC A;  4BAY A;  1FSE A;  1ZG5 A;  2A61 A;  2GAU A;  1ZRC A;  4KUM A;  5FFX A;  3ABT A;  1YS7 A;  4U0W A;  2Z3Y A;  1FLI A;  2ZME B;  4I0A A;  1G4D A;  4HF0 A;  4XSX F;  4Z2Y A;  1ODD A;  2YX7 A;  2D2W A;  1KU9 A;  3K2Z A;  3KE2 A;  3IC7 A;  1T0F A;  1K78 A;  2JRT A;  5DDG A;  5J8C A;  4CYD A;  3DXJ F;  5IT3 A;  5ILU A;  4HV6 A;  2EFN A;  3F8C A;  3W6K B;  1O7L A;  3EUH A;  1B1B A;  3TKY A;  2G9W A;  1FX7 A;  1ZRD A;  2ESH A;  2XAF A;  5CVV A;  3LAP A;  3BJ6 A;  1QZZ A;  5FD6 A;  3WTY C;  3LWF A;  3V8L A;  2Z9O A;  4RS8 A;  2HZT A;  2FXA A;  1FNN A;  2HTJ A;  1QQI A;  1MZB A;  5LBQ A;  3C1D A;  3I59 A;  2ADU A;  1T39 A;  1Z1D A;  2WTE A;  3MWM A;  4R8H A;  5LGT A;  3ROU A;  1UHM A;  1X3U A;  2Y0M A;  2JSC A;  3VEP A;  1MDM B;  1Y0U A;  2WC2 A;  3EET A;  5LHG A;  4MTE A;  1IW7 F;  3EQL F;  4I7H A;  2FMY A;  4ZYE A;  3F6O A;  2OAZ A;  1P4X A;  1D5V A;  2DK8 A;  3FMQ A;  1AWC A;  1DPR A;  1YQA A;  2L01 A;  5FO5 A;  3P7N A;  4EM0 B;  3RKX A;  4MQ9 F;  2BE5 F;  5F6F A;  2CWE A;  4L5I A;  1XCV A;  3H92 A;  5BMZ A;  2F5D A;  1IXS B;  1WKM A;  2NAZ A;  3ZMD A;  2Z33 A;  2H6C A;  2QEN A;  3WGG A;  4YG2 F;  3L00 A;  5A2Q Z;  2H09 A;  4MEX F;  1O3Q A;  1IUY A;  1SMT A;  3IWF A;  3ZN1 A;  3GO5 A;  1XMA A;  3SXY A;  3JAM K;  5HS7 A;  4ENM A;  1BC7 C;  1ZLJ A;  1FZP B;  1TTY A;  2ZNY A;  2HGC A;  1TQI A;  1G3T A;  3D0S A;  2M30 A;  2A68 F;  3WTW C;  4IF4 A;  4BXU A;  3G73 A;  3L7W A;  2MH2 A;  2QWW A;  2A6H F;  3DKW A;  3BWG A;  1LDD A;  2W57 A;  1LDK B;  6PAX A;  3ZMT A;  3F22 A;  5LHI A;  1V4R A;  2DT5 A;  1XD7 A;  1YFH A;  4HX7 A;  1U2W A;  2O8X A;  1YYV A;  4LMY A;  1W5T A;  1P6R A;  4U7D A;  4EJW A;  2PQ8 A;  5BPI A;  4OIN F;  4AD9 A;  3GVA A;  2DPD A;  3ZPL A;  3QU6 A;  2RQP A;  5ICF A;  1FC3 A;  2JTV A;  1U78 A;  4RAY A;  5AIP A;  3E5Q A;  3PQK A;  2IA0 A;  1GXP A;  4I2O A;  4OOI A;  5H20 A;  2K86 A;  1S8N A;  3R0J A;  5E8G A;  2V6C A;  1ZH5 A;  4TV7 A;  1I1G A;  2VE8 A;  4HQM A;  1R00 A;  1S3J A;  4L5J A;  5HS8 A;  1O3S A;  2HFH A;  5D4R A;  1P4A A;  4BQA A;  2HWV A;  2BEO A;  2XAJ A;  5H6Q A;  1JHF A;  1ON2 A;  3BPV A;  5EEG A;  3GEZ A;  3K1N A;  2MLG A;  1OMI A;  1W7P B;  2PI0 A;  3CUQ C;  1LEA A;  4XRF A;  5LRS A;  1O3T A;  1F4K A;  3WU1 B;  3MQ0 A;  1Z91 A;  4M9Z A;  2HQR A;  4U7B A;  2AXL A;  2ESN A;  4E70 A;  4G9Y A;  1BIB A;  2E7W A;  1TNT A;  3G3Z A;  2CYY A;  4P55 A;  1BIA A;  4ESF A;  1TQM A;  3DQV C;  4WK8 F;  4XSZ F;  2G7U A;  2VXZ A;  3ZMS A;  2Q8K A;  3R6S A;  3M7G A;  2A5Y B;  2RDP A;  4WX9 A;  4MHG A;  1Z6T A;  3JSP A;  1FSH A;  2PFB A;  1F9N A;  3ZMZ A;  3FF5 A;  2RN7 A;  3F8N A;  2FML A;  3HRM A;  4HLY A;  3KET A;  3GX4 X;  5E1Z B;  2V9V A;  4UVA A;  4P96 A;  4LLG F;  4QLC U;  5BQT A;  5E20 A;  4AIH A;  2ISY A;  4M74 A;  1IZ1 A;  4LFU A;  3KFW X;  3I5U A;  2KIM A;  4A2U A;  3RYP A;  3I4P A;  2GXB A;  2P6T A;  1HQC A;  2PJP A;  5KK1 A;  2ZME A;  1SD6 A;  1WQ2 A;  2EFO A;  1JE8 A;  2DW4 A;  3ULQ B;  3WTS C;  2QVO A;  2VT2 A;  3P9I A;  4ON0 A;  2L54 A;  2IVM A;  1G3Y A;  5FB2 A;  2IJL A;  2B0L A;  4KIG A;  1EH8 A;  1J5Y A;  3JAM Z;  1RZ4 A;  4IRH A;  3QPT A;  3FHZ A;  4DNC A;  1BJA A;  2EFW A;  1ZAR A;  3U2R A;  4Y17 A;  3TQN A;  4YFN F;  2VOD A;  3KLO A;  1Z9C A;  4WXC A;  4GCV A;  1HXD A;  2OD5 A;  1IXR C;  3Q9S A;  3FZV A;  4HDU A;  1IN7 A;  3CUQ B;  1P92 A;  1QZY A;  1S29 A;  3LA3 A;  2HR3 A;  3ZMV A;  4RB0 A;  4LJZ F;  3BPX A;  2XRN A;  3KP2 A;  3WOD F;  3N4M A;  4CZZ A;  2YX4 A;  4ESB A;  1T98 A;  4OIO F;  2L3D A;  4A0X A;  5EEH A;  1KU7 A;  4KIF A;  5HLI A;  2XAH A;  3CLO A;  2CFX A;  5JR3 A;  4LB5 A;  2GA1 A;  4LG0 A;  2VON A;  4Y15 A;  5LLQ A;  4A12 A;  2EJR A;  5F1R A;  2OQR A;  2LKP A;  3HHG A;  1IN5 A;  4L18 B;  3GFI A;  2K4B A;  1OR7 A;  4EJU A;  4WF2 A;  2RGV A;  4F7Z A;  1ZHF A;  3RKW A;  3F23 A;  3FWE A;  2GZW A;  3E6M A;  1HSJ A;  2FA5 A;  4EJT A;  1HKT A;  4A0Y A;  2XAQ A;  1K7A A;  1D3Y A;  4RB1 A;  4K2E A;  1ZGA A;  3GFL A;  1MKM A;  4G7O F;  1XDU A;  3WU0 A;  3FX3 A;  4P9F A;  1FBQ A;  2OA4 A;  4YFX F;  4RB3 C;  3I54 A;  4WXH A;  3GFM A;  2CO5 A;  3RI4 A;  2AS5 F;  2UWM A;  5CVJ A;  5IT9 K;  3KEO A;  4JQF A;  1NHA A;  2IW5 A;  3CDH A;  4G7H F;  1ZN2 A;  2OBP A;  1STZ A;  1IRG A;  3R61 A;  1XSD A;  4N0B A;  3BDD A;  5DCF A;  4Q4Z F;  3H3U A;  3I71 A;  2WV0 A;  1WSU A;  2YPR A;  2UZK A;  4D0P A;  5LHH A;  2ZFW A;  3QRF F;  1JGS A;  2DTR A;  1BC8 C;  2P7C B;  3HHH A;  1BM9 A;  3F3X A;  2IA2 A;  4KNY A;  1KA8 A;  3IKT A;  5DYM A;  2DAO A;  2PEX A;  2F2E A;  2W84 A;  2QBY B;  2YR2 A;  4OIR F;  2E1N A;  3PQJ A;  4HX4 A;  1B59 A;  4CDG A;  1SAX A;  4EGY A;  3GUD A;  1G3S A;  1V3F A;  2EA4 A;  4NQW A;  5D6E A;  4GYG A;  3QOP A;  3Q5F A;  1BI2 A;  3O3K A;  4GYI A;  2LDU A;  1FT9 A;  5TJJ A;  1E17 A;  3HRT A;  3FM3 A;  3HOT A;  5FLX K;  4UV9 A;  2HTS A;  1QGP A;  3CJN A;  3MZY A;  2JPC A;  2BV6 A;  2DQR A;  1HW2 A;  1FYL A;  4M9S A;  2J5O A;  4ESJ A;  1I27 A;  2VC1 A;  5E17 F;  2JT1 A;  2Z5U A;  4I02 A;  1ZG1 A;  3CTA A;  3K69 A;  4BHB A;  4ZH4 F;  4LB6 B;  3ERE D;  5JHU A;  1TQP A;  3QPH A;  3WG9 A;  3KP4 A;  3NRV A;  3U9G A;  2V79 A;  2HYF A;  4XLN F;  3J80 K;  3TO6 A;  1CF7 B;  1K6O A;  3TOB A;  3KP5 A;  3ML6 A;  2O6G E;  3RJP A;  1W4M A;  2IP2 A;  3ZN0 A;  2PLY A;  4WXD A;  1USS A;  3E5X A;  2YSR A;  2XKP A;  3NEU A;  2QQA A;  1SFE A;  2FF4 A;  4ZZD A;  3M1E A;  1D8K A;  1SD4 A;  1FBS A;  3E6B A;  5ICG A;  2QM3 A;  3VOD A;  2IRF G;  4YFK F;  2D45 A;  1FPQ A;  1MJB A;  2MLK A;  2R3S A;  4BYY A;  4ASN A;  3P9C A;  1Z6R A;  4ZYG A;  3TO9 A;  3KCC A;  1IRF A;  1XB4 A;  5BS6 A;  5HDN A;  3ZMU A;  1U5T A;  2XAS A;  4IHT A;  3F72 A;  4O6J A;  3LA2 A;  2RV8 A;  5HVQ C;  4M6Y A;  2FU4 A;  1SD5 A;  3CUQ A;  5CVU A;  3HSF A;  5CVR A;  4ENK A;  1QBJ A;  4PGH A;  2JPB A;  3R0A A;  4L9T A;  4M73 A;  3RYR A;  4ZYH A;  4IPA A;  2M8E A;  2K27 A;  2VN2 A;  2LF8 A;  3V8K A;  5CLS A;  1BOA A;  3IWZ A;  2F5E A;  2QZ8 A;  1KGS A;  1B9M A;  5DCM A;  1YS6 A;  3GFJ A;  2O3F A;  4M9X A;  4HDV A;  3SZT A;  3RKY A;  4OIP F;  2LF7 A;  5L3B A;  4LD5 A;  2P4W A;  1BN5 A;  1GVJ A;  5FGM A;  4KIC A;  2W24 A;  2UXN A;  2CG4 A;  1UST A;  2ZNZ A;  1S7A A;  1C0W A;  2GA2 A;  4HX8 A;  1MD0 A;  3MFK A;  5JFR A;  3HIF A;  1LDJ A;  4R1H A;  4I0B A;  1KQ0 A;  2Y48 A;  4AWX B;  2OQG A;  4HYE A;  1YIO A;  4Q47 A;  4WCG A;  1KU2 A;  5D5W B;  4HV5 A;  1U3E M;  5L3G A;  3C18 A;  3Q9V A;  3RPQ A;  4ENJ A;  4JBA A;  3L9F A;  1LVA A;  3WTZ A;  3FMS A;  2OZ6 A;  2ISZ A;  4XLP F;  1JHH A;  1REP C;  3I59 B;  3H3Z A;  2IA1 A;  3KLN A;  3EDP A;  4EJV A;  4DQ2 A;  3MEX A;  2F5F A;  4NHJ A;  2O03 A;  3T5X A;  1LJ9 A;  2FNA A;  3F8M A;  4EVI A;  4CHU A;  3GZ6 A;  5DD8 A;  3GYH X;  4R79 A;  2J5P A;  2MH9 A;  4I01 A;  3I0T A;  4UHT A;  5J8F A;  3E6D A;  3LFK A;  3V4G A;  1RUO A;  2NNN A;  1R22 A;  3CUO A;  3ISP A;  5ERI A;  2PMH A;  2VT3 A;  5D8K B;  3J80 Z;  1EH7 A;  1RIO H;  3T8R A;  4BH9 A;  2XUB A;  4M6X A;  2FRH A;  5HOO A;  4RGR A;  2NYX A;  4CO8 A;  1UFM A;  4UVB A;  2FBI A;  3VFZ A;  1PP8 F;  2L4A A;  1BBY A;  2E7X A;  2LNB A;  3WE3 A;  2QQ9 A;  5BOX A;  1AOY A;  2H94 A;  1F5T A;  2LSO A;  1EH6 A;  4IRG A;  3KEQ A;  3E6C C;  5E1W A;  1KQ9 A;  2FE3 A;  3BRO A;  1HKQ A;  4FHT A;  1U8R A;  4HZF A;  4O3M A;  3C7J A;  1Z7U A;  2DU9 A;  5L3C A;  3JW4 A;  3DV8 A;  3LST A;  5K5Q A;  1YLF A;  3ECH A;  3P9K A;  4G7Z F;  1LB2 A;  1G3W A;  3REO A;  3HSR A;  4LGW A;  2STT A;  1PP7 U;  4U88 A;  4BHC A;  4KYW A;  1MDM A;  2XIG A;  2XAG A;  2L4M A;  4GGG A;  2D1H A;  1DDN A;  3B02 A;  2P5K A;  2DBB A;  4PCQ A;  2ZO4 A;  4MGR A;  5DEQ A;  4N9I A;  1FYM A;  1FBU A;  4JK1 X;  4KMU X;  4HF2 A;  2O61 A;  2COM A;  4CIC A;  2TDX A;  5K5R A;  3WGH A;  2IPQ X;  2QYO A;  2EB7 A;  3F8B A;  1J2X A;  1I6X A;  3LQQ A;  3GZ5 A;  2XRO A;  1YW9 A;  3I64 A;  2H27 A;  4HW0 A;  1RI7 A;  3E3V A;  2EV6 A;  1XN7 A;  2BYV E;  4EV0 A;  1HW5 A;  3COA C;  5L3E A;  2W85 A;  2VBX A;  2P5L C;  2ELH A;  3TDZ C;  2O0Y A;  4YII A;  3VB2 A;  2R7D A;  2CGP A;  4ZZL A;  4EGZ A;  1YG2 A;  2STW A;  1B9N A;  5D4S A;  4IJA A;  5D8L B;  1RUN A;  4FX4 A;  1BI0 A;  3OOP A;  3IHU A;  2D1V A;  2CQK A;  1HST A;  3BY6 A;  2M87 A;  4LLL A;  3BJA A;  2YU3 A;  4CGZ A;  3MZH A;  5HS9 A;  4RAZ A;  3DF8 A;  2KRF A;  4S05 A;  5DUI A;  1G6N A;  2Z99 A;  1OPC A;  2DK5 A;  4N9H A;  3IRR A;  3KZY A;  3IKV A;  3E5U A;  3KP6 A;  3ELK A;  1D8J A;  3ECO A;  3M8F A;  1H9T A;  2DFI A;  1ONV A;  1P4W A;  1QO0 D;  5BPD A;  1J75 A;  1VTN C;  1EV7 A;  1OYI A;  2R7F A;  1R1T A;  4S04 A;  2EWN A;  3HSE A;  1ZRF A;  2EFP A;  3GW2 A;  3JSO A;  5E18 F;  5AIQ A;  3AAF A;  1H9G A;  5FFZ A;  1LEB A;  1FYK A;  3CO7 C;  1UB9 A;  1LQ1 A;  4ZYD A;  1R58 A;  2X4H A;  4IXA A;  3S2W A;  2BGC A;  2Y75 A;  4XBF A;  3SQN A;  5DD4 A;  2CW0 F;  4RGX A;  4IVN A;  4EJO A;  4PGG A;  1XGN A;  5D6F A;  3KZZ A;  4KT5 C;  4P5O A;  1PUE E;  1W7P A;  1XGO A;  2PBI A;  3DPL C;  4LLN A;  5ICC A;  4HLX A;  3GWZ A;  1Z05 A;  5ICE A;  2G7H A;  5E8I A;  2MA3 A;  3WTU C;  4YIF A;  3U1D A;  1BI3 A;  3FXQ A;  2V1D A;  4UV8 A;  2K7L A;  2VBY A;  1QNT A;  2OZU A;  2ZBK A;  2HEO A;  2A3S A;  1I1S A;  1S6L A;  2FBK A;  4L0Z B;  2BBY A;  3GF2 A;  4MTD A;  2GQQ A;  3BZ6 A;  4GO1 A;  1T6S A;  3M8E A;  2HKX A;  2ZCW A;  1U6G A;  3TOA A;  1IN4 A;  1R1V A;  1L0O C;  1OKR A;  1XCB A;  2XGX A;  4B09 A;  2EA2 A;  3SZP A;  4CXF A;  5LGN A;  4UUV A;  4I09 A;  3EYY A;  2EV0 A;  3RTR A;  3TO7 A;  3WTT C;  1PDN C;  5FD5 A;  1IAW A;  1LNW A;  2PG4 A;  1KQ8 A;  1T2K A;  4G94 A;  5AON A;  4LG0 B;  2VBW A;  2XKO A;  3BJO A;  1J9I A;  4MNU A;  2VOP A;  3N97 A;  5CJ9 A;  5HLG A;  4I98 B;  4OU0 A;  2M5W A;  3DPT A;  5DUK A;  4EM1 A;  1GXQ A;  3NQO A;  1R5H A;  1KYZ A;  4AVP A;  1JXS A;  4MQV A;  2FOK A;  2V1U A;  2K4J A;  1O7F A;  2P7V B;  3HTU A;  4UXN A;  5JVT A;  2FSW A;  3SFZ A;  4G8X A;  3J81 K;  2EK5 A;  3TGN A;  2HS5 A;  1UCR A;  5L3D A;  3K9T A;  1XGS A;  4KA4 A;  5CVI A;  2XV4 S;  1OYW A;  5H6R A;  3F21 A;  1J0R A;  3K1P A;  5J6X A;  1TW2 A;  1ZLK A;  2C6Y A;  5IT9 Z;  1H0M A;  3J7A O;  1WWX A;  3WGI A;  3F6V A;  5CYV A;  3R60 A;  4P9U A;  1W5S A;  1TBX A;  2DQL A;  4OMZ A;  5L3F A;  1RNL A;  3L09 A;  2XHK A;  1YTY A;  4PDK A;  2VBZ A;  4GXO A;  5D5X B;  4KN7 X;  4KDP A;  1A04 A;  1T38 A;  5ILV A;  5ED4 A;  2ZKZ A;  2F5C A;  4U0V A;  2MD5 A;  3QAH A;  4L9J A;  5LEK A;  2X0L A;  1OYY A;  2GIV A;  1R1U A;  3CO6 C;  5HDK A;  2OU2 A;  3FXR A;  3ABU A;  2M45 A;  3V7S A;  1FP2 A;  1K78 B;  1IN6 A;  2KJC A;  3HTS B;  2FBH A;  2P5V A;  3L2C A;  2VOO A;  3KP7 A;  2XVC A;  2PN6 A;  3KP3 A;  4H0E A;  1ZRE A;  2PMU A;  3OV8 A;  4IRI A;  3W6J B;  1U5T C;  3GLX A;  4KFC A;  3V8J A;  4A6D A;  2KJB A;  3RPU A;  2K02 A;  3JTG A;  4HA8 A;  4RB2 C;  4G6Q A;  5FLX Z;  4AIJ A;  5LRR A;  2NRA C;  4L9V A;  1IXC A;  3QU3 A;  1KU3 A;  2H6B A;  4KN4 X;  2E1C A;  2RC4 A;  4QWQ A;  4WWC A;  1S7O A;  1ZG3 A;  2P6S A;  3QP6 A;  4Y13 A;  2DI3 A;  1MJA A;  3K0L A;  3O2P E;  2ACJ A;  1ZAO A;  2UXX A;  1TLH B;  2KIU A;  3QP5 A;  4HQE A;  1FOK A;  3HYI A;  2KKO A;  1J7K A;  1P2F A;  4EQQ A;  1DPU A;  1B6A A;  1DP7 P;  2EV5 A;  4U0Y A;  3RDI A;  2DO7 A;  2FEZ A;  1XSX A;  3B73 A;  2QUF A;  4HAM A;  4NB5 A;  1MGT A;  5LGU A;  3R4K A;  4KIB A;  4OMY A;  1MJ9 A;  4HBL A;  4Q48 A;  4A5N A;  1DUX C;  1TNS A;  2EFQ A;  2ZJ2 A;  3GXO A;  3D5L A;  1XMK A;  1SFX A;  2HYG D;  4UVC A;  3I53 A;  5K1Y A;  1GHC A;  4ETS A;  1TW3 A;  3BP8 A;  3EYI A;  1WI9 A;  4O5V A;  4RGU A;  3JTH A;  4BHP A;  2QBY A;  1W7P D;  3FMR A;  2VC0 A;  3J81 Z;  3MAJ A;  2VE9 A;  4RGS A;  1FY7 A;  3TDU C;  1KYW A;  3I58 A;  1R7J A;  1SD7 A;  3M9A A;  1QPM A;  2ETH A;  1Q1H A;  2A69 F;  3HRS A;  4AIK A;  1CGP A;  3PFI A;  1I5Z A;  2GWR A;  2W25 A;  1UHW A;  5LEJ A;  3T8T A;  2NS0 A;  1U5T B;  3IRQ A;  3LQR A;  3ZQ7 A;  2IT0 A;  3V7C A;  5ILS A;  3DFG A;  3LAJ A;  2JZY A; 
#chains in the Genus database with same CATH topology
 2FNP A;  1XSV A;  4Y4R A;  5HLH A;  4IHX A;  2WB1 N;  3T0Y A;  2CV2 A;  1U9O A;  3OYH A;  2ZME C;  4HST A;  2VB6 A;  1ZR4 A;  1SMY F;  2BZT A;  2BW3 B;  3K4N A;  1K79 A;  2JWT A;  3DEU A;  2CUJ A;  1HDD C;  5DCM B;  3PO2 J;  2E1M C;  2ZFU A;  3JRG A;  3ZP5 A;  2Q0O A;  5DV5 A;  3BOQ A;  4A0Z A;  5IP9 J;  3CCJ I;  1CF7 A;  3O6B B;  4CCM A;  4BNC A;  4FX0 A;  1XDS A;  3DU5 A;  2L7Z A;  3FK6 A;  3QPS A;  3ZQQ A;  4BAC A;  4EM2 A;  4FE4 A;  5TGT A;  2DPU A;  4IHS A;  3C3W A;  4OIQ F;  4M72 A;  1HKS A;  4HEA 2;  4DYR A;  1SVL A;  1WRJ A;  5F64 A;  4MIM A;  1NTC A;  2WAD A;  1FOW A;  1R36 A;  3FM5 A;  2WWY A;  2DMP A;  5E1X A;  2DLL A;  4M71 A;  3HOY J;  1YW7 A;  2M2E A;  4KMF A;  3G1O A;  3MCZ A;  2BY3 A;  1NG7 A;  2M4G A;  4HF1 A;  1WJA A;  2RNJ A;  1VQ8 I;  1MNE A;  2HOE A;  2V4J C;  2MBF A;  3FXU A;  2A07 F;  3RIR A;  5A2Q K;  1W1W E;  4XR6 A;  5D5V B;  3Q0V A;  2Q2E A;  5KVR A;  3WTX C;  4PZJ A;  1DU0 A;  5GTH C;  1XGM A;  1L3L A;  2QLZ A;  3SHF A;  3GBG A;  4E7S A;  1R4M B;  1F1Z A;  5HDG A;  2RKH A;  2KIF A;  2L02 A;  1XG1 A;  2JA6 J;  3LA7 A;  3CQZ J;  4A6E A;  3BR5 A;  3RCO A;  5JI6 A;  1FP1 D;  1ON1 A;  4LK1 F;  3K1M A;  1E2X A;  4L0Y B;  1IN8 A;  4JP0 A;  4FT8 A;  3H5A A;  4CCK A;  2V1X A;  3PSI A;  1HBX G;  3ZXS A;  2LBF B;  1BI1 A;  3HUG A;  3TMO A;  1IGN A;  1E3H A;  4A5M A;  2MC3 A;  3IL2 A;  4RDU A;  1S7E A;  3DEE A;  4QPO A;  2KZG A;  2ZXJ A;  3V7R A;  3VOE A;  4CZC A;  1MW7 A;  3HB9 A;  2V9K A;  4AVZ A;  1ZYR F;  1R23 A;  1O3R A;  1W36 D;  4EMS A;  5FKL A;  3WE2 A;  1ULY A;  2HKO A;  2MSY A;  4HRI A;  2QQB A;  1B4A A;  1IF1 A;  5FLV A;  3DP7 A;  1HW1 A;  4RLQ A;  4HOB A;  2RVC A;  4ZC3 A;  4HPQ A;  1J59 A;  3HKZ N;  5TRD A;  2EIL H;  3FDY A;  2FQ3 A;  2DMQ A;  1HDP A;  2Y0S N;  3ZQC A;  5FKK A;  2HOT A;  5CPR B;  2HQN A;  3HOS A;  2X6O A;  4B8X A;  2DJI A;  1YW8 A;  1FWZ A;  4L9N A;  3LOC A;  3QWL A;  3T1B A;  3MD2 A;  2R5Z A;  1U8B A;  2JA2 A;  3F8F A;  4M3B A;  2XPW A;  3K4J A;  1T8I A;  4LK0 F;  3E97 A;  3WTV C;  1I39 A;  2NOG A;  4LIV A;  3OMY A;  5K5O A;  2GXG A;  1IRX A;  2P8T A;  2M1B A;  2NNY A;  1SFU A;  1IV6 A;  1ZGJ A;  4XLA A;  1YO5 C;  5D5U B;  1ORK A;  3CC2 I;  1O57 A;  4Q5S F;  4P1W A;  1RC9 A;  2A6E F;  1ZEL A;  2CSO A;  4G6D A;  1HCR A;  1R5G A;  2VJJ A;  4N4N B;  1U0J A;  4ENN A;  2QKM B;  3HRU A;  3OYN A;  4UNO A;  4MEY F;  4XM3 A;  2HDC A;  3HEF A;  4BAY A;  2LOO A;  1FSE A;  1ZG5 A;  1X58 A;  5B3S H;  2A61 A;  3DTI A;  1OR7 C;  3AL0 C;  2GAU A;  1ZRC A;  1Z21 A;  2X9D A;  4KUM A;  5FFX A;  3ABT A;  2FQ4 A;  1YS7 A;  4U0W A;  1S9H A;  2Z3Y A;  2BY0 A;  1DQU A;  1FLI A;  2ZME B;  3S15 J;  3H35 A;  2KDZ A;  3N05 A;  4I0A A;  2M4K A;  3M4O J;  3WU2 C;  1G4D A;  4HF0 A;  4XSX F;  2KPM A;  3HOZ J;  4Z2Y A;  1ODD A;  1ZKG A;  4FQG A;  2YX7 A;  2D2W A;  1Z67 A;  4N4O B;  1KU9 A;  3K2Z A;  3BG7 A;  3KE2 A;  5IY5 H;  2E1M B;  4CYC B;  4X6A J;  3IC7 A;  2LY9 A;  1T0F A;  2LRD A;  1K78 A;  2JRT A;  5DDG A;  5J8C A;  4CYD A;  3DXJ F;  5IT3 A;  2X48 A;  5ILU A;  4HV6 A;  2HNH A;  2EFN A;  3F8C A;  3W6K B;  1OCP A;  2IXS A;  3CCM I;  1ETV A;  4KIT B;  3S93 A;  1O7L A;  2EIJ H;  1B72 A;  3EUH A;  3TBI A;  3OS2 A;  2R92 J;  1B1B A;  2E5N A;  1Y56 A;  2F4I A;  2VIX A;  2VKV A;  3K10 A;  3TKY A;  1TL8 A;  2G9W A;  2VAS A;  4B48 A;  3CJR B;  1FX7 A;  1ZRD A;  2ESH A;  2XAF A;  3RPU D;  5CVV A;  3OYG A;  3LAP A;  1GVD A;  3SZG A;  3BJ6 A;  1QZZ A;  3H36 A;  5FD6 A;  3H0G J;  3LWF A;  3WTY C;  3SYT A;  3V8L A;  2Z9O A;  4RS8 A;  2E71 A;  2HZT A;  2DA5 A;  2FXA A;  1FNN A;  2BHY A;  2HTJ A;  2L5Q A;  1QQI A;  3HXL A;  2QA4 I;  1ZTR A;  1MZB A;  5LBQ A;  3C1D A;  3I59 A;  5FRO A;  2L7M P;  2ADU A;  3FIS A;  2V26 A;  1T39 A;  1Z1D A;  2WTE A;  3OYL A;  2Z1D A;  4FE7 A;  3MWM A;  4R8H A;  4ZJZ A;  5LGT A;  3ROU A;  4DBR A;  1UHM A;  2AXT C;  4GRI A;  4NC7 A;  5J47 A;  1X3U A;  3G2B A;  2Y0M A;  2JSC A;  3VEP A;  1MDM B;  1Y0U A;  1Z7L A;  2VPL A;  2WC2 A;  3BG3 A;  1FIP A;  3EET A;  5LHG A;  1AU7 A;  4MTE A;  1IW7 F;  2CQX A;  3EQL F;  2IGK A;  4I7H A;  2CQN A;  1V5E A;  5FLM J;  4ZTF A;  3OR1 C;  4F93 B;  3VPR A;  3S3N A;  2FMY A;  3QYF A;  3ONQ A;  4XLH A;  4ZYE A;  2JA5 J;  3F6O A;  1AA7 A;  2OAZ A;  2HDD A;  1P4X A;  2VXD A;  1D5V A;  4C2T A;  4JX4 A;  3CCU I;  5F0C A;  2KHM A;  3PNY A;  2DK8 A;  3FMQ A;  1K61 A;  2EH3 A;  4BKX A;  1FMW A;  1AWC A;  5IP6 A;  1DPR A;  1YQA A;  1S72 I;  4A3C J;  4JX5 A;  3H0D A;  2L01 A;  2LKX A;  5FO5 A;  4I6Z A;  2H8W A;  1ERD A;  3P7N A;  4EM0 B;  3RKX A;  3GCM A;  4MQ9 F;  1H89 C;  2BE5 F;  2CS3 A;  5F6F A;  2CWE A;  1Y8R B;  3E0J B;  2E2J J;  2V9P A;  2XF6 A;  4L5I A;  1XCV A;  5JHF A;  4XRM A;  5KAI C;  3H92 A;  4BJ6 C;  3CMA I;  3BQY A;  1MBG A;  3DLL F;  2F5D A;  2M0M A;  3D5S C;  5BMZ A;  1TWF J;  1IXS B;  3TL4 X;  1WKM A;  2NAZ A;  1VQK I;  3ZMD A;  2Z33 A;  2R7T A;  2H6C A;  2QEN A;  2QF7 A;  3WGG A;  4YG2 F;  3L00 A;  1ETO A;  5A2Q Z;  2H09 A;  4MEX F;  1O3Q A;  4LG3 A;  2HOA A;  1IUY A;  1MND A;  2W1O A;  1VQN I;  1MSE C;  3C2G A;  2DCE A;  1SMT A;  3IWF A;  3TP3 A;  3ZN1 A;  4E7L A;  3GO5 A;  3BG6 A;  1XMA A;  3SXY A;  1N78 A;  3PUF A;  3JAM K;  5BNG A;  5HS7 A;  4ENM A;  3H9J A;  4OAY A;  2L7F P;  1BC7 C;  1ZLJ A;  1FZP B;  3FBN B;  1T08 B;  2M7A A;  1TTY A;  2E1O A;  3FXJ A;  2ZNY A;  3OY9 A;  2HGC A;  1R6R A;  1TQI A;  1JUP A;  2UUZ A;  3K4C A;  1ETX A;  1G3T A;  2ZJQ F;  1JT0 A;  3DBR B;  3D0S A;  2M30 A;  2CU7 A;  2A68 F;  3WTW C;  4IF4 A;  4BXU A;  3G73 A;  4FCY A;  3L7W A;  2MH2 A;  4PSW A;  2QWW A;  2A6H F;  3DKW A;  1UG2 A;  3CMY A;  3BWG A;  1LDD A;  2K9N A;  2W57 A;  1LDK B;  6PAX A;  3ZQG A;  4DOZ A;  5B1B H;  4CCL A;  5LD2 C;  2MFZ A;  5IYC J;  3GTJ J;  3S17 J;  1GLN A;  3ZMT A;  3F22 A;  5LHI A;  1RR8 C;  2LP0 A;  2AO9 A;  3RZO J;  1V4R A;  2DT5 A;  5DM7 F;  1D0Z A;  1XD7 A;  4RM3 A;  4BDZ A;  3A4C A;  1QVT A;  1YFH A;  2WV1 A;  4HX7 A;  2JJ7 A;  1U2W A;  2O8X A;  1YYV A;  2VL8 A;  5F27 A;  2NVU B;  4LMY A;  1W5T A;  1UG0 A;  2NVQ J;  4BBS J;  1P6R A;  2ZXW H;  4U7D A;  3S1R J;  4EJW A;  3ESW B;  3OYM A;  2PQ8 A;  5BPI A;  4BXX J;  4OIN F;  3HZJ A;  4AD9 A;  1JI8 A;  3GVA A;  2DPD A;  1Y39 A;  3ZQF A;  3ZPL A;  1FEX A;  3QU6 A;  4D5C A;  5EGO A;  2RQP A;  2Y30 A;  3V42 A;  2E5Z A;  5ICF A;  1SFK A;  1FC3 A;  2JTV A;  1U78 A;  3DBH B;  4RAY A;  5AIP A;  3E5Q A;  1MBH A;  2DA3 A;  4C30 A;  3PQK A;  4RM2 A;  2IA0 A;  1GXP A;  4I2O A;  2K86 A;  1S8N A;  3R0J A;  4OOI A;  5E8G A;  5H20 A;  2V6C A;  5GAH J;  4Z6Y A;  2HPI A;  4CCJ A;  1ZH5 A;  3E1S A;  4TV7 A;  3LSP A;  1I1G A;  1K4S A;  5B5E C;  1FJL A;  2VE8 A;  2AQE A;  5EJC A;  3HDD A;  4HQM A;  1R00 A;  4PSX A;  1S3J A;  1E0E A;  3O8G A;  1JUS A;  4L5J A;  1APL C;  5HS8 A;  1O3S A;  1YJ9 I;  4B47 A;  3DCF A;  2XGC A;  5M5X J;  5EDN A;  2HFH A;  3HM5 A;  4NBQ A;  5D4R A;  2OPT A;  1YJN I;  3CF2 A;  2ECC A;  4UUS B;  3QQA A;  4CUG A;  1WVR A;  9ANT A;  1P4A A;  2DA4 A;  4BQA A;  1MH3 A;  2BEO A;  2HWV A;  2NOJ B;  1JHF A;  2XAJ A;  4NC8 A;  4XL9 A;  5H6Q A;  1ON2 A;  3OYC A;  3BPV A;  5EEG A;  2DOA A;  2KLO A;  3GEZ A;  3K1N A;  5F0H A;  2MLG A;  5JLW A;  1VQO I;  2X1E A;  2EZK A;  2E35 A;  2XRL A;  4CCO A;  2XSJ C;  1OMI A;  1W7P B;  1HF0 A;  4F92 B;  2QSF X;  3FXK A;  3PIO F;  2A05 A;  5JLX A;  2PI0 A;  3CUQ C;  1LEA A;  3B6A A;  3IH2 A;  4UUT A;  4XRF A;  5LRS A;  4NQW B;  1O3T A;  3CJQ B;  1F4K A;  3WU1 B;  4PFP A;  1T95 A;  3MQ0 A;  1Z91 A;  4M9Z A;  2HQR A;  4A3K J;  2LBF A;  1A6Q A;  1RKT A;  2QCO A;  2VJ4 A;  2X6Y A;  4IL6 C;  4BQN A;  4HG2 A;  4U7B A;  3JRA A;  2AXL A;  2ESN A;  1RES A;  1MMA A;  2P0W A;  4G9Y A;  4E70 A;  1BIB A;  2E7W A;  1N75 A;  1W0U A;  2LRE A;  3I55 I;  1TNT A;  3G3Z A;  2MC4 A;  3CCY A;  2CYY A;  1WJC A;  4P55 A;  1BIA A;  4ESF A;  4V2G A;  2E34 A;  1TQM A;  1WZ2 A;  3VYU B;  3DQV C;  4WK8 F;  3AKZ A;  4XSZ F;  1XS9 A;  2G7U A;  2VXZ A;  3MKZ A;  3JRC A;  3ZMS A;  1X1A A;  2Q8K A;  3CDI A;  3R6S A;  2R0Q C;  4GDF A;  2P81 A;  3M7G A;  4XQF A;  2A5Y B;  2RDP A;  2VJI A;  4WX9 A;  4MHG A;  1Z6T A;  3PIP F;  3JSP A;  1FSH A;  2PFB A;  5CQE A;  1MBF A;  1F9N A;  3ZMZ A;  3FF5 A;  1F43 A;  2RN7 A;  2DOF A;  2K40 A;  3K4B A;  3BC8 A;  3F8N A;  4BQO A;  2FML A;  3HRM A;  4HLY A;  1UMQ A;  2OC6 A;  3KET A;  3GX4 X;  3K4K A;  5E1Z B;  4HNU A;  2V9V A;  4UVA A;  4P96 A;  4LLG F;  4QLC U;  3CJT B;  5BQT A;  2I5U A;  3BG5 A;  1MMS A;  5E20 A;  4AIH A;  2ISY A;  4M74 A;  1IZ1 A;  4LFU A;  3KZI C;  2HVQ A;  3KFW X;  3I5U A;  2KIM A;  4A2U A;  2L9V A;  1OCR H;  3RYP A;  3JRE A;  3I4P A;  2GXB A;  3HGY A;  4QSH A;  2P6T A;  1DGR M;  1HQC A;  2ZC2 A;  2PJP A;  5KK1 A;  2ZME A;  1SD6 A;  3FXO A;  1WQ2 A;  5F0F A;  2EFO A;  1JE8 A;  2DW4 A;  3ULQ B;  3WTS C;  2QVO A;  2VT2 A;  3P9I A;  4ON0 A;  2L54 A;  3L1P A;  3BR1 A;  2H8R A;  2IVM A;  1TP4 A;  4BL0 B;  4II2 A;  4A93 J;  1G3Y A;  3PL8 A;  2ELK A;  5FB2 A;  1FIA A;  2IJL A;  5EG0 B;  2B0L A;  2IGN A;  4KIG A;  1EH8 A;  1J5Y A;  2KRC A;  4F52 A;  3JAM Z;  1RZ4 A;  4Y7N J;  3BTL A;  4KIS A;  3RQI A;  4AYB N;  4IRH A;  4XKB A;  5E3N A;  2DJN A;  3QPT A;  3FHZ A;  3MMY B;  1UEL B;  4DNC A;  1BJA A;  1PUF B;  2EFW A;  1ZAR A;  3U2R A;  1UJ8 A;  1R49 A;  3I3L A;  4Y17 A;  3G6E I;  1TWG J;  2BY2 A;  3TQN A;  4YFN F;  2VOD A;  3KLO A;  1Z9C A;  3M1C A;  4WXC A;  2WAQ A;  3M07 A;  2RNG A;  4GCV A;  1HXD A;  3K2A A;  4DYQ A;  1IO2 A;  1IXR C;  1GUU A;  2OD5 A;  3FZV A;  3Q9S A;  3VDX A;  4HDU A;  1IN7 A;  1EA3 A;  3CUQ B;  2KQR A;  4ZDL A;  5IYB J;  4A3F J;  4XLE A;  3AG1 H;  1P92 A;  4AM3 A;  3KEY A;  2HDW A;  1QZY A;  1S29 A;  3LA3 A;  2HR3 A;  1HA8 A;  3ZMV A;  1U9N A;  2X6X A;  3VSK A;  3ABK H;  4RB0 A;  3TW6 A;  4LJZ F;  5HLT A;  3BPX A;  1OJL A;  2XRN A;  3KP2 A;  2BOL A;  3WOD F;  3CZ6 A;  3N4M A;  2NVY J;  3DWL E;  4CZZ A;  2YX4 A;  4CA0 A;  4YEL A;  3FXM A;  2VPR A;  2JA7 J;  2JA8 J;  4DJA A;  4ESB A;  1T98 A;  4OIO F;  2L3D A;  4A0X A;  4A3D J;  2CJJ A;  5EEH A;  3RQ4 A;  4KIF A;  1KU7 A;  4DZJ A;  1VQ9 I;  5C4X J;  1X4P A;  5HLI A;  2XAH A;  3CLO A;  3JCU C;  3I4N J;  2E60 A;  2CFX A;  2EIM H;  5JR3 A;  3PM1 A;  4LB5 A;  3BTJ A;  2GA1 A;  1SVO A;  1BJZ A;  3PSF A;  4LG0 A;  3GTO J;  3MKY B;  2VON A;  4Y15 A;  5LLQ A;  1XC5 A;  4A12 A;  2DA2 A;  2VKE A;  3Q3S A;  1F36 A;  2EJR A;  2O5R A;  3EUA A;  3CLQ A;  5F1R A;  3OIO A;  3OYA A;  1GV2 A;  4IHV A;  3OIQ A;  1BW6 A;  1Z0X A;  3AG4 H;  3NWT A;  4UB6 C;  2XPU A;  1BR1 A;  2OQR A;  2LKP A;  1HOM A;  3TED A;  3HHG A;  1IN5 A;  4L18 B;  3GFI A;  2ZB9 A;  2K4B A;  2ECB A;  2W4S A;  1OR7 A;  5JVG F;  4EJU A;  4WF2 A;  3JRD A;  4A3L J;  2LH9 A;  2RGV A;  4F3Q A;  3LNQ A;  4F7Z A;  4FET A;  1WJD A;  3ABL H;  1ZHF A;  2Y69 H;  3RKW A;  3CDL A;  1PJR A;  5E3L A;  3F23 A;  3FWE A;  2GZW A;  4D7N A;  3BCA A;  3E6M A;  1HSJ A;  2FA5 A;  4E7Z A;  5DTD A;  4EJT A;  1DP3 A;  1HKT A;  3OYI A;  2HPM A;  4BEH B;  1VQ7 I;  3O8H A;  4A0Y A;  5E3M A;  2XAQ A;  1K7A A;  3W6V A;  1D3Y A;  4RB1 A;  2MGQ A;  4K2E A;  1V5G A;  1ZGA A;  2GLO A;  4E7H A;  2A6T A;  4B4C A;  2IS6 A;  1I50 J;  2BXZ A;  3GFL A;  2K85 A;  3SFI A;  3PFY A;  3FKI J;  1MKM A;  1LE8 A;  4G7O F;  1XDU A;  3WU0 A;  1X1P A;  3FX3 A;  4P9F A;  1FBQ A;  2PJR B;  3CMM A;  2F6C A;  2OA4 A;  3AFH A;  4YFX F;  2VKH A;  1AKH B;  4RB3 C;  2Y9Y A;  3PNV A;  3I54 A;  2LMD A;  1DGW Y;  2K9L A;  1OLT A;  1JJ6 C;  4WXH A;  3ASN H;  4ZDP A;  3GFM A;  2CO5 A;  3RI4 A;  5FRN A;  2AS5 F;  3PJR A;  2UWM A;  5CVJ A;  3VSL A;  5IT9 K;  3KEO A;  1WH5 A;  4A69 C;  3W2A A;  4JQF A;  5EZH A;  3I56 I;  3MVP A;  1NHA A;  2IW5 A;  3CDH A;  4G7H F;  1ZN2 A;  2BVM A;  2OBP A;  3NAR A;  1STZ A;  1A31 A;  1LFP A;  1A6I A;  1SC7 A;  1D0X A;  2PMZ N;  1IRG A;  4C2M J;  3R61 A;  1MMD A;  1XSD A;  4N0B A;  3BDD A;  3L2R A;  3DPU A;  2JVG A;  5DCF A;  2R7S A;  4Q4Z F;  5K7Z A;  2BXY A;  3EUK L;  3H3U A;  4PFO A;  3I71 A;  2ZJR F;  2WV0 A;  2VQH A;  1WSU A;  3OL4 A;  2YPR A;  2UZK A;  4D0P A;  1BA5 A;  3ZQH A;  5LHH A;  3LSK A;  1VQ5 I;  2LD5 A;  2ZFW A;  3MKL A;  3QRF F;  3A01 B;  3X2Q H;  4BS9 A;  1JGS A;  4RA2 A;  4M3E A;  2DDB A;  2DTR A;  2MD0 A;  4XK4 A;  1WGX A;  3KYC B;  3BTC A;  4XN3 A;  1BC8 C;  2P7C B;  3HHH A;  1BM9 A;  1YIT I;  2WY8 Q;  4H4K C;  3F3X A;  2IA2 A;  4JX6 A;  5IPA A;  4KNY A;  2F5V A;  3OS0 A;  1KA8 A;  1PVE A;  1WH7 A;  3IKT A;  3CC7 I;  4DIQ A;  3K70 D;  3L2U A;  5DYM A;  4C2U A;  2DAO A;  2PEX A;  2F2E A;  2W84 A;  2QBY B;  2YR2 A;  5LFA A;  4OIR F;  2E1N A;  3PQJ A;  4HX4 A;  1B59 A;  4CDG A;  1SAX A;  4HSR A;  4EGY A;  2E36 A;  2ID6 A;  4IKF A;  1AHD P;  3GUD A;  1G3S A;  5GP9 A;  5FJ8 J;  1V3F A;  1VI0 A;  2HXI A;  2EA4 A;  4NQW A;  3WHC A;  5GAG J;  4MLO A;  4GYG A;  4PUS A;  4RAF A;  5D6E A;  4XID A;  3QOP A;  3Q5F A;  1BI2 A;  1VZ0 A;  4M3F A;  3M3Y J;  3O3K A;  4GYI A;  2CW7 A;  2LDU A;  1FT9 A;  2R7O A;  5FKM A;  5TJJ A;  3IUO A;  1E17 A;  3HRT A;  2HZD A;  4DZP A;  2CUZ A;  3FM3 A;  4YEJ A;  3HOT A;  5FLX K;  4UV9 A;  2HTS A;  4E6K G;  2A5W A;  1QGP A;  3CJN A;  3MZY A;  2K9Q A;  3LL7 A;  2R93 J;  2JPC A;  2BV6 A;  5E79 C;  2DXI A;  2DQR A;  1HW2 A;  1FYL A;  4M9S A;  2J5O A;  4ESJ A;  1I27 A;  1RET A;  2DA6 A;  2VC1 A;  5KAF C;  5E17 F;  4PJM A;  2JT1 A;  2Z5U A;  1BOB A;  2JK3 A;  4I02 A;  1ZG1 A;  3CTA A;  3K69 A;  4BHB A;  4ZH4 F;  4LB6 B;  3ERE D;  3LSH A;  1I3Q J;  1P7I A;  1TWH J;  3NAU A;  5JHU A;  4BDY A;  4XLF A;  2NS7 A;  1TQP A;  4L5E A;  2QKL B;  2W7N A;  3QPH A;  3OR2 C;  3WG9 A;  3OYJ A;  4EEF G;  1G8X A;  3KP4 A;  1VND A;  2L9S A;  1QHH D;  3NRV A;  3U9G A;  2HVR A;  2ZSH B;  2V79 A;  1UZC A;  4F91 B;  2HYF A;  5CQG A;  2QQ8 A;  4XLN F;  3J80 K;  3TO6 A;  1CF7 B;  1K6O A;  3TOB A;  3KP5 A;  3ML6 A;  2O6G E;  2XB5 A;  2FJ1 A;  4NNJ A;  4QPQ A;  1W4M A;  1GV5 A;  2MW8 A;  3H5N A;  2IP2 A;  2ZXI A;  3RJP A;  3ZN0 A;  3OOU A;  2PLY A;  3A1Y A;  4WXD A;  1USS A;  3E5X A;  2JMW A;  2YSR A;  3EUH C;  1ITY A;  5F08 A;  2WAF A;  3HOV J;  2XKP A;  3NEU A;  1JUM A;  2QQA A;  1SFE A;  2FF4 A;  4ZZD A;  3M1E A;  4XIC A;  5M3F J;  1T33 A;  1D8K A;  1YOV B;  1FTT A;  1SD4 A;  3VYR B;  1BL0 A;  2WAQ N;  1FBS A;  3OYB A;  3E6B A;  5ICG A;  2I8D A;  2QM3 A;  4IQ4 A;  2O7O A;  2Q2E B;  3DLA A;  3VOD A;  5IP7 J;  2IRF G;  4NUB A;  3EPZ A;  1MBK A;  3KYL A;  1WPK A;  2X85 A;  4YFK F;  2D45 A;  3CD6 I;  1KON A;  1FPQ A;  2B9S A;  1MJB A;  2W82 A;  2MLK A;  2R3S A;  4BYY A;  3S2D J;  4AU7 A;  4ASN A;  3FKJ A;  2COB A;  2AQF A;  1OCZ H;  3P9C A;  1Z6R A;  4ZYG A;  2NS8 A;  3HUG B;  3GTQ J;  2VQC A;  2R5Y A;  2IAI A;  1BW5 A;  3TO9 A;  3KCC A;  2QSH X;  4XLC A;  1B8I A;  4DBQ A;  1IRF A;  4W1U A;  1XB4 A;  3BQZ A;  5BS6 A;  1GT0 C;  5HDN A;  3ZMU A;  4BXF A;  3G1M A;  1U5T A;  2DMT A;  2XAS A;  3AG3 H;  4IHT A;  3F72 A;  3G1L A;  4O6J A;  3LSJ A;  5CKT A;  1NK2 P;  4ZYA A;  1D1B A;  3LA2 A;  4JYK A;  2RV8 A;  4XKV A;  3OYF A;  3CCL I;  5HVQ C;  4M6Y A;  2FU4 A;  4F55 A;  1SD5 A;  3CUQ A;  3K7A J;  3S3O A;  5CVU A;  5K7F A;  4PJL A;  5C3E J;  1HLV A;  3HSF A;  4IEJ A;  2MG4 A;  2KDO A;  4IOC F;  5CVR A;  2R5Z B;  4ENK A;  2EBI A;  3FBI B;  2EZH A;  4MFD A;  2XF5 A;  1QBJ A;  4PGH A;  2JPB A;  3R0A A;  4L9T A;  4M73 A;  3RYR A;  4ZYH A;  3ZQL A;  4IPA A;  2VKD A;  2M8E A;  2K27 A;  5DS9 A;  2VN2 A;  2LF8 A;  1BR4 A;  3Q0W A;  3V8K A;  5CLS A;  1BOA A;  4XRS A;  3IV5 A;  2BW3 A;  3IWZ A;  1JJ8 C;  2F5E A;  2HU9 A;  2QZ8 A;  1T56 A;  1KGS A;  5J40 A;  4YIR X;  4BBR J;  1B9M A;  5DCM A;  3OL3 A;  1YS6 A;  1TT0 A;  3GFJ A;  2Z2S B;  3A2K A;  2R4G A;  1YIJ I;  2O3F A;  4M9X A;  4HDV A;  3SZT A;  3RKY A;  3HOX J;  4OIP F;  1IDY A;  3U1K A;  2LF7 A;  1UHS A;  5L3B A;  4LD5 A;  2P4W A;  1BN5 A;  1GVJ A;  2XGE A;  2QEX I;  1Q1V A;  2VQL A;  5FGM A;  4KIC A;  2W24 A;  4C3I J;  4QTR A;  2UXN A;  2CG4 A;  1UST A;  2ZNZ A;  4PJ0 C;  1S7A A;  1VQP I;  1C0W A;  2GA2 A;  3BR6 A;  4HX8 A;  1MD0 A;  3MFK A;  3S16 J;  4DW6 A;  5J1Y A;  5JFR A;  3HIF A;  2R7Q A;  3JRF A;  1IDZ A;  1LDJ A;  4R1H A;  4A3J J;  2M3A A;  4DYC A;  1TC3 C;  4I0B A;  1KQ0 A;  2Y48 A;  2GM4 A;  2HXO A;  3TP0 A;  4AWX B;  4B3X A;  2L9N A;  4W97 A;  5F04 A;  2OQG A;  1XMX A;  4I99 C;  4HYE A;  1YIO A;  4Q47 A;  4WCG A;  2XC7 A;  1KU2 A;  3SDB A;  2KL4 A;  3QYE A;  5D5W B;  1W36 C;  1B72 B;  2E2I J;  3A0B C;  1BR2 A;  4HV5 A;  1U3E M;  5L3G A;  3C18 A;  3Q9V A;  3RPQ A;  3OYK A;  4ENJ A;  2CFO A;  4JBA A;  4ZTJ A;  3L9F A;  3A0H C;  1LVA A;  5B66 C;  3WTZ A;  2LK2 A;  3FMS A;  3CCQ I;  1YRN B;  2K9S A;  1JTX A;  2OZ6 A;  1X2N A;  4BE0 A;  2ISZ A;  4XLP F;  1LFB A;  3K6G A;  1JHH A;  1REP C;  2ZSI B;  2LYC A;  3I59 B;  3H3Z A;  1TZL A;  2IA1 A;  2Y2Z A;  3KLN A;  3EDP A;  4EJV A;  4DQ2 A;  4RAG A;  3MEX A;  2F5F A;  4PJN A;  4NHJ A;  2O03 A;  3UKG A;  3T5X A;  1LJ9 A;  3DTK A;  4IZZ A;  1K6Y A;  2FNA A;  2KMU A;  3CCR I;  4A3I J;  4C3J J;  2K5C A;  2EIN H;  4BJ5 C;  3F8M A;  4V2F A;  1P7J A;  4EVI A;  4CHU A;  1ACI A;  3W2W A;  1E3O C;  4Y33 A;  2B63 J;  3GZ6 A;  5HNH A;  5DD8 A;  3GYH X;  1ETY A;  4R79 A;  5J3L A;  2J5P A;  2MH9 A;  4I01 A;  3I0T A;  4UHT A;  5J8F A;  3E6D A;  3LSG A;  3LFK A;  3MZ8 A;  3V4G A;  4A3E J;  2NNN A;  1RUO A;  1R22 A;  3CUO A;  3ISP A;  5ERI A;  2PMH A;  2VT3 A;  5D8K B;  3J80 Z;  3HOU J;  1EH7 A;  1RIO H;  2DMN A;  3T8R A;  2X6W A;  4BH9 A;  4C3H J;  2XUB A;  3M8J A;  4M6X A;  2FRH A;  1GDT A;  5HOO A;  4RGR A;  2NYX A;  4CO8 A;  1UFM A;  4UVB A;  3BT9 A;  2FBI A;  4D5F A;  3LSR A;  3VFZ A;  3ZOB A;  2L4A A;  1BBY A;  2E7X A;  3W3C A;  3F0C A;  1PP8 F;  2LNB A;  3WE3 A;  1K4T A;  2QQ9 A;  3A01 A;  5BOX A;  1AOY A;  2H94 A;  1F5T A;  2LSO A;  1EH6 A;  4CYC A;  2JN6 A;  1OIS A;  4IRG A;  3K70 C;  2MAB A;  3DKY A;  3KEQ A;  2E2H J;  3E6C C;  4PK4 A;  2H1L A;  5E1W A;  1KQ9 A;  2FE3 A;  1M1E B;  3BRO A;  1HKQ A;  4FHT A;  1U8R A;  1J09 A;  3S3M A;  1MNM C;  2Z16 A;  3K4L A;  4HZF A;  4IHY A;  2Q1Z B;  4O3M A;  3C7J A;  1PYV A;  4ZDO A;  2R7X A;  4X1E A;  1HC8 A;  1Z7U A;  1DU6 A;  2DU9 A;  1LVK A;  5L3C A;  1JGG A;  3JW4 A;  4UY8 I;  4J00 A;  1ETK A;  1VF9 A;  3DV8 A;  3LST A;  1QHG A;  5K5Q A;  2DA1 A;  3IAM 2;  1YLF A;  3ECH A;  3P9K A;  4G7Z F;  4EAT A;  1LB2 A;  4BUP A;  2DFF A;  1CQT A;  1WCM J;  2ZXH A;  2GIZ A;  1SAN A;  2LFB A;  2ME0 A;  4IQJ A;  4DGW B;  2HYJ A;  1G3W A;  3REO A;  3ASO H;  3HSR A;  4LGW A;  4ITV A;  2STT A;  1PP7 U;  4U88 A;  4BGD A;  2WBM A;  4BHC A;  4KYW A;  2NVT J;  1MDM A;  2XIG A;  2XAG A;  2L4M A;  4I76 A;  4GGG A;  2D1H A;  1Z3X A;  2OTL I;  1DDN A;  3GTP J;  3B02 A;  1K83 J;  2P5K A;  3OSG A;  2DBB A;  4PCQ A;  2O9L A;  2ZO4 A;  1NH3 A;  3JRB A;  4MGR A;  5DEQ A;  2VJ5 A;  4N9I A;  1FYM A;  2OTJ I;  1FBU A;  2NXN B;  4JK1 X;  4NC6 A;  4KMU X;  2QGU A;  2XB0 X;  4U87 A;  5M3M J;  1IG7 A;  4HF2 A;  1LKX A;  2O61 A;  3D1N I;  2CV1 A;  5EGO B;  2COM A;  5EZG A;  4CIC A;  5C4J J;  2M7B A;  1TWA J;  1XPX A;  2RRE A;  3FXL A;  2F4O B;  2TDX A;  3A02 A;  2LG4 A;  5K5R A;  3WGH A;  3H3V K;  2M0C A;  2EQR A;  2IPQ X;  4OWR B;  2QYO A;  2EB7 A;  5EYR A;  3F8B A;  1J2X A;  1I6X A;  3H1C A;  3LQQ A;  4XN0 A;  1R4N B;  3GZ5 A;  5HOD A;  1R5I D;  2XRO A;  3GTG J;  1YW9 A;  1SAU A;  4NDL A;  5B1A H;  3I64 A;  2ME6 A;  4IX7 A;  4HW0 A;  2EZI A;  2KIS A;  1ZGW A;  1RI7 A;  1OCC H;  2H27 A;  2K9M A;  2KFD A;  4BY7 J;  1Y1W J;  2N8G A;  2EV6 A;  1XN7 A;  2EIK H;  3E3V A;  3FK7 A;  1FTZ A;  1JKR C;  2O8K A;  1Y1V J;  2BYV E;  1ZK8 A;  5H2F C;  4EV0 A;  1HW5 A;  4LIU A;  2JRM A;  1X1C A;  1IUF A;  1ZR2 A;  2LC2 A;  1IRZ A;  2XDV A;  3COA C;  2K3F A;  5L3E A;  2R7W A;  3ZRG A;  2DOD A;  3S8P A;  4J19 A;  2W85 A;  2VBX A;  3L2W A;  2P5L C;  1H8A C;  2ELH A;  5GAD J;  4M3G A;  2VI6 A;  3UNG C;  2JSP A;  3KX2 A;  2IS2 A;  3CCE I;  3TDZ C;  2E19 A;  4BE2 A;  2O0Y A;  1MIJ A;  4YII A;  1Y8Q B;  2X1D A;  4Y3O A;  2FD5 A;  1QVU A;  1R71 A;  4YRV A;  1WHU A;  3VB2 A;  2XGD A;  1RR7 A;  2TRT A;  2R7D A;  3LSM A;  1VFC A;  2QSG X;  1UAA A;  1VQL I;  5EEA A;  2ZJP F;  2CGP A;  1YX5 A;  5E3O A;  4ZZL A;  3LSI A;  4EGZ A;  1YG2 A;  1YJW I;  2STW A;  4II3 A;  2HQA A;  1B9N A;  2RAE A;  5D4S A;  4IJA A;  2R7Z J;  5D8L B;  1RUN A;  4HNV A;  4FX4 A;  1BI0 A;  3G71 I;  3OOP A;  1LFU P;  3IHU A;  4AC0 A;  1EJ9 A;  2D1V A;  2CQK A;  1HST A;  3BY6 A;  2M87 A;  4A3B J;  4LLL A;  3BJA A;  2WAE A;  2YU3 A;  4CGZ A;  2L0K A;  3ZR8 X;  3MZH A;  2HVS A;  5HS9 A;  4RAZ A;  3DF8 A;  2KRF A;  2ICW G;  4S05 A;  3ABM H;  5DUI A;  1G6N A;  2Z99 A;  1OPC A;  2CMP A;  2KRH A;  1D1C A;  2DK5 A;  4N9H A;  3IRR A;  4IOA F;  3KZY A;  3S1Q J;  3IKV A;  3RSN A;  1WI3 A;  3IH3 A;  3J7Z I;  3E5U A;  3KP6 A;  3P5J A;  3ELK A;  3S14 J;  4RMN A;  2L2O A;  1D8J A;  1X3W B;  1WJF A;  1JKP C;  1N25 A;  4D7M A;  3ECO A;  4A3M J;  4BU2 A;  4XKW A;  2YU9 J;  3M8F A;  1H9T A;  2DFI A;  1ONV A;  1P4W A;  1QO0 D;  3H9Q A;  5BPD A;  4E4H A;  1J75 A;  1YE9 A;  4X0G A;  1VTN C;  3S2H J;  2X51 A;  2HQ5 A;  3UR3 C;  3PNT A;  1EV7 A;  1OYI A;  2R7F A;  1R1T A;  4S04 A;  1SVM A;  2XSD C;  2FX0 A;  2EWN A;  3OWT A;  1FMV A;  1G2H A;  2FUG 2;  3HSE A;  3HJE A;  1ZRF A;  4M6V A;  2EFP A;  3PO3 J;  2Y9Z A;  3IAS 2;  3RKQ A;  3GW2 A;  3SJM A;  3JSO A;  5AIQ A;  4JOM A;  5E18 F;  3AAF A;  1H9G A;  5FFZ A;  1A36 A;  1LEB A;  1D1A A;  1LUJ B;  3GTL J;  1FYK A;  3QOE A;  2ID3 A;  3CO7 C;  1UB9 A;  1LQ1 A;  4ZYD A;  1R58 A;  2X4H A;  4IXA A;  3S2W A;  2BGC A;  2Y75 A;  4UUS A;  2OJE D;  4XBF A;  3SQN A;  2OF7 A;  5DD4 A;  1WJ5 A;  3ZGK A;  3K4M A;  2CW0 F;  4RGX A;  2LKS A;  3QYB A;  4IVN A;  4CSW A;  4PGG A;  4EJO A;  4KT6 A;  1XGN A;  5D6F A;  3HOW J;  3KZZ A;  3BCB A;  4KT5 C;  3GME A;  4P5O A;  1PUE E;  1Y0N A;  3NWS A;  2VLA A;  1W7P A;  1XGO A;  2PBI A;  3DPL C;  4LLN A;  3D5R C;  3IP4 B;  3L2V A;  5GPC A;  2DMU A;  5ICC A;  4HLX A;  3GWZ A;  1Z05 A;  5ICE A;  2G7H A;  5E8I A;  2YS9 A;  2MA3 A;  3TW7 A;  2L9R A;  3E7L A;  1YRN A;  1X1B A;  1IJW C;  3WTU C;  3U1D A;  4YIF A;  1BI3 A;  3FXQ A;  2V1D A;  4UV8 A;  2K7L A;  3BR2 A;  2VBY A;  1LPQ A;  1I6H J;  3I4M J;  4RLF A;  2DYS H;  1QNT A;  2OZU A;  2ZBK A;  4E7J A;  2WY7 Q;  2HEO A;  3A03 A;  2A3S A;  3CP8 A;  4LIT A;  1I1S A;  1ETW A;  5J1U A;  2GBY A;  1S6L A;  4AYB A;  1EKE A;  3OSF A;  3JR9 A;  1ZQ3 P;  2FBK A;  4L0Z B;  1N77 A;  2BBY A;  3GF2 A;  3LMM A;  1QA6 A;  4MTD A;  2DOE A;  2GQQ A;  3BZ6 A;  3DU6 A;  4D9J A;  3C2H A;  4GO1 A;  1MMN A;  1T6S A;  3M8E A;  2HKX A;  2ZCW A;  1OCT C;  1U6G A;  3TOA A;  1IN4 A;  1R1V A;  1L0O C;  1OKR A;  3BR0 A;  1NK3 P;  1XCB A;  2XGX A;  3WG7 H;  4B09 A;  2EA2 A;  5KHD A;  3RZD J;  3SZP A;  4CXF A;  5LGN A;  4UUV A;  4XNF A;  4Y52 J;  4I09 A;  3EYY A;  4B43 A;  2EV0 A;  3G4S I;  3GTK J;  2GOM A;  4XOR A;  3RTR A;  3TO7 A;  3WTT C;  4IO9 F;  1T0F C;  2NVX J;  1PDN C;  5FD5 A;  1IAW A;  1LNW A;  2PG4 A;  2H1K A;  1KQ8 A;  1T2K A;  4G94 A;  2HOS A;  2CRG A;  2KZV A;  2BY1 A;  1W0T A;  5AON A;  2KT0 A;  4ANJ A;  4LG0 B;  2CQQ A;  2VBW A;  2XKO A;  1XTA A;  3BJO A;  2V7F A;  2GOX B;  1X3Z B;  1J9I A;  4MNU A;  4S0H B;  5K7H A;  2VOP A;  3N97 A;  1YX3 A;  5CJ9 A;  5HLG A;  1SEU A;  4I98 B;  2IEK A;  4OU0 A;  1D5Y A;  2WB1 A;  2M5W A;  3DPT A;  5DUK A;  4EM1 A;  3IH4 A;  1H88 C;  1JKO C;  2IS1 A;  1GXQ A;  5F1J A;  3NQO A;  1R5H A;  1KYZ A;  4AVP A;  5EG0 A;  4IHW A;  1JXS A;  4MQV A;  2FOK A;  2V1U A;  2K4J A;  2XPV A;  3HGG A;  1O7F A;  2P7V B;  3HPG A;  3AL0 B;  1OFC X;  3HTU A;  5C44 J;  2I10 A;  4G12 A;  4UXN A;  1S5L C;  5JVT A;  1ETQ A;  1W5C C;  3ERM A;  4HNT A;  2FSW A;  3SFZ A;  3SEQ A;  4G8X A;  3BZK A;  1PUF A;  2CV0 A;  3J81 K;  2G0E A;  2EK5 A;  3TGN A;  2GXA A;  2JVH A;  2CUF A;  2HS5 A;  1UCR A;  5KNL A;  4LOC A;  5L3D A;  1VQM I;  3K9T A;  4XOP A;  1XGS A;  4KA4 A;  4E7I A;  2TCT A;  2L7K A;  2IBD A;  3BG9 A;  5CVI A;  2MYS A;  2XV4 S;  1OYW A;  5H6R A;  3F21 A;  5GPA A;  2W00 A;  1Y6I A;  2VUM J;  1I3A A;  1J0R A;  3K1P A;  3U21 A;  3KPH A;  4ABZ A;  4B44 A;  1VQ4 I;  5J6X A;  1TW2 A;  1ZLK A;  1YHQ I;  1X4O A;  2LVS A;  2C6Y A;  2DN0 A;  1LE8 B;  5IT9 Z;  1XX5 A;  3HG9 A;  1POG A;  1H0M A;  2OUM A;  1RRJ A;  3J7A O;  1WWX A;  3WGI A;  3F6V A;  5CYV A;  2WA0 A;  3R60 A;  5FKO A;  4P9U A;  1TT5 B;  1W5S A;  5FRM A;  3CP2 A;  1TBX A;  2DFE A;  3BR3 A;  3L2Q A;  3BLY A;  3LFU A;  4GFB A;  2EPF A;  2DQL A;  4OMZ A;  3VYS B;  1TWC J;  2XAU A;  3ZCO A;  5L3F A;  1RNL A;  3L09 A;  2RQQ A;  2XHK A;  1YTY A;  4PDK A;  2VBZ A;  4GXO A;  5D5X B;  5DM6 F;  2CQ7 A;  4XON A;  3KIO A;  4KN7 X;  4KDP A;  1A04 A;  1T38 A;  3HC7 A;  3FIW A;  5ILV A;  5ED4 A;  1Z3Y A;  4KJZ A;  2ZKZ A;  2F5C A;  4U0V A;  2YUS A;  2KIQ A;  3JRI A;  2MD5 A;  3HKZ A;  1MSF C;  3VWB A;  3QAH A;  4L9J A;  5FKN A;  5LEK A;  2X1C A;  2X0L A;  2Y0S A;  4M3D A;  1OYY A;  1MBE A;  3DTE A;  2GIV A;  1R1U A;  1QZE A;  3CO6 C;  1E3P A;  4UB8 C;  5HDK A;  2OU2 A;  4MFE A;  2DFH A;  3FXR A;  1V55 H;  3KYD B;  1KZH A;  4XMY A;  2R7U A;  3ABU A;  3QPL A;  2M45 A;  3V7S A;  1D0Y A;  1FP2 A;  1K78 B;  1IN6 A;  5IOZ A;  1QPI A;  2KJC A;  2W48 A;  3QOD A;  3HTS B;  3Q0U A;  2FBH A;  3SEZ A;  4J01 A;  3S32 A;  4B3A A;  2PMZ A;  2IGM A;  2P5V A;  3S1N J;  3L2C A;  3H5R A;  2V6E A;  2LR8 A;  2M9H A;  4AUX A;  2VOO A;  3KP7 A;  3HL2 A;  1G59 A;  2XVC A;  1RKW A;  3I9V 2;  3WHB A;  2PN6 A;  5IOY A;  4QIW N;  3KP3 A;  4H0E A;  1ZRE A;  2M8G X;  2PMU A;  1JTY A;  3OV8 A;  2AHQ A;  3W6J B;  3W2V A;  3MKW B;  4IRI A;  1U5T C;  1V54 H;  4E7K A;  3GLX A;  4KFC A;  1R9T J;  3V8J A;  4A6D A;  2KJB A;  4BEH A;  1RPW A;  3RPU A;  2K02 A;  3JTG A;  1JKQ C;  4HA8 A;  4RB2 C;  4G6Q A;  5FLX Z;  4AIJ A;  5LRR A;  5IYD J;  1QRY A;  3SDG A;  2NRA C;  2XF7 A;  1IXC A;  4L9V A;  4XOT A;  5GTI C;  3QU3 A;  2DDA A;  2JQ7 A;  1KU3 A;  2H6B A;  3B6C A;  4KN4 X;  5TIS C;  2RC4 A;  4QWQ A;  4WWC A;  2E1C A;  1Z77 A;  2PJR A;  2Y31 A;  2OV7 A;  3H9G A;  5HNF A;  1AKH A;  1S7O A;  4B1R A;  5J4V A;  2KP6 A;  1ZG3 A;  2P6S A;  3GZN B;  3HBL A;  3QP6 A;  4FAS D;  4V19 K;  4Y13 A;  1VQ6 I;  2DI3 A;  1MJA A;  2UV1 A;  4OAZ A;  2CW8 A;  3K0L A;  1EF4 A;  2FOW A;  3O2P E;  2ACJ A;  1ZAO A;  2UXX A;  1TLH B;  2DYR H;  2KIU A;  5M5W J;  1SFO J;  2M34 A;  2IS4 A;  2D5V A;  3QP5 A;  2BHZ A;  3OIP A;  5GAE J;  3OS1 A;  4HQE A;  4AID A;  1FOK A;  3HYI A;  3CCV I;  2KKO A;  3BZC A;  3DKX A;  2OCC H;  1J7K A;  1P2F A;  4EQQ A;  1A35 A;  1DPU A;  2LY2 A;  1FOX A;  2LY1 A;  4G6T B;  1B6A A;  4BE1 A;  1DP7 P;  2EV5 A;  4U0Y A;  3RDI A;  1MMG A;  5EF6 A;  3CES A;  2DO7 A;  3J7Y J;  1A5J A;  2F48 A;  2FEZ A;  2JUC A;  1XSX A;  3B73 A;  2ELJ A;  2QUF A;  3DBL B;  3CME I;  2DTZ A;  4HAM A;  1O4X A;  4NB5 A;  1MGT A;  4CH7 A;  3C2B A;  5LGU A;  3DEW A;  3OYE A;  3R4K A;  3CC4 I;  4KIB A;  4FIS A;  4OMY A;  1MJ9 A;  4HBL A;  1FOY A;  4Q48 A;  5J1R A;  2JUG A;  1P9Q C;  2K3P A;  2LTP A;  1YI2 I;  3MN2 A;  4A5N A;  3S1M J;  2F4M B;  3OYD A;  1WFX A;  2R7R A;  1DUX C;  2DT6 A;  1TNS A;  2EFQ A;  3CF5 F;  2PX9 A;  2ZJ2 A;  1IV8 A;  3GXO A;  4XRS G;  1MH4 A;  3D5L A;  4BY1 J;  1XMK A;  1SFX A;  2DA7 A;  2HI3 A;  2HYG D;  3I53 A;  4UVC A;  5K1Y A;  1GHC A;  4ETS A;  1TW3 A;  3BP8 A;  3EYI A;  1WJB A;  1OCO H;  1WI9 A;  4FTH A;  2IGO A;  4O5V A;  5M5Y J;  1OQY A;  3JTH A;  4RGU A;  4BHP A;  2QBY A;  1W7P D;  3FMR A;  2VC0 A;  4CCN A;  3J81 Z;  3AG2 H;  1X1D A;  4C9Y A;  3MAJ A;  5J4Y A;  4A3G J;  1X2M A;  4XKC A;  2VE9 A;  3ZQI A;  1X19 A;  4RGS A;  3VYT B;  2BVL A;  5KCM A;  1FY7 A;  4MO7 A;  1IC8 A;  3TDU C;  3J7A Y;  1KYW A;  2OCE A;  3I58 A;  4PJJ A;  1R7J A;  1SD7 A;  2B7E A;  2EZL A;  3M9A A;  2R7V A;  1QPM A;  2VQG A;  3HPH A;  2ETH A;  3CCS I;  3F9K A;  2R5Y B;  2CH0 A;  2DT7 B;  1Q1H A;  2A69 F;  3HRS A;  4AIK A;  1CGP A;  1B8I B;  1NG6 A;  3PFI A;  1MBJ A;  4BQQ A;  3JRH A;  1I5Z A;  2GWR A;  2W25 A;  1UHW A;  5LEJ A;  3T8T A;  2NS0 A;  1U5T B;  3IRQ A;  2LLK A;  4BJT A;  2CUE A;  3LQR A;  3ZQ7 A;  4RBO A;  3BTI A;  2IT0 A;  1ENH A;  3GTM J;  3V7C A;  5ILS A;  1JT6 A;  3DFG A;  3LAJ A;  2V1N A;  1QU3 A;  2JZY A;  1V5F A;  4D1Q A;  3GLL A;  3PUB A;  1WJE A;  3FHN A; 
#chains in the Genus database with same CATH homology
 2FNP A;  1XSV A;  5HLH A;  3T0Y A;  1SMY F;  1K79 A;  3DEU A;  5DCM B;  3ZP5 A;  2Q0O A;  5DV5 A;  3BOQ A;  4A0Z A;  1CF7 A;  3O6B B;  4BNC A;  4FX0 A;  1XDS A;  4EM2 A;  2DPU A;  4OIQ F;  4IHS A;  3C3W A;  4M72 A;  1HKS A;  5F64 A;  1WRJ A;  1R36 A;  3FM5 A;  2WWY A;  5E1X A;  2DLL A;  4M71 A;  1YW7 A;  4KMF A;  3MCZ A;  4HF1 A;  2RNJ A;  2HOE A;  2MBF A;  3FXU A;  2A07 F;  3RIR A;  5A2Q K;  5D5V B;  2Q2E A;  3WTX C;  5KVR A;  4PZJ A;  1XGM A;  1L3L A;  2QLZ A;  3SHF A;  1F1Z A;  5HDG A;  2RKH A;  2KIF A;  2L02 A;  3LA7 A;  4A6E A;  5JI6 A;  1FP1 D;  1ON1 A;  4LK1 F;  3K1M A;  1E2X A;  4L0Y B;  1IN8 A;  4FT8 A;  2V1X A;  1HBX G;  1BI1 A;  3HUG A;  4A5M A;  2MC3 A;  3IL2 A;  2ZXJ A;  3V7R A;  3VOE A;  1ZYR F;  1R23 A;  1O3R A;  4EMS A;  3WE2 A;  1ULY A;  2HKO A;  2QQB A;  1B4A A;  1IF1 A;  3DP7 A;  1HW1 A;  4HOB A;  2RVC A;  1J59 A;  5TRD A;  2FQ3 A;  2HQN A;  3HOS A;  4B8X A;  1YW8 A;  1FWZ A;  4L9N A;  3T1B A;  3F8F A;  4LK0 F;  3E97 A;  3WTV C;  5K5O A;  2GXG A;  2P8T A;  2M1B A;  2NNY A;  1SFU A;  1ZGJ A;  1YO5 C;  5D5U B;  1O57 A;  4Q5S F;  2A6E F;  4G6D A;  2CSO A;  1R5G A;  4ENN A;  3HRU A;  4UNO A;  4MEY F;  2HDC A;  4BAY A;  1FSE A;  1ZG5 A;  2A61 A;  2GAU A;  1ZRC A;  4KUM A;  5FFX A;  3ABT A;  1YS7 A;  4U0W A;  2Z3Y A;  1FLI A;  2ZME B;  4I0A A;  1G4D A;  4HF0 A;  4XSX F;  4Z2Y A;  1ODD A;  2YX7 A;  2D2W A;  1KU9 A;  3K2Z A;  3KE2 A;  3IC7 A;  1T0F A;  1K78 A;  2JRT A;  5DDG A;  5J8C A;  4CYD A;  3DXJ F;  5IT3 A;  5ILU A;  4HV6 A;  2EFN A;  3F8C A;  3W6K B;  1O7L A;  3EUH A;  1B1B A;  3TKY A;  2G9W A;  1FX7 A;  1ZRD A;  2ESH A;  2XAF A;  5CVV A;  3LAP A;  3BJ6 A;  1QZZ A;  5FD6 A;  3WTY C;  3LWF A;  3V8L A;  2Z9O A;  4RS8 A;  2HZT A;  2FXA A;  1FNN A;  2HTJ A;  1QQI A;  1MZB A;  5LBQ A;  3C1D A;  3I59 A;  2ADU A;  1T39 A;  1Z1D A;  2WTE A;  3MWM A;  4R8H A;  5LGT A;  3ROU A;  1UHM A;  1X3U A;  2Y0M A;  2JSC A;  3VEP A;  1MDM B;  1Y0U A;  2WC2 A;  3EET A;  5LHG A;  4MTE A;  1IW7 F;  3EQL F;  4I7H A;  2FMY A;  4ZYE A;  3F6O A;  2OAZ A;  1P4X A;  1D5V A;  2DK8 A;  3FMQ A;  1AWC A;  1DPR A;  1YQA A;  2L01 A;  5FO5 A;  3P7N A;  4EM0 B;  3RKX A;  4MQ9 F;  2BE5 F;  5F6F A;  2CWE A;  4L5I A;  1XCV A;  3H92 A;  5BMZ A;  2F5D A;  1IXS B;  1WKM A;  2NAZ A;  3ZMD A;  2Z33 A;  2H6C A;  2QEN A;  3WGG A;  4YG2 F;  3L00 A;  5A2Q Z;  2H09 A;  4MEX F;  1O3Q A;  1IUY A;  1SMT A;  3IWF A;  3ZN1 A;  3GO5 A;  1XMA A;  3SXY A;  3JAM K;  5HS7 A;  4ENM A;  1BC7 C;  1ZLJ A;  1FZP B;  1TTY A;  2ZNY A;  2HGC A;  1TQI A;  1G3T A;  3D0S A;  2M30 A;  2A68 F;  3WTW C;  4IF4 A;  4BXU A;  3G73 A;  3L7W A;  2MH2 A;  2QWW A;  2A6H F;  3DKW A;  3BWG A;  1LDD A;  2W57 A;  1LDK B;  6PAX A;  3ZMT A;  3F22 A;  5LHI A;  1V4R A;  2DT5 A;  1XD7 A;  1YFH A;  4HX7 A;  1U2W A;  2O8X A;  1YYV A;  4LMY A;  1W5T A;  1P6R A;  4U7D A;  4EJW A;  2PQ8 A;  5BPI A;  4OIN F;  4AD9 A;  3GVA A;  2DPD A;  3ZPL A;  3QU6 A;  2RQP A;  5ICF A;  1FC3 A;  2JTV A;  1U78 A;  4RAY A;  5AIP A;  3E5Q A;  3PQK A;  2IA0 A;  1GXP A;  4I2O A;  4OOI A;  5H20 A;  2K86 A;  1S8N A;  3R0J A;  5E8G A;  2V6C A;  1ZH5 A;  4TV7 A;  1I1G A;  2VE8 A;  4HQM A;  1R00 A;  1S3J A;  4L5J A;  5HS8 A;  1O3S A;  2HFH A;  5D4R A;  1P4A A;  4BQA A;  2HWV A;  2BEO A;  2XAJ A;  5H6Q A;  1JHF A;  1ON2 A;  3BPV A;  5EEG A;  3GEZ A;  3K1N A;  2MLG A;  1OMI A;  1W7P B;  2PI0 A;  3CUQ C;  1LEA A;  4XRF A;  5LRS A;  1O3T A;  1F4K A;  3WU1 B;  3MQ0 A;  1Z91 A;  4M9Z A;  2HQR A;  4U7B A;  2AXL A;  2ESN A;  4E70 A;  4G9Y A;  1BIB A;  2E7W A;  1TNT A;  3G3Z A;  2CYY A;  4P55 A;  1BIA A;  4ESF A;  1TQM A;  3DQV C;  4WK8 F;  4XSZ F;  2G7U A;  2VXZ A;  3ZMS A;  2Q8K A;  3R6S A;  3M7G A;  2A5Y B;  2RDP A;  4WX9 A;  4MHG A;  1Z6T A;  3JSP A;  1FSH A;  2PFB A;  1F9N A;  3ZMZ A;  3FF5 A;  2RN7 A;  3F8N A;  2FML A;  3HRM A;  4HLY A;  3KET A;  3GX4 X;  5E1Z B;  2V9V A;  4UVA A;  4P96 A;  4LLG F;  4QLC U;  5BQT A;  5E20 A;  4AIH A;  2ISY A;  4M74 A;  1IZ1 A;  4LFU A;  3KFW X;  3I5U A;  2KIM A;  4A2U A;  3RYP A;  3I4P A;  2GXB A;  2P6T A;  1HQC A;  2PJP A;  5KK1 A;  2ZME A;  1SD6 A;  1WQ2 A;  2EFO A;  1JE8 A;  2DW4 A;  3ULQ B;  3WTS C;  2QVO A;  2VT2 A;  3P9I A;  4ON0 A;  2L54 A;  2IVM A;  1G3Y A;  5FB2 A;  2IJL A;  2B0L A;  4KIG A;  1EH8 A;  1J5Y A;  3JAM Z;  1RZ4 A;  4IRH A;  3QPT A;  3FHZ A;  4DNC A;  1BJA A;  2EFW A;  1ZAR A;  3U2R A;  4Y17 A;  3TQN A;  4YFN F;  2VOD A;  3KLO A;  1Z9C A;  4WXC A;  4GCV A;  1HXD A;  2OD5 A;  1IXR C;  3Q9S A;  3FZV A;  4HDU A;  1IN7 A;  3CUQ B;  1P92 A;  1QZY A;  1S29 A;  3LA3 A;  2HR3 A;  3ZMV A;  4RB0 A;  4LJZ F;  3BPX A;  2XRN A;  3KP2 A;  3WOD F;  3N4M A;  4CZZ A;  2YX4 A;  4ESB A;  1T98 A;  4OIO F;  2L3D A;  4A0X A;  5EEH A;  1KU7 A;  4KIF A;  5HLI A;  2XAH A;  3CLO A;  2CFX A;  5JR3 A;  4LB5 A;  2GA1 A;  4LG0 A;  2VON A;  4Y15 A;  5LLQ A;  4A12 A;  2EJR A;  5F1R A;  2OQR A;  2LKP A;  3HHG A;  1IN5 A;  4L18 B;  3GFI A;  2K4B A;  1OR7 A;  4EJU A;  4WF2 A;  2RGV A;  4F7Z A;  1ZHF A;  3RKW A;  3F23 A;  3FWE A;  2GZW A;  3E6M A;  1HSJ A;  2FA5 A;  4EJT A;  1HKT A;  4A0Y A;  2XAQ A;  1K7A A;  1D3Y A;  4RB1 A;  4K2E A;  1ZGA A;  3GFL A;  1MKM A;  4G7O F;  1XDU A;  3WU0 A;  3FX3 A;  4P9F A;  1FBQ A;  2OA4 A;  4YFX F;  4RB3 C;  3I54 A;  4WXH A;  3GFM A;  2CO5 A;  3RI4 A;  2AS5 F;  2UWM A;  5CVJ A;  5IT9 K;  3KEO A;  4JQF A;  1NHA A;  2IW5 A;  3CDH A;  4G7H F;  1ZN2 A;  2OBP A;  1STZ A;  1IRG A;  3R61 A;  1XSD A;  4N0B A;  3BDD A;  5DCF A;  4Q4Z F;  3H3U A;  3I71 A;  2WV0 A;  1WSU A;  2YPR A;  2UZK A;  4D0P A;  5LHH A;  2ZFW A;  3QRF F;  1JGS A;  2DTR A;  1BC8 C;  2P7C B;  3HHH A;  1BM9 A;  3F3X A;  2IA2 A;  4KNY A;  1KA8 A;  3IKT A;  5DYM A;  2DAO A;  2PEX A;  2F2E A;  2W84 A;  2QBY B;  2YR2 A;  4OIR F;  2E1N A;  3PQJ A;  4HX4 A;  1B59 A;  4CDG A;  1SAX A;  4EGY A;  3GUD A;  1G3S A;  1V3F A;  2EA4 A;  4NQW A;  5D6E A;  4GYG A;  3QOP A;  3Q5F A;  1BI2 A;  3O3K A;  4GYI A;  2LDU A;  1FT9 A;  5TJJ A;  1E17 A;  3HRT A;  3FM3 A;  3HOT A;  5FLX K;  4UV9 A;  2HTS A;  1QGP A;  3CJN A;  3MZY A;  2JPC A;  2BV6 A;  2DQR A;  1HW2 A;  1FYL A;  4M9S A;  2J5O A;  4ESJ A;  1I27 A;  2VC1 A;  5E17 F;  2JT1 A;  2Z5U A;  4I02 A;  1ZG1 A;  3CTA A;  3K69 A;  4BHB A;  4ZH4 F;  4LB6 B;  3ERE D;  5JHU A;  1TQP A;  3QPH A;  3WG9 A;  3KP4 A;  3NRV A;  3U9G A;  2V79 A;  2HYF A;  4XLN F;  3J80 K;  3TO6 A;  1CF7 B;  1K6O A;  3TOB A;  3KP5 A;  3ML6 A;  2O6G E;  3RJP A;  1W4M A;  2IP2 A;  3ZN0 A;  2PLY A;  4WXD A;  1USS A;  3E5X A;  2YSR A;  2XKP A;  3NEU A;  2QQA A;  1SFE A;  2FF4 A;  4ZZD A;  3M1E A;  1D8K A;  1SD4 A;  1FBS A;  3E6B A;  5ICG A;  2QM3 A;  3VOD A;  2IRF G;  4YFK F;  2D45 A;  1FPQ A;  1MJB A;  2MLK A;  2R3S A;  4BYY A;  4ASN A;  3P9C A;  1Z6R A;  4ZYG A;  3TO9 A;  3KCC A;  1IRF A;  1XB4 A;  5BS6 A;  5HDN A;  3ZMU A;  1U5T A;  2XAS A;  4IHT A;  3F72 A;  4O6J A;  3LA2 A;  2RV8 A;  5HVQ C;  4M6Y A;  2FU4 A;  1SD5 A;  3CUQ A;  5CVU A;  3HSF A;  5CVR A;  4ENK A;  1QBJ A;  4PGH A;  2JPB A;  3R0A A;  4L9T A;  4M73 A;  3RYR A;  4ZYH A;  4IPA A;  2M8E A;  2K27 A;  2VN2 A;  2LF8 A;  3V8K A;  5CLS A;  1BOA A;  3IWZ A;  2F5E A;  2QZ8 A;  1KGS A;  1B9M A;  5DCM A;  1YS6 A;  3GFJ A;  2O3F A;  4M9X A;  4HDV A;  3SZT A;  3RKY A;  4OIP F;  2LF7 A;  5L3B A;  4LD5 A;  2P4W A;  1BN5 A;  1GVJ A;  5FGM A;  4KIC A;  2W24 A;  2UXN A;  2CG4 A;  1UST A;  2ZNZ A;  1S7A A;  1C0W A;  2GA2 A;  4HX8 A;  1MD0 A;  3MFK A;  5JFR A;  3HIF A;  1LDJ A;  4R1H A;  4I0B A;  1KQ0 A;  2Y48 A;  4AWX B;  2OQG A;  4HYE A;  1YIO A;  4Q47 A;  4WCG A;  1KU2 A;  5D5W B;  4HV5 A;  1U3E M;  5L3G A;  3C18 A;  3Q9V A;  3RPQ A;  4ENJ A;  4JBA A;  3L9F A;  1LVA A;  3WTZ A;  3FMS A;  2OZ6 A;  2ISZ A;  4XLP F;  1JHH A;  1REP C;  3I59 B;  3H3Z A;  2IA1 A;  3KLN A;  3EDP A;  4EJV A;  4DQ2 A;  3MEX A;  2F5F A;  4NHJ A;  2O03 A;  3T5X A;  1LJ9 A;  2FNA A;  3F8M A;  4EVI A;  4CHU A;  3GZ6 A;  5DD8 A;  3GYH X;  4R79 A;  2J5P A;  2MH9 A;  4I01 A;  3I0T A;  4UHT A;  5J8F A;  3E6D A;  3LFK A;  3V4G A;  1RUO A;  2NNN A;  1R22 A;  3CUO A;  3ISP A;  5ERI A;  2PMH A;  2VT3 A;  5D8K B;  3J80 Z;  1EH7 A;  1RIO H;  3T8R A;  4BH9 A;  2XUB A;  4M6X A;  2FRH A;  5HOO A;  4RGR A;  2NYX A;  4CO8 A;  1UFM A;  4UVB A;  2FBI A;  3VFZ A;  1PP8 F;  2L4A A;  1BBY A;  2E7X A;  2LNB A;  3WE3 A;  2QQ9 A;  5BOX A;  1AOY A;  2H94 A;  1F5T A;  2LSO A;  1EH6 A;  4IRG A;  3KEQ A;  3E6C C;  5E1W A;  1KQ9 A;  2FE3 A;  3BRO A;  1HKQ A;  4FHT A;  1U8R A;  4HZF A;  4O3M A;  3C7J A;  1Z7U A;  2DU9 A;  5L3C A;  3JW4 A;  3DV8 A;  3LST A;  5K5Q A;  1YLF A;  3ECH A;  3P9K A;  4G7Z F;  1LB2 A;  1G3W A;  3REO A;  3HSR A;  4LGW A;  2STT A;  1PP7 U;  4U88 A;  4BHC A;  4KYW A;  1MDM A;  2XIG A;  2XAG A;  2L4M A;  4GGG A;  2D1H A;  1DDN A;  3B02 A;  2P5K A;  2DBB A;  4PCQ A;  2ZO4 A;  4MGR A;  5DEQ A;  4N9I A;  1FYM A;  1FBU A;  4JK1 X;  4KMU X;  4HF2 A;  2O61 A;  2COM A;  4CIC A;  2TDX A;  5K5R A;  3WGH A;  2IPQ X;  2QYO A;  2EB7 A;  3F8B A;  1J2X A;  1I6X A;  3LQQ A;  3GZ5 A;  2XRO A;  1YW9 A;  3I64 A;  2H27 A;  4HW0 A;  1RI7 A;  3E3V A;  2EV6 A;  1XN7 A;  2BYV E;  4EV0 A;  1HW5 A;  3COA C;  5L3E A;  2W85 A;  2VBX A;  2P5L C;  2ELH A;  3TDZ C;  2O0Y A;  4YII A;  3VB2 A;  2R7D A;  2CGP A;  4ZZL A;  4EGZ A;  1YG2 A;  2STW A;  1B9N A;  5D4S A;  4IJA A;  5D8L B;  1RUN A;  4FX4 A;  1BI0 A;  3OOP A;  3IHU A;  2D1V A;  2CQK A;  1HST A;  3BY6 A;  2M87 A;  4LLL A;  3BJA A;  2YU3 A;  4CGZ A;  3MZH A;  5HS9 A;  4RAZ A;  3DF8 A;  2KRF A;  4S05 A;  5DUI A;  1G6N A;  2Z99 A;  1OPC A;  2DK5 A;  4N9H A;  3IRR A;  3KZY A;  3IKV A;  3E5U A;  3KP6 A;  3ELK A;  1D8J A;  3ECO A;  3M8F A;  1H9T A;  2DFI A;  1ONV A;  1P4W A;  1QO0 D;  5BPD A;  1J75 A;  1VTN C;  1EV7 A;  1OYI A;  2R7F A;  1R1T A;  4S04 A;  2EWN A;  3HSE A;  1ZRF A;  2EFP A;  3GW2 A;  3JSO A;  5E18 F;  5AIQ A;  3AAF A;  1H9G A;  5FFZ A;  1LEB A;  1FYK A;  3CO7 C;  1UB9 A;  1LQ1 A;  4ZYD A;  1R58 A;  2X4H A;  4IXA A;  3S2W A;  2BGC A;  2Y75 A;  4XBF A;  3SQN A;  5DD4 A;  2CW0 F;  4RGX A;  4IVN A;  4EJO A;  4PGG A;  1XGN A;  5D6F A;  3KZZ A;  4KT5 C;  4P5O A;  1PUE E;  1W7P A;  1XGO A;  2PBI A;  3DPL C;  4LLN A;  5ICC A;  4HLX A;  3GWZ A;  1Z05 A;  5ICE A;  2G7H A;  5E8I A;  2MA3 A;  3WTU C;  4YIF A;  3U1D A;  1BI3 A;  3FXQ A;  2V1D A;  4UV8 A;  2K7L A;  2VBY A;  1QNT A;  2OZU A;  2ZBK A;  2HEO A;  2A3S A;  1I1S A;  1S6L A;  2FBK A;  4L0Z B;  2BBY A;  3GF2 A;  4MTD A;  2GQQ A;  3BZ6 A;  4GO1 A;  1T6S A;  3M8E A;  2HKX A;  2ZCW A;  1U6G A;  3TOA A;  1IN4 A;  1R1V A;  1L0O C;  1OKR A;  1XCB A;  2XGX A;  4B09 A;  2EA2 A;  3SZP A;  4CXF A;  5LGN A;  4UUV A;  4I09 A;  3EYY A;  2EV0 A;  3RTR A;  3TO7 A;  3WTT C;  1PDN C;  5FD5 A;  1IAW A;  1LNW A;  2PG4 A;  1KQ8 A;  1T2K A;  4G94 A;  5AON A;  4LG0 B;  2VBW A;  2XKO A;  3BJO A;  1J9I A;  4MNU A;  2VOP A;  3N97 A;  5CJ9 A;  5HLG A;  4I98 B;  4OU0 A;  2M5W A;  3DPT A;  5DUK A;  4EM1 A;  1GXQ A;  3NQO A;  1R5H A;  1KYZ A;  4AVP A;  1JXS A;  4MQV A;  2FOK A;  2V1U A;  2K4J A;  1O7F A;  2P7V B;  3HTU A;  4UXN A;  5JVT A;  2FSW A;  3SFZ A;  4G8X A;  3J81 K;  2EK5 A;  3TGN A;  2HS5 A;  1UCR A;  5L3D A;  3K9T A;  1XGS A;  4KA4 A;  5CVI A;  2XV4 S;  1OYW A;  5H6R A;  3F21 A;  1J0R A;  3K1P A;  5J6X A;  1TW2 A;  1ZLK A;  2C6Y A;  5IT9 Z;  1H0M A;  3J7A O;  1WWX A;  3WGI A;  3F6V A;  5CYV A;  3R60 A;  4P9U A;  1W5S A;  1TBX A;  2DQL A;  4OMZ A;  5L3F A;  1RNL A;  3L09 A;  2XHK A;  1YTY A;  4PDK A;  2VBZ A;  4GXO A;  5D5X B;  4KN7 X;  4KDP A;  1A04 A;  1T38 A;  5ILV A;  5ED4 A;  2ZKZ A;  2F5C A;  4U0V A;  2MD5 A;  3QAH A;  4L9J A;  5LEK A;  2X0L A;  1OYY A;  2GIV A;  1R1U A;  3CO6 C;  5HDK A;  2OU2 A;  3FXR A;  3ABU A;  2M45 A;  3V7S A;  1FP2 A;  1K78 B;  1IN6 A;  2KJC A;  3HTS B;  2FBH A;  2P5V A;  3L2C A;  2VOO A;  3KP7 A;  2XVC A;  2PN6 A;  3KP3 A;  4H0E A;  1ZRE A;  2PMU A;  3OV8 A;  4IRI A;  3W6J B;  1U5T C;  3GLX A;  4KFC A;  3V8J A;  4A6D A;  2KJB A;  3RPU A;  2K02 A;  3JTG A;  4HA8 A;  4RB2 C;  4G6Q A;  5FLX Z;  4AIJ A;  5LRR A;  2NRA C;  4L9V A;  1IXC A;  3QU3 A;  1KU3 A;  2H6B A;  4KN4 X;  2E1C A;  2RC4 A;  4QWQ A;  4WWC A;  1S7O A;  1ZG3 A;  2P6S A;  3QP6 A;  4Y13 A;  2DI3 A;  1MJA A;  3K0L A;  3O2P E;  2ACJ A;  1ZAO A;  2UXX A;  1TLH B;  2KIU A;  3QP5 A;  4HQE A;  1FOK A;  3HYI A;  2KKO A;  1J7K A;  1P2F A;  4EQQ A;  1DPU A;  1B6A A;  1DP7 P;  2EV5 A;  4U0Y A;  3RDI A;  2DO7 A;  2FEZ A;  1XSX A;  3B73 A;  2QUF A;  4HAM A;  4NB5 A;  1MGT A;  5LGU A;  3R4K A;  4KIB A;  4OMY A;  1MJ9 A;  4HBL A;  4Q48 A;  4A5N A;  1DUX C;  1TNS A;  2EFQ A;  2ZJ2 A;  3GXO A;  3D5L A;  1XMK A;  1SFX A;  2HYG D;  4UVC A;  3I53 A;  5K1Y A;  1GHC A;  4ETS A;  1TW3 A;  3BP8 A;  3EYI A;  1WI9 A;  4O5V A;  4RGU A;  3JTH A;  4BHP A;  2QBY A;  1W7P D;  3FMR A;  2VC0 A;  3J81 Z;  3MAJ A;  2VE9 A;  4RGS A;  1FY7 A;  3TDU C;  1KYW A;  3I58 A;  1R7J A;  1SD7 A;  3M9A A;  1QPM A;  2ETH A;  1Q1H A;  2A69 F;  3HRS A;  4AIK A;  1CGP A;  3PFI A;  1I5Z A;  2GWR A;  2W25 A;  1UHW A;  5LEJ A;  3T8T A;  2NS0 A;  1U5T B;  3IRQ A;  3LQR A;  3ZQ7 A;  2IT0 A;  3V7C A;  5ILS A;  3DFG A;  3LAJ A;  2JZY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...