3QU6A

Crystal structure of irf-3 dbd free form
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
106
structure length
98
Chain Sequence
KPRILPWLVSQLDLGQLEGVAWVNKSRTRFRIPWKHEDFGIFQAWAEATGAYVPGRDKPDLPTWKRNFRSAMNRKEGLRLAEDRSKDPHDPHKIYEFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of apo IRF-3 and IRF-7 DNA binding domains: effect of loop L1 on DNA binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
molecule keywords IRF3 protein
total genus 26
structure length 98
sequence length 106
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2011-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00605 IRF Interferon regulatory factor transcription factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3qu6A01
4Q5SF 4UV8A 5FD5A 3I58A 4CGZA 2DK8A 3BP8A 3LA7A 1J0RA 2P5VA 4ENNA 4HF1A 4EJVA 3RKYA 4XRFA 1O3RA 4WX9A 3RKWA 1IXRC 3IC7A 2YSRA 5DCMA 2EJRA 3TO7A 4KDPA 5JI6A 4G9YA 2FQ3A 2Q8KA 4A0YA 3KFWX 2PN6A 4BYYA 2QQ9A 2RGVA 2Y48A 3R60A 1S8NA 3ZMUA 3IL2A 3MAJA 4MEXF 4IXAA 2VT2A 2MLGA 2E1NA 3GFJA 3WGGA 2OZ6A 5JR3A 4S05A 1SMYF 2ZXJA 3ZMZA 1KA8A 3BZ6A 4KIFA 2QQAA 2W25A 2XHKA 4K2EA 3J7AO 3D0SA 3KETA 1O57A 2IRFG 1FOKA 1KU9A 3BWGA 1FP2A 2QWWA 4CZZA 2CWEA 4ZYHA 3IHUA 5FGMA 5HOOA 2JRTA 1R00A 1ZG5A 2VC1A 3F21A 2VE9A 5KVRA 1KGSA 1FSHA 4UVCA 1B1BA 3V7SA 5L3EA 4BXUA 3RI4A 2HYFA 1DPUA 1W7PD 2EFOA 1O3TA 5ICFA 4HZFA 2HEOA 2FMYA 2MC3A 5E18F 1G3SA 5E20A 3TO6A 3GO5A 1BIBA 2CYYA 1JGSA 2JZYA 2CSOA 4FT8A 2DLLA 3KP6A 3CLOA 4XSXF 1F1ZA 1KYZA 2VOPA 1USSA 2RKHA 1IN5A 3M9AA 1HKSA 2HYGD 4CXFA 2RC4A 4IHSA 1U6GA 2P5KA 1HSJA 5L3FA 3WU0A 5LHIA 3WGHA 2EFWA 3K9TA 3FF5A 2GA2A 5D5UB 1F5TA 2XASA 4HX8A 3MZHA 4EM1A 2R7DA 3HRMA 3FZVA 5LGNA 2QBYA 3ULQB 3EYYA 4MHGA 3MQ0A 3F8CA 2AXLA 4M74A 3VOEA 3GLXA 3ROUA 4LG0A 1U5TA 2P5LC 1KU2A 2MBFA 5F6FA 4G7HF 2K4JA 2QUFA 5E1XA 1EH8A 3Q9VA 1OMIA 3T5XA 3WTYC 4IF4A 3QU3A 4EM2A 2C6YA 1C0WA 3ZPLA 4WF2A 1GXQA 3ML6A 3CUQA 4JQFA 5JVTA 4L5IA 3QAHA 1LB2A 1O3SA 2V9VA 2Z99A 4A6DA 1B9MA 5FLXZ 1ODDA 3R6SA 2V1UA 2D1VA 2O03A 3N4MA 4KN4X 3L9FA 4HOBA 2ISYA 3JTGA 3HSEA 4KIGA 3LFKA 4WXCA 2FNAA 4ZYEA 4DQ2A 2DPUA 2M8EA 3GW2A 5CVUA 1BJAA 3S2WA 3FHZA 2JPBA 1B6AA 4MGRA 3T0YA 3BPVA 1S29A 4U88A 4L9JA 3CUQC 2L4MA 4LK1F 1FP1D 1TLHB 4M72A 3B73A 4UV9A 4KUMA 5D5WB 3KLNA 6PAXA 3WTWC 3SHFA 1ZRCA 2KJCA 4OINF 3LSTA 2E1CA 4BHPA 1XMKA 4G6QA 3F8FA 3HHGA 1SMTA 1T39A 2EV5A 4D0PA 3JSOA 1ULYA 1YW9A 2E7XA 4ZYDA 1MJBA 2O3FA 1GVJA 2H94A 1YO5C 1PDNC 2IA1A 2IPQX 4EVIA 4UVAA 3JTHA 4G8XA 2HS5A 1D8KA 3R4KA 1MJAA 3FXRA 1WKMA 1TW2A 4L0ZB 2W57A 3TKYA 2ZCWA 5LBQA 1K78B 2D45A 2ZFWA 1J5YA 2P7VB 2VC0A 4LLNA 2XUBA 1SD4A 3I59B 1VTNC 3PFIA 1R1TA 2XKPA 2H6CA 1RIOH 4WXDA 2K86A 4YFXF 3G73A 3ELKA 5CVJA 4P96A 4RB2C 2L01A 5H6QA 3CUQB 4L9NA 5HS9A 2AS5F 4HYEA 5E1WA 5D5XB 4HF0A 2HOEA 4IRHA 4CO8A 3M1EA 1R23A 3GZ6A 3BJOA 5FO5A 3ISPA 4AIHA 2VE8A 4HLYA 1LQ1A 2M45A 5H6RA 3HTSB 3WTXC 2GQQA 1XGMA 2X0LA 5D8LB 3V7RA 2IA0A 2IA2A 4L9TA 3CDHA 1REPC 1XSVA 1F4KA 2JT1A 4RGRA 5LGTA 2Q0OA 1SFUA 3C18A 2OBPA 1HKTA 5LLQA 1FBSA 2XV4S 4MEYF 5DD4A 1IN6A 2OAZA 3BROA 3DXJF 1TBXA 1ON2A 2L02A 2L3DA 1FYLA 2QLZA 2VONA 3K1MA 4HDVA 3TDUC 1AOYA 1S3JA 2TDXA 3RYRA 1IW7F 5ICEA 2XKOA 2EFNA 1HKQA 2ETHA 2DK5A 2H6BA 2FBIA 1IN4A 1F9NA 3BY6A 5E8GA 1X3UA 1H9GA 2JPCA 1OKRA 2A68F 3O6BB 2A3SA 4HF2A 4NB5A 4LK0F 2F5DA 2Z5UA 1XDUA 4WK8F 1Y0UA 1BN5A 3Q5FA 5DYMA 2LDUA 2DPDA 1BM9A 2FE3A 1G3TA 2P8TA 1DUXC 5BPDA 2CQKA 4LLLA 1KQ9A 2Z3YA 5L3DA 2OZUA 4PZJA 3GEZA 3EDPA 1O3QA 1FWZA 4M9SA 3KCCA 3KZZA 3E6MA 1ZH5A 2K02A 4FX0A 2HKXA 4G94A 3BJ6A 3KLOA 4ENMA 3WTUC 1Q1HA 1T98A 5L3GA 5F64A 2UWMA 2YPRA 1U5TC 3FM5A 1Z1DA 1YS6A 5IT3A 2QVOA 2EB7A 2P6SA 1USTA 1OR7A 1XCVA 5ICGA 1ZN2A 3F23A 4BAYA 1FSEA 2M87A 4QLCU 4A0ZA 3GZ5A 2W84A 2ESNA 3SQNA 2PEXA 1LDDA 4WCGA 1ZGAA 3NEUA 4IVNA 1LJ9A 5J6XA 5CLSA 4YFKF 3O2PE 2EK5A 4ESJA 1U2WA 2B0LA 4QWQA 2HGCA 3VEPA 2EV6A 5HLGA 3R0JA 5E17F 4LLGF 5FLXK 2DAOA 4HDUA 1HSTA 2VXZA 1R5HA 5LEJA 1XSDA 2VT3A 1YTYA 3DQVC 3LAJA 4A12A 3H3ZA 3JW4A 1ZAOA 1TQMA 2BE5F 3I4PA 4ENKA 3GVAA 2GIVA 4A5MA 2CW0F 2IT0A 2GWRA 2WTEA 2STWA 4ENJA 2DQRA 5F1RA 4FX4A 1UB9A 3DPTA 2FMLA 2JSCA 2G7UA 3JAMZ 1PP8F 2LF8A 1B9NA 4Q47A 3RPUA 5BPIA 2RN7A 2UXXA 4LGWA 3NRVA 1XGNA 1ZHFA 2HZTA 4R79A 5FFZA 4EJTA 3IWFA 1MJ9A 4YG2F 3N97A 2O0YA 4AVPA 2P7CB 3I5UA 1LDKB 1LEAA 3GXOA 2MA3A 4I0AA 4FHTA 1YQAA 3SZPA 1EV7A 2Z9OA 4B09A 2RDPA 3I54A 2ZJ2A 4YIIA 1BI0A 1IN7A 4AWXB 5D4SA 2Y0MA 1K79A 5A2QK 1T2KA 1T6SA 4RAZA 3WGIA 3KZYA 2F5FA 1U78A 2EA2A 3HHHA 1V3FA 1S7AA 4BH9A 3GFMA 4LB6B 1P2FA 3WE2A 3HUGA 4KA4A 3GUDA 4M6XA 4Y15A 1JE8A 1FZPB 1ZARA 5HDNA 3MEXA 4G6DA 4BHBA 2GAUA 2J5OA 2XAJA 2FXAA 1IF1A 4A5NA 3REOA 4BHCA 5D4RA 2F5CA 4LD5A 3IKTA 1Z6TA 4ON0A 2VBXA 2DW4A 4HLXA 3LQQA 2UZKA 1KYWA 1UHMA 2XAQA 1QQIA 3GX4X 4OMZA 1MDMB 4M71A 3PQKA 1IXSB 2QYOA 3HRUA 3LA2A 2XAFA 3QRFF 1U8RA 5LRSA 4O6JA 5BS6A 5CJ9A 1LEBA 1FX7A 2EFPA 3E5QA 1P4XA 3IWZA 1R36A 3T8RA 3KP2A 2KIMA 5FFXA 3C1DA 2QQBA 2VBYA 2YX7A 4M9XA 4MQVA 4CICA 1H0MA 1YW7A 1W4MA 3QOPA 4H0EA 4GCVA 1KQ8A 1DP7P 4L0YB 1RNLA 3WU1B 1CGPA 2GXGA 5A2QZ 1TW3A 1B4AA 3HIFA 3TDZC 4F7ZA 4HAMA 3DP7A 3M8EA 3RKXA 5ILVA 1WSUA 5JFRA 2ZO4A 1YG2A 2A61A 5DUIA 3EQLF 1QGPA 2K4BA 1XGSA 3OV8A 4I2OA 4L5JA 3OOPA 2IJLA 1HW5A 1H9TA 3SZTA 1XB4A 3L09A 3KP5A 1IRGA 4I02A 4OIQF 3HOSA 3F8NA 3FWEA 1K6OA 3WE3A 3F72A 2ELHA 2PFBA 2KRFA 1WWXA 4U0YA 5D6EA 3ECOA 3RTRA 3ECHA 1QNTA 1SFEA 1PP7U 2EFQA 4MNUA 5HDGA 4PDKA 5E1ZB 3DKWA 2HKOA 3O3KA 1S6LA 4Q4ZF 2IW5A 1L0OC 4KN7X 1W7PB 2X4HA 5D8KB 4YIFA 1QPMA 3E6CC 2ACJA 3SXYA 2FA5A 3FMSA 2DO7A 3F8MA 3DPLC 3HOTA 3RPQA 3CTAA 1I6XA 5ICCA 2LF7A 1A04A 3Q9SA 2KIUA 4GYGA 2F5EA 1R5GA 1QBJA 2QM3A 3IKVA 3V8JA 1SD7A 3K69A 5ERIA 1CF7A 3HYIA 1I1SA 1G3YA 5HS8A 2VOOA 1IRFA 4G7ZF 2Q2EA 5DCMB 1KU7A 4JK1X 2ZNYA 2MD5A 2XAGA 1OYYA 4KMUX 2GXBA 4MTEA 3WTVC 4Z2YA 3P7NA 5AIQA 1BOAA 1FNNA 3KP3A 2VBWA 3RJPA 4ETSA 2NRAC 3P9KA 4OMYA 1FBQA 1SD5A 3QPHA 4XLPF 1FBUA 4I7HA 1JHFA 1LDJA 1SAXA 3I64A 2BV6A 4G7OF 4Y13A 3DV8A 3LQRA 1RUNA 2A07F 1W5TA 2HDCA 2VN2A 4I0BA 1YFHA 5K5OA 1ZGJA 3COAC 4XLNF 3L2CA 5HLHA 3DF8A 2G7HA 2L4AA 2UXNA 3H92A 1WQ2A 1T38A 4GGGA 5EEHA 2ISZA 5CYVA 1P6RA 3TOAA 2O8XA 2FBHA 5HDKA 2A6HF 1BI2A 4WWCA 1G4DA 5IT9Z 5LGUA 2BGCA 2DU9A 4UXNA 2M30A 1DPRA 3L00A 4RB1A 3I59A 3BDDA 3KP7A 4CYDA 3U9GA 4U7DA 1WI9A 3M8FA 1ON1A 2HTSA 2DTRA 3PQJA 4HQEA 4P55A 4IHTA 2PMHA 2GZWA 1ZLJA 1J7KA 3V7CA 2YX4A 2A69F 2COMA 4U7BA 1TQPA 2ZNZA 2FBKA 4EQQA 3E6BA 3F3XA 3FM3A 4M73A 2RQPA 4IRIA 1D8JA 4MTDA 5AONA 4S04A 4Y17A 2PLYA 2FF4A 1P92A 3QP5A 3WODF 3J81K 4ESBA 2HR3A 3KE2A 3TOBA 4GXOA 4ASNA 3L7WA 4P9UA 1R22A 3RDIA 5ED4A 5J8CA 3WTTC 2NNYA 5DDGA 3FXUA 5D6FA 2LSOA 2L54A 4HX4A 1RZ4A 1WRJA 4GYIA 2QENA 1Z6RA 2HQRA 1K7AA 3ZMTA 2FRHA 4AIKA 2EV0A 5CVVA 1R1VA 3FXQA 2ZMEB 3E5XA 3K1NA 3W6JB 5D5VB 4EM0B 3KP4A 1E2XA 5HVQC 1W5SA 3RIRA 2G9WA 2QBYB 1STZA 4RB0A 2H27A 3GFLA 5DUKA 1G3WA 1TQIA 2FOKA 2WC2A 3HRTA 3HRSA 1P4AA 5DD8A 1T0FA 2P6TA 4UNOA 4JBAA 2HWVA 2V1XA 4P9FA 3ZN1A 4AD9A 4N9IA 3U1DA 4O3MA 4E70A 2DQLA 4I09A 4I01A 2R7FA 4DNCA 1P4WA 2V6CA 3AAFA 2DT5A 2O61A 1UFMA 5K1YA 3SFZA 3IRRA 3P9CA 4GO1A 1YIOA 1BC7C 1O7FA 2VODA 1MD0A 1V4RA 2R3SA 1BIAA 5KK1A 5IT9K 1MZBA 2K27A 4RAYA 2CFXA 4HX7A 2RV8A 3EYIA 4YFNF 1XD7A 3LA3A 3V8LA 4RGXA 1SD6A 2OA4A 1IN8A 2OD5A 1OYIA 2FSWA 3JAMK 2CO5A 3WG9A 4M9ZA 4OIRF 3F22A 1HW1A 5L3BA 2NYXA 2J5PA 3EUHA 4RS8A 4N9HA 4KYWA 2XAHA 1MKMA 5TJJA 4UVBA 3FMQA 4MQ9F 3ERED 4EJUA 4ZYGA 5BQTA 5CVRA 4KICA 4LMYA 2STTA 3E6DA 2DFIA 3DEUA 2JTVA 3M7GA 4M6YA 3VB2A 2LKPA 2WV0A 2XGXA 2VBZA 1IUYA 3V4GA 3EETA 5BOXA 2WWYA 2K7LA 1J59A 1FYMA 2V79A 2CG4A 1YLFA 2HTJA 1BI3A 2M5WA 4OU0A 1K78A 5CVIA 5BMZA 2NNNA 4KMFA 1CF7B 2D1HA 1FT9A 3NQOA 1XN7A 5L3CA 1MGTA 1HXDA 1EH6A 1LNWA 4ZH4F 1UHWA 2E7WA 1JXSA 3R61A 3HSRA 1KQ0A 2CGPA 2W85A 1D5VA 3QPTA 4LB5A 1J9IA 1QZYA 1DDNA 5ILSA 1GXPA 1W7PA 4P5OA 1EH7A 1OYWA 3BPXA 3ZQ7A 3LAPA 3K1PA 2XIGA 2IVMA 3DFGA 3J81Z 4I98B 1AWCA 4EMSA 1FLIA 3P9IA 4LFUA 1XCBA 4R1HA 1OPCA 1HBXG 1UCRA 4HQMA 3CO7C 1BC8C 1R1UA 1R7JA 1BBYA 2MH2A 4IJAA 4KT5C 4EGYA 2V1DA 1HW2A 1ZRFA 3MFKA 1IZ1A 1E17A 5DV5A 4HV6A 5TRDA 1ZREA 2HQNA 1S7OA 1TNSA 3JSPA 1GHCA 3F8BA 4N0BA 1G6NA 4A6EA 5K5QA 2IP2A 3ZMSA 1U5TB 2DBBA 4NQWA 1KU3A 2D2WA 4EJOA 4CHUA 3K0LA 2NAZA 2MLKA 2ADUA 5LHGA 3MWMA 1XDSA 3H3UA 2ZBKA 4LJZF 3ABUA 3ZN0A 4HV5A 1ZG3A 3WTSC 4HA8A 2PG4A 4OOIA 3TO9A 4O5VA 3F6VA 2KKOA 3GWZA 3R0AA 4KIBA 1QZZA 3FMRA 5HS7A 3GYHX 2FEZA 1L3LA 1NHAA 1ZG1A 2BBYA 2XRNA 1R58A 2PQ8A 3G3ZA 5HLIA 1IXCA 3VODA 1J75A 1TNTA 3I0TA 3WTZA 2YU3A 1FYKA 2BYVE 3D5LA 1Z9CA 3C7JA 3C3WA 5EEGA 2M1BA 2RNJA 3TQNA 4LG0B 5E8IA 2FU4A 2H09A 2XROA 5DEQA 4UHTA 2DI3A 1QO0D 4B8XA 1RI7A 3CO6C 2P4WA 3FX3A 5LRRA 4IRGA 3J80Z 2ZMEA 2QZ8A 1YW8A 2A5YB 5DCFA 4A0XA 2NS0A 2RVCA 3VFZA 3ZMDA 1I1GA 1IAWA 1TTYA 2ESHA 3GFIA 1U3EM 1RUOA 4ZZDA 1ZRDA 1Z91A 1FC3A 4UUVA 5LHHA 4L9VA 5J8FA 2PJPA 1FY7A 1J2XA 2HFHA 3I71A 5FB2A 3CUOA 2MH9A 3J80K 4A2UA 3V8KA 3U2RA 5AIPA 3E5UA 2BEOA 4Q48A 3K2ZA 2A6EF 4EGZA 2OU2A 5FD6A 3CJNA 4IPAA 4RB3C 2OQRA 3T1BA 1LVAA 4RGUA 2W24A 1HQCA 2Y75A 3F6OA 3GF2A 4WXHA 2OQGA 4R8HA 3E3VA 4PCQA 1FPQA 1PUEE 3BJAA 2LNBA 3HSFA 4BNCA 2Z33A 3T8TA 3QU6A 4TV7A 1YYVA 1I27A 1O7LA 2PI0A 3LWFA 4EV0A 3HTUA 3IRQA 4KFCA 2GA1A 5ILUA 1SFXA 4HBLA 2YR2A 4OIPF 1B59A 4EJWA 5H20A 1BI1A 2EA4A 3ZMVA 1ZYRF 4CDGA 3BOQA 4ZZLA 4PGGA 1ZLKA 3E97A 2PBIA 2ZKZA 3TGNA 4XBFA 2EWNA 1XSXA 3ABTA 3KEQA 3KEOA 2O6GE 4KNYA 3RYPA 3ZP5A 1XGOA 2KJBA 3MCZA 3B02A 4AIJA 5JHUA 5K5RA 4OIOF 4ESFA 1Z05A 2FNPA 4BQAA 4L18B 1MDMA 1YS7A 4RGSA 1XMAA 3QP6A 3W6KB 4PGHA 2XVCA 2PMUA 4HW0A 2KIFA 1Z7UA 4U0WA 1D3YA 4XSZF 3MZYA 5LEKA 3I53A 1I5ZA 1ONVA 4NHJA 4U0VA 1JHHA 2F2EA
chains in the Genus database with same CATH superfamily
4Q5SF 3S3OA 2M7AA 4UV8A 2W00A 1H88C 2CUFA 4NC7A 5FD5A 3OYFA 3I58A 2CJJA 3CCRI 4CGZA 2DK8A 3BP8A 3LA7A 2IEKA 2JK3A 1J0RA 2P5VA 2EZHA 4W1UA 4ENNA 2XPUA 4HF1A 4EJVA 2NS7A 3LFUA 3RKYA 5FJ8J 1RR7A 4XRFA 5FKOA 1XG1A 3E1SA 1O3RA 3EUHC 3RCOA 4WX9A 3I55I 3RKWA 3M4OJ 1D0XA 5EZGA 3H35A 2R5YA 1IXRC 1V5GA 3JRIA 3FKJA 3IC7A 1YOVB 2YSRA 4D7MA 5TISC 4XOPA 2W1OA 5DCMA 4B47A 2EJRA 3TO7A 3JRBA 4KDPA 3K4KA 5JI6A 4G9YA 5F0HA 2FQ3A 2Q8KA 3K4BA 1BR1A 3BTJA 4A0YA 1ZELA 3KFWX 1R71A 2PN6A 4BYYA 2QQ9A 2RGVA 2Y48A 3R60A 3RQIA 1S8NA 3RQ4A 3ZMUA 3IL2A 2L5QA 2VJIA 3MAJA 4ZTFA 4MEXF 1SVMA 4IXAA 2VT2A 1PUFB 2MLGA 5J4YA 2E1NA 4E7KA 3OY9A 3KEYA 3GFJA 3WGGA 2OZ6A 5JR3A 4S05A 1SMYF 2ZXJA 3ZMZA 1KA8A 3BZ6A 4IL6C 2A5WA 4KIFA 2DDAA 3BQYA 2QQAA 3AKZA 2EPFA 2W25A 2XHKA 4K2EA 4B48A 3J7AO 3D0SA 2Y2ZA 3KETA 1O57A 2IRFG 1J09A 3BR0A 1QRYA 3A4CA 2IS6A 2AQEA 1EKEA 2OTLI 3DTIA 1FOKA 1KU9A 1K4SA 4MIMA 2WV1A 3BTLA 3BWGA 4KISA 4PJNA 3PJRA 3VSKA 1FP2A 4IHXA 2QWWA 4CZZA 2CWEA 4ZYHA 3IHUA 1D0ZA 2WADA 5FGMA 3VYRB 5HOOA 2B7EA 3U21A 2IS4A 4JP0A 5JHFA 1WCMJ 2I8DA 2JRTA 5BNGA 4A69C 1X3ZB 1W0TA 1R00A 2M0CA 3HPGA 4KT6A 2BY2A 1ZG5A 4BGDA 4IHYA 2VC1A 3F21A 3GBGA 1E3OC 2VE9A 5KVRA 1KGSA 3F0CA 4PJLA 4OAYA 3D5SC 1FSHA 4UVCA 5JLWA 2EZLA 1B1BA 2MC4A 2CQXA 4GDFA 3V7SA 4A3FJ 5L3EA 1BOBA 4BXUA 2K40A 3RI4A 2HYFA 1DPUA 3KYCB 1W7PD 2EFOA 4HNVA 2XC7A 1O3TA 2VASA 1IO2A 1QU3A 3DPUA 4JOMA 5ICFA 4HZFA 2HEOA 3HL2A 2FMYA 2MC3A 3PM1A 5E18F 3H9GA 1RRJA 3H3VK 1G3SA 3E0JB 4U87A 5E20A 3TO6A 3GO5A 3H9QA 4BE1A 4XL9A 1BIBA 2CYYA 1WJBA 5LD2C 1JGSA 1JT6A 2FQ4A 2CSOA 2JZYA 4XKCA 3GLLA 4FT8A 2DLLA 3KP6A 2HI3A 3CLOA 4XSXF 1F1ZA 1KYZA 1S72I 2LVSA 2VOPA 1USSA 2L9NA 3MKZA 5M5XJ 1IV8A 2RKHA 1IN5A 3M9AA 2KDZA 1HKSA 5IP9J 2HYGD 2NOGA 4CXFA 2RC4A 4IHSA 1FEXA 1U6GA 2P5KA 5B66C 1HSJA 5L3FA 3OOUA 3WU0A 3WGHA 5LHIA 2LOOA 3HOZJ 2EFWA 1UG0A 3IP4B 1P9QC 3K9TA 3A0HC 3FF5A 3S1MJ 2KISA 2GA2A 4NDLA 3H1CA 2XASA 5D5UB 4HX8A 3BG7A 3MZHA 1K4TA 3QOEA 4EM1A 2R7DA 3M8JA 3HRMA 5KNLA 3FZVA 5LGNA 2JVHA 2QBYA 3ULQB 3Q0VA 3EYYA 1JT0A 3MVPA 2HNHA 4MHGA 3MQ0A 1JI8A 5E3MA 3SEQA 3CJRB 3F8CA 4I76A 2FJ1A 3DCFA 5HODA 2WY8Q 2VJ5A 2AXLA 4C3IJ 4M74A 3VOEA 1Z77A 3GLXA 2JA2A 3ROUA 2E60A 4LG0A 1U5TA 4N4OB 4II2A 2P5LC 1KU2A 2MBFA 5F6FA 4G7HF 2ME0A 2K4JA 2QUFA 5E1XA 1VQOI 1EH8A 4RLQA 3Q9VA 2ZB9A 1OMIA 3T5XA 3WTYC 3BR3A 4IF4A 2DMPA 3QU3A 4EM2A 2C6YA 2COBA 1C0WA 2M8GX 1U8BA 1NTCA 2QSFX 2NVUB 5E3NA 2R7RA 2BW3B 3ZPLA 3ZR8X 4WF2A 2JA8J 1FOXA 1GXQA 3ML6A 5EGOB 3CUQA 3JRDA 4JQFA 5JVTA 2GM4A 3HDDA 3BQZA 3DBRB 4AVZA 4L5IA 3QAHA 1LB2A 1YHQI 2V9VA 1O3SA 3MKYB 2Z99A 2FOWA 2B63J 4A6DA 1B9MA 1UELB 3ZGKA 3OSGA 5FLXZ 1ODDA 3R6SA 2V1UA 4ABZA 3HM5A 2LRDA 2KHMA 2D1VA 4PSWA 2O03A 3N4MA 4KN4X 3L9FA 2M4KA 4HOBA 2ISYA 3JTGA 3HSEA 4KIGA 5K7HA 4XK4A 3LFKA 4WXCA 2FNAA 4ZYEA 4DQ2A 1U9OA 2DPUA 1JTYA 3K4MA 2M8EA 2TRTA 3GW2A 5CVUA 1BJAA 3S2WA 2K85A 3FHZA 2JPBA 1B6AA 1WH7A 3VWBA 3CP8A 4MGRA 1WVRA 3PO3J 1YJWI 4EATA 3T0YA 1UG2A 3BPVA 1S29A 4X6AJ 1Z3YA 4U88A 4L9JA 2MG4A 3L2RA 3K7AJ 3CUQC 1I3AA 2L4MA 4LK1F 1TZLA 5HNFA 1FP1D 3WU2C 1TLHB 4II3A 2LLKA 4M72A 1SEUA 3B73A 3FIWA 3BR1A 3PL8A 4KUMA 4MFDA 4UV9A 5D5WB 4A3JJ 3KLNA 6PAXA 1ETOA 4I99C 3WTWC 3SHFA 1ZRCA 2KJCA 1FMWA 4OINF 2MABA 5IP7J 2R7OA 3LSTA 2QKLB 3CDIA 2E1CA 4BHPA 3HKZN 4F52A 1DGWY 1XMKA 2EZKA 4G6QA 5FRNA 2ZXIA 3F8FA 3A02A 1SMTA 3HHGA 3K10A 2EV5A 4D0PA 3JSOA 1T39A 2QQ8A 1Y0NA 2DFEA 2OJED 1ULYA 1YW9A 2EIJH 1IGNA 5B1AH 2E7XA 4PJJA 5M3MJ 4ZYDA 1LFUP 2HXIA 1I50J 3I9V2 4JX4A 5E3OA 1W0UA 2IBDA 2VJJA 1XS9A 1MJBA 3IV5A 2O3FA 1GVJA 2H94A 2OCCH 3HOYJ 4IOCF 1YO5C 4J19A 1PDNC 1GT0C 2IA1A 2IPQX 2JUGA 4EVIA 4UVAA 4XRSA 3JTHA 4G8XA 2HS5A 1D8KA 2JUCA 1MJAA 3FXRA 3R4KA 1WKMA 4AIDA 1TW2A 4L0ZB 1WJ5A 2W57A 3TKYA 1HCRA 3KIOA 2ZCWA 1P7JA 1RETA 2Y31A 5LBQA 1Q1VA 1K78B 1FOYA 2D45A 2ZFWA 3NWSA 1ERDA 3W6VA 1J5YA 2P7VB 3PUFA 3GTQJ 1MSEC 1MH4A 3HC7A 2VC0A 3HUGB 9ANTA 4LLNA 4GRIA 2E19A 4IEJA 5EG0B 1QZEA 1SD4A 2XUBA 1K6YA 1MSFC 2R92J 3I59B 3TP0A 1VTNC 2NVTJ 4BXXJ 1IDZA 3PFIA 1BW6A 1R1TA 2XKPA 2H6CA 4ZJZA 5J4VA 4WXDA 1RIOH 4XN3A 2L7FP 2RQQA 2K86A 4YFXF 2GXAA 5CVJA 3ELKA 4RB2C 4P96A 3G73A 2L01A 4BEHA 5H6QA 3CUQB 4L9NA 2E1MB 5HS9A 1YX3A 1A36A 2AS5F 4HYEA 1V55H 2E1OA 2L7MP 2JWTA 5E1WA 1FIAA 5D5XB 3OYBA 4HF0A 2ZXHA 3W2AA 3OR1C 2AHQA 2HOEA 4IRHA 4CO8A 3FKIJ 2CQNA 3M1EA 1R23A 3GZ6A 3BJOA 1ZR4A 5FO5A 4EEFG 3ISPA 1T0FC 1D1AA 2EIMH 2IXSA 3SJMA 4AIHA 2E36A 2VE8A 4BE0A 1DGRM 4HLYA 2LKXA 1LKXA 1LQ1A 3ABMH 3S15J 5HNHA 2M45A 5H6RA 3HTSB 1MW7A 3WTXC 1F43A 2GQQA 1XGMA 2CUZA 2X0LA 5D8LB 3V7RA 2IA0A 1GVDA 3VYTB 3BC8A 2IA2A 5K7ZA 3CCUI 4L9TA 1X4OA 2MD0A 3CDHA 1W36D 2DA1A 1B72A 2BY0A 1REPC 1XSVA 2WB1A 1RC9A 1F4KA 1LFBA 2FX0A 1VNDA 2JT1A 3BG5A 4RGRA 2X6OA 2VXDA 5LGTA 3D1NI 2Q0OA 1OFCX 3A0BC 4PFOA 4AYBN 3A03A 5DM7F 3OYDA 1FOWA 4A3IJ 2E71A 2V9KA 1SFUA 2DTZA 3C18A 2OBPA 1HKTA 5LLQA 1FBSA 3CF2A 1HF0A 2XV4S 3G1LA 4CCLA 4MEYF 5DD4A 1IN6A 2OAZA 3BROA 4G12A 4V2GA 2HDDA 3DXJF 3S32A 1TBXA 3OYCA 1ON2A 2L02A 4CYCA 2L3DA 1FYLA 1MMGA 2QLZA 2X6YA 2VONA 3K1MA 4HDVA 2OCEA 2OUMA 3ERMA 3TDUC 5HLTA 1PUFA 3KYLA 2GLOA 4A3BJ 3OS0A 1AOYA 3PO2J 1S3JA 5F1JA 2JQ7A 2TDXA 3RYRA 3F9KA 5C3EJ 4A3LJ 1IW7F 1TWGJ 5ICEA 2XKOA 3L2QA 2EFNA 1HKQA 4NNJA 3AFHA 4W97A 2ETHA 2DK5A 2H6BA 1E3PA 2FBIA 1FTZA 2PMZA 3HOXJ 3JRFA 1IN4A 1F9NA 3BY6A 5E8GA 5KAIC 4PK4A 1X3UA 1H9GA 1TWCJ 3CESA 5GP9A 4BKXA 3CCSI 4N4NB 2JPCA 1OKRA 1X2NA 2A68F 2H1LA 3O6BB 2A3SA 5J1UA 3GTLJ 3VYSB 4NB5A 4HF2A 4IOAF 4LK0F 5J1RA 3DLLF 4FCYA 1X1AA 2F5DA 2Z5UA 3ZXSA 4M3FA 1XDUA 4AYBA 3L2UA 5IYCJ 4WK8F 2KP6A 3M1CA 4X1EA 1Y0UA 1BN5A 3Q5FA 3S3MA 5DYMA 1MMSA 5EF6A 1SFOJ 1Y6IA 2LDUA 3IH3A 2P81A 1BM9A 2DPDA 1KZHA 2FE3A 1G3TA 4A3KJ 1SVLA 2P8TA 4HNUA 5BPDA 1DUXC 2BXZA 2CQKA 3WG7H 4FETA 4LLLA 1KQ9A 1PYVA 2ELKA 2Z3YA 5L3DA 1T56A 4C9YA 4DBQA 3OYMA 3A1YA 2OZUA 4PZJA 3GEZA 3EDPA 4DYQA 1O3QA 1VQKI 1FWZA 4M9SA 4UB6C 3B6CA 3KCCA 3KZZA 2FD5A 2DOFA 2M34A 2IS2A 3BTIA 1YRNA 3E6MA 1ZH5A 2K02A 1AA7A 3Q3SA 4FX0A 3UNGC 2HKXA 3LL7A 3OYKA 4G94A 3BJ6A 1VQPI 3KLOA 4CCNA 4ENMA 3WTUC 1Q1HA 1T98A 3QPLA 4G6TB 3S2DJ 5L3GA 5LFAA 2LBFB 4QIWN 1AHDP 1N75A 5F64A 2UWMA 3ABKH 3BR2A 1U5TC 2YPRA 3FM5A 5K7FA 3G6EI 4M3BA 1OJLA 4QPQA 2IGOA 2FUG2 1OCOH 2ZMEC 4F92B 1Z1DA 2KFDA 1YS6A 5IT3A 2QVOA 2EB7A 1CQTA 2LY2A 1MNMC 2P6SA 1USTA 1OR7A 2L9SA 3P5JA 1XCVA 4D5CA 3CC2I 5ICGA 2LH9A 2X85A 1ZN2A 1MMNA 3MMYB 3F23A 4BAYA 1FSEA 2M87A 3Q0WA 4QLCU 3IH4A 3N05A 4A0ZA 3GZ5A 2W84A 3JRHA 2JA5J 2LP0A 2ESNA 2HPIA 3PNVA 3SQNA 2PEXA 1LDDA 3HB9A 3ZQGA 4WCGA 1ZGAA 2ICWG 3NEUA 2HOAA 4IVNA 1LJ9A 4UUSB 5J6XA 4XRSG 5F08A 3HOVJ 3HGGA 5GPCA 5CLSA 2WAFA 4YFKF 3O2PE 3DU5A 2Z16A 5GADJ 1A5JA 2EK5A 3W3CA 4ESJA 1U2WA 2B0LA 2RAEA 5B5EC 2JN6A 2XF5A 4QWQA 2HGCA 3VEPA 2M7BA 2EV6A 2L0KA 5HLGA 1I39A 3R0JA 5E17F 1VF9A 4LLGF 3L2VA 5FLXK 2ZC2A 2F4MB 2DAOA 1OCTC 4HDUA 1HSTA 1Y1VJ 2VXZA 3QYFA 1R5HA 3C2HA 3H5RA 1X1PA 2XGCA 3FK7A 3G4SI 5LEJA 4IO9F 1KONA 1XSDA 2VT3A 1YTYA 1ZGWA 3DQVC 3LAJA 2XSJC 4A12A 1JUMA 3LSRA 1WH5A 3K70C 3H3ZA 1QVTA 3JW4A 3S17J 1N25A 1ZAOA 1MBJA 1QHHD 1TQMA 2E35A 2BE5F 2LYCA 3I4PA 2E2JJ 2X6WA 4ENKA 3GVAA 1ETVA 4XLCA 5H2FC 3W2VA 2GIVA 5FLVA 4RBOA 4A5MA 2CW0F 4DBRA 2CU7A 4Y4RA 1PJRA 4QSHA 2IT0A 1RKTA 2GWRA 1T33A 2WTEA 2Y69H 2STWA 4ENJA 2DQRA 5F1RA 2DJIA 1UB9A 4FX4A 3DPTA 2FMLA 1TP4A 1XMXA 5GAHJ 2JSCA 4XLFA 2G7UA 2JJ7A 2GOMA 2W7NA 3PFYA 1SAUA 5CQEA 3JAMZ 3S3NA 3A01B 1GV2A 1PP8F 2LF8A 1B9NA 4FTHA 4Q47A 2W82A 3RPUA 5BPIA 2RN7A 1T08B 5M5WJ 4BS9A 2UXXA 4LGWA 2L9RA 1R6RA 1WHUA 4IQJA 3NRVA 2R0QC 1XGNA 1ZHFA 2PJRA 2LK2A 4C2TA 4B44A 2HZTA 4R79A 5FFZA 1RESA 4EJTA 1BA5A 3IWFA 4ZYAA 3OYGA 1MJ9A 4LOCA 4YG2F 3N97A 2O0YA 1X1CA 4AVPA 1A6QA 2P7CB 3I5UA 1LDKB 1WJFA 3H0DA 1LEAA 3GXOA 2MA3A 4I0AA 4FHTA 1YQAA 2BW3A 3SZPA 1EV7A 2LMDA 2EINH 4B09A 3OYLA 2L2OA 2Z9OA 3CQZJ 1JTXA 2RDPA 4NBQA 3I54A 2ZJ2A 4YIIA 2KRCA 3A2KA 2IS1A 1Z7LA 2NS8A 1BI0A 3LSGA 1IN7A 2VQCA 4AWXB 1ETKA 5D4SA 3PIOF 2Y0MA 3CMEI 1K79A 5A2QK 1T2KA 1T6SA 1MNEA 4RAZA 3WGIA 3KZYA 3OS2A 2F5FA 1U78A 2EA2A 3HHHA 3ZQQA 1MH3A 1V3FA 4DIQA 4XICA 2BY3A 5KCMA 1S7AA 3CF5F 3CMMA 1TT0A 4UUSA 4BH9A 1UHSA 3GFMA 4BDYA 4A3MJ 3LSPA 1K83J 4LB6B 2VLAA 1P2FA 3WE2A 1R49A 3HUGA 4KA4A 3GUDA 4M6XA 4Y15A 1JE8A 3ZQCA 1FZPB 3S93A 3FXOA 2LREA 1ZARA 5HDNA 1BR2A 2XB5A 3MEXA 4G6DA 4BHBA 2OTJI 2OPTA 2GAUA 2XF6A 2J5OA 2XAJA 3B6AA 1GUUA 2FXAA 4NQWB 1IF1A 4A5NA 4ZDOA 3REOA 4BHCA 2CQ7A 1Y1WJ 5D4RA 2F5CA 3TW7A 2RREA 3S2HJ 1ORKA 4LD5A 4UUTA 1Z6TA 3IKTA 1MBEA 4IZZA 4ON0A 1HA8A 1IV6A 2VBXA 2DA3A 2DW4A 1UMQA 3OYJA 4QPOA 4HLXA 2HPMA 2YS9A 4E7LA 5C44J 3QODA 4C3HJ 5GAGJ 3LQQA 2UZKA 1KYWA 1UHMA 4DOZA 1LE8A 3KYDB 2XAQA 2H8RA 1TWFJ 3BLYA 1QQIA 3GX4X 2DFHA 4OMZA 1MDMB 2VKEA 1ETYA 4DJAA 3RZDJ 4IHWA 4M71A 2EH3A 3PQKA 1NK2P 1IXSB 1IRXA 3UR3C 2E2IJ 2QYOA 4V2FA 3HRUA 3LA2A 2XAFA 1JJ6C 3QRFF 1U8RA 2CFOA 4BBRJ 5LRSA 4O6JA 2X48A 5BS6A 1UAAA 5CJ9A 3SZGA 1OCCH 1LEBA 2HVSA 1FX7A 2EFPA 3K4NA 2RNGA 4ITVA 3OL4A 4A3EJ 1N77A 1U9NA 1VI0A 3E5QA 5C4XJ 2E5ZA 4BBSJ 2YUSA 2K9SA 1P4XA 2PMZN 2WAQN 3IWZA 4MLOA 1R36A 1VQ4I 3T8RA 3H36A 3KP2A 2KIMA 2CQQA 5FFXA 2DFFA 3C1DA 2NVYJ 2QQBA 1D5YA 1IUFA 1AU7A 4RAGA 2VBYA 2YX7A 4FQGA 4M9XA 4MQVA 4CICA 1H0MA 1YW7A 3H5NA 1EA3A 5EG0A 2DOAA 2W4SA 1W4MA 1MBGA 3QOPA 3ZCOA 4H0EA 1TWHJ 4GCVA 1KQ8A 1NG6A 1DP7P 4L0YB 4XORA 4ANJA 3PNTA 5TGTA 1RNLA 3WU1B 2DXIA 1CGPA 2GXGA 1X2MA 1W5CC 2QA4I 2O9LA 2KT0A 4CCKA 4HPQA 5A2QZ 1TW3A 1B4AA 3HIFA 3TDZC 4F7ZA 4HAMA 4NUBA 2R7UA 2D5VA 3DP7A 3M8EA 3RKXA 5ILVA 1WSUA 3BZKA 5JFRA 2ZO4A 3JRAA 1WJEA 1YG2A 2A61A 1HDPA 5DUIA 3HZJA 3EQLF 4LIUA 1OCRH 1EF4A 4XLAA 2IAIA 4XKWA 5IPAA 1QGPA 2KDOA 2K4BA 2QEXI 1XGSA 3OV8A 4I2OA 2X51A 3C2GA 3DEEA 4L5JA 3ZQIA 1YIJI 3OOPA 2K9QA 5IOZA 2IJLA 1HW5A 1H9TA 1SANA 3SZTA 2JRMA 1XB4A 3L09A 1VQLI 3KP5A 5FROA 2VQHA 3DU6A 1IRGA 4I02A 2Q1ZB 4OIQF 1VQ9I 3HOSA 3F8NA 3GZNB 2K9MA 1POGA 2MW8A 3FWEA 2VKVA 3JR9A 1K6OA 3WE3A 3F72A 2ELHA 1GDTA 2PFBA 3BR6A 2KRFA 1WWXA 2ID3A 4U0YA 5D6EA 4C3JJ 2R7ZJ 2XB0X 3ECOA 3RTRA 3I4NJ 3ECHA 1B72B 1QNTA 1SFEA 1PP7U 2EFQA 4MNUA 5HDGA 4PDKA 4YEJA 2XGDA 3DKWA 5E1ZB 4P1WA 2HKOA 5DS9A 3O3KA 1XTAA 1S6LA 4Q4ZF 2EIKH 4YIRX 2WAQA 4ZTJA 1R4NB 2I5UA 2Y30A 4L5EA 3AL0C 3JREA 2IW5A 4Z6YA 1L0OC 4F91B 5GAEJ 1TT5B 1YE9A 1W7PB 4KN7X 2X4HA 4C30A 5D8KB 3CMYA 2ECBA 2NOJB 4YIFA 1QPMA 2N8GA 5DM6F 2ECCA 2WBMA 2DMTA 1MBHA 3E6CC 2ACJA 3SXYA 4KITB 2FA5A 3FMSA 3IH2A 2F4IA 2DO7A 4E4HA 3ZRGA 3F8MA 3OYHA 1QPIA 3DEWA 3DPLC 3HOTA 3RPQA 1FJLA 3LOCA 2LBFA 2KZVA 3CTAA 3E7LA 1I6XA 5ICCA 1WJCA 3CLQA 2E5NA 4FE7A 2LF7A 3BT9A 4X0GA 1WGXA 1A04A 3K4CA 3Q9SA 2WA0A 1IDYA 1V5FA 2KIUA 4GYGA 2F5EA 1R5GA 1QBJA 3C2BA 3I4MJ 2QM3A 1ETXA 3IKVA 1TL8A 4JX6A 4M3EA 5GPAA 1SD7A 3K69A 1MBFA 3V8JA 2A05A 5ERIA 3BCBA 1CF7A 2M4GA 3HYIA 1I1SA 3TL4X 1G3YA 2M0MA 3K2AA 1PVEA 5HS8A 2VOOA 5CQGA 1IRFA 4C2UA 4CUGA 4UY8I 1VQ8I 4G7ZF 2Q2EA 5DCMB 1KU7A 3M07A 4JK1X 2ZNYA 2B9SA 2DA4A 4LG3A 4RMNA 1R4MB 2HOTA 4M3DA 3HBLA 4PJMA 4RM2A 2MD5A 2XAGA 1BL0A 1FMVA 2VB6A 5FKMA 3OIPA 4Y3OA 1ZQ3P 3FXLA 4XKVA 4HEA2 2L9VA 1IRZA 2DA5A 3OIQA 1OYYA 4KMUX 4PFPA 3CMAI 2GXBA 2P0WA 4MTEA 3ZQLA 2QF7A 2K9NA 3WTVC 4Z2YA 3P7NA 5AIQA 1QVUA 1BOAA 1FNNA 3KP3A 4FISA 4F93B 3ONQA 1Z67A 3H5AA 2VBWA 1UZCA 3RJPA 4ETSA 2NRAC 2VKDA 3P9KA 4F55A 1B8IB 5C4JJ 3IAM2 4OMYA 3BZCA 1FBQA 1SD5A 4RM3A 4D7NA 1M1EB 3QPHA 4XLPF 1FBUA 4I7HA 1JHFA 4XKBA 1LDJA 3SDBA 1SAXA 3I64A 2BV6A 4G7OF 4Y13A 3DV8A 3LQRA 1S5LC 3K4JA 1RUNA 2A07F 2EQRA 3LMMA 3LNQA 3PNYA 4A3DJ 2CH0A 2CRGA 3JRCA 1W5TA 2HDCA 4ZDLA 4NC8A 1NG7A 1YJ9I 2VN2A 2ZSHB 4I0BA 1YFHA 5K5OA 1ZGJA 3CDLA 4D5FA 3COAC 4XLNF 3HKZA 2OC6A 3AL0B 3L2CA 5HLHA 3DF8A 2R5YB 3FDYA 4ZDPA 1XX5A 2G7HA 2L4AA 2UXNA 2XGEA 3H92A 3VSLA 3A01A 1WQ2A 3CCQI 1T38A 3S16J 4GGGA 2CW8A 1V5EA 5EEHA 2ISZA 5CYVA 1P6RA 1AKHA 3TOAA 2O8XA 2FBHA 5HDKA 3GTGJ 2A6HF 5M5YJ 1RKWA 1BI2A 4WWCA 3HOWJ 3EUAA 3GMEA 1Z0XA 1G4DA 3CC7I 5IT9Z 3AG4H 3K70D 5LGUA 1Y8QB 2BGCA 2DU9A 4UXNA 2CUJA 2M30A 1WI3A 2ZJRF 1OQYA 2O7OA 1DPRA 2MYSA 2E2HJ 1S7EA 3VYUB 1ZR2A 3L00A 4RB1A 1O4XA 1VQNI 3BG9A 3CP2A 3I59A 2XSDC 3ZQFA 5FKKA 3BR5A 1P7IA 3BDDA 3KP7A 4CYDA 4XQFA 2JA6J 3U9GA 3SFIA 4U7DA 4NC6A 1WI9A 3M8FA 1ON1A 2HTSA 3QYBA 2VUMJ 2DTRA 3PQJA 1BW5A 3J7ZI 4P55A 5EYRA 4HQEA 4IHTA 5F0CA 2PMHA 2GZWA 1ZLJA 1J7KA 3EUKL 3V7CA 3S8PA 5IP6A 2YX4A 2AXTC 3ABLH 2A69F 1LFPA 2AQFA 2BHZA 2COMA 4U7BA 1TQPA 2ZNZA 2FBKA 4EQQA 3G2BA 3E6BA 3F3XA 2F5VA 3FM3A 3J7YJ 4Y52J 4ZC3A 2IGNA 2VQLA 2CS3A 4M73A 3RPUD 2RQPA 3JCUC 4IRIA 1LPQA 2DMUA 1D8JA 4MTDA 2HYJA 5AONA 4S04A 4Y17A 2ZFUA 2PLYA 2FF4A 1P92A 2Y0SA 1IC8A 2I10A 3QP5A 3WODF 3J81K 4ESBA 5CPRB 4FASD 2HR3A 3KE2A 4B3XA 5F0FA 1T95A 3TOBA 2F6CA 3CJQB 3QPSA 4GXOA 4ASNA 4PUSA 3OIOA 3L7WA 4P9UA 1R22A 4XLHA 4A93J 3RDIA 3OYNA 1W36C 5ED4A 2H1KA 3ZQHA 1DU6A 1X4PA 5FKLA 5J8CA 2G0EA 2KZGA 4AM3A 3WTTC 2NNYA 4BJTA 3G1OA 5DDGA 3U1KA 2VJ4A 3FXUA 5D6FA 2LSOA 1BJZA 2QGUA 4RAFA 2PJRB 1ENHA 2KL4A 2L54A 2L7KA 2M2EA 4HX4A 1RZ4A 1WRJA 3ASNH 2A6TA 4GYIA 2QENA 1Z6RA 2HQRA 2AO9A 1VQ5I 1K7AA 1D1CA 1LE8B 2JMWA 3ZMTA 2FRHA 1SVOA 4AIKA 5JLXA 2R7VA 2CW7A 3J7AY 1X1DA 2EV0A 4M6VA 1R1VA 2DDBA 2KIQA 3FXQA 5CVVA 2ZMEB 3E5XA 4BJ5C 3K1NA 1NK3P 5KHDA 3GTJJ 2UUZA 3W6JB 5D5VB 1ACIA 1X58A 2LFBA 4EM0B 2W48A 4E6KG 3KP4A 1E2XA 3IAS2 5HVQC 2VKHA 2GOXB 1H8AC 1W5SA 2PX9A 2G9WA 3RIRA 4E7ZA 2QBYB 1STZA 4RB0A 2BOLA 5EDNA 3GFLA 5DUKA 3ESWB 1AKHB 2H27A 1G3WA 3DTEA 1OCPA 3FBIB 1TQIA 2FOKA 1QA6A 2WC2A 1SFKA 3HRTA 3HRSA 1P4AA 4AUXA 2ZSIB 3IUOA 2IGMA 5DD8A 3SYTA 1T0FA 3HXLA 2K3PA 4AU7A 3LSKA 2P6TA 1JJ8C 4JBAA 4UNOA 2HWVA 2M9HA 4XN0A 2V1XA 4P9FA 3UKGA 3PUBA 2GBYA 3ZN1A 4AD9A 4N9IA 3U1DA 4O3MA 4E70A 1WFXA 2DQLA 2E34A 4XONA 4I09A 4BL0B 3CD6I 4I01A 2R7FA 4DNCA 1IG7A 1P4WA 2KLOA 3HPHA 1GLNA 3AG1H 3D5RC 2V6CA 1LVKA 2KPMA 3AAFA 4QTRA 3O8HA 3OYEA 2Z2SB 2DT5A 2IGKA 4LIVA 1Y39A 2O61A 2NXNB 1UFMA 5K1YA 1E3HA 3MN2A 2QSHX 3SFZA 4CCMA 3IRRA 1GV5A 3CJTB 1V54H 3P9CA 1I3QJ 4XIDA 4GO1A 2DMQA 4S0HB 1DU0A 1YIOA 1O7FA 1BC7C 2VODA 1MD0A 2R7SA 1V4RA 1YRNB 2R3SA 1BIAA 2E1MC 5KK1A 5IT9K 4BUPA 1MZBA 2K27A 1R9TJ 3S1QJ 2LKSA 3QQAA 3CCMI 2VPLA 1OR7C 4E7SA 4RAYA 1MIJA 2CFXA 3QYEA 1QHGA 3VPRA 4HX7A 2RV8A 4CCJA 3EYIA 4YFNF 2VIXA 1XD7A 3LA3A 1Z21A 3V8LA 4HSRA 4RGXA 3CCVI 3H9JA 1SD6A 2L7ZA 2BXYA 4D9JA 1RR8C 3S1NJ 3LSHA 1WPKA 1X1BA 2OA4A 2ME6A 3SEZA 3RSNA 2XRLA 3HJEA 2XDVA 4MFEA 3TBIA 3CZ6A 1IN8A 2OD5A 1OYIA 2FSWA 3JAMK 4MO7A 2CO5A 3WG9A 4M9ZA 4OIRF 3F22A 4RLFA 4XRMA 1HW1A 1JKPC 5L3BA 4BDZA 5J1YA 4BQNA 2NYXA 4UB8C 3CCJI 3GTKJ 2J5PA 3EUHA 2CV0A 4RS8A 4N9HA 4KYWA 2V4JC 3GTMJ 2XAHA 1TWAJ 1MKMA 5TJJA 1DQUA 4UVBA 2VL8A 3FMQA 4MQ9F 1Y8RB 3ERED 2V6EA 4EJUA 4ZYGA 4RDUA 5BQTA 5CVRA 3QWLA 1A35A 4B3AA 4KICA 4LMYA 2STTA 5DTDA 3MKLA 3E6DA 2DFIA 3DEUA 2JTVA 1MBKA 3AG3H 3M7GA 4M6YA 1IJWC 1HDDC 3VB2A 1T8IA 4D1QA 4DZJA 2QCOA 4CH7A 2JVGA 2LKPA 2EZIA 3CC4I 3RKQA 2WV0A 2XGXA 2XAUA 3FHNA 2VBZA 1IUYA 3V4GA 3CCLI 3EETA 4HRIA 5BOXA 2WWYA 4E7IA 2K7LA 1J59A 1FYMA 1JGGA 2JSPA 2V79A 2CG4A 3FK6A 1YLFA 2HTJA 1BI3A 2M5WA 2GIZA 4OAZA 2LC2A 4OU0A 3TP3A 1K78A 5CVIA 5BMZA 3NARA 3OMYA 2NNNA 4OWRB 4IHVA 2WAEA 3PSFA 4KMFA 2Q2EB 1CF7B 2D1HA 1FT9A 3NQOA 1XN7A 2HU9A 1MGTA 5L3CA 4BXFA 4HG2A 3L2WA 5JVGF 1HXDA 1EH6A 1LNWA 2DCEA 5GTHC 4ZH4F 1UHWA 2E7WA 3BTCA 1JXSA 3R61A 3HSRA 2V7FA 1KQ0A 2CGPA 2W85A 4CCOA 2EBIA 1LUJB 1E0EA 1D5VA 3QPTA 4LB5A 1J9IA 3GCMA 3DWLE 1A31A 1QZYA 1K61A 4E7HA 5IOYA 1DDNA 3HOUJ 2DN0A 2X1CA 1ITYA 3DTKA 5ILSA 1GXPA 1W7PA 5EJCA 4P5OA 1EH7A 2LR8A 1OYWA 3BPXA 3ZQ7A 1VFCA 3LAPA 3K1PA 2XIGA 3H0GJ 1ETWA 3LSMA 2IVMA 3DFGA 3J81Z 2X9DA 1B8IA 4I98B 5J40A 2LD5A 4EMSA 1AWCA 1FLIA 3DBHB 3P9IA 2MSYA 4LFUA 1XCBA 4R1HA 1ZK8A 1U0JA 1OPCA 1HBXG 1UCRA 4HQMA 2HZDA 3CO7C 1BC8C 4BACA 1R1UA 2R5ZA 1R7JA 1BBYA 4GFBA 3I3LA 2MH2A 2VQGA 5E3LA 1VZ0A 4YRVA 2LY9A 1ZKGA 4IJAA 1MMAA 4Y33A 4KT5C 4EGYA 1HOMA 1VQ7I 2V1DA 1HW2A 2DA7A 4HSTA 4DGWB 3MFKA 1ZRFA 1IZ1A 1XC5A 1E17A 4BU2A 4C2MJ 2BHYA 4DYRA 3M3YJ 5DV5A 1ETQA 3W2WA 2BVLA 4HV6A 5TRDA 1S9HA 1ZREA 1Y56A 2F4OB 3DBLB 2HQNA 1S7OA 1TNSA 2LG4A 3JSPA 1MMDA 1GHCA 2HVRA 3F8BA 4N0BA 4IKFA 1G6NA 2M3AA 1BR4A 4A6EA 5K5QA 3Q0UA 2X1EA 2IP2A 4CYCB 1UJ8A 4PSXA 3FBNB 3ZMSA 1U5TB 3PIPF 1G2HA 4XM3A 4I6ZA 2DBBA 4B1RA 3BCAA 3NAUA 4NQWA 4DZPA 1KU3A 2D2WA 4EJOA 3KX2A 4CHUA 1R5ID 3K0LA 2R5ZB 5EGOA 1F5TA 2NAZA 2MLKA 2Z1DA 2ADUA 2H8WA 1WJDA 3O8GA 5LHGA 4CZCA 3MWMA 1XDSA 3H3UA 2ZJPF 2ZBKA 4LJZF 5J47A 1YITI 3ABUA 3ZN0A 4HV5A 1ZG3A 3WTSC 4HA8A 2X1DA 3HGYA 5FLMJ 2Y9ZA 2PG4A 4OOIA 3TO9A 2O8KA 3OSFA 3FXJA 1RPWA 3DKYA 4JX5A 2HXOA 2MFZA 4O5VA 4IQ4A 3F6VA 2OV7A 2KKOA 2V26A 3GWZA 3R0AA 4KIBA 5IYDJ 3GTPJ 3X2QH 1QZZA 3FMRA 5HS7A 3GYHX 1I6HJ 2FEZA 2TCTA 3TMOA 1L3LA 4BE2A 1JKRC 2BVMA 2Y9YA 2VI6A 1MNDA 4JYKA 2HQAA 1NHAA 4DW6A 1ZG1A 1G8XA 3JRGA 2BBYA 3I56I 3DKXA 2XRNA 2XPWA 3BG3A 1R58A 2R7XA 2PQ8A 4XR6A 3G3ZA 3CCEI 2KMUA 4XOTA 5HLIA 1D1BA 1IXCA 3VODA 1YI2I 4A3CJ 1TNTA 2VPRA 1A6IA 1J75A 4LITA 3I0TA 4HNTA 3WTZA 2YU9J 2YU3A 1FTTA 3V42A 1FYKA 2BYVE 3D5LA 1DP3A 4XMYA 1Z9CA 3C7JA 3C3WA 1G59A 3GTOJ 5EEGA 3AG2H 2M1BA 2RNJA 3TQNA 2DYRH 1YJNI 4CA0A 2DA6A 2Y0SN 2QSGX 4LG0B 2FU4A 2H09A 2EILH 2K3FA 5DEQA 5E8IA 3CCYA 4UHTA 2XROA 2DI3A 1QO0D 2DJNA 4B8XA 5M3FJ 3KZIC 1RI7A 5KAFC 1Z3XA 2DT7B 2K9LA 3CO6C 2P4WA 3FX3A 4BJ6C 5LRRA 4IRGA 3J80Z 2ZMEA 2QZ8A 2R7WA 1YW8A 2A5YB 5J3LA 2CV2A 5DCFA 2XPVA 4M3GA 4A0XA 2NS0A 2DA2A 2RVCA 3VFZA 3ZMDA 5IYBJ 5B3SH 1I1GA 5GTIC 1IAWA 3OS1A 1TTYA 5IY5H 2ELJA 2ESHA 3GFIA 3MKWB 4F3QA 1U3EM 1RUOA 2V1NA 4ZZDA 4BY7J 1ZRDA 3RZOJ 1Z91A 1FC3A 4BQQA 4UUVA 5LHHA 4L9VA 5J8FA 1FIPA 2PJPA 1FY7A 1J2XA 2HFHA 3I71A 3LSIA 5CKTA 5FB2A 4XLEA 5B1BH 2ID6A 2MH9A 3CUOA 3J80K 4A2UA 3V8KA 3U2RA 5AIPA 2UV1A 3OR2C 3E5UA 2BEOA 3MZ8A 2V9PA 4Q48A 2KRHA 1YX5A 3K2ZA 4Y7NJ 2A6EF 4EGZA 5FRMA 2BY1A 2OU2A 2K5CA 3MD2A 5FD6A 1NH3A 3CJNA 4B43A 4IPAA 4RB3C 2OQRA 3T1BA 1LVAA 3EPZA 4RGUA 2CUEA 2W24A 2HDWA 3WHBA 1HQCA 3OYAA 1VQMI 2WB1N 2Y75A 4BEHB 2KQRA 3KPHA 3F6OA 2QKMB 1ZTRA 3GF2A 4WXHA 2DMNA 2OQGA 4R8HA 3E3VA 4PCQA 1FPQA 1PUEE 1HC8A 2R7QA 3FXKA 3BJAA 2LNBA 3HSFA 4BNCA 2HOSA 4BQOA 2Z33A 5FKNA 3T8TA 3HG9A 3QU6A 4TV7A 1YYVA 3OL3A 2WY7Q 2DOEA 1I27A 2ZJQF 5E79C 1O7LA 2PI0A 2LY1A 3L1PA 3FISA 2DT6A 2NVXJ 3LWFA 3DLAA 4EV0A 4XNFA 3HTUA 3IRQA 3FXMA 2R4GA 3G71I 4KFCA 3S14J 3NWTA 2GA1A 5ILUA 4YELA 4CSWA 1SFXA 4HBLA 4V19K 2YR2A 4OIPF 1JUSA 1B59A 4EJWA 1N78A 5H20A 1BI1A 2EA4A 3ZMVA 3TW6A 2NVQJ 3G1MA 2BZTA 5EEAA 2CMPA 1F36A 4A3GJ 4BY1J 1X19A 1ZYRF 4CDGA 3BOQA 2DYSH 3WHCA 4ZZLA 4PGGA 1ZLKA 4J01A 4KJZA 3E97A 2JA7J 2O5RA 3ASOH 1WZ2A 2DODA 2PBIA 3TEDA 3S1RJ 2ZKZA 5F04A 3TGNA 1X3WB 1EJ9A 4XBFA 4DYCA 2EWNA 1XSXA 3ABTA 3KEQA 1OLTA 3KEOA 2O6GE 4KNYA 3RYPA 3ZOBA 2HQ5A 3K4LA 5F27A 3ZP5A 1XGOA 2KJBA 3MCZA 3B02A 3HEFA 4AIJA 4IX7A 5JHUA 1TC3C 4H4KC 2X6XA 1W1WE 4PJ0C 1XPXA 5K5RA 4FE4A 1JKOC 3PSIA 4OIOF 4ESFA 1Z05A 2FNPA 3OYIA 4BQAA 4L18B 1MDMA 2LTPA 4AC0A 1YS7A 4RGSA 4B4CA 1WJAA 1XMAA 3QP6A 1JUPA 3LSJA 3W6KB 4PGHA 2XVCA 1D0YA 2HVQA 2PMUA 4HW0A 2KIFA 1HLVA 4J00A 1Z7UA 2ZXWH 1OCZH 4U0WA 2CV1A 2R93J 3SDGA 1D3YA 2MGQA 4XSZF 2OF7A 3BG6A 3VDXA 3MZYA 4RA2A 5LEKA 1H89C 3I53A 1I5ZA 1JKQC 1ONVA 1VQ6I 2F48A 3OWTA 1APLC 4NHJA 5EZHA 2XF7A 4U0VA 4E7JA 1OISA 1SC7A 3K6GA 2R7TA 1JHHA 2F2EA
chains in the Genus database with same CATH topology
4Q5SF 4UV8A 5FD5A 3I58A 4CGZA 2DK8A 3BP8A 3LA7A 1J0RA 2P5VA 4ENNA 4HF1A 4EJVA 3RKYA 4XRFA 1O3RA 4WX9A 3RKWA 1IXRC 3IC7A 2YSRA 5DCMA 2EJRA 3TO7A 4KDPA 5JI6A 4G9YA 2FQ3A 2Q8KA 4A0YA 3KFWX 2PN6A 4BYYA 2QQ9A 2RGVA 2Y48A 3R60A 1S8NA 3ZMUA 3IL2A 3MAJA 4MEXF 4IXAA 2VT2A 2MLGA 2E1NA 3GFJA 3WGGA 2OZ6A 5JR3A 4S05A 1SMYF 2ZXJA 3ZMZA 1KA8A 3BZ6A 4KIFA 2QQAA 2W25A 2XHKA 4K2EA 3J7AO 3D0SA 3KETA 1O57A 2IRFG 1FOKA 1KU9A 3BWGA 1FP2A 2QWWA 4CZZA 2CWEA 4ZYHA 3IHUA 5FGMA 5HOOA 2JRTA 1R00A 1ZG5A 2VC1A 3F21A 2VE9A 5KVRA 1KGSA 1FSHA 4UVCA 1B1BA 3V7SA 5L3EA 4BXUA 3RI4A 2HYFA 1DPUA 1W7PD 2EFOA 1O3TA 5ICFA 4HZFA 2HEOA 2FMYA 2MC3A 5E18F 1G3SA 5E20A 3TO6A 3GO5A 1BIBA 2CYYA 1JGSA 2JZYA 2CSOA 4FT8A 2DLLA 3KP6A 3CLOA 4XSXF 1F1ZA 1KYZA 2VOPA 1USSA 2RKHA 1IN5A 3M9AA 1HKSA 2HYGD 4CXFA 2RC4A 4IHSA 1U6GA 2P5KA 1HSJA 5L3FA 3WU0A 5LHIA 3WGHA 2EFWA 3K9TA 3FF5A 2GA2A 5D5UB 1F5TA 2XASA 4HX8A 3MZHA 4EM1A 2R7DA 3HRMA 3FZVA 5LGNA 2QBYA 3ULQB 3EYYA 4MHGA 3MQ0A 3F8CA 2AXLA 4M74A 3VOEA 3GLXA 3ROUA 4LG0A 1U5TA 2P5LC 1KU2A 2MBFA 5F6FA 4G7HF 2K4JA 2QUFA 5E1XA 1EH8A 3Q9VA 1OMIA 3T5XA 3WTYC 4IF4A 3QU3A 4EM2A 2C6YA 1C0WA 3ZPLA 4WF2A 1GXQA 3ML6A 3CUQA 4JQFA 5JVTA 4L5IA 3QAHA 1LB2A 1O3SA 2V9VA 2Z99A 4A6DA 1B9MA 5FLXZ 1ODDA 3R6SA 2V1UA 2D1VA 2O03A 3N4MA 4KN4X 3L9FA 4HOBA 2ISYA 3JTGA 3HSEA 4KIGA 3LFKA 4WXCA 2FNAA 4ZYEA 4DQ2A 2DPUA 2M8EA 3GW2A 5CVUA 1BJAA 3S2WA 3FHZA 2JPBA 1B6AA 4MGRA 3T0YA 3BPVA 1S29A 4U88A 4L9JA 3CUQC 2L4MA 4LK1F 1FP1D 1TLHB 4M72A 3B73A 4UV9A 4KUMA 5D5WB 3KLNA 6PAXA 3WTWC 3SHFA 1ZRCA 2KJCA 4OINF 3LSTA 2E1CA 4BHPA 1XMKA 4G6QA 3F8FA 3HHGA 1SMTA 1T39A 2EV5A 4D0PA 3JSOA 1ULYA 1YW9A 2E7XA 4ZYDA 1MJBA 2O3FA 1GVJA 2H94A 1YO5C 1PDNC 2IA1A 2IPQX 4EVIA 4UVAA 3JTHA 4G8XA 2HS5A 1D8KA 3R4KA 1MJAA 3FXRA 1WKMA 1TW2A 4L0ZB 2W57A 3TKYA 2ZCWA 5LBQA 1K78B 2D45A 2ZFWA 1J5YA 2P7VB 2VC0A 4LLNA 2XUBA 1SD4A 3I59B 1VTNC 3PFIA 1R1TA 2XKPA 2H6CA 1RIOH 4WXDA 2K86A 4YFXF 3G73A 3ELKA 5CVJA 4P96A 4RB2C 2L01A 5H6QA 3CUQB 4L9NA 5HS9A 2AS5F 4HYEA 5E1WA 5D5XB 4HF0A 2HOEA 4IRHA 4CO8A 3M1EA 1R23A 3GZ6A 3BJOA 5FO5A 3ISPA 4AIHA 2VE8A 4HLYA 1LQ1A 2M45A 5H6RA 3HTSB 3WTXC 2GQQA 1XGMA 2X0LA 5D8LB 3V7RA 2IA0A 2IA2A 4L9TA 3CDHA 1REPC 1XSVA 1F4KA 2JT1A 4RGRA 5LGTA 2Q0OA 1SFUA 3C18A 2OBPA 1HKTA 5LLQA 1FBSA 2XV4S 4MEYF 5DD4A 1IN6A 2OAZA 3BROA 3DXJF 1TBXA 1ON2A 2L02A 2L3DA 1FYLA 2QLZA 2VONA 3K1MA 4HDVA 3TDUC 1AOYA 1S3JA 2TDXA 3RYRA 1IW7F 5ICEA 2XKOA 2EFNA 1HKQA 2ETHA 2DK5A 2H6BA 2FBIA 1IN4A 1F9NA 3BY6A 5E8GA 1X3UA 1H9GA 2JPCA 1OKRA 2A68F 3O6BB 2A3SA 4HF2A 4NB5A 4LK0F 2F5DA 2Z5UA 1XDUA 4WK8F 1Y0UA 1BN5A 3Q5FA 5DYMA 2LDUA 2DPDA 1BM9A 2FE3A 1G3TA 2P8TA 1DUXC 5BPDA 2CQKA 4LLLA 1KQ9A 2Z3YA 5L3DA 2OZUA 4PZJA 3GEZA 3EDPA 1O3QA 1FWZA 4M9SA 3KCCA 3KZZA 3E6MA 1ZH5A 2K02A 4FX0A 2HKXA 4G94A 3BJ6A 3KLOA 4ENMA 3WTUC 1Q1HA 1T98A 5L3GA 5F64A 2UWMA 2YPRA 1U5TC 3FM5A 1Z1DA 1YS6A 5IT3A 2QVOA 2EB7A 2P6SA 1USTA 1OR7A 1XCVA 5ICGA 1ZN2A 3F23A 4BAYA 1FSEA 2M87A 4QLCU 4A0ZA 3GZ5A 2W84A 2ESNA 3SQNA 2PEXA 1LDDA 4WCGA 1ZGAA 3NEUA 4IVNA 1LJ9A 5J6XA 5CLSA 4YFKF 3O2PE 2EK5A 4ESJA 1U2WA 2B0LA 4QWQA 2HGCA 3VEPA 2EV6A 5HLGA 3R0JA 5E17F 4LLGF 5FLXK 2DAOA 4HDUA 1HSTA 2VXZA 1R5HA 5LEJA 1XSDA 2VT3A 1YTYA 3DQVC 3LAJA 4A12A 3H3ZA 3JW4A 1ZAOA 1TQMA 2BE5F 3I4PA 4ENKA 3GVAA 2GIVA 4A5MA 2CW0F 2IT0A 2GWRA 2WTEA 2STWA 4ENJA 2DQRA 5F1RA 4FX4A 1UB9A 3DPTA 2FMLA 2JSCA 2G7UA 3JAMZ 1PP8F 2LF8A 1B9NA 4Q47A 3RPUA 5BPIA 2RN7A 2UXXA 4LGWA 3NRVA 1XGNA 1ZHFA 2HZTA 4R79A 5FFZA 4EJTA 3IWFA 1MJ9A 4YG2F 3N97A 2O0YA 4AVPA 2P7CB 3I5UA 1LDKB 1LEAA 3GXOA 2MA3A 4I0AA 4FHTA 1YQAA 3SZPA 1EV7A 2Z9OA 4B09A 2RDPA 3I54A 2ZJ2A 4YIIA 1BI0A 1IN7A 4AWXB 5D4SA 2Y0MA 1K79A 5A2QK 1T2KA 1T6SA 4RAZA 3WGIA 3KZYA 2F5FA 1U78A 2EA2A 3HHHA 1V3FA 1S7AA 4BH9A 3GFMA 4LB6B 1P2FA 3WE2A 3HUGA 4KA4A 3GUDA 4M6XA 4Y15A 1JE8A 1FZPB 1ZARA 5HDNA 3MEXA 4G6DA 4BHBA 2GAUA 2J5OA 2XAJA 2FXAA 1IF1A 4A5NA 3REOA 4BHCA 5D4RA 2F5CA 4LD5A 3IKTA 1Z6TA 4ON0A 2VBXA 2DW4A 4HLXA 3LQQA 2UZKA 1KYWA 1UHMA 2XAQA 1QQIA 3GX4X 4OMZA 1MDMB 4M71A 3PQKA 1IXSB 2QYOA 3HRUA 3LA2A 2XAFA 3QRFF 1U8RA 5LRSA 4O6JA 5BS6A 5CJ9A 1LEBA 1FX7A 2EFPA 3E5QA 1P4XA 3IWZA 1R36A 3T8RA 3KP2A 2KIMA 5FFXA 3C1DA 2QQBA 2VBYA 2YX7A 4M9XA 4MQVA 4CICA 1H0MA 1YW7A 1W4MA 3QOPA 4H0EA 4GCVA 1KQ8A 1DP7P 4L0YB 1RNLA 3WU1B 1CGPA 2GXGA 5A2QZ 1TW3A 1B4AA 3HIFA 3TDZC 4F7ZA 4HAMA 3DP7A 3M8EA 3RKXA 5ILVA 1WSUA 5JFRA 2ZO4A 1YG2A 2A61A 5DUIA 3EQLF 1QGPA 2K4BA 1XGSA 3OV8A 4I2OA 4L5JA 3OOPA 2IJLA 1HW5A 1H9TA 3SZTA 1XB4A 3L09A 3KP5A 1IRGA 4I02A 4OIQF 3HOSA 3F8NA 3FWEA 1K6OA 3WE3A 3F72A 2ELHA 2PFBA 2KRFA 1WWXA 4U0YA 5D6EA 3ECOA 3RTRA 3ECHA 1QNTA 1SFEA 1PP7U 2EFQA 4MNUA 5HDGA 4PDKA 5E1ZB 3DKWA 2HKOA 3O3KA 1S6LA 4Q4ZF 2IW5A 1L0OC 4KN7X 1W7PB 2X4HA 5D8KB 4YIFA 1QPMA 3E6CC 2ACJA 3SXYA 2FA5A 3FMSA 2DO7A 3F8MA 3DPLC 3HOTA 3RPQA 3CTAA 1I6XA 5ICCA 2LF7A 1A04A 3Q9SA 2KIUA 4GYGA 2F5EA 1R5GA 1QBJA 2QM3A 3IKVA 3V8JA 1SD7A 3K69A 5ERIA 1CF7A 3HYIA 1I1SA 1G3YA 5HS8A 2VOOA 1IRFA 4G7ZF 2Q2EA 5DCMB 1KU7A 4JK1X 2ZNYA 2MD5A 2XAGA 1OYYA 4KMUX 2GXBA 4MTEA 3WTVC 4Z2YA 3P7NA 5AIQA 1BOAA 1FNNA 3KP3A 2VBWA 3RJPA 4ETSA 2NRAC 3P9KA 4OMYA 1FBQA 1SD5A 3QPHA 4XLPF 1FBUA 4I7HA 1JHFA 1LDJA 1SAXA 3I64A 2BV6A 4G7OF 4Y13A 3DV8A 3LQRA 1RUNA 2A07F 1W5TA 2HDCA 2VN2A 4I0BA 1YFHA 5K5OA 1ZGJA 3COAC 4XLNF 3L2CA 5HLHA 3DF8A 2G7HA 2L4AA 2UXNA 3H92A 1WQ2A 1T38A 4GGGA 5EEHA 2ISZA 5CYVA 1P6RA 3TOAA 2O8XA 2FBHA 5HDKA 2A6HF 1BI2A 4WWCA 1G4DA 5IT9Z 5LGUA 2BGCA 2DU9A 4UXNA 2M30A 1DPRA 3L00A 4RB1A 3I59A 3BDDA 3KP7A 4CYDA 3U9GA 4U7DA 1WI9A 3M8FA 1ON1A 2HTSA 2DTRA 3PQJA 4HQEA 4P55A 4IHTA 2PMHA 2GZWA 1ZLJA 1J7KA 3V7CA 2YX4A 2A69F 2COMA 4U7BA 1TQPA 2ZNZA 2FBKA 4EQQA 3E6BA 3F3XA 3FM3A 4M73A 2RQPA 4IRIA 1D8JA 4MTDA 5AONA 4S04A 4Y17A 2PLYA 2FF4A 1P92A 3QP5A 3WODF 3J81K 4ESBA 2HR3A 3KE2A 3TOBA 4GXOA 4ASNA 3L7WA 4P9UA 1R22A 3RDIA 5ED4A 5J8CA 3WTTC 2NNYA 5DDGA 3FXUA 5D6FA 2LSOA 2L54A 4HX4A 1RZ4A 1WRJA 4GYIA 2QENA 1Z6RA 2HQRA 1K7AA 3ZMTA 2FRHA 4AIKA 2EV0A 5CVVA 1R1VA 3FXQA 2ZMEB 3E5XA 3K1NA 3W6JB 5D5VB 4EM0B 3KP4A 1E2XA 5HVQC 1W5SA 3RIRA 2G9WA 2QBYB 1STZA 4RB0A 2H27A 3GFLA 5DUKA 1G3WA 1TQIA 2FOKA 2WC2A 3HRTA 3HRSA 1P4AA 5DD8A 1T0FA 2P6TA 4UNOA 4JBAA 2HWVA 2V1XA 4P9FA 3ZN1A 4AD9A 4N9IA 3U1DA 4O3MA 4E70A 2DQLA 4I09A 4I01A 2R7FA 4DNCA 1P4WA 2V6CA 3AAFA 2DT5A 2O61A 1UFMA 5K1YA 3SFZA 3IRRA 3P9CA 4GO1A 1YIOA 1BC7C 1O7FA 2VODA 1MD0A 1V4RA 2R3SA 1BIAA 5KK1A 5IT9K 1MZBA 2K27A 4RAYA 2CFXA 4HX7A 2RV8A 3EYIA 4YFNF 1XD7A 3LA3A 3V8LA 4RGXA 1SD6A 2OA4A 1IN8A 2OD5A 1OYIA 2FSWA 3JAMK 2CO5A 3WG9A 4M9ZA 4OIRF 3F22A 1HW1A 5L3BA 2NYXA 2J5PA 3EUHA 4RS8A 4N9HA 4KYWA 2XAHA 1MKMA 5TJJA 4UVBA 3FMQA 4MQ9F 3ERED 4EJUA 4ZYGA 5BQTA 5CVRA 4KICA 4LMYA 2STTA 3E6DA 2DFIA 3DEUA 2JTVA 3M7GA 4M6YA 3VB2A 2LKPA 2WV0A 2XGXA 2VBZA 1IUYA 3V4GA 3EETA 5BOXA 2WWYA 2K7LA 1J59A 1FYMA 2V79A 2CG4A 1YLFA 2HTJA 1BI3A 2M5WA 4OU0A 1K78A 5CVIA 5BMZA 2NNNA 4KMFA 1CF7B 2D1HA 1FT9A 3NQOA 1XN7A 5L3CA 1MGTA 1HXDA 1EH6A 1LNWA 4ZH4F 1UHWA 2E7WA 1JXSA 3R61A 3HSRA 1KQ0A 2CGPA 2W85A 1D5VA 3QPTA 4LB5A 1J9IA 1QZYA 1DDNA 5ILSA 1GXPA 1W7PA 4P5OA 1EH7A 1OYWA 3BPXA 3ZQ7A 3LAPA 3K1PA 2XIGA 2IVMA 3DFGA 3J81Z 4I98B 1AWCA 4EMSA 1FLIA 3P9IA 4LFUA 1XCBA 4R1HA 1OPCA 1HBXG 1UCRA 4HQMA 3CO7C 1BC8C 1R1UA 1R7JA 1BBYA 2MH2A 4IJAA 4KT5C 4EGYA 2V1DA 1HW2A 1ZRFA 3MFKA 1IZ1A 1E17A 5DV5A 4HV6A 5TRDA 1ZREA 2HQNA 1S7OA 1TNSA 3JSPA 1GHCA 3F8BA 4N0BA 1G6NA 4A6EA 5K5QA 2IP2A 3ZMSA 1U5TB 2DBBA 4NQWA 1KU3A 2D2WA 4EJOA 4CHUA 3K0LA 2NAZA 2MLKA 2ADUA 5LHGA 3MWMA 1XDSA 3H3UA 2ZBKA 4LJZF 3ABUA 3ZN0A 4HV5A 1ZG3A 3WTSC 4HA8A 2PG4A 4OOIA 3TO9A 4O5VA 3F6VA 2KKOA 3GWZA 3R0AA 4KIBA 1QZZA 3FMRA 5HS7A 3GYHX 2FEZA 1L3LA 1NHAA 1ZG1A 2BBYA 2XRNA 1R58A 2PQ8A 3G3ZA 5HLIA 1IXCA 3VODA 1J75A 1TNTA 3I0TA 3WTZA 2YU3A 1FYKA 2BYVE 3D5LA 1Z9CA 3C7JA 3C3WA 5EEGA 2M1BA 2RNJA 3TQNA 4LG0B 5E8IA 2FU4A 2H09A 2XROA 5DEQA 4UHTA 2DI3A 1QO0D 4B8XA 1RI7A 3CO6C 2P4WA 3FX3A 5LRRA 4IRGA 3J80Z 2ZMEA 2QZ8A 1YW8A 2A5YB 5DCFA 4A0XA 2NS0A 2RVCA 3VFZA 3ZMDA 1I1GA 1IAWA 1TTYA 2ESHA 3GFIA 1U3EM 1RUOA 4ZZDA 1ZRDA 1Z91A 1FC3A 4UUVA 5LHHA 4L9VA 5J8FA 2PJPA 1FY7A 1J2XA 2HFHA 3I71A 5FB2A 3CUOA 2MH9A 3J80K 4A2UA 3V8KA 3U2RA 5AIPA 3E5UA 2BEOA 4Q48A 3K2ZA 2A6EF 4EGZA 2OU2A 5FD6A 3CJNA 4IPAA 4RB3C 2OQRA 3T1BA 1LVAA 4RGUA 2W24A 1HQCA 2Y75A 3F6OA 3GF2A 4WXHA 2OQGA 4R8HA 3E3VA 4PCQA 1FPQA 1PUEE 3BJAA 2LNBA 3HSFA 4BNCA 2Z33A 3T8TA 3QU6A 4TV7A 1YYVA 1I27A 1O7LA 2PI0A 3LWFA 4EV0A 3HTUA 3IRQA 4KFCA 2GA1A 5ILUA 1SFXA 4HBLA 2YR2A 4OIPF 1B59A 4EJWA 5H20A 1BI1A 2EA4A 3ZMVA 1ZYRF 4CDGA 3BOQA 4ZZLA 4PGGA 1ZLKA 3E97A 2PBIA 2ZKZA 3TGNA 4XBFA 2EWNA 1XSXA 3ABTA 3KEQA 3KEOA 2O6GE 4KNYA 3RYPA 3ZP5A 1XGOA 2KJBA 3MCZA 3B02A 4AIJA 5JHUA 5K5RA 4OIOF 4ESFA 1Z05A 2FNPA 4BQAA 4L18B 1MDMA 1YS7A 4RGSA 1XMAA 3QP6A 3W6KB 4PGHA 2XVCA 2PMUA 4HW0A 2KIFA 1Z7UA 4U0WA 1D3YA 4XSZF 3MZYA 5LEKA 3I53A 1I5ZA 1ONVA 4NHJA 4U0VA 1JHHA 2F2EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Q5S F;  4UV8 A;  5FD5 A;  3I58 A;  4CGZ A;  2DK8 A;  3BP8 A;  3LA7 A;  1J0R A;  2P5V A;  4ENN A;  4HF1 A;  4EJV A;  3RKY A;  4XRF A;  1O3R A;  4WX9 A;  3RKW A;  1IXR C;  3IC7 A;  2YSR A;  5DCM A;  2EJR A;  3TO7 A;  4KDP A;  5JI6 A;  4G9Y A;  2FQ3 A;  2Q8K A;  4A0Y A;  3KFW X;  2PN6 A;  4BYY A;  2QQ9 A;  2RGV A;  2Y48 A;  3R60 A;  1S8N A;  3ZMU A;  3IL2 A;  3MAJ A;  4MEX F;  4IXA A;  2VT2 A;  2MLG A;  2E1N A;  3GFJ A;  3WGG A;  2OZ6 A;  5JR3 A;  4S05 A;  1SMY F;  2ZXJ A;  3ZMZ A;  1KA8 A;  3BZ6 A;  4KIF A;  2QQA A;  2W25 A;  2XHK A;  4K2E A;  3J7A O;  3D0S A;  3KET A;  1O57 A;  2IRF G;  1FOK A;  1KU9 A;  3BWG A;  1FP2 A;  2QWW A;  4CZZ A;  2CWE A;  4ZYH A;  3IHU A;  5FGM A;  5HOO A;  2JRT A;  1R00 A;  1ZG5 A;  2VC1 A;  3F21 A;  2VE9 A;  5KVR A;  1KGS A;  1FSH A;  4UVC A;  1B1B A;  3V7S A;  5L3E A;  4BXU A;  3RI4 A;  2HYF A;  1DPU A;  1W7P D;  2EFO A;  1O3T A;  5ICF A;  4HZF A;  2HEO A;  2FMY A;  2MC3 A;  5E18 F;  1G3S A;  5E20 A;  3TO6 A;  3GO5 A;  1BIB A;  2CYY A;  1JGS A;  2JZY A;  2CSO A;  4FT8 A;  2DLL A;  3KP6 A;  3CLO A;  4XSX F;  1F1Z A;  1KYZ A;  2VOP A;  1USS A;  2RKH A;  1IN5 A;  3M9A A;  1HKS A;  2HYG D;  4CXF A;  2RC4 A;  4IHS A;  1U6G A;  2P5K A;  1HSJ A;  5L3F A;  3WU0 A;  5LHI A;  3WGH A;  2EFW A;  3K9T A;  3FF5 A;  2GA2 A;  5D5U B;  1F5T A;  2XAS A;  4HX8 A;  3MZH A;  4EM1 A;  2R7D A;  3HRM A;  3FZV A;  5LGN A;  2QBY A;  3ULQ B;  3EYY A;  4MHG A;  3MQ0 A;  3F8C A;  2AXL A;  4M74 A;  3VOE A;  3GLX A;  3ROU A;  4LG0 A;  1U5T A;  2P5L C;  1KU2 A;  2MBF A;  5F6F A;  4G7H F;  2K4J A;  2QUF A;  5E1X A;  1EH8 A;  3Q9V A;  1OMI A;  3T5X A;  3WTY C;  4IF4 A;  3QU3 A;  4EM2 A;  2C6Y A;  1C0W A;  3ZPL A;  4WF2 A;  1GXQ A;  3ML6 A;  3CUQ A;  4JQF A;  5JVT A;  4L5I A;  3QAH A;  1LB2 A;  1O3S A;  2V9V A;  2Z99 A;  4A6D A;  1B9M A;  5FLX Z;  1ODD A;  3R6S A;  2V1U A;  2D1V A;  2O03 A;  3N4M A;  4KN4 X;  3L9F A;  4HOB A;  2ISY A;  3JTG A;  3HSE A;  4KIG A;  3LFK A;  4WXC A;  2FNA A;  4ZYE A;  4DQ2 A;  2DPU A;  2M8E A;  3GW2 A;  5CVU A;  1BJA A;  3S2W A;  3FHZ A;  2JPB A;  1B6A A;  4MGR A;  3T0Y A;  3BPV A;  1S29 A;  4U88 A;  4L9J A;  3CUQ C;  2L4M A;  4LK1 F;  1FP1 D;  1TLH B;  4M72 A;  3B73 A;  4UV9 A;  4KUM A;  5D5W B;  3KLN A;  6PAX A;  3WTW C;  3SHF A;  1ZRC A;  2KJC A;  4OIN F;  3LST A;  2E1C A;  4BHP A;  1XMK A;  4G6Q A;  3F8F A;  3HHG A;  1SMT A;  1T39 A;  2EV5 A;  4D0P A;  3JSO A;  1ULY A;  1YW9 A;  2E7X A;  4ZYD A;  1MJB A;  2O3F A;  1GVJ A;  2H94 A;  1YO5 C;  1PDN C;  2IA1 A;  2IPQ X;  4EVI A;  4UVA A;  3JTH A;  4G8X A;  2HS5 A;  1D8K A;  3R4K A;  1MJA A;  3FXR A;  1WKM A;  1TW2 A;  4L0Z B;  2W57 A;  3TKY A;  2ZCW A;  5LBQ A;  1K78 B;  2D45 A;  2ZFW A;  1J5Y A;  2P7V B;  2VC0 A;  4LLN A;  2XUB A;  1SD4 A;  3I59 B;  1VTN C;  3PFI A;  1R1T A;  2XKP A;  2H6C A;  1RIO H;  4WXD A;  2K86 A;  4YFX F;  3G73 A;  3ELK A;  5CVJ A;  4P96 A;  4RB2 C;  2L01 A;  5H6Q A;  3CUQ B;  4L9N A;  5HS9 A;  2AS5 F;  4HYE A;  5E1W A;  5D5X B;  4HF0 A;  2HOE A;  4IRH A;  4CO8 A;  3M1E A;  1R23 A;  3GZ6 A;  3BJO A;  5FO5 A;  3ISP A;  4AIH A;  2VE8 A;  4HLY A;  1LQ1 A;  2M45 A;  5H6R A;  3HTS B;  3WTX C;  2GQQ A;  1XGM A;  2X0L A;  5D8L B;  3V7R A;  2IA0 A;  2IA2 A;  4L9T A;  3CDH A;  1REP C;  1XSV A;  1F4K A;  2JT1 A;  4RGR A;  5LGT A;  2Q0O A;  1SFU A;  3C18 A;  2OBP A;  1HKT A;  5LLQ A;  1FBS A;  2XV4 S;  4MEY F;  5DD4 A;  1IN6 A;  2OAZ A;  3BRO A;  3DXJ F;  1TBX A;  1ON2 A;  2L02 A;  2L3D A;  1FYL A;  2QLZ A;  2VON A;  3K1M A;  4HDV A;  3TDU C;  1AOY A;  1S3J A;  2TDX A;  3RYR A;  1IW7 F;  5ICE A;  2XKO A;  2EFN A;  1HKQ A;  2ETH A;  2DK5 A;  2H6B A;  2FBI A;  1IN4 A;  1F9N A;  3BY6 A;  5E8G A;  1X3U A;  1H9G A;  2JPC A;  1OKR A;  2A68 F;  3O6B B;  2A3S A;  4HF2 A;  4NB5 A;  4LK0 F;  2F5D A;  2Z5U A;  1XDU A;  4WK8 F;  1Y0U A;  1BN5 A;  3Q5F A;  5DYM A;  2LDU A;  2DPD A;  1BM9 A;  2FE3 A;  1G3T A;  2P8T A;  1DUX C;  5BPD A;  2CQK A;  4LLL A;  1KQ9 A;  2Z3Y A;  5L3D A;  2OZU A;  4PZJ A;  3GEZ A;  3EDP A;  1O3Q A;  1FWZ A;  4M9S A;  3KCC A;  3KZZ A;  3E6M A;  1ZH5 A;  2K02 A;  4FX0 A;  2HKX A;  4G94 A;  3BJ6 A;  3KLO A;  4ENM A;  3WTU C;  1Q1H A;  1T98 A;  5L3G A;  5F64 A;  2UWM A;  2YPR A;  1U5T C;  3FM5 A;  1Z1D A;  1YS6 A;  5IT3 A;  2QVO A;  2EB7 A;  2P6S A;  1UST A;  1OR7 A;  1XCV A;  5ICG A;  1ZN2 A;  3F23 A;  4BAY A;  1FSE A;  2M87 A;  4QLC U;  4A0Z A;  3GZ5 A;  2W84 A;  2ESN A;  3SQN A;  2PEX A;  1LDD A;  4WCG A;  1ZGA A;  3NEU A;  4IVN A;  1LJ9 A;  5J6X A;  5CLS A;  4YFK F;  3O2P E;  2EK5 A;  4ESJ A;  1U2W A;  2B0L A;  4QWQ A;  2HGC A;  3VEP A;  2EV6 A;  5HLG A;  3R0J A;  5E17 F;  4LLG F;  5FLX K;  2DAO A;  4HDU A;  1HST A;  2VXZ A;  1R5H A;  5LEJ A;  1XSD A;  2VT3 A;  1YTY A;  3DQV C;  3LAJ A;  4A12 A;  3H3Z A;  3JW4 A;  1ZAO A;  1TQM A;  2BE5 F;  3I4P A;  4ENK A;  3GVA A;  2GIV A;  4A5M A;  2CW0 F;  2IT0 A;  2GWR A;  2WTE A;  2STW A;  4ENJ A;  2DQR A;  5F1R A;  4FX4 A;  1UB9 A;  3DPT A;  2FML A;  2JSC A;  2G7U A;  3JAM Z;  1PP8 F;  2LF8 A;  1B9N A;  4Q47 A;  3RPU A;  5BPI A;  2RN7 A;  2UXX A;  4LGW A;  3NRV A;  1XGN A;  1ZHF A;  2HZT A;  4R79 A;  5FFZ A;  4EJT A;  3IWF A;  1MJ9 A;  4YG2 F;  3N97 A;  2O0Y A;  4AVP A;  2P7C B;  3I5U A;  1LDK B;  1LEA A;  3GXO A;  2MA3 A;  4I0A A;  4FHT A;  1YQA A;  3SZP A;  1EV7 A;  2Z9O A;  4B09 A;  2RDP A;  3I54 A;  2ZJ2 A;  4YII A;  1BI0 A;  1IN7 A;  4AWX B;  5D4S A;  2Y0M A;  1K79 A;  5A2Q K;  1T2K A;  1T6S A;  4RAZ A;  3WGI A;  3KZY A;  2F5F A;  1U78 A;  2EA2 A;  3HHH A;  1V3F A;  1S7A A;  4BH9 A;  3GFM A;  4LB6 B;  1P2F A;  3WE2 A;  3HUG A;  4KA4 A;  3GUD A;  4M6X A;  4Y15 A;  1JE8 A;  1FZP B;  1ZAR A;  5HDN A;  3MEX A;  4G6D A;  4BHB A;  2GAU A;  2J5O A;  2XAJ A;  2FXA A;  1IF1 A;  4A5N A;  3REO A;  4BHC A;  5D4R A;  2F5C A;  4LD5 A;  3IKT A;  1Z6T A;  4ON0 A;  2VBX A;  2DW4 A;  4HLX A;  3LQQ A;  2UZK A;  1KYW A;  1UHM A;  2XAQ A;  1QQI A;  3GX4 X;  4OMZ A;  1MDM B;  4M71 A;  3PQK A;  1IXS B;  2QYO A;  3HRU A;  3LA2 A;  2XAF A;  3QRF F;  1U8R A;  5LRS A;  4O6J A;  5BS6 A;  5CJ9 A;  1LEB A;  1FX7 A;  2EFP A;  3E5Q A;  1P4X A;  3IWZ A;  1R36 A;  3T8R A;  3KP2 A;  2KIM A;  5FFX A;  3C1D A;  2QQB A;  2VBY A;  2YX7 A;  4M9X A;  4MQV A;  4CIC A;  1H0M A;  1YW7 A;  1W4M A;  3QOP A;  4H0E A;  4GCV A;  1KQ8 A;  1DP7 P;  4L0Y B;  1RNL A;  3WU1 B;  1CGP A;  2GXG A;  5A2Q Z;  1TW3 A;  1B4A A;  3HIF A;  3TDZ C;  4F7Z A;  4HAM A;  3DP7 A;  3M8E A;  3RKX A;  5ILV A;  1WSU A;  5JFR A;  2ZO4 A;  1YG2 A;  2A61 A;  5DUI A;  3EQL F;  1QGP A;  2K4B A;  1XGS A;  3OV8 A;  4I2O A;  4L5J A;  3OOP A;  2IJL A;  1HW5 A;  1H9T A;  3SZT A;  1XB4 A;  3L09 A;  3KP5 A;  1IRG A;  4I02 A;  4OIQ F;  3HOS A;  3F8N A;  3FWE A;  1K6O A;  3WE3 A;  3F72 A;  2ELH A;  2PFB A;  2KRF A;  1WWX A;  4U0Y A;  5D6E A;  3ECO A;  3RTR A;  3ECH A;  1QNT A;  1SFE A;  1PP7 U;  2EFQ A;  4MNU A;  5HDG A;  4PDK A;  5E1Z B;  3DKW A;  2HKO A;  3O3K A;  1S6L A;  4Q4Z F;  2IW5 A;  1L0O C;  4KN7 X;  1W7P B;  2X4H A;  5D8K B;  4YIF A;  1QPM A;  3E6C C;  2ACJ A;  3SXY A;  2FA5 A;  3FMS A;  2DO7 A;  3F8M A;  3DPL C;  3HOT A;  3RPQ A;  3CTA A;  1I6X A;  5ICC A;  2LF7 A;  1A04 A;  3Q9S A;  2KIU A;  4GYG A;  2F5E A;  1R5G A;  1QBJ A;  2QM3 A;  3IKV A;  3V8J A;  1SD7 A;  3K69 A;  5ERI A;  1CF7 A;  3HYI A;  1I1S A;  1G3Y A;  5HS8 A;  2VOO A;  1IRF A;  4G7Z F;  2Q2E A;  5DCM B;  1KU7 A;  4JK1 X;  2ZNY A;  2MD5 A;  2XAG A;  1OYY A;  4KMU X;  2GXB A;  4MTE A;  3WTV C;  4Z2Y A;  3P7N A;  5AIQ A;  1BOA A;  1FNN A;  3KP3 A;  2VBW A;  3RJP A;  4ETS A;  2NRA C;  3P9K A;  4OMY A;  1FBQ A;  1SD5 A;  3QPH A;  4XLP F;  1FBU A;  4I7H A;  1JHF A;  1LDJ A;  1SAX A;  3I64 A;  2BV6 A;  4G7O F;  4Y13 A;  3DV8 A;  3LQR A;  1RUN A;  2A07 F;  1W5T A;  2HDC A;  2VN2 A;  4I0B A;  1YFH A;  5K5O A;  1ZGJ A;  3COA C;  4XLN F;  3L2C A;  5HLH A;  3DF8 A;  2G7H A;  2L4A A;  2UXN A;  3H92 A;  1WQ2 A;  1T38 A;  4GGG A;  5EEH A;  2ISZ A;  5CYV A;  1P6R A;  3TOA A;  2O8X A;  2FBH A;  5HDK A;  2A6H F;  1BI2 A;  4WWC A;  1G4D A;  5IT9 Z;  5LGU A;  2BGC A;  2DU9 A;  4UXN A;  2M30 A;  1DPR A;  3L00 A;  4RB1 A;  3I59 A;  3BDD A;  3KP7 A;  4CYD A;  3U9G A;  4U7D A;  1WI9 A;  3M8F A;  1ON1 A;  2HTS A;  2DTR A;  3PQJ A;  4HQE A;  4P55 A;  4IHT A;  2PMH A;  2GZW A;  1ZLJ A;  1J7K A;  3V7C A;  2YX4 A;  2A69 F;  2COM A;  4U7B A;  1TQP A;  2ZNZ A;  2FBK A;  4EQQ A;  3E6B A;  3F3X A;  3FM3 A;  4M73 A;  2RQP A;  4IRI A;  1D8J A;  4MTD A;  5AON A;  4S04 A;  4Y17 A;  2PLY A;  2FF4 A;  1P92 A;  3QP5 A;  3WOD F;  3J81 K;  4ESB A;  2HR3 A;  3KE2 A;  3TOB A;  4GXO A;  4ASN A;  3L7W A;  4P9U A;  1R22 A;  3RDI A;  5ED4 A;  5J8C A;  3WTT C;  2NNY A;  5DDG A;  3FXU A;  5D6F A;  2LSO A;  2L54 A;  4HX4 A;  1RZ4 A;  1WRJ A;  4GYI A;  2QEN A;  1Z6R A;  2HQR A;  1K7A A;  3ZMT A;  2FRH A;  4AIK A;  2EV0 A;  5CVV A;  1R1V A;  3FXQ A;  2ZME B;  3E5X A;  3K1N A;  3W6J B;  5D5V B;  4EM0 B;  3KP4 A;  1E2X A;  5HVQ C;  1W5S A;  3RIR A;  2G9W A;  2QBY B;  1STZ A;  4RB0 A;  2H27 A;  3GFL A;  5DUK A;  1G3W A;  1TQI A;  2FOK A;  2WC2 A;  3HRT A;  3HRS A;  1P4A A;  5DD8 A;  1T0F A;  2P6T A;  4UNO A;  4JBA A;  2HWV A;  2V1X A;  4P9F A;  3ZN1 A;  4AD9 A;  4N9I A;  3U1D A;  4O3M A;  4E70 A;  2DQL A;  4I09 A;  4I01 A;  2R7F A;  4DNC A;  1P4W A;  2V6C A;  3AAF A;  2DT5 A;  2O61 A;  1UFM A;  5K1Y A;  3SFZ A;  3IRR A;  3P9C A;  4GO1 A;  1YIO A;  1BC7 C;  1O7F A;  2VOD A;  1MD0 A;  1V4R A;  2R3S A;  1BIA A;  5KK1 A;  5IT9 K;  1MZB A;  2K27 A;  4RAY A;  2CFX A;  4HX7 A;  2RV8 A;  3EYI A;  4YFN F;  1XD7 A;  3LA3 A;  3V8L A;  4RGX A;  1SD6 A;  2OA4 A;  1IN8 A;  2OD5 A;  1OYI A;  2FSW A;  3JAM K;  2CO5 A;  3WG9 A;  4M9Z A;  4OIR F;  3F22 A;  1HW1 A;  5L3B A;  2NYX A;  2J5P A;  3EUH A;  4RS8 A;  4N9H A;  4KYW A;  2XAH A;  1MKM A;  5TJJ A;  4UVB A;  3FMQ A;  4MQ9 F;  3ERE D;  4EJU A;  4ZYG A;  5BQT A;  5CVR A;  4KIC A;  4LMY A;  2STT A;  3E6D A;  2DFI A;  3DEU A;  2JTV A;  3M7G A;  4M6Y A;  3VB2 A;  2LKP A;  2WV0 A;  2XGX A;  2VBZ A;  1IUY A;  3V4G A;  3EET A;  5BOX A;  2WWY A;  2K7L A;  1J59 A;  1FYM A;  2V79 A;  2CG4 A;  1YLF A;  2HTJ A;  1BI3 A;  2M5W A;  4OU0 A;  1K78 A;  5CVI A;  5BMZ A;  2NNN A;  4KMF A;  1CF7 B;  2D1H A;  1FT9 A;  3NQO A;  1XN7 A;  5L3C A;  1MGT A;  1HXD A;  1EH6 A;  1LNW A;  4ZH4 F;  1UHW A;  2E7W A;  1JXS A;  3R61 A;  3HSR A;  1KQ0 A;  2CGP A;  2W85 A;  1D5V A;  3QPT A;  4LB5 A;  1J9I A;  1QZY A;  1DDN A;  5ILS A;  1GXP A;  1W7P A;  4P5O A;  1EH7 A;  1OYW A;  3BPX A;  3ZQ7 A;  3LAP A;  3K1P A;  2XIG A;  2IVM A;  3DFG A;  3J81 Z;  4I98 B;  1AWC A;  4EMS A;  1FLI A;  3P9I A;  4LFU A;  1XCB A;  4R1H A;  1OPC A;  1HBX G;  1UCR A;  4HQM A;  3CO7 C;  1BC8 C;  1R1U A;  1R7J A;  1BBY A;  2MH2 A;  4IJA A;  4KT5 C;  4EGY A;  2V1D A;  1HW2 A;  1ZRF A;  3MFK A;  1IZ1 A;  1E17 A;  5DV5 A;  4HV6 A;  5TRD A;  1ZRE A;  2HQN A;  1S7O A;  1TNS A;  3JSP A;  1GHC A;  3F8B A;  4N0B A;  1G6N A;  4A6E A;  5K5Q A;  2IP2 A;  3ZMS A;  1U5T B;  2DBB A;  4NQW A;  1KU3 A;  2D2W A;  4EJO A;  4CHU A;  3K0L A;  2NAZ A;  2MLK A;  2ADU A;  5LHG A;  3MWM A;  1XDS A;  3H3U A;  2ZBK A;  4LJZ F;  3ABU A;  3ZN0 A;  4HV5 A;  1ZG3 A;  3WTS C;  4HA8 A;  2PG4 A;  4OOI A;  3TO9 A;  4O5V A;  3F6V A;  2KKO A;  3GWZ A;  3R0A A;  4KIB A;  1QZZ A;  3FMR A;  5HS7 A;  3GYH X;  2FEZ A;  1L3L A;  1NHA A;  1ZG1 A;  2BBY A;  2XRN A;  1R58 A;  2PQ8 A;  3G3Z A;  5HLI A;  1IXC A;  3VOD A;  1J75 A;  1TNT A;  3I0T A;  3WTZ A;  2YU3 A;  1FYK A;  2BYV E;  3D5L A;  1Z9C A;  3C7J A;  3C3W A;  5EEG A;  2M1B A;  2RNJ A;  3TQN A;  4LG0 B;  5E8I A;  2FU4 A;  2H09 A;  2XRO A;  5DEQ A;  4UHT A;  2DI3 A;  1QO0 D;  4B8X A;  1RI7 A;  3CO6 C;  2P4W A;  3FX3 A;  5LRR A;  4IRG A;  3J80 Z;  2ZME A;  2QZ8 A;  1YW8 A;  2A5Y B;  5DCF A;  4A0X A;  2NS0 A;  2RVC A;  3VFZ A;  3ZMD A;  1I1G A;  1IAW A;  1TTY A;  2ESH A;  3GFI A;  1U3E M;  1RUO A;  4ZZD A;  1ZRD A;  1Z91 A;  1FC3 A;  4UUV A;  5LHH A;  4L9V A;  5J8F A;  2PJP A;  1FY7 A;  1J2X A;  2HFH A;  3I71 A;  5FB2 A;  3CUO A;  2MH9 A;  3J80 K;  4A2U A;  3V8K A;  3U2R A;  5AIP A;  3E5U A;  2BEO A;  4Q48 A;  3K2Z A;  2A6E F;  4EGZ A;  2OU2 A;  5FD6 A;  3CJN A;  4IPA A;  4RB3 C;  2OQR A;  3T1B A;  1LVA A;  4RGU A;  2W24 A;  1HQC A;  2Y75 A;  3F6O A;  3GF2 A;  4WXH A;  2OQG A;  4R8H A;  3E3V A;  4PCQ A;  1FPQ A;  1PUE E;  3BJA A;  2LNB A;  3HSF A;  4BNC A;  2Z33 A;  3T8T A;  3QU6 A;  4TV7 A;  1YYV A;  1I27 A;  1O7L A;  2PI0 A;  3LWF A;  4EV0 A;  3HTU A;  3IRQ A;  4KFC A;  2GA1 A;  5ILU A;  1SFX A;  4HBL A;  2YR2 A;  4OIP F;  1B59 A;  4EJW A;  5H20 A;  1BI1 A;  2EA4 A;  3ZMV A;  1ZYR F;  4CDG A;  3BOQ A;  4ZZL A;  4PGG A;  1ZLK A;  3E97 A;  2PBI A;  2ZKZ A;  3TGN A;  4XBF A;  2EWN A;  1XSX A;  3ABT A;  3KEQ A;  3KEO A;  2O6G E;  4KNY A;  3RYP A;  3ZP5 A;  1XGO A;  2KJB A;  3MCZ A;  3B02 A;  4AIJ A;  5JHU A;  5K5R A;  4OIO F;  4ESF A;  1Z05 A;  2FNP A;  4BQA A;  4L18 B;  1MDM A;  1YS7 A;  4RGS A;  1XMA A;  3QP6 A;  3W6K B;  4PGH A;  2XVC A;  2PMU A;  4HW0 A;  2KIF A;  1Z7U A;  4U0W A;  1D3Y A;  4XSZ F;  3MZY A;  5LEK A;  3I53 A;  1I5Z A;  1ONV A;  4NHJ A;  4U0V A;  1JHH A;  2F2E A; 
#chains in the Genus database with same CATH topology
 4Q5S F;  3S3O A;  2M7A A;  4UV8 A;  2W00 A;  1H88 C;  2CUF A;  4NC7 A;  5FD5 A;  3OYF A;  3I58 A;  2CJJ A;  3CCR I;  4CGZ A;  2DK8 A;  3BP8 A;  3LA7 A;  2IEK A;  2JK3 A;  1J0R A;  2P5V A;  2EZH A;  4W1U A;  4ENN A;  2XPU A;  4HF1 A;  4EJV A;  2NS7 A;  3LFU A;  3RKY A;  5FJ8 J;  1RR7 A;  4XRF A;  5FKO A;  1XG1 A;  3E1S A;  1O3R A;  3EUH C;  3RCO A;  4WX9 A;  3I55 I;  3RKW A;  3M4O J;  1D0X A;  5EZG A;  3H35 A;  2R5Y A;  1IXR C;  1V5G A;  3JRI A;  3FKJ A;  3IC7 A;  1YOV B;  2YSR A;  4D7M A;  5TIS C;  4XOP A;  2W1O A;  5DCM A;  4B47 A;  2EJR A;  3TO7 A;  3JRB A;  4KDP A;  3K4K A;  5JI6 A;  4G9Y A;  5F0H A;  2FQ3 A;  2Q8K A;  3K4B A;  1BR1 A;  3BTJ A;  4A0Y A;  1ZEL A;  3KFW X;  1R71 A;  2PN6 A;  4BYY A;  2QQ9 A;  2RGV A;  2Y48 A;  3R60 A;  3RQI A;  1S8N A;  3RQ4 A;  3ZMU A;  3IL2 A;  2L5Q A;  2VJI A;  3MAJ A;  4ZTF A;  4MEX F;  1SVM A;  4IXA A;  2VT2 A;  1PUF B;  2MLG A;  5J4Y A;  2E1N A;  4E7K A;  3OY9 A;  3KEY A;  3GFJ A;  3WGG A;  2OZ6 A;  5JR3 A;  4S05 A;  1SMY F;  2ZXJ A;  3ZMZ A;  1KA8 A;  3BZ6 A;  4IL6 C;  2A5W A;  4KIF A;  2DDA A;  3BQY A;  2QQA A;  3AKZ A;  2EPF A;  2W25 A;  2XHK A;  4K2E A;  4B48 A;  3J7A O;  3D0S A;  2Y2Z A;  3KET A;  1O57 A;  2IRF G;  1J09 A;  3BR0 A;  1QRY A;  3A4C A;  2IS6 A;  2AQE A;  1EKE A;  2OTL I;  3DTI A;  1FOK A;  1KU9 A;  1K4S A;  4MIM A;  2WV1 A;  3BTL A;  3BWG A;  4KIS A;  4PJN A;  3PJR A;  3VSK A;  1FP2 A;  4IHX A;  2QWW A;  4CZZ A;  2CWE A;  4ZYH A;  3IHU A;  1D0Z A;  2WAD A;  5FGM A;  3VYR B;  5HOO A;  2B7E A;  3U21 A;  2IS4 A;  4JP0 A;  5JHF A;  1WCM J;  2I8D A;  2JRT A;  5BNG A;  4A69 C;  1X3Z B;  1W0T A;  1R00 A;  2M0C A;  3HPG A;  4KT6 A;  2BY2 A;  1ZG5 A;  4BGD A;  4IHY A;  2VC1 A;  3F21 A;  3GBG A;  1E3O C;  2VE9 A;  5KVR A;  1KGS A;  3F0C A;  4PJL A;  4OAY A;  3D5S C;  1FSH A;  4UVC A;  5JLW A;  2EZL A;  1B1B A;  2MC4 A;  2CQX A;  4GDF A;  3V7S A;  4A3F J;  5L3E A;  1BOB A;  4BXU A;  2K40 A;  3RI4 A;  2HYF A;  1DPU A;  3KYC B;  1W7P D;  2EFO A;  4HNV A;  2XC7 A;  1O3T A;  2VAS A;  1IO2 A;  1QU3 A;  3DPU A;  4JOM A;  5ICF A;  4HZF A;  2HEO A;  3HL2 A;  2FMY A;  2MC3 A;  3PM1 A;  5E18 F;  3H9G A;  1RRJ A;  3H3V K;  1G3S A;  3E0J B;  4U87 A;  5E20 A;  3TO6 A;  3GO5 A;  3H9Q A;  4BE1 A;  4XL9 A;  1BIB A;  2CYY A;  1WJB A;  5LD2 C;  1JGS A;  1JT6 A;  2FQ4 A;  2CSO A;  2JZY A;  4XKC A;  3GLL A;  4FT8 A;  2DLL A;  3KP6 A;  2HI3 A;  3CLO A;  4XSX F;  1F1Z A;  1KYZ A;  1S72 I;  2LVS A;  2VOP A;  1USS A;  2L9N A;  3MKZ A;  5M5X J;  1IV8 A;  2RKH A;  1IN5 A;  3M9A A;  2KDZ A;  1HKS A;  5IP9 J;  2HYG D;  2NOG A;  4CXF A;  2RC4 A;  4IHS A;  1FEX A;  1U6G A;  2P5K A;  5B66 C;  1HSJ A;  5L3F A;  3OOU A;  3WU0 A;  3WGH A;  5LHI A;  2LOO A;  3HOZ J;  2EFW A;  1UG0 A;  3IP4 B;  1P9Q C;  3K9T A;  3A0H C;  3FF5 A;  3S1M J;  2KIS A;  2GA2 A;  4NDL A;  3H1C A;  2XAS A;  5D5U B;  4HX8 A;  3BG7 A;  3MZH A;  1K4T A;  3QOE A;  4EM1 A;  2R7D A;  3M8J A;  3HRM A;  5KNL A;  3FZV A;  5LGN A;  2JVH A;  2QBY A;  3ULQ B;  3Q0V A;  3EYY A;  1JT0 A;  3MVP A;  2HNH A;  4MHG A;  3MQ0 A;  1JI8 A;  5E3M A;  3SEQ A;  3CJR B;  3F8C A;  4I76 A;  2FJ1 A;  3DCF A;  5HOD A;  2WY8 Q;  2VJ5 A;  2AXL A;  4C3I J;  4M74 A;  3VOE A;  1Z77 A;  3GLX A;  2JA2 A;  3ROU A;  2E60 A;  4LG0 A;  1U5T A;  4N4O B;  4II2 A;  2P5L C;  1KU2 A;  2MBF A;  5F6F A;  4G7H F;  2ME0 A;  2K4J A;  2QUF A;  5E1X A;  1VQO I;  1EH8 A;  4RLQ A;  3Q9V A;  2ZB9 A;  1OMI A;  3T5X A;  3WTY C;  3BR3 A;  4IF4 A;  2DMP A;  3QU3 A;  4EM2 A;  2C6Y A;  2COB A;  1C0W A;  2M8G X;  1U8B A;  1NTC A;  2QSF X;  2NVU B;  5E3N A;  2R7R A;  2BW3 B;  3ZPL A;  3ZR8 X;  4WF2 A;  2JA8 J;  1FOX A;  1GXQ A;  3ML6 A;  5EGO B;  3CUQ A;  3JRD A;  4JQF A;  5JVT A;  2GM4 A;  3HDD A;  3BQZ A;  3DBR B;  4AVZ A;  4L5I A;  3QAH A;  1LB2 A;  1YHQ I;  2V9V A;  1O3S A;  3MKY B;  2Z99 A;  2FOW A;  2B63 J;  4A6D A;  1B9M A;  1UEL B;  3ZGK A;  3OSG A;  5FLX Z;  1ODD A;  3R6S A;  2V1U A;  4ABZ A;  3HM5 A;  2LRD A;  2KHM A;  2D1V A;  4PSW A;  2O03 A;  3N4M A;  4KN4 X;  3L9F A;  2M4K A;  4HOB A;  2ISY A;  3JTG A;  3HSE A;  4KIG A;  5K7H A;  4XK4 A;  3LFK A;  4WXC A;  2FNA A;  4ZYE A;  4DQ2 A;  1U9O A;  2DPU A;  1JTY A;  3K4M A;  2M8E A;  2TRT A;  3GW2 A;  5CVU A;  1BJA A;  3S2W A;  2K85 A;  3FHZ A;  2JPB A;  1B6A A;  1WH7 A;  3VWB A;  3CP8 A;  4MGR A;  1WVR A;  3PO3 J;  1YJW I;  4EAT A;  3T0Y A;  1UG2 A;  3BPV A;  1S29 A;  4X6A J;  1Z3Y A;  4U88 A;  4L9J A;  2MG4 A;  3L2R A;  3K7A J;  3CUQ C;  1I3A A;  2L4M A;  4LK1 F;  1TZL A;  5HNF A;  1FP1 D;  3WU2 C;  1TLH B;  4II3 A;  2LLK A;  4M72 A;  1SEU A;  3B73 A;  3FIW A;  3BR1 A;  3PL8 A;  4KUM A;  4MFD A;  4UV9 A;  5D5W B;  4A3J J;  3KLN A;  6PAX A;  1ETO A;  4I99 C;  3WTW C;  3SHF A;  1ZRC A;  2KJC A;  1FMW A;  4OIN F;  2MAB A;  5IP7 J;  2R7O A;  3LST A;  2QKL B;  3CDI A;  2E1C A;  4BHP A;  3HKZ N;  4F52 A;  1DGW Y;  1XMK A;  2EZK A;  4G6Q A;  5FRN A;  2ZXI A;  3F8F A;  3A02 A;  1SMT A;  3HHG A;  3K10 A;  2EV5 A;  4D0P A;  3JSO A;  1T39 A;  2QQ8 A;  1Y0N A;  2DFE A;  2OJE D;  1ULY A;  1YW9 A;  2EIJ H;  1IGN A;  5B1A H;  2E7X A;  4PJJ A;  5M3M J;  4ZYD A;  1LFU P;  2HXI A;  1I50 J;  3I9V 2;  4JX4 A;  5E3O A;  1W0U A;  2IBD A;  2VJJ A;  1XS9 A;  1MJB A;  3IV5 A;  2O3F A;  1GVJ A;  2H94 A;  2OCC H;  3HOY J;  4IOC F;  1YO5 C;  4J19 A;  1PDN C;  1GT0 C;  2IA1 A;  2IPQ X;  2JUG A;  4EVI A;  4UVA A;  4XRS A;  3JTH A;  4G8X A;  2HS5 A;  1D8K A;  2JUC A;  1MJA A;  3FXR A;  3R4K A;  1WKM A;  4AID A;  1TW2 A;  4L0Z B;  1WJ5 A;  2W57 A;  3TKY A;  1HCR A;  3KIO A;  2ZCW A;  1P7J A;  1RET A;  2Y31 A;  5LBQ A;  1Q1V A;  1K78 B;  1FOY A;  2D45 A;  2ZFW A;  3NWS A;  1ERD A;  3W6V A;  1J5Y A;  2P7V B;  3PUF A;  3GTQ J;  1MSE C;  1MH4 A;  3HC7 A;  2VC0 A;  3HUG B;  9ANT A;  4LLN A;  4GRI A;  2E19 A;  4IEJ A;  5EG0 B;  1QZE A;  1SD4 A;  2XUB A;  1K6Y A;  1MSF C;  2R92 J;  3I59 B;  3TP0 A;  1VTN C;  2NVT J;  4BXX J;  1IDZ A;  3PFI A;  1BW6 A;  1R1T A;  2XKP A;  2H6C A;  4ZJZ A;  5J4V A;  4WXD A;  1RIO H;  4XN3 A;  2L7F P;  2RQQ A;  2K86 A;  4YFX F;  2GXA A;  5CVJ A;  3ELK A;  4RB2 C;  4P96 A;  3G73 A;  2L01 A;  4BEH A;  5H6Q A;  3CUQ B;  4L9N A;  2E1M B;  5HS9 A;  1YX3 A;  1A36 A;  2AS5 F;  4HYE A;  1V55 H;  2E1O A;  2L7M P;  2JWT A;  5E1W A;  1FIA A;  5D5X B;  3OYB A;  4HF0 A;  2ZXH A;  3W2A A;  3OR1 C;  2AHQ A;  2HOE A;  4IRH A;  4CO8 A;  3FKI J;  2CQN A;  3M1E A;  1R23 A;  3GZ6 A;  3BJO A;  1ZR4 A;  5FO5 A;  4EEF G;  3ISP A;  1T0F C;  1D1A A;  2EIM H;  2IXS A;  3SJM A;  4AIH A;  2E36 A;  2VE8 A;  4BE0 A;  1DGR M;  4HLY A;  2LKX A;  1LKX A;  1LQ1 A;  3ABM H;  3S15 J;  5HNH A;  2M45 A;  5H6R A;  3HTS B;  1MW7 A;  3WTX C;  1F43 A;  2GQQ A;  1XGM A;  2CUZ A;  2X0L A;  5D8L B;  3V7R A;  2IA0 A;  1GVD A;  3VYT B;  3BC8 A;  2IA2 A;  5K7Z A;  3CCU I;  4L9T A;  1X4O A;  2MD0 A;  3CDH A;  1W36 D;  2DA1 A;  1B72 A;  2BY0 A;  1REP C;  1XSV A;  2WB1 A;  1RC9 A;  1F4K A;  1LFB A;  2FX0 A;  1VND A;  2JT1 A;  3BG5 A;  4RGR A;  2X6O A;  2VXD A;  5LGT A;  3D1N I;  2Q0O A;  1OFC X;  3A0B C;  4PFO A;  4AYB N;  3A03 A;  5DM7 F;  3OYD A;  1FOW A;  4A3I J;  2E71 A;  2V9K A;  1SFU A;  2DTZ A;  3C18 A;  2OBP A;  1HKT A;  5LLQ A;  1FBS A;  3CF2 A;  1HF0 A;  2XV4 S;  3G1L A;  4CCL A;  4MEY F;  5DD4 A;  1IN6 A;  2OAZ A;  3BRO A;  4G12 A;  4V2G A;  2HDD A;  3DXJ F;  3S32 A;  1TBX A;  3OYC A;  1ON2 A;  2L02 A;  4CYC A;  2L3D A;  1FYL A;  1MMG A;  2QLZ A;  2X6Y A;  2VON A;  3K1M A;  4HDV A;  2OCE A;  2OUM A;  3ERM A;  3TDU C;  5HLT A;  1PUF A;  3KYL A;  2GLO A;  4A3B J;  3OS0 A;  1AOY A;  3PO2 J;  1S3J A;  5F1J A;  2JQ7 A;  2TDX A;  3RYR A;  3F9K A;  5C3E J;  4A3L J;  1IW7 F;  1TWG J;  5ICE A;  2XKO A;  3L2Q A;  2EFN A;  1HKQ A;  4NNJ A;  3AFH A;  4W97 A;  2ETH A;  2DK5 A;  2H6B A;  1E3P A;  2FBI A;  1FTZ A;  2PMZ A;  3HOX J;  3JRF A;  1IN4 A;  1F9N A;  3BY6 A;  5E8G A;  5KAI C;  4PK4 A;  1X3U A;  1H9G A;  1TWC J;  3CES A;  5GP9 A;  4BKX A;  3CCS I;  4N4N B;  2JPC A;  1OKR A;  1X2N A;  2A68 F;  2H1L A;  3O6B B;  2A3S A;  5J1U A;  3GTL J;  3VYS B;  4NB5 A;  4HF2 A;  4IOA F;  4LK0 F;  5J1R A;  3DLL F;  4FCY A;  1X1A A;  2F5D A;  2Z5U A;  3ZXS A;  4M3F A;  1XDU A;  4AYB A;  3L2U A;  5IYC J;  4WK8 F;  2KP6 A;  3M1C A;  4X1E A;  1Y0U A;  1BN5 A;  3Q5F A;  3S3M A;  5DYM A;  1MMS A;  5EF6 A;  1SFO J;  1Y6I A;  2LDU A;  3IH3 A;  2P81 A;  1BM9 A;  2DPD A;  1KZH A;  2FE3 A;  1G3T A;  4A3K J;  1SVL A;  2P8T A;  4HNU A;  5BPD A;  1DUX C;  2BXZ A;  2CQK A;  3WG7 H;  4FET A;  4LLL A;  1KQ9 A;  1PYV A;  2ELK A;  2Z3Y A;  5L3D A;  1T56 A;  4C9Y A;  4DBQ A;  3OYM A;  3A1Y A;  2OZU A;  4PZJ A;  3GEZ A;  3EDP A;  4DYQ A;  1O3Q A;  1VQK I;  1FWZ A;  4M9S A;  4UB6 C;  3B6C A;  3KCC A;  3KZZ A;  2FD5 A;  2DOF A;  2M34 A;  2IS2 A;  3BTI A;  1YRN A;  3E6M A;  1ZH5 A;  2K02 A;  1AA7 A;  3Q3S A;  4FX0 A;  3UNG C;  2HKX A;  3LL7 A;  3OYK A;  4G94 A;  3BJ6 A;  1VQP I;  3KLO A;  4CCN A;  4ENM A;  3WTU C;  1Q1H A;  1T98 A;  3QPL A;  4G6T B;  3S2D J;  5L3G A;  5LFA A;  2LBF B;  4QIW N;  1AHD P;  1N75 A;  5F64 A;  2UWM A;  3ABK H;  3BR2 A;  1U5T C;  2YPR A;  3FM5 A;  5K7F A;  3G6E I;  4M3B A;  1OJL A;  4QPQ A;  2IGO A;  2FUG 2;  1OCO H;  2ZME C;  4F92 B;  1Z1D A;  2KFD A;  1YS6 A;  5IT3 A;  2QVO A;  2EB7 A;  1CQT A;  2LY2 A;  1MNM C;  2P6S A;  1UST A;  1OR7 A;  2L9S A;  3P5J A;  1XCV A;  4D5C A;  3CC2 I;  5ICG A;  2LH9 A;  2X85 A;  1ZN2 A;  1MMN A;  3MMY B;  3F23 A;  4BAY A;  1FSE A;  2M87 A;  3Q0W A;  4QLC U;  3IH4 A;  3N05 A;  4A0Z A;  3GZ5 A;  2W84 A;  3JRH A;  2JA5 J;  2LP0 A;  2ESN A;  2HPI A;  3PNV A;  3SQN A;  2PEX A;  1LDD A;  3HB9 A;  3ZQG A;  4WCG A;  1ZGA A;  2ICW G;  3NEU A;  2HOA A;  4IVN A;  1LJ9 A;  4UUS B;  5J6X A;  4XRS G;  5F08 A;  3HOV J;  3HGG A;  5GPC A;  5CLS A;  2WAF A;  4YFK F;  3O2P E;  3DU5 A;  2Z16 A;  5GAD J;  1A5J A;  2EK5 A;  3W3C A;  4ESJ A;  1U2W A;  2B0L A;  2RAE A;  5B5E C;  2JN6 A;  2XF5 A;  4QWQ A;  2HGC A;  3VEP A;  2M7B A;  2EV6 A;  2L0K A;  5HLG A;  1I39 A;  3R0J A;  5E17 F;  1VF9 A;  4LLG F;  3L2V A;  5FLX K;  2ZC2 A;  2F4M B;  2DAO A;  1OCT C;  4HDU A;  1HST A;  1Y1V J;  2VXZ A;  3QYF A;  1R5H A;  3C2H A;  3H5R A;  1X1P A;  2XGC A;  3FK7 A;  3G4S I;  5LEJ A;  4IO9 F;  1KON A;  1XSD A;  2VT3 A;  1YTY A;  1ZGW A;  3DQV C;  3LAJ A;  2XSJ C;  4A12 A;  1JUM A;  3LSR A;  1WH5 A;  3K70 C;  3H3Z A;  1QVT A;  3JW4 A;  3S17 J;  1N25 A;  1ZAO A;  1MBJ A;  1QHH D;  1TQM A;  2E35 A;  2BE5 F;  2LYC A;  3I4P A;  2E2J J;  2X6W A;  4ENK A;  3GVA A;  1ETV A;  4XLC A;  5H2F C;  3W2V A;  2GIV A;  5FLV A;  4RBO A;  4A5M A;  2CW0 F;  4DBR A;  2CU7 A;  4Y4R A;  1PJR A;  4QSH A;  2IT0 A;  1RKT A;  2GWR A;  1T33 A;  2WTE A;  2Y69 H;  2STW A;  4ENJ A;  2DQR A;  5F1R A;  2DJI A;  1UB9 A;  4FX4 A;  3DPT A;  2FML A;  1TP4 A;  1XMX A;  5GAH J;  2JSC A;  4XLF A;  2G7U A;  2JJ7 A;  2GOM A;  2W7N A;  3PFY A;  1SAU A;  5CQE A;  3JAM Z;  3S3N A;  3A01 B;  1GV2 A;  1PP8 F;  2LF8 A;  1B9N A;  4FTH A;  4Q47 A;  2W82 A;  3RPU A;  5BPI A;  2RN7 A;  1T08 B;  5M5W J;  4BS9 A;  2UXX A;  4LGW A;  2L9R A;  1R6R A;  1WHU A;  4IQJ A;  3NRV A;  2R0Q C;  1XGN A;  1ZHF A;  2PJR A;  2LK2 A;  4C2T A;  4B44 A;  2HZT A;  4R79 A;  5FFZ A;  1RES A;  4EJT A;  1BA5 A;  3IWF A;  4ZYA A;  3OYG A;  1MJ9 A;  4LOC A;  4YG2 F;  3N97 A;  2O0Y A;  1X1C A;  4AVP A;  1A6Q A;  2P7C B;  3I5U A;  1LDK B;  1WJF A;  3H0D A;  1LEA A;  3GXO A;  2MA3 A;  4I0A A;  4FHT A;  1YQA A;  2BW3 A;  3SZP A;  1EV7 A;  2LMD A;  2EIN H;  4B09 A;  3OYL A;  2L2O A;  2Z9O A;  3CQZ J;  1JTX A;  2RDP A;  4NBQ A;  3I54 A;  2ZJ2 A;  4YII A;  2KRC A;  3A2K A;  2IS1 A;  1Z7L A;  2NS8 A;  1BI0 A;  3LSG A;  1IN7 A;  2VQC A;  4AWX B;  1ETK A;  5D4S A;  3PIO F;  2Y0M A;  3CME I;  1K79 A;  5A2Q K;  1T2K A;  1T6S A;  1MNE A;  4RAZ A;  3WGI A;  3KZY A;  3OS2 A;  2F5F A;  1U78 A;  2EA2 A;  3HHH A;  3ZQQ A;  1MH3 A;  1V3F A;  4DIQ A;  4XIC A;  2BY3 A;  5KCM A;  1S7A A;  3CF5 F;  3CMM A;  1TT0 A;  4UUS A;  4BH9 A;  1UHS A;  3GFM A;  4BDY A;  4A3M J;  3LSP A;  1K83 J;  4LB6 B;  2VLA A;  1P2F A;  3WE2 A;  1R49 A;  3HUG A;  4KA4 A;  3GUD A;  4M6X A;  4Y15 A;  1JE8 A;  3ZQC A;  1FZP B;  3S93 A;  3FXO A;  2LRE A;  1ZAR A;  5HDN A;  1BR2 A;  2XB5 A;  3MEX A;  4G6D A;  4BHB A;  2OTJ I;  2OPT A;  2GAU A;  2XF6 A;  2J5O A;  2XAJ A;  3B6A A;  1GUU A;  2FXA A;  4NQW B;  1IF1 A;  4A5N A;  4ZDO A;  3REO A;  4BHC A;  2CQ7 A;  1Y1W J;  5D4R A;  2F5C A;  3TW7 A;  2RRE A;  3S2H J;  1ORK A;  4LD5 A;  4UUT A;  1Z6T A;  3IKT A;  1MBE A;  4IZZ A;  4ON0 A;  1HA8 A;  1IV6 A;  2VBX A;  2DA3 A;  2DW4 A;  1UMQ A;  3OYJ A;  4QPO A;  4HLX A;  2HPM A;  2YS9 A;  4E7L A;  5C44 J;  3QOD A;  4C3H J;  5GAG J;  3LQQ A;  2UZK A;  1KYW A;  1UHM A;  4DOZ A;  1LE8 A;  3KYD B;  2XAQ A;  2H8R A;  1TWF J;  3BLY A;  1QQI A;  3GX4 X;  2DFH A;  4OMZ A;  1MDM B;  2VKE A;  1ETY A;  4DJA A;  3RZD J;  4IHW A;  4M71 A;  2EH3 A;  3PQK A;  1NK2 P;  1IXS B;  1IRX A;  3UR3 C;  2E2I J;  2QYO A;  4V2F A;  3HRU A;  3LA2 A;  2XAF A;  1JJ6 C;  3QRF F;  1U8R A;  2CFO A;  4BBR J;  5LRS A;  4O6J A;  2X48 A;  5BS6 A;  1UAA A;  5CJ9 A;  3SZG A;  1OCC H;  1LEB A;  2HVS A;  1FX7 A;  2EFP A;  3K4N A;  2RNG A;  4ITV A;  3OL4 A;  4A3E J;  1N77 A;  1U9N A;  1VI0 A;  3E5Q A;  5C4X J;  2E5Z A;  4BBS J;  2YUS A;  2K9S A;  1P4X A;  2PMZ N;  2WAQ N;  3IWZ A;  4MLO A;  1R36 A;  1VQ4 I;  3T8R A;  3H36 A;  3KP2 A;  2KIM A;  2CQQ A;  5FFX A;  2DFF A;  3C1D A;  2NVY J;  2QQB A;  1D5Y A;  1IUF A;  1AU7 A;  4RAG A;  2VBY A;  2YX7 A;  4FQG A;  4M9X A;  4MQV A;  4CIC A;  1H0M A;  1YW7 A;  3H5N A;  1EA3 A;  5EG0 A;  2DOA A;  2W4S A;  1W4M A;  1MBG A;  3QOP A;  3ZCO A;  4H0E A;  1TWH J;  4GCV A;  1KQ8 A;  1NG6 A;  1DP7 P;  4L0Y B;  4XOR A;  4ANJ A;  3PNT A;  5TGT A;  1RNL A;  3WU1 B;  2DXI A;  1CGP A;  2GXG A;  1X2M A;  1W5C C;  2QA4 I;  2O9L A;  2KT0 A;  4CCK A;  4HPQ A;  5A2Q Z;  1TW3 A;  1B4A A;  3HIF A;  3TDZ C;  4F7Z A;  4HAM A;  4NUB A;  2R7U A;  2D5V A;  3DP7 A;  3M8E A;  3RKX A;  5ILV A;  1WSU A;  3BZK A;  5JFR A;  2ZO4 A;  3JRA A;  1WJE A;  1YG2 A;  2A61 A;  1HDP A;  5DUI A;  3HZJ A;  3EQL F;  4LIU A;  1OCR H;  1EF4 A;  4XLA A;  2IAI A;  4XKW A;  5IPA A;  1QGP A;  2KDO A;  2K4B A;  2QEX I;  1XGS A;  3OV8 A;  4I2O A;  2X51 A;  3C2G A;  3DEE A;  4L5J A;  3ZQI A;  1YIJ I;  3OOP A;  2K9Q A;  5IOZ A;  2IJL A;  1HW5 A;  1H9T A;  1SAN A;  3SZT A;  2JRM A;  1XB4 A;  3L09 A;  1VQL I;  3KP5 A;  5FRO A;  2VQH A;  3DU6 A;  1IRG A;  4I02 A;  2Q1Z B;  4OIQ F;  1VQ9 I;  3HOS A;  3F8N A;  3GZN B;  2K9M A;  1POG A;  2MW8 A;  3FWE A;  2VKV A;  3JR9 A;  1K6O A;  3WE3 A;  3F72 A;  2ELH A;  1GDT A;  2PFB A;  3BR6 A;  2KRF A;  1WWX A;  2ID3 A;  4U0Y A;  5D6E A;  4C3J J;  2R7Z J;  2XB0 X;  3ECO A;  3RTR A;  3I4N J;  3ECH A;  1B72 B;  1QNT A;  1SFE A;  1PP7 U;  2EFQ A;  4MNU A;  5HDG A;  4PDK A;  4YEJ A;  2XGD A;  3DKW A;  5E1Z B;  4P1W A;  2HKO A;  5DS9 A;  3O3K A;  1XTA A;  1S6L A;  4Q4Z F;  2EIK H;  4YIR X;  2WAQ A;  4ZTJ A;  1R4N B;  2I5U A;  2Y30 A;  4L5E A;  3AL0 C;  3JRE A;  2IW5 A;  4Z6Y A;  1L0O C;  4F91 B;  5GAE J;  1TT5 B;  1YE9 A;  1W7P B;  4KN7 X;  2X4H A;  4C30 A;  5D8K B;  3CMY A;  2ECB A;  2NOJ B;  4YIF A;  1QPM A;  2N8G A;  5DM6 F;  2ECC A;  2WBM A;  2DMT A;  1MBH A;  3E6C C;  2ACJ A;  3SXY A;  4KIT B;  2FA5 A;  3FMS A;  3IH2 A;  2F4I A;  2DO7 A;  4E4H A;  3ZRG A;  3F8M A;  3OYH A;  1QPI A;  3DEW A;  3DPL C;  3HOT A;  3RPQ A;  1FJL A;  3LOC A;  2LBF A;  2KZV A;  3CTA A;  3E7L A;  1I6X A;  5ICC A;  1WJC A;  3CLQ A;  2E5N A;  4FE7 A;  2LF7 A;  3BT9 A;  4X0G A;  1WGX A;  1A04 A;  3K4C A;  3Q9S A;  2WA0 A;  1IDY A;  1V5F A;  2KIU A;  4GYG A;  2F5E A;  1R5G A;  1QBJ A;  3C2B A;  3I4M J;  2QM3 A;  1ETX A;  3IKV A;  1TL8 A;  4JX6 A;  4M3E A;  5GPA A;  1SD7 A;  3K69 A;  1MBF A;  3V8J A;  2A05 A;  5ERI A;  3BCB A;  1CF7 A;  2M4G A;  3HYI A;  1I1S A;  3TL4 X;  1G3Y A;  2M0M A;  3K2A A;  1PVE A;  5HS8 A;  2VOO A;  5CQG A;  1IRF A;  4C2U A;  4CUG A;  4UY8 I;  1VQ8 I;  4G7Z F;  2Q2E A;  5DCM B;  1KU7 A;  3M07 A;  4JK1 X;  2ZNY A;  2B9S A;  2DA4 A;  4LG3 A;  4RMN A;  1R4M B;  2HOT A;  4M3D A;  3HBL A;  4PJM A;  4RM2 A;  2MD5 A;  2XAG A;  1BL0 A;  1FMV A;  2VB6 A;  5FKM A;  3OIP A;  4Y3O A;  1ZQ3 P;  3FXL A;  4XKV A;  4HEA 2;  2L9V A;  1IRZ A;  2DA5 A;  3OIQ A;  1OYY A;  4KMU X;  4PFP A;  3CMA I;  2GXB A;  2P0W A;  4MTE A;  3ZQL A;  2QF7 A;  2K9N A;  3WTV C;  4Z2Y A;  3P7N A;  5AIQ A;  1QVU A;  1BOA A;  1FNN A;  3KP3 A;  4FIS A;  4F93 B;  3ONQ A;  1Z67 A;  3H5A A;  2VBW A;  1UZC A;  3RJP A;  4ETS A;  2NRA C;  2VKD A;  3P9K A;  4F55 A;  1B8I B;  5C4J J;  3IAM 2;  4OMY A;  3BZC A;  1FBQ A;  1SD5 A;  4RM3 A;  4D7N A;  1M1E B;  3QPH A;  4XLP F;  1FBU A;  4I7H A;  1JHF A;  4XKB A;  1LDJ A;  3SDB A;  1SAX A;  3I64 A;  2BV6 A;  4G7O F;  4Y13 A;  3DV8 A;  3LQR A;  1S5L C;  3K4J A;  1RUN A;  2A07 F;  2EQR A;  3LMM A;  3LNQ A;  3PNY A;  4A3D J;  2CH0 A;  2CRG A;  3JRC A;  1W5T A;  2HDC A;  4ZDL A;  4NC8 A;  1NG7 A;  1YJ9 I;  2VN2 A;  2ZSH B;  4I0B A;  1YFH A;  5K5O A;  1ZGJ A;  3CDL A;  4D5F A;  3COA C;  4XLN F;  3HKZ A;  2OC6 A;  3AL0 B;  3L2C A;  5HLH A;  3DF8 A;  2R5Y B;  3FDY A;  4ZDP A;  1XX5 A;  2G7H A;  2L4A A;  2UXN A;  2XGE A;  3H92 A;  3VSL A;  3A01 A;  1WQ2 A;  3CCQ I;  1T38 A;  3S16 J;  4GGG A;  2CW8 A;  1V5E A;  5EEH A;  2ISZ A;  5CYV A;  1P6R A;  1AKH A;  3TOA A;  2O8X A;  2FBH A;  5HDK A;  3GTG J;  2A6H F;  5M5Y J;  1RKW A;  1BI2 A;  4WWC A;  3HOW J;  3EUA A;  3GME A;  1Z0X A;  1G4D A;  3CC7 I;  5IT9 Z;  3AG4 H;  3K70 D;  5LGU A;  1Y8Q B;  2BGC A;  2DU9 A;  4UXN A;  2CUJ A;  2M30 A;  1WI3 A;  2ZJR F;  1OQY A;  2O7O A;  1DPR A;  2MYS A;  2E2H J;  1S7E A;  3VYU B;  1ZR2 A;  3L00 A;  4RB1 A;  1O4X A;  1VQN I;  3BG9 A;  3CP2 A;  3I59 A;  2XSD C;  3ZQF A;  5FKK A;  3BR5 A;  1P7I A;  3BDD A;  3KP7 A;  4CYD A;  4XQF A;  2JA6 J;  3U9G A;  3SFI A;  4U7D A;  4NC6 A;  1WI9 A;  3M8F A;  1ON1 A;  2HTS A;  3QYB A;  2VUM J;  2DTR A;  3PQJ A;  1BW5 A;  3J7Z I;  4P55 A;  5EYR A;  4HQE A;  4IHT A;  5F0C A;  2PMH A;  2GZW A;  1ZLJ A;  1J7K A;  3EUK L;  3V7C A;  3S8P A;  5IP6 A;  2YX4 A;  2AXT C;  3ABL H;  2A69 F;  1LFP A;  2AQF A;  2BHZ A;  2COM A;  4U7B A;  1TQP A;  2ZNZ A;  2FBK A;  4EQQ A;  3G2B A;  3E6B A;  3F3X A;  2F5V A;  3FM3 A;  3J7Y J;  4Y52 J;  4ZC3 A;  2IGN A;  2VQL A;  2CS3 A;  4M73 A;  3RPU D;  2RQP A;  3JCU C;  4IRI A;  1LPQ A;  2DMU A;  1D8J A;  4MTD A;  2HYJ A;  5AON A;  4S04 A;  4Y17 A;  2ZFU A;  2PLY A;  2FF4 A;  1P92 A;  2Y0S A;  1IC8 A;  2I10 A;  3QP5 A;  3WOD F;  3J81 K;  4ESB A;  5CPR B;  4FAS D;  2HR3 A;  3KE2 A;  4B3X A;  5F0F A;  1T95 A;  3TOB A;  2F6C A;  3CJQ B;  3QPS A;  4GXO A;  4ASN A;  4PUS A;  3OIO A;  3L7W A;  4P9U A;  1R22 A;  4XLH A;  4A93 J;  3RDI A;  3OYN A;  1W36 C;  5ED4 A;  2H1K A;  3ZQH A;  1DU6 A;  1X4P A;  5FKL A;  5J8C A;  2G0E A;  2KZG A;  4AM3 A;  3WTT C;  2NNY A;  4BJT A;  3G1O A;  5DDG A;  3U1K A;  2VJ4 A;  3FXU A;  5D6F A;  2LSO A;  1BJZ A;  2QGU A;  4RAF A;  2PJR B;  1ENH A;  2KL4 A;  2L54 A;  2L7K A;  2M2E A;  4HX4 A;  1RZ4 A;  1WRJ A;  3ASN H;  2A6T A;  4GYI A;  2QEN A;  1Z6R A;  2HQR A;  2AO9 A;  1VQ5 I;  1K7A A;  1D1C A;  1LE8 B;  2JMW A;  3ZMT A;  2FRH A;  1SVO A;  4AIK A;  5JLX A;  2R7V A;  2CW7 A;  3J7A Y;  1X1D A;  2EV0 A;  4M6V A;  1R1V A;  2DDB A;  2KIQ A;  3FXQ A;  5CVV A;  2ZME B;  3E5X A;  4BJ5 C;  3K1N A;  1NK3 P;  5KHD A;  3GTJ J;  2UUZ A;  3W6J B;  5D5V B;  1ACI A;  1X58 A;  2LFB A;  4EM0 B;  2W48 A;  4E6K G;  3KP4 A;  1E2X A;  3IAS 2;  5HVQ C;  2VKH A;  2GOX B;  1H8A C;  1W5S A;  2PX9 A;  2G9W A;  3RIR A;  4E7Z A;  2QBY B;  1STZ A;  4RB0 A;  2BOL A;  5EDN A;  3GFL A;  5DUK A;  3ESW B;  1AKH B;  2H27 A;  1G3W A;  3DTE A;  1OCP A;  3FBI B;  1TQI A;  2FOK A;  1QA6 A;  2WC2 A;  1SFK A;  3HRT A;  3HRS A;  1P4A A;  4AUX A;  2ZSI B;  3IUO A;  2IGM A;  5DD8 A;  3SYT A;  1T0F A;  3HXL A;  2K3P A;  4AU7 A;  3LSK A;  2P6T A;  1JJ8 C;  4JBA A;  4UNO A;  2HWV A;  2M9H A;  4XN0 A;  2V1X A;  4P9F A;  3UKG A;  3PUB A;  2GBY A;  3ZN1 A;  4AD9 A;  4N9I A;  3U1D A;  4O3M A;  4E70 A;  1WFX A;  2DQL A;  2E34 A;  4XON A;  4I09 A;  4BL0 B;  3CD6 I;  4I01 A;  2R7F A;  4DNC A;  1IG7 A;  1P4W A;  2KLO A;  3HPH A;  1GLN A;  3AG1 H;  3D5R C;  2V6C A;  1LVK A;  2KPM A;  3AAF A;  4QTR A;  3O8H A;  3OYE A;  2Z2S B;  2DT5 A;  2IGK A;  4LIV A;  1Y39 A;  2O61 A;  2NXN B;  1UFM A;  5K1Y A;  1E3H A;  3MN2 A;  2QSH X;  3SFZ A;  4CCM A;  3IRR A;  1GV5 A;  3CJT B;  1V54 H;  3P9C A;  1I3Q J;  4XID A;  4GO1 A;  2DMQ A;  4S0H B;  1DU0 A;  1YIO A;  1O7F A;  1BC7 C;  2VOD A;  1MD0 A;  2R7S A;  1V4R A;  1YRN B;  2R3S A;  1BIA A;  2E1M C;  5KK1 A;  5IT9 K;  4BUP A;  1MZB A;  2K27 A;  1R9T J;  3S1Q J;  2LKS A;  3QQA A;  3CCM I;  2VPL A;  1OR7 C;  4E7S A;  4RAY A;  1MIJ A;  2CFX A;  3QYE A;  1QHG A;  3VPR A;  4HX7 A;  2RV8 A;  4CCJ A;  3EYI A;  4YFN F;  2VIX A;  1XD7 A;  3LA3 A;  1Z21 A;  3V8L A;  4HSR A;  4RGX A;  3CCV I;  3H9J A;  1SD6 A;  2L7Z A;  2BXY A;  4D9J A;  1RR8 C;  3S1N J;  3LSH A;  1WPK A;  1X1B A;  2OA4 A;  2ME6 A;  3SEZ A;  3RSN A;  2XRL A;  3HJE A;  2XDV A;  4MFE A;  3TBI A;  3CZ6 A;  1IN8 A;  2OD5 A;  1OYI A;  2FSW A;  3JAM K;  4MO7 A;  2CO5 A;  3WG9 A;  4M9Z A;  4OIR F;  3F22 A;  4RLF A;  4XRM A;  1HW1 A;  1JKP C;  5L3B A;  4BDZ A;  5J1Y A;  4BQN A;  2NYX A;  4UB8 C;  3CCJ I;  3GTK J;  2J5P A;  3EUH A;  2CV0 A;  4RS8 A;  4N9H A;  4KYW A;  2V4J C;  3GTM J;  2XAH A;  1TWA J;  1MKM A;  5TJJ A;  1DQU A;  4UVB A;  2VL8 A;  3FMQ A;  4MQ9 F;  1Y8R B;  3ERE D;  2V6E A;  4EJU A;  4ZYG A;  4RDU A;  5BQT A;  5CVR A;  3QWL A;  1A35 A;  4B3A A;  4KIC A;  4LMY A;  2STT A;  5DTD A;  3MKL A;  3E6D A;  2DFI A;  3DEU A;  2JTV A;  1MBK A;  3AG3 H;  3M7G A;  4M6Y A;  1IJW C;  1HDD C;  3VB2 A;  1T8I A;  4D1Q A;  4DZJ A;  2QCO A;  4CH7 A;  2JVG A;  2LKP A;  2EZI A;  3CC4 I;  3RKQ A;  2WV0 A;  2XGX A;  2XAU A;  3FHN A;  2VBZ A;  1IUY A;  3V4G A;  3CCL I;  3EET A;  4HRI A;  5BOX A;  2WWY A;  4E7I A;  2K7L A;  1J59 A;  1FYM A;  1JGG A;  2JSP A;  2V79 A;  2CG4 A;  3FK6 A;  1YLF A;  2HTJ A;  1BI3 A;  2M5W A;  2GIZ A;  4OAZ A;  2LC2 A;  4OU0 A;  3TP3 A;  1K78 A;  5CVI A;  5BMZ A;  3NAR A;  3OMY A;  2NNN A;  4OWR B;  4IHV A;  2WAE A;  3PSF A;  4KMF A;  2Q2E B;  1CF7 B;  2D1H A;  1FT9 A;  3NQO A;  1XN7 A;  2HU9 A;  1MGT A;  5L3C A;  4BXF A;  4HG2 A;  3L2W A;  5JVG F;  1HXD A;  1EH6 A;  1LNW A;  2DCE A;  5GTH C;  4ZH4 F;  1UHW A;  2E7W A;  3BTC A;  1JXS A;  3R61 A;  3HSR A;  2V7F A;  1KQ0 A;  2CGP A;  2W85 A;  4CCO A;  2EBI A;  1LUJ B;  1E0E A;  1D5V A;  3QPT A;  4LB5 A;  1J9I A;  3GCM A;  3DWL E;  1A31 A;  1QZY A;  1K61 A;  4E7H A;  5IOY A;  1DDN A;  3HOU J;  2DN0 A;  2X1C A;  1ITY A;  3DTK A;  5ILS A;  1GXP A;  1W7P A;  5EJC A;  4P5O A;  1EH7 A;  2LR8 A;  1OYW A;  3BPX A;  3ZQ7 A;  1VFC A;  3LAP A;  3K1P A;  2XIG A;  3H0G J;  1ETW A;  3LSM A;  2IVM A;  3DFG A;  3J81 Z;  2X9D A;  1B8I A;  4I98 B;  5J40 A;  2LD5 A;  4EMS A;  1AWC A;  1FLI A;  3DBH B;  3P9I A;  2MSY A;  4LFU A;  1XCB A;  4R1H A;  1ZK8 A;  1U0J A;  1OPC A;  1HBX G;  1UCR A;  4HQM A;  2HZD A;  3CO7 C;  1BC8 C;  4BAC A;  1R1U A;  2R5Z A;  1R7J A;  1BBY A;  4GFB A;  3I3L A;  2MH2 A;  2VQG A;  5E3L A;  1VZ0 A;  4YRV A;  2LY9 A;  1ZKG A;  4IJA A;  1MMA A;  4Y33 A;  4KT5 C;  4EGY A;  1HOM A;  1VQ7 I;  2V1D A;  1HW2 A;  2DA7 A;  4HST A;  4DGW B;  3MFK A;  1ZRF A;  1IZ1 A;  1XC5 A;  1E17 A;  4BU2 A;  4C2M J;  2BHY A;  4DYR A;  3M3Y J;  5DV5 A;  1ETQ A;  3W2W A;  2BVL A;  4HV6 A;  5TRD A;  1S9H A;  1ZRE A;  1Y56 A;  2F4O B;  3DBL B;  2HQN A;  1S7O A;  1TNS A;  2LG4 A;  3JSP A;  1MMD A;  1GHC A;  2HVR A;  3F8B A;  4N0B A;  4IKF A;  1G6N A;  2M3A A;  1BR4 A;  4A6E A;  5K5Q A;  3Q0U A;  2X1E A;  2IP2 A;  4CYC B;  1UJ8 A;  4PSX A;  3FBN B;  3ZMS A;  1U5T B;  3PIP F;  1G2H A;  4XM3 A;  4I6Z A;  2DBB A;  4B1R A;  3BCA A;  3NAU A;  4NQW A;  4DZP A;  1KU3 A;  2D2W A;  4EJO A;  3KX2 A;  4CHU A;  1R5I D;  3K0L A;  2R5Z B;  5EGO A;  1F5T A;  2NAZ A;  2MLK A;  2Z1D A;  2ADU A;  2H8W A;  1WJD A;  3O8G A;  5LHG A;  4CZC A;  3MWM A;  1XDS A;  3H3U A;  2ZJP F;  2ZBK A;  4LJZ F;  5J47 A;  1YIT I;  3ABU A;  3ZN0 A;  4HV5 A;  1ZG3 A;  3WTS C;  4HA8 A;  2X1D A;  3HGY A;  5FLM J;  2Y9Z A;  2PG4 A;  4OOI A;  3TO9 A;  2O8K A;  3OSF A;  3FXJ A;  1RPW A;  3DKY A;  4JX5 A;  2HXO A;  2MFZ A;  4O5V A;  4IQ4 A;  3F6V A;  2OV7 A;  2KKO A;  2V26 A;  3GWZ A;  3R0A A;  4KIB A;  5IYD J;  3GTP J;  3X2Q H;  1QZZ A;  3FMR A;  5HS7 A;  3GYH X;  1I6H J;  2FEZ A;  2TCT A;  3TMO A;  1L3L A;  4BE2 A;  1JKR C;  2BVM A;  2Y9Y A;  2VI6 A;  1MND A;  4JYK A;  2HQA A;  1NHA A;  4DW6 A;  1ZG1 A;  1G8X A;  3JRG A;  2BBY A;  3I56 I;  3DKX A;  2XRN A;  2XPW A;  3BG3 A;  1R58 A;  2R7X A;  2PQ8 A;  4XR6 A;  3G3Z A;  3CCE I;  2KMU A;  4XOT A;  5HLI A;  1D1B A;  1IXC A;  3VOD A;  1YI2 I;  4A3C J;  1TNT A;  2VPR A;  1A6I A;  1J75 A;  4LIT A;  3I0T A;  4HNT A;  3WTZ A;  2YU9 J;  2YU3 A;  1FTT A;  3V42 A;  1FYK A;  2BYV E;  3D5L A;  1DP3 A;  4XMY A;  1Z9C A;  3C7J A;  3C3W A;  1G59 A;  3GTO J;  5EEG A;  3AG2 H;  2M1B A;  2RNJ A;  3TQN A;  2DYR H;  1YJN I;  4CA0 A;  2DA6 A;  2Y0S N;  2QSG X;  4LG0 B;  2FU4 A;  2H09 A;  2EIL H;  2K3F A;  5DEQ A;  5E8I A;  3CCY A;  4UHT A;  2XRO A;  2DI3 A;  1QO0 D;  2DJN A;  4B8X A;  5M3F J;  3KZI C;  1RI7 A;  5KAF C;  1Z3X A;  2DT7 B;  2K9L A;  3CO6 C;  2P4W A;  3FX3 A;  4BJ6 C;  5LRR A;  4IRG A;  3J80 Z;  2ZME A;  2QZ8 A;  2R7W A;  1YW8 A;  2A5Y B;  5J3L A;  2CV2 A;  5DCF A;  2XPV A;  4M3G A;  4A0X A;  2NS0 A;  2DA2 A;  2RVC A;  3VFZ A;  3ZMD A;  5IYB J;  5B3S H;  1I1G A;  5GTI C;  1IAW A;  3OS1 A;  1TTY A;  5IY5 H;  2ELJ A;  2ESH A;  3GFI A;  3MKW B;  4F3Q A;  1U3E M;  1RUO A;  2V1N A;  4ZZD A;  4BY7 J;  1ZRD A;  3RZO J;  1Z91 A;  1FC3 A;  4BQQ A;  4UUV A;  5LHH A;  4L9V A;  5J8F A;  1FIP A;  2PJP A;  1FY7 A;  1J2X A;  2HFH A;  3I71 A;  3LSI A;  5CKT A;  5FB2 A;  4XLE A;  5B1B H;  2ID6 A;  2MH9 A;  3CUO A;  3J80 K;  4A2U A;  3V8K A;  3U2R A;  5AIP A;  2UV1 A;  3OR2 C;  3E5U A;  2BEO A;  3MZ8 A;  2V9P A;  4Q48 A;  2KRH A;  1YX5 A;  3K2Z A;  4Y7N J;  2A6E F;  4EGZ A;  5FRM A;  2BY1 A;  2OU2 A;  2K5C A;  3MD2 A;  5FD6 A;  1NH3 A;  3CJN A;  4B43 A;  4IPA A;  4RB3 C;  2OQR A;  3T1B A;  1LVA A;  3EPZ A;  4RGU A;  2CUE A;  2W24 A;  2HDW A;  3WHB A;  1HQC A;  3OYA A;  1VQM I;  2WB1 N;  2Y75 A;  4BEH B;  2KQR A;  3KPH A;  3F6O A;  2QKM B;  1ZTR A;  3GF2 A;  4WXH A;  2DMN A;  2OQG A;  4R8H A;  3E3V A;  4PCQ A;  1FPQ A;  1PUE E;  1HC8 A;  2R7Q A;  3FXK A;  3BJA A;  2LNB A;  3HSF A;  4BNC A;  2HOS A;  4BQO A;  2Z33 A;  5FKN A;  3T8T A;  3HG9 A;  3QU6 A;  4TV7 A;  1YYV A;  3OL3 A;  2WY7 Q;  2DOE A;  1I27 A;  2ZJQ F;  5E79 C;  1O7L A;  2PI0 A;  2LY1 A;  3L1P A;  3FIS A;  2DT6 A;  2NVX J;  3LWF A;  3DLA A;  4EV0 A;  4XNF A;  3HTU A;  3IRQ A;  3FXM A;  2R4G A;  3G71 I;  4KFC A;  3S14 J;  3NWT A;  2GA1 A;  5ILU A;  4YEL A;  4CSW A;  1SFX A;  4HBL A;  4V19 K;  2YR2 A;  4OIP F;  1JUS A;  1B59 A;  4EJW A;  1N78 A;  5H20 A;  1BI1 A;  2EA4 A;  3ZMV A;  3TW6 A;  2NVQ J;  3G1M A;  2BZT A;  5EEA A;  2CMP A;  1F36 A;  4A3G J;  4BY1 J;  1X19 A;  1ZYR F;  4CDG A;  3BOQ A;  2DYS H;  3WHC A;  4ZZL A;  4PGG A;  1ZLK A;  4J01 A;  4KJZ A;  3E97 A;  2JA7 J;  2O5R A;  3ASO H;  1WZ2 A;  2DOD A;  2PBI A;  3TED A;  3S1R J;  2ZKZ A;  5F04 A;  3TGN A;  1X3W B;  1EJ9 A;  4XBF A;  4DYC A;  2EWN A;  1XSX A;  3ABT A;  3KEQ A;  1OLT A;  3KEO A;  2O6G E;  4KNY A;  3RYP A;  3ZOB A;  2HQ5 A;  3K4L A;  5F27 A;  3ZP5 A;  1XGO A;  2KJB A;  3MCZ A;  3B02 A;  3HEF A;  4AIJ A;  4IX7 A;  5JHU A;  1TC3 C;  4H4K C;  2X6X A;  1W1W E;  4PJ0 C;  1XPX A;  5K5R A;  4FE4 A;  1JKO C;  3PSI A;  4OIO F;  4ESF A;  1Z05 A;  2FNP A;  3OYI A;  4BQA A;  4L18 B;  1MDM A;  2LTP A;  4AC0 A;  1YS7 A;  4RGS A;  4B4C A;  1WJA A;  1XMA A;  3QP6 A;  1JUP A;  3LSJ A;  3W6K B;  4PGH A;  2XVC A;  1D0Y A;  2HVQ A;  2PMU A;  4HW0 A;  2KIF A;  1HLV A;  4J00 A;  1Z7U A;  2ZXW H;  1OCZ H;  4U0W A;  2CV1 A;  2R93 J;  3SDG A;  1D3Y A;  2MGQ A;  4XSZ F;  2OF7 A;  3BG6 A;  3VDX A;  3MZY A;  4RA2 A;  5LEK A;  1H89 C;  3I53 A;  1I5Z A;  1JKQ C;  1ONV A;  1VQ6 I;  2F48 A;  3OWT A;  1APL C;  4NHJ A;  5EZH A;  2XF7 A;  4U0V A;  4E7J A;  1OIS A;  1SC7 A;  3K6G A;  2R7T A;  1JHH A;  2F2E A; 
#chains in the Genus database with same CATH homology
 4Q5S F;  4UV8 A;  5FD5 A;  3I58 A;  4CGZ A;  2DK8 A;  3BP8 A;  3LA7 A;  1J0R A;  2P5V A;  4ENN A;  4HF1 A;  4EJV A;  3RKY A;  4XRF A;  1O3R A;  4WX9 A;  3RKW A;  1IXR C;  3IC7 A;  2YSR A;  5DCM A;  2EJR A;  3TO7 A;  4KDP A;  5JI6 A;  4G9Y A;  2FQ3 A;  2Q8K A;  4A0Y A;  3KFW X;  2PN6 A;  4BYY A;  2QQ9 A;  2RGV A;  2Y48 A;  3R60 A;  1S8N A;  3ZMU A;  3IL2 A;  3MAJ A;  4MEX F;  4IXA A;  2VT2 A;  2MLG A;  2E1N A;  3GFJ A;  3WGG A;  2OZ6 A;  5JR3 A;  4S05 A;  1SMY F;  2ZXJ A;  3ZMZ A;  1KA8 A;  3BZ6 A;  4KIF A;  2QQA A;  2W25 A;  2XHK A;  4K2E A;  3J7A O;  3D0S A;  3KET A;  1O57 A;  2IRF G;  1FOK A;  1KU9 A;  3BWG A;  1FP2 A;  2QWW A;  4CZZ A;  2CWE A;  4ZYH A;  3IHU A;  5FGM A;  5HOO A;  2JRT A;  1R00 A;  1ZG5 A;  2VC1 A;  3F21 A;  2VE9 A;  5KVR A;  1KGS A;  1FSH A;  4UVC A;  1B1B A;  3V7S A;  5L3E A;  4BXU A;  3RI4 A;  2HYF A;  1DPU A;  1W7P D;  2EFO A;  1O3T A;  5ICF A;  4HZF A;  2HEO A;  2FMY A;  2MC3 A;  5E18 F;  1G3S A;  5E20 A;  3TO6 A;  3GO5 A;  1BIB A;  2CYY A;  1JGS A;  2JZY A;  2CSO A;  4FT8 A;  2DLL A;  3KP6 A;  3CLO A;  4XSX F;  1F1Z A;  1KYZ A;  2VOP A;  1USS A;  2RKH A;  1IN5 A;  3M9A A;  1HKS A;  2HYG D;  4CXF A;  2RC4 A;  4IHS A;  1U6G A;  2P5K A;  1HSJ A;  5L3F A;  3WU0 A;  5LHI A;  3WGH A;  2EFW A;  3K9T A;  3FF5 A;  2GA2 A;  5D5U B;  1F5T A;  2XAS A;  4HX8 A;  3MZH A;  4EM1 A;  2R7D A;  3HRM A;  3FZV A;  5LGN A;  2QBY A;  3ULQ B;  3EYY A;  4MHG A;  3MQ0 A;  3F8C A;  2AXL A;  4M74 A;  3VOE A;  3GLX A;  3ROU A;  4LG0 A;  1U5T A;  2P5L C;  1KU2 A;  2MBF A;  5F6F A;  4G7H F;  2K4J A;  2QUF A;  5E1X A;  1EH8 A;  3Q9V A;  1OMI A;  3T5X A;  3WTY C;  4IF4 A;  3QU3 A;  4EM2 A;  2C6Y A;  1C0W A;  3ZPL A;  4WF2 A;  1GXQ A;  3ML6 A;  3CUQ A;  4JQF A;  5JVT A;  4L5I A;  3QAH A;  1LB2 A;  1O3S A;  2V9V A;  2Z99 A;  4A6D A;  1B9M A;  5FLX Z;  1ODD A;  3R6S A;  2V1U A;  2D1V A;  2O03 A;  3N4M A;  4KN4 X;  3L9F A;  4HOB A;  2ISY A;  3JTG A;  3HSE A;  4KIG A;  3LFK A;  4WXC A;  2FNA A;  4ZYE A;  4DQ2 A;  2DPU A;  2M8E A;  3GW2 A;  5CVU A;  1BJA A;  3S2W A;  3FHZ A;  2JPB A;  1B6A A;  4MGR A;  3T0Y A;  3BPV A;  1S29 A;  4U88 A;  4L9J A;  3CUQ C;  2L4M A;  4LK1 F;  1FP1 D;  1TLH B;  4M72 A;  3B73 A;  4UV9 A;  4KUM A;  5D5W B;  3KLN A;  6PAX A;  3WTW C;  3SHF A;  1ZRC A;  2KJC A;  4OIN F;  3LST A;  2E1C A;  4BHP A;  1XMK A;  4G6Q A;  3F8F A;  3HHG A;  1SMT A;  1T39 A;  2EV5 A;  4D0P A;  3JSO A;  1ULY A;  1YW9 A;  2E7X A;  4ZYD A;  1MJB A;  2O3F A;  1GVJ A;  2H94 A;  1YO5 C;  1PDN C;  2IA1 A;  2IPQ X;  4EVI A;  4UVA A;  3JTH A;  4G8X A;  2HS5 A;  1D8K A;  3R4K A;  1MJA A;  3FXR A;  1WKM A;  1TW2 A;  4L0Z B;  2W57 A;  3TKY A;  2ZCW A;  5LBQ A;  1K78 B;  2D45 A;  2ZFW A;  1J5Y A;  2P7V B;  2VC0 A;  4LLN A;  2XUB A;  1SD4 A;  3I59 B;  1VTN C;  3PFI A;  1R1T A;  2XKP A;  2H6C A;  1RIO H;  4WXD A;  2K86 A;  4YFX F;  3G73 A;  3ELK A;  5CVJ A;  4P96 A;  4RB2 C;  2L01 A;  5H6Q A;  3CUQ B;  4L9N A;  5HS9 A;  2AS5 F;  4HYE A;  5E1W A;  5D5X B;  4HF0 A;  2HOE A;  4IRH A;  4CO8 A;  3M1E A;  1R23 A;  3GZ6 A;  3BJO A;  5FO5 A;  3ISP A;  4AIH A;  2VE8 A;  4HLY A;  1LQ1 A;  2M45 A;  5H6R A;  3HTS B;  3WTX C;  2GQQ A;  1XGM A;  2X0L A;  5D8L B;  3V7R A;  2IA0 A;  2IA2 A;  4L9T A;  3CDH A;  1REP C;  1XSV A;  1F4K A;  2JT1 A;  4RGR A;  5LGT A;  2Q0O A;  1SFU A;  3C18 A;  2OBP A;  1HKT A;  5LLQ A;  1FBS A;  2XV4 S;  4MEY F;  5DD4 A;  1IN6 A;  2OAZ A;  3BRO A;  3DXJ F;  1TBX A;  1ON2 A;  2L02 A;  2L3D A;  1FYL A;  2QLZ A;  2VON A;  3K1M A;  4HDV A;  3TDU C;  1AOY A;  1S3J A;  2TDX A;  3RYR A;  1IW7 F;  5ICE A;  2XKO A;  2EFN A;  1HKQ A;  2ETH A;  2DK5 A;  2H6B A;  2FBI A;  1IN4 A;  1F9N A;  3BY6 A;  5E8G A;  1X3U A;  1H9G A;  2JPC A;  1OKR A;  2A68 F;  3O6B B;  2A3S A;  4HF2 A;  4NB5 A;  4LK0 F;  2F5D A;  2Z5U A;  1XDU A;  4WK8 F;  1Y0U A;  1BN5 A;  3Q5F A;  5DYM A;  2LDU A;  2DPD A;  1BM9 A;  2FE3 A;  1G3T A;  2P8T A;  1DUX C;  5BPD A;  2CQK A;  4LLL A;  1KQ9 A;  2Z3Y A;  5L3D A;  2OZU A;  4PZJ A;  3GEZ A;  3EDP A;  1O3Q A;  1FWZ A;  4M9S A;  3KCC A;  3KZZ A;  3E6M A;  1ZH5 A;  2K02 A;  4FX0 A;  2HKX A;  4G94 A;  3BJ6 A;  3KLO A;  4ENM A;  3WTU C;  1Q1H A;  1T98 A;  5L3G A;  5F64 A;  2UWM A;  2YPR A;  1U5T C;  3FM5 A;  1Z1D A;  1YS6 A;  5IT3 A;  2QVO A;  2EB7 A;  2P6S A;  1UST A;  1OR7 A;  1XCV A;  5ICG A;  1ZN2 A;  3F23 A;  4BAY A;  1FSE A;  2M87 A;  4QLC U;  4A0Z A;  3GZ5 A;  2W84 A;  2ESN A;  3SQN A;  2PEX A;  1LDD A;  4WCG A;  1ZGA A;  3NEU A;  4IVN A;  1LJ9 A;  5J6X A;  5CLS A;  4YFK F;  3O2P E;  2EK5 A;  4ESJ A;  1U2W A;  2B0L A;  4QWQ A;  2HGC A;  3VEP A;  2EV6 A;  5HLG A;  3R0J A;  5E17 F;  4LLG F;  5FLX K;  2DAO A;  4HDU A;  1HST A;  2VXZ A;  1R5H A;  5LEJ A;  1XSD A;  2VT3 A;  1YTY A;  3DQV C;  3LAJ A;  4A12 A;  3H3Z A;  3JW4 A;  1ZAO A;  1TQM A;  2BE5 F;  3I4P A;  4ENK A;  3GVA A;  2GIV A;  4A5M A;  2CW0 F;  2IT0 A;  2GWR A;  2WTE A;  2STW A;  4ENJ A;  2DQR A;  5F1R A;  4FX4 A;  1UB9 A;  3DPT A;  2FML A;  2JSC A;  2G7U A;  3JAM Z;  1PP8 F;  2LF8 A;  1B9N A;  4Q47 A;  3RPU A;  5BPI A;  2RN7 A;  2UXX A;  4LGW A;  3NRV A;  1XGN A;  1ZHF A;  2HZT A;  4R79 A;  5FFZ A;  4EJT A;  3IWF A;  1MJ9 A;  4YG2 F;  3N97 A;  2O0Y A;  4AVP A;  2P7C B;  3I5U A;  1LDK B;  1LEA A;  3GXO A;  2MA3 A;  4I0A A;  4FHT A;  1YQA A;  3SZP A;  1EV7 A;  2Z9O A;  4B09 A;  2RDP A;  3I54 A;  2ZJ2 A;  4YII A;  1BI0 A;  1IN7 A;  4AWX B;  5D4S A;  2Y0M A;  1K79 A;  5A2Q K;  1T2K A;  1T6S A;  4RAZ A;  3WGI A;  3KZY A;  2F5F A;  1U78 A;  2EA2 A;  3HHH A;  1V3F A;  1S7A A;  4BH9 A;  3GFM A;  4LB6 B;  1P2F A;  3WE2 A;  3HUG A;  4KA4 A;  3GUD A;  4M6X A;  4Y15 A;  1JE8 A;  1FZP B;  1ZAR A;  5HDN A;  3MEX A;  4G6D A;  4BHB A;  2GAU A;  2J5O A;  2XAJ A;  2FXA A;  1IF1 A;  4A5N A;  3REO A;  4BHC A;  5D4R A;  2F5C A;  4LD5 A;  3IKT A;  1Z6T A;  4ON0 A;  2VBX A;  2DW4 A;  4HLX A;  3LQQ A;  2UZK A;  1KYW A;  1UHM A;  2XAQ A;  1QQI A;  3GX4 X;  4OMZ A;  1MDM B;  4M71 A;  3PQK A;  1IXS B;  2QYO A;  3HRU A;  3LA2 A;  2XAF A;  3QRF F;  1U8R A;  5LRS A;  4O6J A;  5BS6 A;  5CJ9 A;  1LEB A;  1FX7 A;  2EFP A;  3E5Q A;  1P4X A;  3IWZ A;  1R36 A;  3T8R A;  3KP2 A;  2KIM A;  5FFX A;  3C1D A;  2QQB A;  2VBY A;  2YX7 A;  4M9X A;  4MQV A;  4CIC A;  1H0M A;  1YW7 A;  1W4M A;  3QOP A;  4H0E A;  4GCV A;  1KQ8 A;  1DP7 P;  4L0Y B;  1RNL A;  3WU1 B;  1CGP A;  2GXG A;  5A2Q Z;  1TW3 A;  1B4A A;  3HIF A;  3TDZ C;  4F7Z A;  4HAM A;  3DP7 A;  3M8E A;  3RKX A;  5ILV A;  1WSU A;  5JFR A;  2ZO4 A;  1YG2 A;  2A61 A;  5DUI A;  3EQL F;  1QGP A;  2K4B A;  1XGS A;  3OV8 A;  4I2O A;  4L5J A;  3OOP A;  2IJL A;  1HW5 A;  1H9T A;  3SZT A;  1XB4 A;  3L09 A;  3KP5 A;  1IRG A;  4I02 A;  4OIQ F;  3HOS A;  3F8N A;  3FWE A;  1K6O A;  3WE3 A;  3F72 A;  2ELH A;  2PFB A;  2KRF A;  1WWX A;  4U0Y A;  5D6E A;  3ECO A;  3RTR A;  3ECH A;  1QNT A;  1SFE A;  1PP7 U;  2EFQ A;  4MNU A;  5HDG A;  4PDK A;  5E1Z B;  3DKW A;  2HKO A;  3O3K A;  1S6L A;  4Q4Z F;  2IW5 A;  1L0O C;  4KN7 X;  1W7P B;  2X4H A;  5D8K B;  4YIF A;  1QPM A;  3E6C C;  2ACJ A;  3SXY A;  2FA5 A;  3FMS A;  2DO7 A;  3F8M A;  3DPL C;  3HOT A;  3RPQ A;  3CTA A;  1I6X A;  5ICC A;  2LF7 A;  1A04 A;  3Q9S A;  2KIU A;  4GYG A;  2F5E A;  1R5G A;  1QBJ A;  2QM3 A;  3IKV A;  3V8J A;  1SD7 A;  3K69 A;  5ERI A;  1CF7 A;  3HYI A;  1I1S A;  1G3Y A;  5HS8 A;  2VOO A;  1IRF A;  4G7Z F;  2Q2E A;  5DCM B;  1KU7 A;  4JK1 X;  2ZNY A;  2MD5 A;  2XAG A;  1OYY A;  4KMU X;  2GXB A;  4MTE A;  3WTV C;  4Z2Y A;  3P7N A;  5AIQ A;  1BOA A;  1FNN A;  3KP3 A;  2VBW A;  3RJP A;  4ETS A;  2NRA C;  3P9K A;  4OMY A;  1FBQ A;  1SD5 A;  3QPH A;  4XLP F;  1FBU A;  4I7H A;  1JHF A;  1LDJ A;  1SAX A;  3I64 A;  2BV6 A;  4G7O F;  4Y13 A;  3DV8 A;  3LQR A;  1RUN A;  2A07 F;  1W5T A;  2HDC A;  2VN2 A;  4I0B A;  1YFH A;  5K5O A;  1ZGJ A;  3COA C;  4XLN F;  3L2C A;  5HLH A;  3DF8 A;  2G7H A;  2L4A A;  2UXN A;  3H92 A;  1WQ2 A;  1T38 A;  4GGG A;  5EEH A;  2ISZ A;  5CYV A;  1P6R A;  3TOA A;  2O8X A;  2FBH A;  5HDK A;  2A6H F;  1BI2 A;  4WWC A;  1G4D A;  5IT9 Z;  5LGU A;  2BGC A;  2DU9 A;  4UXN A;  2M30 A;  1DPR A;  3L00 A;  4RB1 A;  3I59 A;  3BDD A;  3KP7 A;  4CYD A;  3U9G A;  4U7D A;  1WI9 A;  3M8F A;  1ON1 A;  2HTS A;  2DTR A;  3PQJ A;  4HQE A;  4P55 A;  4IHT A;  2PMH A;  2GZW A;  1ZLJ A;  1J7K A;  3V7C A;  2YX4 A;  2A69 F;  2COM A;  4U7B A;  1TQP A;  2ZNZ A;  2FBK A;  4EQQ A;  3E6B A;  3F3X A;  3FM3 A;  4M73 A;  2RQP A;  4IRI A;  1D8J A;  4MTD A;  5AON A;  4S04 A;  4Y17 A;  2PLY A;  2FF4 A;  1P92 A;  3QP5 A;  3WOD F;  3J81 K;  4ESB A;  2HR3 A;  3KE2 A;  3TOB A;  4GXO A;  4ASN A;  3L7W A;  4P9U A;  1R22 A;  3RDI A;  5ED4 A;  5J8C A;  3WTT C;  2NNY A;  5DDG A;  3FXU A;  5D6F A;  2LSO A;  2L54 A;  4HX4 A;  1RZ4 A;  1WRJ A;  4GYI A;  2QEN A;  1Z6R A;  2HQR A;  1K7A A;  3ZMT A;  2FRH A;  4AIK A;  2EV0 A;  5CVV A;  1R1V A;  3FXQ A;  2ZME B;  3E5X A;  3K1N A;  3W6J B;  5D5V B;  4EM0 B;  3KP4 A;  1E2X A;  5HVQ C;  1W5S A;  3RIR A;  2G9W A;  2QBY B;  1STZ A;  4RB0 A;  2H27 A;  3GFL A;  5DUK A;  1G3W A;  1TQI A;  2FOK A;  2WC2 A;  3HRT A;  3HRS A;  1P4A A;  5DD8 A;  1T0F A;  2P6T A;  4UNO A;  4JBA A;  2HWV A;  2V1X A;  4P9F A;  3ZN1 A;  4AD9 A;  4N9I A;  3U1D A;  4O3M A;  4E70 A;  2DQL A;  4I09 A;  4I01 A;  2R7F A;  4DNC A;  1P4W A;  2V6C A;  3AAF A;  2DT5 A;  2O61 A;  1UFM A;  5K1Y A;  3SFZ A;  3IRR A;  3P9C A;  4GO1 A;  1YIO A;  1BC7 C;  1O7F A;  2VOD A;  1MD0 A;  1V4R A;  2R3S A;  1BIA A;  5KK1 A;  5IT9 K;  1MZB A;  2K27 A;  4RAY A;  2CFX A;  4HX7 A;  2RV8 A;  3EYI A;  4YFN F;  1XD7 A;  3LA3 A;  3V8L A;  4RGX A;  1SD6 A;  2OA4 A;  1IN8 A;  2OD5 A;  1OYI A;  2FSW A;  3JAM K;  2CO5 A;  3WG9 A;  4M9Z A;  4OIR F;  3F22 A;  1HW1 A;  5L3B A;  2NYX A;  2J5P A;  3EUH A;  4RS8 A;  4N9H A;  4KYW A;  2XAH A;  1MKM A;  5TJJ A;  4UVB A;  3FMQ A;  4MQ9 F;  3ERE D;  4EJU A;  4ZYG A;  5BQT A;  5CVR A;  4KIC A;  4LMY A;  2STT A;  3E6D A;  2DFI A;  3DEU A;  2JTV A;  3M7G A;  4M6Y A;  3VB2 A;  2LKP A;  2WV0 A;  2XGX A;  2VBZ A;  1IUY A;  3V4G A;  3EET A;  5BOX A;  2WWY A;  2K7L A;  1J59 A;  1FYM A;  2V79 A;  2CG4 A;  1YLF A;  2HTJ A;  1BI3 A;  2M5W A;  4OU0 A;  1K78 A;  5CVI A;  5BMZ A;  2NNN A;  4KMF A;  1CF7 B;  2D1H A;  1FT9 A;  3NQO A;  1XN7 A;  5L3C A;  1MGT A;  1HXD A;  1EH6 A;  1LNW A;  4ZH4 F;  1UHW A;  2E7W A;  1JXS A;  3R61 A;  3HSR A;  1KQ0 A;  2CGP A;  2W85 A;  1D5V A;  3QPT A;  4LB5 A;  1J9I A;  1QZY A;  1DDN A;  5ILS A;  1GXP A;  1W7P A;  4P5O A;  1EH7 A;  1OYW A;  3BPX A;  3ZQ7 A;  3LAP A;  3K1P A;  2XIG A;  2IVM A;  3DFG A;  3J81 Z;  4I98 B;  1AWC A;  4EMS A;  1FLI A;  3P9I A;  4LFU A;  1XCB A;  4R1H A;  1OPC A;  1HBX G;  1UCR A;  4HQM A;  3CO7 C;  1BC8 C;  1R1U A;  1R7J A;  1BBY A;  2MH2 A;  4IJA A;  4KT5 C;  4EGY A;  2V1D A;  1HW2 A;  1ZRF A;  3MFK A;  1IZ1 A;  1E17 A;  5DV5 A;  4HV6 A;  5TRD A;  1ZRE A;  2HQN A;  1S7O A;  1TNS A;  3JSP A;  1GHC A;  3F8B A;  4N0B A;  1G6N A;  4A6E A;  5K5Q A;  2IP2 A;  3ZMS A;  1U5T B;  2DBB A;  4NQW A;  1KU3 A;  2D2W A;  4EJO A;  4CHU A;  3K0L A;  2NAZ A;  2MLK A;  2ADU A;  5LHG A;  3MWM A;  1XDS A;  3H3U A;  2ZBK A;  4LJZ F;  3ABU A;  3ZN0 A;  4HV5 A;  1ZG3 A;  3WTS C;  4HA8 A;  2PG4 A;  4OOI A;  3TO9 A;  4O5V A;  3F6V A;  2KKO A;  3GWZ A;  3R0A A;  4KIB A;  1QZZ A;  3FMR A;  5HS7 A;  3GYH X;  2FEZ A;  1L3L A;  1NHA A;  1ZG1 A;  2BBY A;  2XRN A;  1R58 A;  2PQ8 A;  3G3Z A;  5HLI A;  1IXC A;  3VOD A;  1J75 A;  1TNT A;  3I0T A;  3WTZ A;  2YU3 A;  1FYK A;  2BYV E;  3D5L A;  1Z9C A;  3C7J A;  3C3W A;  5EEG A;  2M1B A;  2RNJ A;  3TQN A;  4LG0 B;  5E8I A;  2FU4 A;  2H09 A;  2XRO A;  5DEQ A;  4UHT A;  2DI3 A;  1QO0 D;  4B8X A;  1RI7 A;  3CO6 C;  2P4W A;  3FX3 A;  5LRR A;  4IRG A;  3J80 Z;  2ZME A;  2QZ8 A;  1YW8 A;  2A5Y B;  5DCF A;  4A0X A;  2NS0 A;  2RVC A;  3VFZ A;  3ZMD A;  1I1G A;  1IAW A;  1TTY A;  2ESH A;  3GFI A;  1U3E M;  1RUO A;  4ZZD A;  1ZRD A;  1Z91 A;  1FC3 A;  4UUV A;  5LHH A;  4L9V A;  5J8F A;  2PJP A;  1FY7 A;  1J2X A;  2HFH A;  3I71 A;  5FB2 A;  3CUO A;  2MH9 A;  3J80 K;  4A2U A;  3V8K A;  3U2R A;  5AIP A;  3E5U A;  2BEO A;  4Q48 A;  3K2Z A;  2A6E F;  4EGZ A;  2OU2 A;  5FD6 A;  3CJN A;  4IPA A;  4RB3 C;  2OQR A;  3T1B A;  1LVA A;  4RGU A;  2W24 A;  1HQC A;  2Y75 A;  3F6O A;  3GF2 A;  4WXH A;  2OQG A;  4R8H A;  3E3V A;  4PCQ A;  1FPQ A;  1PUE E;  3BJA A;  2LNB A;  3HSF A;  4BNC A;  2Z33 A;  3T8T A;  3QU6 A;  4TV7 A;  1YYV A;  1I27 A;  1O7L A;  2PI0 A;  3LWF A;  4EV0 A;  3HTU A;  3IRQ A;  4KFC A;  2GA1 A;  5ILU A;  1SFX A;  4HBL A;  2YR2 A;  4OIP F;  1B59 A;  4EJW A;  5H20 A;  1BI1 A;  2EA4 A;  3ZMV A;  1ZYR F;  4CDG A;  3BOQ A;  4ZZL A;  4PGG A;  1ZLK A;  3E97 A;  2PBI A;  2ZKZ A;  3TGN A;  4XBF A;  2EWN A;  1XSX A;  3ABT A;  3KEQ A;  3KEO A;  2O6G E;  4KNY A;  3RYP A;  3ZP5 A;  1XGO A;  2KJB A;  3MCZ A;  3B02 A;  4AIJ A;  5JHU A;  5K5R A;  4OIO F;  4ESF A;  1Z05 A;  2FNP A;  4BQA A;  4L18 B;  1MDM A;  1YS7 A;  4RGS A;  1XMA A;  3QP6 A;  3W6K B;  4PGH A;  2XVC A;  2PMU A;  4HW0 A;  2KIF A;  1Z7U A;  4U0W A;  1D3Y A;  4XSZ F;  3MZY A;  5LEK A;  3I53 A;  1I5Z A;  1ONV A;  4NHJ A;  4U0V A;  1JHH A;  2F2E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...