3QU6A

Crystal structure of irf-3 dbd free form
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
106
structure length
98
Chain Sequence
KPRILPWLVSQLDLGQLEGVAWVNKSRTRFRIPWKHEDFGIFQAWAEATGAYVPGRDKPDLPTWKRNFRSAMNRKEGLRLAEDRSKDPHDPHKIYEFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of apo IRF-3 and IRF-7 DNA binding domains: effect of loop L1 on DNA binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
molecule keywords IRF3 protein
total genus 26
structure length 98
sequence length 106
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2011-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00605 IRF Interferon regulatory factor transcription factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3qu6A01
3TO6A 4NB5A 4U7BA 4G7HF 4KUMA 4EM1A 3R0JA 4HX8A 2HZTA 2YU3A 4XSXF 3P9IA 5E1ZB 3V7SA 5BQTA 4BQAA 3WTXC 1LQ1A 1IN5A 2K4JA 1FY7A 3H3UA 3J7AO 5AIPA 2UXNA 1UHMA 3GO5A 3KP5A 5HDKA 2XHKA 2QVOA 4FT8A 2EFQA 3D0SA 1QPMA 3DFGA 3GWZA 1WI9A 1FZPB 2L4AA 2PMUA 1KU3A 3I5UA 2FMYA 1R1UA 5FD6A 3LQRA 2AXLA 5E8IA 4UHTA 1T39A 1OMIA 2ZO4A 1ZG1A 3EETA 2FMLA 3IWZA 3RTRA 2QZ8A 2XASA 3H3ZA 1D8JA 3J80Z 4M74A 2X4HA 1FBUA 1MJ9A 2DAOA 4PGGA 1LNWA 4M72A 2R7DA 1BBYA 2STWA 5AONA 5L3DA 2HYFA 2H94A 5JVTA 2OD5A 1BI3A 5K5OA 4HV5A 4H0EA 2XROA 3B02A 3RDIA 2LSOA 3WTVC 1DDNA 2P7CB 4G6QA 1ZG3A 2PEXA 3ZP5A 3BROA 1YW7A 5E18F 2PI0A 5ICGA 1LJ9A 3RKWA 2XRNA 4N0BA 2D2WA 3ZMSA 4IRIA 5BOXA 1BM9A 4MGRA 1REPC 4YFKF 3ZQ7A 3JAMZ 4WXCA 4HDUA 4AIKA 5LHHA 4ZYEA 4FX4A 3M8FA 2BYVE 3I58A 2GAUA 1IN4A 1YTYA 2VONA 4DQ2A 4MTEA 1LB2A 2M45A 3DP7A 4AVPA 1F5TA 3C3WA 3HOSA 1ODDA 3F21A 2L3DA 2ZKZA 2E1NA 3DXJF 5ILSA 3S2WA 3ULQB 3KETA 4IRGA 3N4MA 3DKWA 2L01A 3IRQA 1BI0A 1QO0D 4P55A 4HA8A 1OKRA 2FBKA 5HS9A 3ZN0A 3E6DA 4RB3C 3DEUA 4AD9A 5F64A 4HW0A 3HTSB 1H0MA 4S05A 3F8BA 5HOOA 2UWMA 1XGNA 4LB6B 2Q8KA 2KJCA 1S8NA 3ABUA 2TDXA 1MD0A 1IXRC 4PZJA 1XD7A 2IP2A 1J9IA 1FYMA 3RKXA 2F5FA 3F6OA 4KYWA 4EJVA 5D8LB 4BH9A 4LD5A 5ICEA 3SZPA 3TKYA 4L0YB 2EV5A 2O3FA 2HQNA 4EGZA 3SXYA 3E6MA 2EWNA 1UB9A 1H9GA 3HHGA 3WE2A 1XCBA 1TTYA 2DK5A 1O3QA 1A04A 3GZ5A 3R4KA 1SFXA 2E7XA 2IW5A 1K78B 3CUQC 1Z91A 1KU2A 2WC2A 3CLOA 5K1YA 4Y13A 5LRSA 4U88A 3TO9A 1KYZA 3R60A 2EA2A 4UVCA 3SHFA 3DPTA 4UUVA 3U2RA 3GW2A 1CGPA 4KNYA 3WG9A 2CGPA 3IRRA 4HX4A 2IPQX 2EFPA 3JW4A 3COAC 2JRTA 1P2FA 1Z7UA 1HW5A 2EV0A 2DPDA 3ZPLA 4LK1F 4EV0A 5ICCA 1S7AA 4GYGA 3GUDA 4O6JA 4A0XA 1XCVA 4CHUA 4CICA 4N9IA 2MLKA 4BHBA 4ESFA 2RDPA 5LGTA 4I09A 1FYLA 3WGGA 1G3WA 1FPQA 2BV6A 2NS0A 3TDUC 2M87A 2DTRA 1JHFA 1BN5A 1HSTA 1ZREA 2PQ8A 3TOAA 3BPVA 2HFHA 3K1NA 3LSTA 3CDHA 1J0RA 4ETSA 3QP6A 1P4AA 1ZG5A 3VODA 3KE2A 1KU7A 1W5SA 1EH8A 5HLHA 2Q2EA 3F8NA 2JZYA 1I6XA 2NYXA 1IXCA 1IF1A 3CUQA 3C7JA 1BIAA 1RNLA 4RGXA 2A6HF 2O0YA 4U7DA 1I5ZA 4MEXF 3Q9VA 3WTWC 2ESHA 4M6XA 4I0BA 2YSRA 1Z05A 2A6EF 3JTHA 3KLNA 3MFKA 5TRDA 2X0LA 4M9SA 1W7PA 4O5VA 4PDKA 4M6YA 1FWZA 1W4MA 4FX0A 2PG4A 2Q0OA 1FSHA 2CG4A 3GXOA 1ULYA 4M9XA 1O3RA 2RN7A 5A2QZ 3BDDA 4WXHA 1BC8C 4ZYHA 3VB2A 4KDPA 1O7LA 2HEOA 4L9VA 3RYRA 1CF7B 1TNTA 5LEJA 2G9WA 2A61A 2W57A 1SAXA 2Z33A 4ESBA 3ISPA 2ACJA 1IRGA 4G7OF 4G8XA 5LBQA 2O03A 2DBBA 2HR3A 1T0FA 4LK0F 2FF4A 3JSPA 3O3KA 2G7UA 4A2UA 5CVRA 5FO5A 4ON0A 1K7AA 2QBYB 4GCVA 3SZTA 1PP7U 2QBYA 1T6SA 2YX4A 4G94A 4LLLA 2F2EA 4KN7X 3E3VA 5JR3A 1K78A 4LMYA 3C1DA 3GFMA 5D8KB 3HTUA 4NHJA 3GF2A 1RIOH 3MEXA 2XKOA 3BP8A 3E5UA 1U5TB 5HDGA 4LFUA 2P5LC 5E17F 5DUKA 2GA2A 2XKPA 2K02A 2W24A 4HQEA 3F8FA 1BI2A 1BC7C 1QGPA 1OYIA 1MJBA 3QU3A 2FXAA 4XSZF 4F7ZA 1LEBA 4ZYDA 4BNCA 2EJRA 4YIIA 3R6SA 4XLPF 3BJOA 2F5CA 2W25A 4LGWA 2VC0A 2V9VA 4ESJA 3F72A 1BI1A 3EQLF 4G6DA 5F1RA 2QLZA 3E5QA 4MHGA 1OYWA 2MH9A 1V4RA 2P5KA 3WODF 5D5UB 3PQJA 4RGSA 4WK8F 1F9NA 2VBWA 3GFJA 4AIHA 2DT5A 2R7FA 4NQWA 4L9JA 3GFLA 1S6LA 2D1HA 3BJAA 1O57A 3W6JB 2EA4A 2M1BA 1XSVA 2PLYA 1T2KA 3V7CA 1FSEA 3RPUA 3LFKA 1J75A 4HOBA 1YIOA 2XVCA 4A0ZA 3BZ6A 5LGNA 3GVAA 3VFZA 5EEGA 1G6NA 2H27A 1KA8A 3BWGA 1R58A 2F5EA 2OBPA 3P9KA 1R1TA 3QPTA 1KQ8A 1W7PD 3GFIA 1Y0UA 3L09A 1U8RA 2V1DA 3KP3A 4XLNF 3O6BB 2GXBA 1MDMB 2O6GE 1DPUA 3B73A 2VODA 4KA4A 1Z6RA 1R36A 2XIGA 4I2OA 1ZLJA 3M1EA 4EJTA 2VOPA 4AIJA 4R79A 2V1UA 2HKXA 2OAZA 1S29A 1HQCA 1D8KA 3FF5A 1UHWA 1R00A 1ZHFA 1G3YA 5D5XB 2WWYA 1RZ4A 3HHHA 1R23A 2FSWA 4Q5SF 2VOOA 4XBFA 2YX7A 3ROUA 2GZWA 3QOPA 4EJOA 2IRFG 1XB4A 3MCZA 4OIRF 5D5VB 2VXZA 2COMA 2DLLA 3ERED 2J5OA 3K0LA 2KKOA 1OYYA 3FM3A 4FHTA 5FLXK 4K2EA 1IN7A 5J8FA 4KIBA 3KZYA 3FXUA 5ILUA 3VOEA 2XAFA 1HW1A 4GGGA 5E8GA 1SMTA 5KK1A 3T0YA 2V1XA 3T8RA 2B0LA 1J7KA 2K86A 2L02A 3T8TA 4MQ9F 3JTGA 2DO7A 1RI7A 5A2QK 1IN8A 1Z6TA 2VN2A 3WU0A 3T5XA 2Y0MA 2ZNYA 2W84A 3V7RA 1ZRDA 1JGSA 2BBYA 3R61A 3F8CA 3RI4A 3K69A 3TDZC 2P5VA 2YPRA 4P9UA 1U6GA 5DDGA 3CUQB 1FC3A 4HBLA 4P5OA 1HBXG 5H20A 1U2WA 1MDMA 4EVIA 2PN6A 2WV0A 3HRUA 1SD6A 4OINF 5JI6A 3NRVA 5D5WB 3KZZA 3KCCA 4KFCA 2OZ6A 2MBFA 5BMZA 4O3MA 1B6AA 1VTNC 1O3SA 3I4PA 2ZFWA 4MTDA 2H6CA 2V6CA 5LEKA 1HKSA 4L9TA 2FNAA 1LDKB 3MZHA 3TO7A 4ZYGA 3HSRA 4RAYA 1B4AA 1P6RA 1XMKA 2MA3A 3OV8A 2WTEA 3P7NA 1MGTA 3DF8A 3H92A 2HTJA 1J59A 1USTA 4KN4X 3SQNA 2XAGA 4RB2C 3LA7A 1PUEE 1AWCA 3U1DA 2RC4A 2VT2A 1WRJA 4ASNA 4QLCU 2PFBA 3FM5A 4I98B 4UVBA 2QQ9A 1IW7F 5L3CA 2XAQA 1KQ0A 3I53A 2ESNA 4JK1X 1S3JA 3REOA 4HX7A 1YLFA 2FBHA 4OIQF 1XGOA 3NEUA 4YFNF 1UCRA 3DV8A 5L3BA 4AWXB 2LF7A 2VT3A 5IT9Z 1I27A 2C6YA 5FGMA 3WTUC 2EFNA 3MWMA 1ZH5A 2ISZA 4RB1A 1J2XA 4CDGA 2OA4A 2DQLA 4P96A 4R8HA 5JHUA 4YIFA 4BYYA 1FOKA 5AIQA 1GXQA 4PCQA 3TGNA 4Q48A 4BXUA 2YR2A 2IA0A 2F5DA 1HW2A 2CFXA 4L18B 5IT9K 4RGUA 4IHSA 5FLXZ 1TQMA 4GXOA 3E6BA 4RAZA 1ONVA 4KICA 1ZRCA 5E1XA 2KIUA 2O61A 3I64A 3ZMVA 1CF7A 3PFIA 2ADUA 1TW3A 4UNOA 4KMUX 1HSJA 3G3ZA 4I01A 2LDUA 1XSDA 2CWEA 1XDSA 3SFZA 3CO7C 3IKVA 4HDVA 1FNNA 1QZYA 1B59A 1FYKA 1WWXA 1TQIA 5E20A 5ICFA 3WTYC 1DUXC 3R0AA 5JFRA 3IHUA 4EM2A 1LEAA 3RYPA 2RNJA 2AS5F 3E97A 3I0TA 1W5TA 2QENA 2ELHA 5EEHA 2LNBA 4ENJA 4L5IA 2BE5F 2HOEA 3ZN1A 1SD7A 2M30A 4WXDA 3GZ6A 1KQ9A 3RJPA 4A5NA 5DCMA 1C0WA 5DV5A 3CO6C 1P4XA 3G73A 4BHCA 2XV4S 3BOQA 3CUOA 4E70A 3L2CA 3ELKA 5LGUA 3T1BA 1B9MA 2XGXA 4IRHA 2VE8A 4U0VA 2DW4A 5D4RA 1WQ2A 2JPCA 2HQRA 1FLIA 2L4MA 1Q1HA 4MEYF 3QRFF 3J80K 2FA5A 1R7JA 3CTAA 3I71A 1RUOA 1ZN2A 2FQ3A 2UXXA 2LKPA 3FZVA 1SD5A 4LJZF 2FOKA 2BGCA 1JXSA 3HOTA 3C18A 4OMZA 4XRFA 1ZLKA 2DQRA 2G7HA 2QWWA 2EB7A 2K27A 3WGHA 3DPLC 4HF2A 1LDJA 6PAXA 5ED4A 3KEQA 2CW0F 2M5WA 4EQQA 2STTA 3EUHA 4HLYA 2QUFA 3E5XA 4IXAA 2NNNA 3D5LA 2GXGA 3GYHX 4B09A 5DEQA 3FMSA 4OU0A 2A68F 2D45A 3ML6A 5ERIA 1ZARA 4ZH4F 1IUYA 5CVVA 4CYDA 4N9HA 3N97A 3V8JA 2MH2A 3EYIA 3F23A 4HYEA 1I1SA 4EM0B 2EK5A 1FX7A 2QYOA 2MD5A 5BS6A 1IXSB 3F3XA 4PGHA 4HQMA 1F4KA 3L00A 5HLGA 2W85A 1D3YA 5DCMB 4S04A 2FEZA 3ECOA 1FP2A 4CGZA 2CQKA 2KIFA 1U5TC 5TJJA 4LB5A 4A5MA 2DU9A 5DCFA 2ZNZA 2XAHA 1P92A 1KGSA 4M71A 4WWCA 4A0YA 3HSFA 2GWRA 4U0WA 3FXQA 5CVIA 4WCGA 4L0ZB 2IA2A 1RUNA 5IT3A 2V79A 1EH7A 3EDPA 1G3TA 4HF1A 3V8KA 4GO1A 1SFUA 1YQAA 1R5GA 3K1PA 2H09A 3LWFA 1YG2A 2RGVA 1MZBA 2L54A 2QM3A 4EMSA 3M8EA 3L9FA 5CVJA 3J81K 2IVMA 4ZZLA 2NRAC 2HWVA 5L3GA 2LF8A 4LLGF 3RPQA 3W6KB 2GQQA 3V4GA 2JT1A 4OMYA 3FX3A 2O8XA 2K4BA 3LQQA 2Y75A 1SFEA 5CVUA 3IC7A 3P9CA 1ZGAA 2CYYA 1QNTA 2JPBA 2VBYA 4R1HA 4UXNA 1OPCA 1D5VA 3IKTA 1GVJA 5K5RA 4JQFA 2OU2A 4KIGA 2HYGD 1FP1D 4HLXA 2MC3A 1K6OA 2FE3A 2M8EA 2EV6A 1B9NA 1PP8F 3HSEA 2PMHA 3HRSA 2D1VA 1S7OA 2Z9OA 1GHCA 4Y17A 2OQGA 1T38A 5J8CA 4WX9A 2E1CA 4Q4ZF 4LG0A 1AOYA 5L3EA 4HAMA 2P8TA 5F6FA 1EH6A 1O3TA 3KP4A 3I59B 3L7WA 3E6CC 2P6TA 2ZCWA 1YS6A 2RVCA 2ZJ2A 4DNCA 4UV8A 4ENNA 2Z99A 3Q5FA 4QWQA 2JSCA 1GXPA 3RIRA 4I0AA 1R22A 4I7HA 4YG2F 4OIOF 3QP5A 1YYVA 2ISYA 3IWFA 2CO5A 2K7LA 3ECHA 1BJAA 2XUBA 4IF4A 4B8XA 4HV6A 3BJ6A 3WTTC 1IRFA 3NQOA 1FT9A 3QU6A 3MQ0A 4IPAA 1PDNC 2A07F 4RB0A 4CXFA 2P7VB 4D0PA 1B1BA 1YS7A 1XSXA 2A5YB 3M9AA 2A69F 2HS5A 2Z5UA 3GX4X 3KP7A 3KEOA 1HXDA 2QQBA 5LHGA 3CJNA 2OQRA 3WGIA 2ZBKA 4EJWA 2JTVA 5CJ9A 3F6VA 2GIVA 1FBQA 2R3SA 5LHIA 2IT0A 4MQVA 4LG0B 1ZRFA 5L3FA 2DPUA 4Q47A 3I59A 5CYVA 2Y48A 3J81Z 3GLXA 3BY6A 4KT5C 5LLQA 5FB2A 2Z3YA 1G4DA 4A6EA 1KU9A 1XDUA 2ETHA 5H6QA 1V3FA 1G3SA 3HYIA 4TV7A 4CZZA 1SD4A 2J5PA 2QQAA 4HZFA 1K79A 4RGRA 5DD8A 4L5JA 4GYIA 4L9NA 3HRTA 5ILVA 1F1ZA 3LA3A 4ENKA 2OZUA 2E7WA 2HKOA 4G7ZF 1TQPA 5H6RA 5HVQC 4Z2YA 5D4SA 1ZYRF 5BPDA 3Q9SA 5E1WA 3ZMZA 3JSOA 1BOAA 1ON1A 1BIBA 1STZA 2RQPA 3K2ZA 3HIFA 3K1MA 1JHHA 1SMYF 2FNPA 4MNUA 1J5YA 4ENMA 3KLOA 5KVRA 1KYWA 1TBXA 1L0OC 2KRFA 1JE8A 2RKHA 2DI3A 3ABTA 2PJPA 3KP6A 3HRMA 3MZYA 2FU4A 3I54A 4BAYA 3GEZA 4JBAA 3TQNA 3LA2A 1XGSA 5D6FA 1YFHA 2ZXJA 2EFWA 1MJAA 5DD4A 1NHAA 3VEPA 1I1GA 3FMRA 5LRRA 4U0YA 2NNYA 1R1VA 3LAJA 1XN7A 3DQVC 4M9ZA 1E17A 1X3UA 2DFIA 2VBXA 4HF0A 5HLIA 2ZMEB 2P4WA 4UVAA 3WTZA 3PQKA 4WF2A 3IL2A 3JAMK 3ZMDA 2P6SA 1TW2A 1ZGJA 4BHPA 3WE3A 5HS8A 2IA1A 3BPXA 4RS8A 2HTSA 4IVNA 1XGMA 2XAJA 1ON2A 3LAPA 1E2XA 5FFXA 1USSA 1Z9CA 4YFXF 5HS7A 1TNSA 3QAHA 5FFZA 4CO8A 3WU1B 3OOPA 3WTSC 1MKMA 1YW9A 3HUGA 1QQIA 1YW8A 4KMFA 3RKYA 5DUIA 3MAJA 3ZMTA 1IZ1A 1HKQA 4I02A 3F22A 3KFWX 2MLGA 1QZZA 3EYYA 4IHTA 3KP2A 1U78A 1LVAA 1ZAOA 5K5QA 1T98A 3FHZA 1H9TA 1WSUA 2BEOA 1IN6A 1W7PB 4IJAA 2HGCA 5D6EA 3FWEA 5J6XA 1EV7A 4EGYA 5BPIA 1WKMA 2ZMEA 2H6BA 1P4WA 4P9FA 4M73A 4A6DA 1L3LA 2UZKA 1HKTA 3ZMUA 5HDNA 3K9TA 2FRHA 1Z1DA 4LLNA 3QPHA 1O7FA 3M7GA 4UV9A 5CLSA 2PBIA 3F8MA 2VE9A 4ZZDA 2NAZA 2IJLA 4OIPF 3FMQA 1LDDA 4Y15A 3FXRA 2CSOA 4OOIA 1QBJA 3U9GA 3O2PE 1TLHB 2EFOA 4A12A 1IAWA 5DYMA 5FD5A 4G9YA 2HDCA 1XMAA 2RV8A 2VBZA 2VC1A 3TOBA 2KIMA 1UFMA 4EJUA 1U3EM 2FBIA 1DP7P 3AAFA 3V8LA 1R5HA 2KJBA 4KIFA 1YO5C 1OR7A 2GA1A 1FBSA 2DK8A 1U5TA 1DPRA 2A3SA
chains in the Genus database with same CATH superfamily
3MZ8A 4XONA 4AYBA 3TO6A 4NB5A 4U7BA 3BG5A 5TISC 3HC7A 2JWTA 4KUMA 4YIRX 4G7HF 4Y7NJ 4EM1A 3R0JA 4AUXA 4HX8A 5IY5H 1A31A 4JP0A 1R4MB 3FBNB 2HZTA 1VFCA 2YU3A 2W82A 2FUG2 4XSXF 5B5EC 4E6KG 3HUGB 3P9IA 5E1ZB 3TW6A 3V7SA 5BQTA 4BQAA 3WTXC 1LQ1A 1IN5A 2K4JA 3L2QA 4A3LJ 1XG1A 1FY7A 3H3UA 5EGOB 4MFEA 4NC6A 3J7AO 5AIPA 2UXNA 1UHMA 3BR1A 4RAFA 4F93B 3GO5A 3KP5A 5HDKA 4BJTA 3OYCA 2H8WA 2XHKA 2QVOA 4FT8A 4D5CA 4BQQA 2EFQA 3D0SA 4KT6A 1QPMA 2M8GX 2XF6A 3DFGA 3GWZA 5HNHA 1UG0A 1OCCH 2A6TA 1WI9A 3SFIA 4LOCA 2L4AA 1FZPB 2PMUA 1KU3A 3F9KA 3CESA 2LK2A 2QA4I 3L2VA 1Y56A 3I5UA 2FMYA 1R1UA 1U9OA 5FD6A 3LQRA 1Y1VJ 2QQ8A 2AXLA 1D0YA 5E8IA 3CMAI 3M07A 3ZQGA 2Y9ZA 1OLTA 5GAEJ 3MKWB 4UHTA 1T39A 2R7XA 1OMIA 3DTIA 2ZO4A 2DMUA 2QSHX 1ZG1A 3EETA 2FMLA 3CCLI 3IWZA 3RTRA 2QZ8A 4IQJA 2XASA 3PFYA 2GXAA 3H3ZA 1GUUA 3PUFA 3QQAA 1D8JA 3J80Z 2K9SA 3H1CA 2X4HA 1FBUA 1MJ9A 4M74A 4CH7A 4XOPA 2DAOA 2EINH 4PJ0C 1DQUA 4PGGA 1LNWA 2YUSA 4M72A 1IV6A 1SVOA 1ORKA 2DYRH 2R7DA 3S3OA 1BBYA 1IDYA 2CV2A 2QSFX 2STWA 5AONA 5L3DA 2HYFA 2VLAA 2H94A 5JVTA 2OD5A 2LYCA 1YITI 1BI3A 5K5OA 4HV5A 4H0EA 3BR6A 2XROA 1SEUA 3B02A 4JYKA 3RDIA 2LSOA 3WTVC 1DDNA 2P7CB 3OYAA 4G6QA 4XRSA 3K4KA 1ZG3A 2PEXA 3ZP5A 3BROA 2B63J 1YW7A 5E18F 1MBGA 2K5CA 2PI0A 3FISA 5ICGA 5B3SH 2ZXIA 1LJ9A 3RKWA 2FJ1A 2XRNA 4N0BA 2VJ5A 5HODA 2D2WA 3ZMSA 4IRIA 3H0GJ 1EA3A 1I3AA 2LP0A 5BOXA 1BM9A 4MGRA 1RKTA 2E1OA 1REPC 2Q2EB 2Y30A 4YFKF 3CLQA 3ZQ7A 2NOJB 4J01A 3JAMZ 1BR2A 3CJQB 4I76A 4WXCA 2JVGA 4HDUA 5LHHA 4AIKA 4ZYEA 4FX4A 3M8FA 2BYVE 3ZGKA 4FE7A 5E79C 1JJ6C 2CH0A 3I58A 1P7JA 2GAUA 1IN4A 2KIQA 4A3JJ 1YTYA 2VONA 1FTZA 4NBQA 2VQCA 4GRIA 4DQ2A 4MTEA 1LB2A 2M45A 3DP7A 5DTDA 5EJCA 4RA2A 2HPIA 4AVPA 2X1DA 1F5TA 3C3WA 3CC7I 3HOSA 1ODDA 3F21A 2L3DA 2ZKZA 2E1NA 3DXJF 1MIJA 5ILSA 3S2WA 3ULQB 2DXIA 4XRSG 3KETA 3DLLF 3NARA 4IRGA 3N4MA 1WJAA 3ZQQA 3DKWA 2X6WA 2L01A 3IRQA 1BI0A 1QO0D 1WJFA 4IHWA 4P55A 4HA8A 1OKRA 2IS6A 2FBKA 5HS9A 3ZN0A 3E6DA 4RB3C 3DEUA 4ABZA 4AD9A 5F64A 2EZKA 4HW0A 2NS8A 2YU9J 3K2AA 3HTSB 1H0MA 4S05A 3LL7A 3F8BA 5HOOA 2W7NA 4M3DA 3RPUD 3HGYA 3K70D 5M5YJ 2UWMA 2JUCA 1XGNA 2DJNA 3DBHB 4L5EA 4LB6B 2CS3A 1BOBA 2Q8KA 2KJCA 1UZCA 1S8NA 3ABUA 1D1CA 3FK7A 3M4OJ 2TDXA 1MD0A 4E7JA 2IS4A 1IXRC 4U87A 2ZB9A 4PZJA 1XD7A 2IP2A 4XORA 3E0JB 2DDBA 1J9IA 2ID3A 1FYMA 2L0KA 3VYRB 4DIQA 3RKXA 4M3EA 2F5FA 3F6OA 1FOWA 4HNVA 1YRNA 4KYWA 2XF7A 2EIMH 2BVMA 4EJVA 5D8LB 4BH9A 4LD5A 5ICEA 2CQ7A 1X19A 2Y0SA 3SZPA 5DM6F 3TKYA 4L0YB 3W2VA 5IYCJ 2EV5A 5J4YA 2OTLI 3JRHA 2O3FA 5K7ZA 1YJNI 2HQNA 2HYJA 4EGZA 1JKRC 1QPIA 3SXYA 3E6MA 3BLYA 1ZK8A 2EWNA 1UB9A 4IKFA 5GPAA 1H9GA 2COBA 5IYBJ 3I4NJ 3HHGA 3VYTB 3WE2A 3PIOF 1XCBA 2L7ZA 1K4TA 1TTYA 3SDGA 2DK5A 4BE2A 3E1SA 1O3QA 2DA3A 1A04A 3CMYA 3HDDA 3GZ5A 2Z1DA 1MNMC 3R4KA 2CRGA 2W1OA 1SFXA 2E7XA 3FHNA 2IW5A 3FBIB 2XPVA 1K78B 3CUQC 2WV1A 3ABMH 4CCNA 4BQNA 3OYDA 1U0JA 1Z91A 1KU2A 2M7BA 2WC2A 3DU6A 3CLOA 2VKDA 2R5ZA 5K1YA 4Y13A 4BACA 2DT6A 5LRSA 2X6OA 1S72I 2EILH 4ZYAA 4U88A 3TO9A 1KYZA 1S9HA 3R60A 2EA2A 4UVCA 3SHFA 4AIDA 3DPTA 1MBHA 4UUVA 5TGTA 3U2RA 3GW2A 3S1NJ 3FXKA 1CGPA 4E7KA 4KNYA 5F0CA 2DA6A 3WG9A 1MMGA 2CGPA 3IRRA 4HX4A 3JRBA 1S7EA 3EUHC 2IPQX 2KP6A 1IJWC 2EFPA 1OFCX 1JUSA 3J7ZI 3JW4A 3COAC 2JRTA 1P2FA 1Z7UA 3DBLB 4C2MJ 4BS9A 3RSNA 3CCJI 1HW5A 2EV0A 2PX9A 2JQ7A 2VASA 4IHVA 3HM5A 4XQFA 2DPDA 1FEXA 1BJZA 2BXZA 3ZPLA 4LK1F 4EV0A 5ICCA 1NTCA 1UELB 1S7AA 4GYGA 4P1WA 3IH4A 2ME6A 4NDLA 1N25A 3GUDA 4O6JA 4A0XA 1XCVA 4CHUA 4CICA 5FKMA 4N9IA 2MLKA 1MSEC 5E3NA 4BHBA 4ESFA 3OOUA 3K6GA 2RDPA 5LGTA 4I09A 1LE8B 1FYLA 3O8GA 3WGGA 3L2RA 1G3WA 4MIMA 1FPQA 1R49A 4A3KJ 3X2QH 2BV6A 2E5ZA 2EIKH 2M3AA 2NS0A 3IP4B 5M3MJ 3TDUC 1OCTC 2DYSH 2M87A 2DTRA 1JHFA 1BN5A 4DZJA 3HL2A 1Z3YA 2G0EA 4A69C 2L9NA 1HSTA 1ZREA 2PQ8A 3TOAA 3BPVA 2VPLA 2HFHA 3K1NA 2NS7A 5IP9J 3LSTA 3CDHA 4XN0A 1J0RA 4ETSA 1HCRA 3QP6A 1R9TJ 1P4AA 1ZG5A 3VODA 3KE2A 2DA4A 1W0TA 2MG4A 1KU7A 1W5SA 1EH8A 2JA5J 5K7FA 1ITYA 5HLHA 1XPXA 3PJRA 3HJEA 5E3OA 2Q2EA 3F8NA 2JZYA 2W00A 2E19A 1SFOJ 2R5ZB 3FXJA 3HPGA 1YJWI 1I6XA 2NYXA 1M1EB 2DFEA 1IXCA 1IF1A 3CUQA 3C7JA 1BIAA 1RNLA 4RGXA 1H88C 1IV8A 3IAM2 2A6HF 2O0YA 1T33A 3M3YJ 4U7DA 1I5ZA 1VQ7I 2E60A 2ZXHA 4MEXF 2JA6J 3Q9VA 3S17J 3WTWC 5FJ8J 2ESHA 2Q1ZB 3ZCOA 4LIUA 4M6XA 4FASD 4IOCF 2LMDA 4I0BA 2YSRA 1Z05A 2A6EF 3JTHA 3K4NA 3KLNA 3MFKA 5TRDA 2GBYA 4KITB 4G12A 3G4SI 2X0LA 4M9SA 1W7PA 4O5VA 1TWCJ 4PDKA 1VZ0A 4M6YA 1DU0A 2NVXJ 1FWZA 2IBDA 1LPQA 1W4MA 4FX0A 2PG4A 2Q0OA 1FSHA 2CG4A 3CZ6A 3GXOA 1ULYA 4IEJA 2L2OA 2FQ4A 4M9XA 4DOZA 5C44J 3OS0A 4C2UA 1O3RA 2RN7A 1X3WB 5A2QZ 3BDDA 4WXHA 5IOYA 1BC8C 2GIZA 4ZYHA 2MGQA 1FIAA 2O7OA 3VB2A 4KDPA 4GDFA 3DU5A 1DP3A 3BR2A 1O7LA 3B6AA 4W97A 2HEOA 3CC4I 2F6CA 4L9VA 3RYRA 1SVLA 4E7IA 1TNTA 1CF7B 4IQ4A 5LEJA 1SAUA 2G9WA 2A61A 2W57A 4DYRA 1SAXA 2HPMA 2Z33A 4ESBA 4PK4A 4OAZA 4UUTA 4CUGA 1QVUA 3ISPA 4HSTA 4RLQA 4FCYA 2ACJA 1WI3A 4Y4RA 4JX6A 2KFDA 4G7OF 1IRGA 4G8XA 5LBQA 2O03A 5JLWA 2F4IA 3CCEI 4BL0B 3H5RA 3JRGA 2DBBA 3U1KA 2HR3A 1T0FA 4FTHA 4LK0F 4ZJZA 2FF4A 2EBIA 1VQ8I 1HA8A 2OUMA 3JSPA 3O3KA 1LUJB 2G7UA 4D7NA 4A2UA 2VL8A 3BQYA 5CVRA 5HNFA 3PM1A 5FO5A 3VYSB 4ON0A 1V55H 3Q0VA 1RKWA 3MKYB 3I4MJ 2OCCH 3SJMA 3UR3C 1YHQI 2HDDA 1K7AA 1WPKA 1IUFA 4XKBA 2QBYB 4GCVA 3SZTA 3K4CA 1PP7U 2QBYA 1T6SA 2X6XA 2UUZA 1T95A 2YX4A 2XPWA 4G94A 4LLLA 5FROA 1MH3A 2F2EA 4KN7X 2QKMB 3E3VA 5JR3A 1K78A 4LMYA 3ASNH 3C1DA 3GFMA 5D8KB 3HTUA 4NHJA 3GF2A 1RIOH 2BHYA 3MEXA 2XKOA 3BP8A 3GTKJ 3E5UA 4CA0A 2R7RA 4E7LA 1U5TB 5HDGA 3I9V2 3A1YA 4LFUA 2P5LC 4B44A 5E17F 1IRXA 5DUKA 3OSFA 1RRJA 5C4XJ 2F4OB 2GA2A 1Y6IA 3KIOA 3UNGC 2Y0SN 2XKPA 3KX2A 4W1UA 2K02A 2W24A 4HQEA 3F8FA 1BR4A 1BI2A 1BC7C 2X1EA 1QGPA 2VB6A 1OYIA 1MJBA 3QU3A 2FXAA 2IAIA 4XSZF 4F7ZA 1LEBA 4ZYDA 4BNCA 3CJRB 5IPAA 2EJRA 2XSDC 4YIIA 3OS2A 3K10A 2EZLA 2LY9A 1FTTA 2CV1A 3R6SA 4XLPF 3BJOA 2E2JJ 3RZOJ 2F5CA 2W25A 2M0CA 1D1BA 2DN0A 4LGWA 3TMOA 2VC0A 2V9VA 4X0GA 4ESJA 3F72A 3PSIA 1OCOH 1BI1A 1MMAA 2JRMA 3EQLF 5IOZA 2IEKA 2VXDA 4G6DA 3BTCA 3VSKA 2M9HA 5F1RA 2QLZA 2QF7A 3E5QA 3OYBA 4MHGA 4II2A 1OYWA 2VKEA 2MH9A 3H5NA 1V4RA 2P5KA 3WODF 5D5UB 3PQJA 1PUFA 2LR8A 4RGSA 4WK8F 1F9NA 4IO9F 2VBWA 1VQ6I 4PJJA 3GFJA 4AIHA 2DT5A 2R7FA 4NQWA 2PMZA 3K70C 4IHYA 4L9JA 3GFLA 1A5JA 1S6LA 3H9GA 2D1HA 3BJAA 1O57A 2M4GA 3W6JB 1PYVA 2EA4A 2M1BA 1XSVA 5CQEA 2PLYA 1T2KA 3V7CA 2V26A 2BY3A 1RPWA 1FSEA 2ZXWH 3RPUA 4X6AJ 4Y33A 3LFKA 1J75A 2KISA 1H89C 1GV2A 4HOBA 1YIOA 3QYFA 2JUGA 4BBSJ 2XVCA 4A0ZA 1IO2A 3BZ6A 3HBLA 3MVPA 5LGNA 3GVAA 2ELKA 3CCYA 1LE8A 3VFZA 3MKLA 2V6EA 5EEGA 4E7ZA 1G6NA 2H27A 1KA8A 3BWGA 1R58A 3G1MA 2F5EA 3GTGJ 2OBPA 3K4MA 3P9KA 1R1TA 3QPTA 1JTXA 1KQ8A 1W7PD 1J09A 3GFIA 1Y0UA 3L09A 1U8RA 2DCEA 3PSFA 2V1DA 3KP3A 2LBFA 4B48A 2E1MB 4LITA 4XLNF 2XSJC 1EKEA 3KEYA 4KJZA 1OR7C 2DOAA 3O6BB 2GXBA 1ETQA 2JVHA 1UMQA 1MDMB 3ZR8X 4RLFA 2O6GE 1DPUA 2DFHA 3B73A 3LSKA 2DDAA 4RM3A 4BEHB 3CP2A 2VODA 2IGKA 4A3MJ 2LC2A 1FMWA 4BU2A 2WY7Q 3RKQA 1TWHJ 1ZR4A 4KA4A 1Z6RA 2R7VA 1R36A 4IX7A 2OV7A 5J1UA 2BHZA 2M0MA 2PMZN 2XIGA 2XF5A 4I2OA 1ZLJA 3M1EA 5GTIC 4EJTA 2VOPA 4AIJA 4R79A 2V1UA 2HKXA 1P9QC 2NVYJ 5J4VA 2OAZA 1S29A 4B4CA 1HQCA 1D8KA 3QYEA 2LFBA 3FF5A 3OYMA 2CUZA 2VUMJ 2WB1N 3LSRA 1R5ID 1G2HA 2HDWA 1UHWA 1R00A 1ZHFA 1G3YA 3PNVA 5D5XB 2WWYA 1RZ4A 3HHHA 1R23A 2FSWA 4Q5SF 2DA7A 2VOOA 3RQIA 4XBFA 2YX7A 3ROUA 2LY1A 2GZWA 2Y2ZA 3QOPA 4EJOA 1ZTRA 3FDYA 2IRFG 2M34A 1XB4A 3LSJA 1MNDA 2AO9A 2KLOA 5GTHC 1X2NA 1W1WE 1FOXA 3MCZA 2K40A 4OIRF 5D5VB 2EIJH 3M1CA 2VXZA 5EGOA 1WCMJ 5FLMJ 2COMA 3HKZN 2E5NA 4BBRJ 2DLLA 3ERED 2J5OA 3K0LA 2KKOA 3V42A 3HOXJ 1OYYA 2ECCA 3FM3A 4FHTA 5FLXK 4K2EA 3QPSA 1IN7A 5J8FA 4CSWA 2B9SA 2I10A 4KIBA 2ZJPF 2LTPA 1E0EA 4V19K 3KZYA 3FXUA 5ILUA 3VOEA 1PUFB 2XAFA 1HW1A 4GGGA 5E8GA 1JUPA 1SMTA 5KK1A 2HOSA 4Y52J 3T0YA 1OQYA 2V1XA 1K4SA 3L2WA 2R7QA 3A03A 1YRNB 4NQWB 1OCRH 3T8RA 2B0LA 1J7KA 4QPOA 2K86A 3WHCA 1VQLI 2L02A 3T8TA 2KPMA 2LY2A 4MQ9F 1EJ9A 3JTGA 1ZR2A 1FIPA 2DO7A 5J40A 2X6YA 1RI7A 5A2QK 2F48A 1IN8A 3SZGA 2R93J 1Z6TA 2VN2A 3WU0A 3T5XA 3KYDB 1GV5A 2BW3A 2Y0MA 2ZNYA 3KPHA 2QCOA 2W84A 3B6CA 3BG6A 3A4CA 3HOUJ 3KZIC 3ZXSA 2IGOA 3CDLA 1GLNA 3V7RA 2W48A 3VWBA 1ZRDA 1JGSA 2JA7J 5E3MA 2BBYA 4MLOA 4ZDOA 3R61A 3F8CA 3RI4A 4HSRA 2E2IJ 3K69A 4NNJA 3TDZC 2P5VA 3OR2C 2OJED 1AHDP 2Y31A 5EF6A 1X4PA 2YPRA 3BG9A 4DYQA 4P9UA 1T8IA 3HG9A 5GP9A 1U6GA 3W2WA 5DDGA 3CUQB 1FC3A 4HBLA 4P5OA 1B72B 2K9QA 1ETYA 5H20A 1RESA 4D5FA 5GAGJ 1U2WA 1HBXG 4BXXJ 3G1OA 4AC0A 5GADJ 5EYRA 2CQNA 1MDMA 4CCMA 4EVIA 2PN6A 2WV0A 2YS9A 3HRUA 2Y9YA 1SD6A 4OINF 5JI6A 2DMQA 1Z21A 3NRVA 3KZZA 5D5WB 3KCCA 3HEFA 3PNTA 3FK6A 1VQOI 3F0CA 4UB6C 4KFCA 2BY0A 3BR3A 2OZ6A 2MBFA 5BMZA 4O3MA 1B6AA 1VTNC 1O3SA 3I4PA 3AFHA 2ZFWA 2E2HJ 4MTDA 2H6CA 2V6CA 5LEKA 1HKSA 2A5WA 4L9TA 2FNAA 1LDKB 3MZHA 5K7HA 2MW8A 3TO7A 4ZYGA 2L5QA 2HQ5A 3HSRA 4RAYA 4RMNA 2BY2A 3A01B 3QWLA 1K61A 1E3OC 3C2BA 4XLFA 4A93J 3A02A 3I3LA 2R7OA 1B4AA 3JRIA 2V9KA 2BXYA 2WAFA 1P6RA 1XMKA 2MA3A 3OV8A 2WTEA 3P7NA 1MGTA 3DF8A 3H92A 2HTJA 2MC4A 3H9JA 1J59A 3W2AA 1USTA 4KN4X 3SQNA 2XAGA 4Z6YA 2PJRB 1LVKA 3OY9A 4RB2C 2IGMA 3LA7A 3PL8A 1PUEE 3CF2A 1AWCA 1JKPC 1JUMA 2Z2SB 1QHGA 2LBFB 3U1DA 2RC4A 2F4MB 3OL4A 4Y3OA 3RZDJ 2VT2A 1VQ5I 1WRJA 4ASNA 4QLCU 2PFBA 3FM5A 4I98B 4NC8A 3FXMA 4UVBA 1KZHA 2QQ9A 3OYFA 3DTKA 1IW7F 5L3CA 2HNHA 2XAQA 5BNGA 1KQ0A 3I53A 1OISA 1JT0A 2ESNA 4BEHA 4JK1X 1S3JA 3REOA 4HX7A 5KAIC 1YLFA 2FBHA 4OIQF 1XGOA 3NEUA 4YFNF 1UCRA 3DV8A 5L3BA 4AWXB 2LF7A 4LG3A 1WVRA 5IP6A 2VT3A 1IC8A 5IT9Z 1I27A 5CKTA 4DBRA 2C6YA 5FGMA 2K9LA 3WTUC 4IOAF 1DGWY 3TP0A 2EFNA 3MWMA 1VQMI 1MNEA 2ISZA 1ZH5A 4RB1A 1QZEA 3OL3A 4DJAA 1XX5A 2WA0A 1J2XA 4HNUA 3OYGA 2VJ4A 4CDGA 2OA4A 4RAGA 2DQLA 4P96A 4BY1J 2DA5A 4R8HA 5JHUA 4YIFA 3CC2I 4BYYA 3OYNA 2WAEA 1Z7LA 2E1MC 1FOKA 5AIQA 1GXQA 4PCQA 1BW5A 3TGNA 4Q48A 2HQAA 4BXUA 1MBEA 3GMEA 4YEJA 1I50J 2YR2A 2IA0A 2F5DA 1V5EA 3SDBA 2OC6A 5J1RA 3BQZA 3GLLA 3VPRA 3DBRB 1FOYA 2KDOA 5FKKA 1HW2A 2CFXA 4L18B 4FQGA 4RGUA 5IT9K 2CUFA 2E36A 2BZTA 3IH2A 4IHSA 5FLXZ 2L9SA 1TQMA 4GXOA 3E6BA 4RAZA 4BXFA 1ONVA 4KICA 3TBIA 3ZQLA 1D0ZA 1S5LC 2XGCA 1ZRCA 3Q0UA 5E1XA 2KIUA 2O61A 1HF0A 3I64A 3ZMVA 2RAEA 1CF7A 3PFIA 2ADUA 1TW3A 3FXLA 4UNOA 4KMUX 1HSJA 3G3ZA 1B72A 3OIOA 5FKNA 4I01A 2LDUA 3GTQJ 3CCQI 1XSDA 2CWEA 1KONA 1XDSA 2BOLA 2ECBA 2WB1A 3QPLA 4OAYA 3SFZA 3CO7C 1GT0C 4PJNA 4IHXA 3IKVA 4HDVA 3ZQFA 1FNNA 2GOMA 5B1AH 1AA7A 4IZZA 2LREA 3OYJA 1QZYA 1B59A 1FYKA 2XRLA 2JJ7A 4XM3A 4M3FA 1WWXA 1TQIA 4JX5A 5E20A 5ICFA 2VJJA 3WTYC 2X1CA 4PSXA 1DUXC 3R0AA 2ZSHB 3DEWA 3CCVI 5JFRA 4EATA 2QKLB 3IHUA 4EM2A 1MBKA 1LEAA 1X1AA 2RNJA 2XAUA 1UHSA 3RYPA 2KZGA 1QA6A 4S0HB 2AS5F 3E97A 3I0TA 3QODA 1W5TA 2QENA 3S8PA 3Q3SA 2V7FA 2ELHA 3OYIA 5EEHA 2LNBA 3HKZA 2F5VA 3PIPF 4ENJA 3LSMA 4L5IA 2BE5F 2HOEA 3ZN1A 1SD7A 1XS9A 2M30A 4WXDA 3GZ6A 1KQ9A 3RJPA 2OCEA 2A05A 3JRDA 4A5NA 2JN6A 2M7AA 2EPFA 5DCMA 4C3JJ 2MSYA 1C0WA 3HB9A 4HG2A 1ZKGA 2CQXA 5DV5A 3H36A 1P4XA 4B3AA 3G73A 4BHCA 3CO6C 4CYCA 1JGGA 2XV4S 3BOQA 4RBOA 3K7AJ 3K4JA 5FKLA 3CUOA 3DTEA 1GDTA 4JOMA 5CQGA 4E70A 4BE1A 3MD2A 4RDUA 3L2CA 1JJ8C 2ZJRF 2NVTJ 3ELKA 4I99C 3HOVJ 5LGUA 3T1BA 2VQHA 1X4OA 1B9MA 1F43A 4ZTJA 2XGXA 4IRHA 1LFUP 2VE8A 4U0VA 1W5CC 4XN3A 2DW4A 2K85A 4B3XA 5D4RA 2CUJA 1WQ2A 2JPCA 3ESWB 2LKSA 3L1PA 2CUEA 2HQRA 3HPHA 1FLIA 2L4MA 1Z67A 4V2GA 1OJLA 1T56A 5F1JA 1Q1HA 4MEYF 2TRTA 3OIQA 3QRFF 3J80K 2FA5A 1WJ5A 5CPRB 1R7JA 3CTAA 3I71A 1MBJA 4IL6C 2GM4A 2EQRA 4F55A 1VNDA 1RUOA 1K83J 1EF4A 2LRDA 1ZN2A 2FQ3A 2VI6A 2HVSA 2UXXA 3A01A 1TT5B 2LKPA 3FZVA 4F3QA 3MN2A 2EZIA 1SD5A 4LJZF 1G59A 2FOKA 4A3GJ 4A3BJ 2BGCA 1JXSA 1JKOC 4J00A 4BE0A 1N75A 1MMSA 3HOTA 5EEAA 3D5RC 3A0BC 4I6ZA 3TEDA 3C18A 4OMZA 4XRFA 1ZLKA 2DQRA 4H4KC 5FLVA 1DGRM 2CV0A 2G7HA 2QSGX 5IYDJ 2QWWA 2X51A 2EB7A 2K27A 3WGHA 3RQ4A 3CMMA 3DPLC 4HF2A 1LDJA 3ZOBA 1Y39A 3S15J 3S3NA 3SEQA 6PAXA 3L2UA 5ED4A 3KEQA 2CW0F 2M5WA 4EQQA 3KYLA 3EUHA 2STTA 4HLYA 3EUKL 2QUFA 3CJTB 3I55I 3E5XA 3OS1A 3CCMI 2XB5A 1D5YA 4IXAA 2NNNA 3D5LA 2GXGA 2GLOA 3VSLA 3GTPJ 9ANTA 2NVQJ 3GYHX 4B09A 1JTYA 5DEQA 2JSPA 2R7WA 2CU7A 2EZHA 3FMSA 4OU0A 4XMYA 2A68F 2D45A 3ML6A 5ERIA 2O9LA 1NK3P 4D1QA 2X48A 1BL0A 1FJLA 1VQ9I 3HOZJ 1V5GA 2DMNA 1MSFC 1ZARA 1NG7A 5DM7F 4ZH4F 4XKWA 3S3MA 4ITVA 2M2EA 3BR0A 1IUYA 5CVVA 4CYDA 3ASOH 4ZTFA 4N9HA 3N97A 3HOWJ 2I5UA 3V8JA 2MH2A 1VQNI 3EYIA 2V9PA 2VJIA 2Z16A 4QPQA 2LG4A 3F23A 3K4BA 3AL0B 4HYEA 3CCRI 1I1SA 2EK5A 2QYOA 1FX7A 2HOAA 4EM0B 2MD5A 3IV5A 2KT0A 4E7SA 5F0HA 5BS6A 1IXSB 3F3XA 2FD5A 4PGHA 2K9MA 4HQMA 1F4KA 3L00A 5HLGA 2W85A 1D3YA 5DCMB 1VQKI 1E3HA 4F91B 4CZCA 2FEZA 4S04A 3G6EI 3ECOA 1FP2A 1G8XA 4CGZA 1AKHA 2CQKA 2DA2A 2KIFA 2DT7B 1K6YA 2DA1A 4ZDPA 1TZLA 1U5TC 3ZRGA 3N05A 3SYTA 5TJJA 3H0DA 4A5MA 4LB5A 2DU9A 5DCFA 2ZNZA 3AG3H 3W3CA 2XAHA 1P92A 2AQEA 1YX5A 3H3VK 2ICWG 1KGSA 5F08A 2RNGA 4M71A 2DMPA 2MD0A 4WWCA 1WJEA 4A0YA 3HSFA 3AG4H 2GWRA 4U0WA 2NVUB 1X2MA 2N8GA 3FXQA 5EZHA 5CVIA 4WCGA 1TL8A 4L0ZB 1JT6A 2HI3A 2IA2A 3PO2J 1FMVA 1RUNA 1YJ9I 2K9NA 5IT3A 4JX4A 3QOEA 1UJ8A 1ZQ3P 2V79A 1EH7A 3EDPA 1G3TA 3H5AA 4HF1A 3GBGA 4QSHA 4XOTA 3V8KA 3WHBA 4EEFG 1ACIA 4GO1A 2TCTA 1SFUA 3DWLE 1UG2A 1QVTA 4N4OB 1YQAA 2CW7A 3FIWA 1R5GA 3M8JA 1TP4A 3K1PA 4C2TA 2H09A 3LWFA 3DLAA 1YG2A 2RGVA 1MZBA 5H2FC 2L54A 4XL9A 2QM3A 4EMSA 3M8EA 2MABA 3L9FA 2ZSIB 5CVJA 1ETVA 2ELJA 3J81K 2IVMA 2BVLA 4ZZLA 3BZCA 1NH3A 2NRAC 2HWVA 5L3GA 2X9DA 2LF8A 4LLGF 3RPQA 3W6KB 2GQQA 3LFUA 3V4GA 2JT1A 2XGEA 2BY1A 4OMYA 3OWTA 3FX3A 2AXTC 2O8XA 2HU9A 2D5VA 4UY8I 1VQ4I 2K4BA 3LQQA 2Y75A 1HC8A 1SFEA 5CVUA 3CCUI 3IC7A 4XKVA 3P9CA 2PJRA 1ZGAA 1R4NB 2CYYA 3CP8A 1QNTA 1MH4A 1TT0A 2JPBA 2E35A 4BQOA 2VBYA 3LMMA 4R1HA 4UXNA 1ENHA 5KCMA 4BKXA 3W6VA 2LKXA 4XK4A 1OPCA 3KYCB 3JRFA 1D5VA 3H9QA 2ID6A 3IKTA 1GVJA 1YE9A 5K5RA 4JQFA 2OU2A 2IGNA 4KIGA 4BDZA 2HYGD 3BR5A 1FP1D 1I6HJ 4HLXA 5EZGA 3OIPA 2EH3A 2MC3A 3CMEI 1K6OA 2FE3A 5KNLA 4E4HA 4BUPA 2M8EA 2EV6A 1B9NA 4V2FA 3VDXA 2ZMEC 5IP7J 4XIDA 1PP8F 2IS1A 4C9YA 3OMYA 3G71I 1RC9A 3HSEA 2PMHA 4A3FJ 1T0FC 1RETA 4C3IJ 3HRSA 3IH3A 2D1VA 3WG7H 1S7OA 2E71A 3EUAA 1SC7A 2Z9OA 1GHCA 3JREA 1XC5A 4Y17A 3NWSA 2OQGA 3ONQA 1T38A 3NWTA 4QIWN 5J8CA 4WX9A 2E1CA 4Q4ZF 4LG0A 4M3BA 1AOYA 5L3EA 4HAMA 2P8TA 5F6FA 1EH6A 4XLAA 1O3TA 4XICA 1TC3C 3KP4A 3I59B 2WBMA 3L7WA 3E6CC 2P6TA 2ZCWA 2NOGA 5EG0A 2RREA 1Y0NA 5F04A 1ETXA 4BGDA 1YS6A 2RVCA 1NK2P 2R92J 3S14J 4C30A 2ZJ2A 4DNCA 2CJJA 2R5YB 1D1AA 2HVRA 4UV8A 4ENNA 2Z99A 2Y69H 3BZKA 2LD5A 2WADA 2FX0A 3Q5FA 4QWQA 4UUSA 4CCLA 3FKJA 2JSCA 1W36D 2LH9A 3NAUA 2H8RA 1GXPA 3RIRA 1Z77A 2KRHA 1WH7A 1O4XA 4I0AA 1R22A 3ZQHA 4F92B 3BT9A 4I7HA 4YG2F 1B8IB 2IXSA 3QP5A 4OIOF 1X1CA 1YYVA 3BC8A 2ISYA 3IWFA 3ABLH 2WAQN 2L9RA 2CO5A 2K7LA 4HRIA 3ECHA 1BJAA 3DKYA 3FXOA 2XUBA 3HOYJ 1JI8A 3BTLA 3OR1C 4IF4A 4B8XA 4HV6A 2M4KA 3BJ6A 2UV1A 5C4JJ 3WTTC 1IRFA 3NQOA 2ZFUA 2H1LA 1FT9A 3FKIJ 3QU6A 2NXNB 3MQ0A 4IPAA 1PDNC 2A07F 1VI0A 4RB0A 3CDIA 3GTLJ 4CXFA 2P7VB 4D0PA 1Y8QB 1B1BA 1YS7A 2DFFA 1XSXA 2A5YB 3M9AA 2A69F 1QRYA 1MBFA 2HS5A 2Z5UA 3OYKA 3GX4X 3KP7A 1ERDA 3KEOA 5B66C 1HXDA 2QQBA 5LHGA 4F52A 1MMNA 4XNFA 1I3QJ 3CJNA 2OQRA 2R4GA 3VYUB 3WGIA 2VKHA 2ZBKA 4EJWA 2K3PA 2JTVA 5CJ9A 3F6VA 2GIVA 1FBQA 4HNTA 4B47A 1A35A 3JR9A 3K4LA 4II3A 3GTOJ 2R3SA 5M5WJ 5LHIA 2IT0A 4MQVA 5B1BH 5C3EJ 4LG0B 1ZRFA 5L3FA 2HZDA 2H1KA 1RR8C 3PNYA 3OYLA 4A3IJ 2DPUA 4MO7A 4Q47A 1U8BA 3I59A 2XDVA 5CYVA 2Y48A 2BW3B 4AVZA 3J81Z 1IG7A 2VKVA 3GLXA 2O5RA 3D5SC 3BY6A 4KT5C 1ETOA 3LOCA 4BJ6C 5LLQA 1DU6A 1I39A 5FB2A 5F27A 4HEA2 3TW7A 2HVQA 2FOWA 2Z3YA 3RCOA 4DBQA 2KDZA 1G4DA 4RM2A 2IS2A 3AG1H 3ZQCA 4A6EA 1KU9A 3O8HA 1X58A 1XDUA 2ETHA 3HGGA 5H6QA 1LFPA 1V3FA 2R5YA 4B1RA 1G3SA 3HYIA 4TV7A 4CZZA 1HLVA 4BDYA 3EPZA 5KHDA 1BW6A 1SD4A 2J5PA 2QQAA 4DYCA 3I56I 4HZFA 3BTJA 1K79A 1R6RA 1IGNA 2O8KA 4RGRA 1E3PA 5DD8A 4L5JA 2VPRA 4GYIA 1ETKA 4L9NA 3HRTA 5ILVA 1F1ZA 1TWAJ 3LA3A 1AU7A 3CCSI 4ENKA 2OZUA 2E7WA 3E7LA 1XTAA 2HKOA 1WFXA 1TQPA 2CW8A 2ME0A 4G6TB 4G7ZF 4M6VA 5H6RA 5HVQC 3PUBA 4Z2YA 5D4SA 1F36A 1ZYRF 5BPDA 3Q9SA 1HDPA 4XLCA 5E1WA 3ZMZA 3GTMJ 3JSOA 3CD6I 1A36A 1BOAA 1ON1A 1BIBA 3PO3J 1STZA 3ABKH 2RQPA 1Q1VA 3K2ZA 4CCOA 1YOVB 2RQQA 3HIFA 3K1MA 3LSHA 1WJDA 1JHHA 1SMYF 5EDNA 2KZVA 2FNPA 1V5FA 4MNUA 2JMWA 3P5JA 1J5YA 4ENMA 2L7MP 3KLOA 1APLC 5KVRA 4UUSB 1KYWA 3LSGA 1TBXA 1L0OC 3IUOA 4A3DJ 2VIXA 4CYCB 3AG2H 2KRFA 2WY8Q 4XRMA 1B8IA 4NUBA 1JE8A 2RKHA 5LD2C 4DGWB 2AHQA 4QTRA 2DI3A 2HOTA 2KL4A 3JRAA 4GFBA 4XKCA 2R7UA 2ZC2A 3ABTA 2PJPA 4BJ5C 5FRMA 1SFKA 2V1NA 3KP6A 3HRMA 1N78A 3MZYA 2FU4A 1SANA 3IAS2 3SEZA 3I54A 3LSPA 1VF9A 1ETWA 2OF7A 4BAYA 3GEZA 5J47A 2HXOA 4XR6A 4JBAA 3TQNA 4D7MA 3LA2A 1XGSA 3MMYB 5D6FA 5JHFA 1YFHA 4E7HA 2ZXJA 1X1DA 4CCJA 2EFWA 2VQLA 1MJAA 1Y1WJ 2L7FP 5DD4A 1HDDC 2KMUA 3BCBA 3C2HA 1NHAA 3VEPA 2CMPA 1I1GA 3FMRA 5GAHJ 1YI2I 4CCKA 5LRRA 5M5XJ 5EG0B 4U0YA 2NNYA 1R1VA 3LAJA 1XN7A 3DEEA 3DQVC 4M9ZA 4PFPA 3CQZJ 1X3UA 1E17A 2DFIA 2VBXA 4HF0A 4PFOA 4OWRB 5HLIA 2ZMEB 3S93A 2P4WA 4UVAA 1IRZA 3WTZA 5J1YA 5JLXA 3PQKA 4WF2A 3IL2A 5DS9A 3Q0WA 3JAMK 3A2KA 1N77A 1WJBA 3OYHA 4X1EA 3ZMDA 2P6SA 1TW2A 5FKOA 1ZGJA 4BHPA 3OSGA 3WE3A 3S2DJ 5JVGF 5HS8A 2IA1A 3BPXA 4RS8A 2HTSA 1PVEA 2KRCA 1POGA 4IVNA 1XGMA 2B7EA 3DPUA 2KHMA 1A6IA 3BTIA 2P81A 4PSWA 2XAJA 1ON2A 3TL4X 3LAPA 1E2XA 1HOMA 5FFXA 1U9NA 1USSA 5KAFC 2OTJI 1WZ2A 3G1LA 4ANJA 2L9VA 1Z9CA 4YFXF 5HS7A 5FRNA 2XB0X 1TNSA 5GPCA 1V54H 3S2HJ 3QAHA 5LFAA 5FFZA 4CO8A 1X1BA 3WU1B 1WH5A 1SVMA 3OOPA 4AYBN 3WTSC 2R0QC 2R7SA 3CF5F 1ZGWA 4D9JA 4PJMA 1MKMA 5J3LA 1YW9A 4A3CJ 3HUGA 1QQIA 1YW8A 4PJLA 4KMFA 3RKYA 1MW7A 5DUIA 3MAJA 2XPUA 2MYSA 3ZMTA 1D0XA 2AQFA 2DODA 2MFZA 2GOXB 1IZ1A 1HKQA 4I02A 2VQGA 2P0WA 1LKXA 2CFOA 1GVDA 3KFWX 2MLGA 3JRCA 3F22A 2K3FA 1QZZA 2R7TA 2JK3A 5E3LA 5M3FJ 2HXIA 4DZPA 1Z3XA 3EYYA 4DW6A 4IHTA 3KP2A 4LIVA 3GZNB 3HXLA 4FE4A 1PJRA 3LNQA 1U78A 1LVAA 1ZAOA 1ZELA 5HLTA 3LSIA 5K5QA 4J19A 1T98A 3FHZA 4UB8C 1WSUA 1BR1A 1H9TA 1UAAA 2R7ZJ 1IDZA 4AU7A 2V4JC 3S32A 3S1MJ 2BEOA 1T08B 1IN6A 3S1RJ 2I8DA 1W7PB 4IJAA 2HGCA 5D6EA 3D1NI 3AKZA 3FWEA 3OYEA 5J6XA 2CQQA 1EV7A 3J7AY 2LLKA 4EGYA 1AKHB 3QYBA 5BPIA 1WKMA 2ZMEA 1VQPI 2WAQA 1R71A 2H6BA 1P4WA 4P9FA 1MMDA 4M73A 2XGDA 4A6DA 1L3LA 2JA8J 1WGXA 4ZC3A 2UZKA 2KQRA 3ZMUA 5HDNA 1HKTA 3K9TA 2JA2A 3DCFA 1X3ZB 1A6QA 2DOEA 2FRHA 2DOFA 1BA5A 1XMXA 2DJIA 1Z0XA 1Z1DA 1W36C 4LLNA 1NG6A 2QEXI 3QPHA 4XLEA 3DKXA 1O7FA 3M7GA 4UV9A 5CLSA 1OCPA 2DTZA 2PBIA 1YIJI 2X85A 1WJCA 3F8MA 4YELA 4PUSA 1OCZH 2E34A 3AL0C 2VE9A 3WU2C 3H35A 1QHHD 4ZZDA 2NAZA 3A0HC 3BCAA 2IJLA 2LVSA 4OIPF 4N4NB 3FMQA 1LDDA 4ZDLA 4XLHA 4Y15A 3FXRA 1JKQC 1W0UA 2CSOA 2DMTA 4OOIA 4FISA 1QBJA 3U9GA 1P7IA 4HPQA 1TWGJ 3O2PE 3C2GA 1TLHB 2EFOA 4A12A 1RR7A 1YX3A 3MKZA 1TWFJ 5DYMA 1IAWA 3GCMA 5FD5A 2ZJQF 4G9YA 2HDCA 1XMAA 4NC7A 3ZQIA 3BG3A 2RV8A 1CQTA 2VBZA 2VC1A 2OPTA 5F0FA 4FETA 3UKGA 2W4SA 1X1PA 3TOBA 4AM3A 2KIMA 1UFMA 4A3EJ 3BG7A 3ERMA 4MFDA 4BY7J 4EJUA 3G2BA 1U3EM 2FBIA 3HZJA 1LFBA 1DP7P 1Y8RB 3S1QJ 3AAFA 3V8LA 1R5HA 2KJBA 4M3GA 4KIFA 4KISA 1YO5C 1WHUA 1QU3A 1OR7A 2LOOA 2GA1A 1H8AC 3U21A 4C3HJ 2XC7A 4YRVA 1FBSA 3J7YJ 2DK8A 4B43A 3S16J 2QGUA 1U5TA 1DPRA 3TP3A 3JCUC 2A3SA 3GTJJ 2L7KA
chains in the Genus database with same CATH topology
3TO6A 4NB5A 4U7BA 4G7HF 4KUMA 4EM1A 3R0JA 4HX8A 2HZTA 2YU3A 4XSXF 3P9IA 5E1ZB 3V7SA 5BQTA 4BQAA 3WTXC 1LQ1A 1IN5A 2K4JA 1FY7A 3H3UA 3J7AO 5AIPA 2UXNA 1UHMA 3GO5A 3KP5A 5HDKA 2XHKA 2QVOA 4FT8A 2EFQA 3D0SA 1QPMA 3DFGA 3GWZA 1WI9A 1FZPB 2L4AA 2PMUA 1KU3A 3I5UA 2FMYA 1R1UA 5FD6A 3LQRA 2AXLA 5E8IA 4UHTA 1T39A 1OMIA 2ZO4A 1ZG1A 3EETA 2FMLA 3IWZA 3RTRA 2QZ8A 2XASA 3H3ZA 1D8JA 3J80Z 4M74A 2X4HA 1FBUA 1MJ9A 2DAOA 4PGGA 1LNWA 4M72A 2R7DA 1BBYA 2STWA 5AONA 5L3DA 2HYFA 2H94A 5JVTA 2OD5A 1BI3A 5K5OA 4HV5A 4H0EA 2XROA 3B02A 3RDIA 2LSOA 3WTVC 1DDNA 2P7CB 4G6QA 1ZG3A 2PEXA 3ZP5A 3BROA 1YW7A 5E18F 2PI0A 5ICGA 1LJ9A 3RKWA 2XRNA 4N0BA 2D2WA 3ZMSA 4IRIA 5BOXA 1BM9A 4MGRA 1REPC 4YFKF 3ZQ7A 3JAMZ 4WXCA 4HDUA 4AIKA 5LHHA 4ZYEA 4FX4A 3M8FA 2BYVE 3I58A 2GAUA 1IN4A 1YTYA 2VONA 4DQ2A 4MTEA 1LB2A 2M45A 3DP7A 4AVPA 1F5TA 3C3WA 3HOSA 1ODDA 3F21A 2L3DA 2ZKZA 2E1NA 3DXJF 5ILSA 3S2WA 3ULQB 3KETA 4IRGA 3N4MA 3DKWA 2L01A 3IRQA 1BI0A 1QO0D 4P55A 4HA8A 1OKRA 2FBKA 5HS9A 3ZN0A 3E6DA 4RB3C 3DEUA 4AD9A 5F64A 4HW0A 3HTSB 1H0MA 4S05A 3F8BA 5HOOA 2UWMA 1XGNA 4LB6B 2Q8KA 2KJCA 1S8NA 3ABUA 2TDXA 1MD0A 1IXRC 4PZJA 1XD7A 2IP2A 1J9IA 1FYMA 3RKXA 2F5FA 3F6OA 4KYWA 4EJVA 5D8LB 4BH9A 4LD5A 5ICEA 3SZPA 3TKYA 4L0YB 2EV5A 2O3FA 2HQNA 4EGZA 3SXYA 3E6MA 2EWNA 1UB9A 1H9GA 3HHGA 3WE2A 1XCBA 1TTYA 2DK5A 1O3QA 1A04A 3GZ5A 3R4KA 1SFXA 2E7XA 2IW5A 1K78B 3CUQC 1Z91A 1KU2A 2WC2A 3CLOA 5K1YA 4Y13A 5LRSA 4U88A 3TO9A 1KYZA 3R60A 2EA2A 4UVCA 3SHFA 3DPTA 4UUVA 3U2RA 3GW2A 1CGPA 4KNYA 3WG9A 2CGPA 3IRRA 4HX4A 2IPQX 2EFPA 3JW4A 3COAC 2JRTA 1P2FA 1Z7UA 1HW5A 2EV0A 2DPDA 3ZPLA 4LK1F 4EV0A 5ICCA 1S7AA 4GYGA 3GUDA 4O6JA 4A0XA 1XCVA 4CHUA 4CICA 4N9IA 2MLKA 4BHBA 4ESFA 2RDPA 5LGTA 4I09A 1FYLA 3WGGA 1G3WA 1FPQA 2BV6A 2NS0A 3TDUC 2M87A 2DTRA 1JHFA 1BN5A 1HSTA 1ZREA 2PQ8A 3TOAA 3BPVA 2HFHA 3K1NA 3LSTA 3CDHA 1J0RA 4ETSA 3QP6A 1P4AA 1ZG5A 3VODA 3KE2A 1KU7A 1W5SA 1EH8A 5HLHA 2Q2EA 3F8NA 2JZYA 1I6XA 2NYXA 1IXCA 1IF1A 3CUQA 3C7JA 1BIAA 1RNLA 4RGXA 2A6HF 2O0YA 4U7DA 1I5ZA 4MEXF 3Q9VA 3WTWC 2ESHA 4M6XA 4I0BA 2YSRA 1Z05A 2A6EF 3JTHA 3KLNA 3MFKA 5TRDA 2X0LA 4M9SA 1W7PA 4O5VA 4PDKA 4M6YA 1FWZA 1W4MA 4FX0A 2PG4A 2Q0OA 1FSHA 2CG4A 3GXOA 1ULYA 4M9XA 1O3RA 2RN7A 5A2QZ 3BDDA 4WXHA 1BC8C 4ZYHA 3VB2A 4KDPA 1O7LA 2HEOA 4L9VA 3RYRA 1CF7B 1TNTA 5LEJA 2G9WA 2A61A 2W57A 1SAXA 2Z33A 4ESBA 3ISPA 2ACJA 1IRGA 4G7OF 4G8XA 5LBQA 2O03A 2DBBA 2HR3A 1T0FA 4LK0F 2FF4A 3JSPA 3O3KA 2G7UA 4A2UA 5CVRA 5FO5A 4ON0A 1K7AA 2QBYB 4GCVA 3SZTA 1PP7U 2QBYA 1T6SA 2YX4A 4G94A 4LLLA 2F2EA 4KN7X 3E3VA 5JR3A 1K78A 4LMYA 3C1DA 3GFMA 5D8KB 3HTUA 4NHJA 3GF2A 1RIOH 3MEXA 2XKOA 3BP8A 3E5UA 1U5TB 5HDGA 4LFUA 2P5LC 5E17F 5DUKA 2GA2A 2XKPA 2K02A 2W24A 4HQEA 3F8FA 1BI2A 1BC7C 1QGPA 1OYIA 1MJBA 3QU3A 2FXAA 4XSZF 4F7ZA 1LEBA 4ZYDA 4BNCA 2EJRA 4YIIA 3R6SA 4XLPF 3BJOA 2F5CA 2W25A 4LGWA 2VC0A 2V9VA 4ESJA 3F72A 1BI1A 3EQLF 4G6DA 5F1RA 2QLZA 3E5QA 4MHGA 1OYWA 2MH9A 1V4RA 2P5KA 3WODF 5D5UB 3PQJA 4RGSA 4WK8F 1F9NA 2VBWA 3GFJA 4AIHA 2DT5A 2R7FA 4NQWA 4L9JA 3GFLA 1S6LA 2D1HA 3BJAA 1O57A 3W6JB 2EA4A 2M1BA 1XSVA 2PLYA 1T2KA 3V7CA 1FSEA 3RPUA 3LFKA 1J75A 4HOBA 1YIOA 2XVCA 4A0ZA 3BZ6A 5LGNA 3GVAA 3VFZA 5EEGA 1G6NA 2H27A 1KA8A 3BWGA 1R58A 2F5EA 2OBPA 3P9KA 1R1TA 3QPTA 1KQ8A 1W7PD 3GFIA 1Y0UA 3L09A 1U8RA 2V1DA 3KP3A 4XLNF 3O6BB 2GXBA 1MDMB 2O6GE 1DPUA 3B73A 2VODA 4KA4A 1Z6RA 1R36A 2XIGA 4I2OA 1ZLJA 3M1EA 4EJTA 2VOPA 4AIJA 4R79A 2V1UA 2HKXA 2OAZA 1S29A 1HQCA 1D8KA 3FF5A 1UHWA 1R00A 1ZHFA 1G3YA 5D5XB 2WWYA 1RZ4A 3HHHA 1R23A 2FSWA 4Q5SF 2VOOA 4XBFA 2YX7A 3ROUA 2GZWA 3QOPA 4EJOA 2IRFG 1XB4A 3MCZA 4OIRF 5D5VB 2VXZA 2COMA 2DLLA 3ERED 2J5OA 3K0LA 2KKOA 1OYYA 3FM3A 4FHTA 5FLXK 4K2EA 1IN7A 5J8FA 4KIBA 3KZYA 3FXUA 5ILUA 3VOEA 2XAFA 1HW1A 4GGGA 5E8GA 1SMTA 5KK1A 3T0YA 2V1XA 3T8RA 2B0LA 1J7KA 2K86A 2L02A 3T8TA 4MQ9F 3JTGA 2DO7A 1RI7A 5A2QK 1IN8A 1Z6TA 2VN2A 3WU0A 3T5XA 2Y0MA 2ZNYA 2W84A 3V7RA 1ZRDA 1JGSA 2BBYA 3R61A 3F8CA 3RI4A 3K69A 3TDZC 2P5VA 2YPRA 4P9UA 1U6GA 5DDGA 3CUQB 1FC3A 4HBLA 4P5OA 1HBXG 5H20A 1U2WA 1MDMA 4EVIA 2PN6A 2WV0A 3HRUA 1SD6A 4OINF 5JI6A 3NRVA 5D5WB 3KZZA 3KCCA 4KFCA 2OZ6A 2MBFA 5BMZA 4O3MA 1B6AA 1VTNC 1O3SA 3I4PA 2ZFWA 4MTDA 2H6CA 2V6CA 5LEKA 1HKSA 4L9TA 2FNAA 1LDKB 3MZHA 3TO7A 4ZYGA 3HSRA 4RAYA 1B4AA 1P6RA 1XMKA 2MA3A 3OV8A 2WTEA 3P7NA 1MGTA 3DF8A 3H92A 2HTJA 1J59A 1USTA 4KN4X 3SQNA 2XAGA 4RB2C 3LA7A 1PUEE 1AWCA 3U1DA 2RC4A 2VT2A 1WRJA 4ASNA 4QLCU 2PFBA 3FM5A 4I98B 4UVBA 2QQ9A 1IW7F 5L3CA 2XAQA 1KQ0A 3I53A 2ESNA 4JK1X 1S3JA 3REOA 4HX7A 1YLFA 2FBHA 4OIQF 1XGOA 3NEUA 4YFNF 1UCRA 3DV8A 5L3BA 4AWXB 2LF7A 2VT3A 5IT9Z 1I27A 2C6YA 5FGMA 3WTUC 2EFNA 3MWMA 1ZH5A 2ISZA 4RB1A 1J2XA 4CDGA 2OA4A 2DQLA 4P96A 4R8HA 5JHUA 4YIFA 4BYYA 1FOKA 5AIQA 1GXQA 4PCQA 3TGNA 4Q48A 4BXUA 2YR2A 2IA0A 2F5DA 1HW2A 2CFXA 4L18B 5IT9K 4RGUA 4IHSA 5FLXZ 1TQMA 4GXOA 3E6BA 4RAZA 1ONVA 4KICA 1ZRCA 5E1XA 2KIUA 2O61A 3I64A 3ZMVA 1CF7A 3PFIA 2ADUA 1TW3A 4UNOA 4KMUX 1HSJA 3G3ZA 4I01A 2LDUA 1XSDA 2CWEA 1XDSA 3SFZA 3CO7C 3IKVA 4HDVA 1FNNA 1QZYA 1B59A 1FYKA 1WWXA 1TQIA 5E20A 5ICFA 3WTYC 1DUXC 3R0AA 5JFRA 3IHUA 4EM2A 1LEAA 3RYPA 2RNJA 2AS5F 3E97A 3I0TA 1W5TA 2QENA 2ELHA 5EEHA 2LNBA 4ENJA 4L5IA 2BE5F 2HOEA 3ZN1A 1SD7A 2M30A 4WXDA 3GZ6A 1KQ9A 3RJPA 4A5NA 5DCMA 1C0WA 5DV5A 3CO6C 1P4XA 3G73A 4BHCA 2XV4S 3BOQA 3CUOA 4E70A 3L2CA 3ELKA 5LGUA 3T1BA 1B9MA 2XGXA 4IRHA 2VE8A 4U0VA 2DW4A 5D4RA 1WQ2A 2JPCA 2HQRA 1FLIA 2L4MA 1Q1HA 4MEYF 3QRFF 3J80K 2FA5A 1R7JA 3CTAA 3I71A 1RUOA 1ZN2A 2FQ3A 2UXXA 2LKPA 3FZVA 1SD5A 4LJZF 2FOKA 2BGCA 1JXSA 3HOTA 3C18A 4OMZA 4XRFA 1ZLKA 2DQRA 2G7HA 2QWWA 2EB7A 2K27A 3WGHA 3DPLC 4HF2A 1LDJA 6PAXA 5ED4A 3KEQA 2CW0F 2M5WA 4EQQA 2STTA 3EUHA 4HLYA 2QUFA 3E5XA 4IXAA 2NNNA 3D5LA 2GXGA 3GYHX 4B09A 5DEQA 3FMSA 4OU0A 2A68F 2D45A 3ML6A 5ERIA 1ZARA 4ZH4F 1IUYA 5CVVA 4CYDA 4N9HA 3N97A 3V8JA 2MH2A 3EYIA 3F23A 4HYEA 1I1SA 4EM0B 2EK5A 1FX7A 2QYOA 2MD5A 5BS6A 1IXSB 3F3XA 4PGHA 4HQMA 1F4KA 3L00A 5HLGA 2W85A 1D3YA 5DCMB 4S04A 2FEZA 3ECOA 1FP2A 4CGZA 2CQKA 2KIFA 1U5TC 5TJJA 4LB5A 4A5MA 2DU9A 5DCFA 2ZNZA 2XAHA 1P92A 1KGSA 4M71A 4WWCA 4A0YA 3HSFA 2GWRA 4U0WA 3FXQA 5CVIA 4WCGA 4L0ZB 2IA2A 1RUNA 5IT3A 2V79A 1EH7A 3EDPA 1G3TA 4HF1A 3V8KA 4GO1A 1SFUA 1YQAA 1R5GA 3K1PA 2H09A 3LWFA 1YG2A 2RGVA 1MZBA 2L54A 2QM3A 4EMSA 3M8EA 3L9FA 5CVJA 3J81K 2IVMA 4ZZLA 2NRAC 2HWVA 5L3GA 2LF8A 4LLGF 3RPQA 3W6KB 2GQQA 3V4GA 2JT1A 4OMYA 3FX3A 2O8XA 2K4BA 3LQQA 2Y75A 1SFEA 5CVUA 3IC7A 3P9CA 1ZGAA 2CYYA 1QNTA 2JPBA 2VBYA 4R1HA 4UXNA 1OPCA 1D5VA 3IKTA 1GVJA 5K5RA 4JQFA 2OU2A 4KIGA 2HYGD 1FP1D 4HLXA 2MC3A 1K6OA 2FE3A 2M8EA 2EV6A 1B9NA 1PP8F 3HSEA 2PMHA 3HRSA 2D1VA 1S7OA 2Z9OA 1GHCA 4Y17A 2OQGA 1T38A 5J8CA 4WX9A 2E1CA 4Q4ZF 4LG0A 1AOYA 5L3EA 4HAMA 2P8TA 5F6FA 1EH6A 1O3TA 3KP4A 3I59B 3L7WA 3E6CC 2P6TA 2ZCWA 1YS6A 2RVCA 2ZJ2A 4DNCA 4UV8A 4ENNA 2Z99A 3Q5FA 4QWQA 2JSCA 1GXPA 3RIRA 4I0AA 1R22A 4I7HA 4YG2F 4OIOF 3QP5A 1YYVA 2ISYA 3IWFA 2CO5A 2K7LA 3ECHA 1BJAA 2XUBA 4IF4A 4B8XA 4HV6A 3BJ6A 3WTTC 1IRFA 3NQOA 1FT9A 3QU6A 3MQ0A 4IPAA 1PDNC 2A07F 4RB0A 4CXFA 2P7VB 4D0PA 1B1BA 1YS7A 1XSXA 2A5YB 3M9AA 2A69F 2HS5A 2Z5UA 3GX4X 3KP7A 3KEOA 1HXDA 2QQBA 5LHGA 3CJNA 2OQRA 3WGIA 2ZBKA 4EJWA 2JTVA 5CJ9A 3F6VA 2GIVA 1FBQA 2R3SA 5LHIA 2IT0A 4MQVA 4LG0B 1ZRFA 5L3FA 2DPUA 4Q47A 3I59A 5CYVA 2Y48A 3J81Z 3GLXA 3BY6A 4KT5C 5LLQA 5FB2A 2Z3YA 1G4DA 4A6EA 1KU9A 1XDUA 2ETHA 5H6QA 1V3FA 1G3SA 3HYIA 4TV7A 4CZZA 1SD4A 2J5PA 2QQAA 4HZFA 1K79A 4RGRA 5DD8A 4L5JA 4GYIA 4L9NA 3HRTA 5ILVA 1F1ZA 3LA3A 4ENKA 2OZUA 2E7WA 2HKOA 4G7ZF 1TQPA 5H6RA 5HVQC 4Z2YA 5D4SA 1ZYRF 5BPDA 3Q9SA 5E1WA 3ZMZA 3JSOA 1BOAA 1ON1A 1BIBA 1STZA 2RQPA 3K2ZA 3HIFA 3K1MA 1JHHA 1SMYF 2FNPA 4MNUA 1J5YA 4ENMA 3KLOA 5KVRA 1KYWA 1TBXA 1L0OC 2KRFA 1JE8A 2RKHA 2DI3A 3ABTA 2PJPA 3KP6A 3HRMA 3MZYA 2FU4A 3I54A 4BAYA 3GEZA 4JBAA 3TQNA 3LA2A 1XGSA 5D6FA 1YFHA 2ZXJA 2EFWA 1MJAA 5DD4A 1NHAA 3VEPA 1I1GA 3FMRA 5LRRA 4U0YA 2NNYA 1R1VA 3LAJA 1XN7A 3DQVC 4M9ZA 1E17A 1X3UA 2DFIA 2VBXA 4HF0A 5HLIA 2ZMEB 2P4WA 4UVAA 3WTZA 3PQKA 4WF2A 3IL2A 3JAMK 3ZMDA 2P6SA 1TW2A 1ZGJA 4BHPA 3WE3A 5HS8A 2IA1A 3BPXA 4RS8A 2HTSA 4IVNA 1XGMA 2XAJA 1ON2A 3LAPA 1E2XA 5FFXA 1USSA 1Z9CA 4YFXF 5HS7A 1TNSA 3QAHA 5FFZA 4CO8A 3WU1B 3OOPA 3WTSC 1MKMA 1YW9A 3HUGA 1QQIA 1YW8A 4KMFA 3RKYA 5DUIA 3MAJA 3ZMTA 1IZ1A 1HKQA 4I02A 3F22A 3KFWX 2MLGA 1QZZA 3EYYA 4IHTA 3KP2A 1U78A 1LVAA 1ZAOA 5K5QA 1T98A 3FHZA 1H9TA 1WSUA 2BEOA 1IN6A 1W7PB 4IJAA 2HGCA 5D6EA 3FWEA 5J6XA 1EV7A 4EGYA 5BPIA 1WKMA 2ZMEA 2H6BA 1P4WA 4P9FA 4M73A 4A6DA 1L3LA 2UZKA 1HKTA 3ZMUA 5HDNA 3K9TA 2FRHA 1Z1DA 4LLNA 3QPHA 1O7FA 3M7GA 4UV9A 5CLSA 2PBIA 3F8MA 2VE9A 4ZZDA 2NAZA 2IJLA 4OIPF 3FMQA 1LDDA 4Y15A 3FXRA 2CSOA 4OOIA 1QBJA 3U9GA 3O2PE 1TLHB 2EFOA 4A12A 1IAWA 5DYMA 5FD5A 4G9YA 2HDCA 1XMAA 2RV8A 2VBZA 2VC1A 3TOBA 2KIMA 1UFMA 4EJUA 1U3EM 2FBIA 1DP7P 3AAFA 3V8LA 1R5HA 2KJBA 4KIFA 1YO5C 1OR7A 2GA1A 1FBSA 2DK8A 1U5TA 1DPRA 2A3SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TO6 A;  4NB5 A;  4U7B A;  4G7H F;  4KUM A;  4EM1 A;  3R0J A;  4HX8 A;  2HZT A;  2YU3 A;  4XSX F;  3P9I A;  5E1Z B;  3V7S A;  5BQT A;  4BQA A;  3WTX C;  1LQ1 A;  1IN5 A;  2K4J A;  1FY7 A;  3H3U A;  3J7A O;  5AIP A;  2UXN A;  1UHM A;  3GO5 A;  3KP5 A;  5HDK A;  2XHK A;  2QVO A;  4FT8 A;  2EFQ A;  3D0S A;  1QPM A;  3DFG A;  3GWZ A;  1WI9 A;  1FZP B;  2L4A A;  2PMU A;  1KU3 A;  3I5U A;  2FMY A;  1R1U A;  5FD6 A;  3LQR A;  2AXL A;  5E8I A;  4UHT A;  1T39 A;  1OMI A;  2ZO4 A;  1ZG1 A;  3EET A;  2FML A;  3IWZ A;  3RTR A;  2QZ8 A;  2XAS A;  3H3Z A;  1D8J A;  3J80 Z;  4M74 A;  2X4H A;  1FBU A;  1MJ9 A;  2DAO A;  4PGG A;  1LNW A;  4M72 A;  2R7D A;  1BBY A;  2STW A;  5AON A;  5L3D A;  2HYF A;  2H94 A;  5JVT A;  2OD5 A;  1BI3 A;  5K5O A;  4HV5 A;  4H0E A;  2XRO A;  3B02 A;  3RDI A;  2LSO A;  3WTV C;  1DDN A;  2P7C B;  4G6Q A;  1ZG3 A;  2PEX A;  3ZP5 A;  3BRO A;  1YW7 A;  5E18 F;  2PI0 A;  5ICG A;  1LJ9 A;  3RKW A;  2XRN A;  4N0B A;  2D2W A;  3ZMS A;  4IRI A;  5BOX A;  1BM9 A;  4MGR A;  1REP C;  4YFK F;  3ZQ7 A;  3JAM Z;  4WXC A;  4HDU A;  4AIK A;  5LHH A;  4ZYE A;  4FX4 A;  3M8F A;  2BYV E;  3I58 A;  2GAU A;  1IN4 A;  1YTY A;  2VON A;  4DQ2 A;  4MTE A;  1LB2 A;  2M45 A;  3DP7 A;  4AVP A;  1F5T A;  3C3W A;  3HOS A;  1ODD A;  3F21 A;  2L3D A;  2ZKZ A;  2E1N A;  3DXJ F;  5ILS A;  3S2W A;  3ULQ B;  3KET A;  4IRG A;  3N4M A;  3DKW A;  2L01 A;  3IRQ A;  1BI0 A;  1QO0 D;  4P55 A;  4HA8 A;  1OKR A;  2FBK A;  5HS9 A;  3ZN0 A;  3E6D A;  4RB3 C;  3DEU A;  4AD9 A;  5F64 A;  4HW0 A;  3HTS B;  1H0M A;  4S05 A;  3F8B A;  5HOO A;  2UWM A;  1XGN A;  4LB6 B;  2Q8K A;  2KJC A;  1S8N A;  3ABU A;  2TDX A;  1MD0 A;  1IXR C;  4PZJ A;  1XD7 A;  2IP2 A;  1J9I A;  1FYM A;  3RKX A;  2F5F A;  3F6O A;  4KYW A;  4EJV A;  5D8L B;  4BH9 A;  4LD5 A;  5ICE A;  3SZP A;  3TKY A;  4L0Y B;  2EV5 A;  2O3F A;  2HQN A;  4EGZ A;  3SXY A;  3E6M A;  2EWN A;  1UB9 A;  1H9G A;  3HHG A;  3WE2 A;  1XCB A;  1TTY A;  2DK5 A;  1O3Q A;  1A04 A;  3GZ5 A;  3R4K A;  1SFX A;  2E7X A;  2IW5 A;  1K78 B;  3CUQ C;  1Z91 A;  1KU2 A;  2WC2 A;  3CLO A;  5K1Y A;  4Y13 A;  5LRS A;  4U88 A;  3TO9 A;  1KYZ A;  3R60 A;  2EA2 A;  4UVC A;  3SHF A;  3DPT A;  4UUV A;  3U2R A;  3GW2 A;  1CGP A;  4KNY A;  3WG9 A;  2CGP A;  3IRR A;  4HX4 A;  2IPQ X;  2EFP A;  3JW4 A;  3COA C;  2JRT A;  1P2F A;  1Z7U A;  1HW5 A;  2EV0 A;  2DPD A;  3ZPL A;  4LK1 F;  4EV0 A;  5ICC A;  1S7A A;  4GYG A;  3GUD A;  4O6J A;  4A0X A;  1XCV A;  4CHU A;  4CIC A;  4N9I A;  2MLK A;  4BHB A;  4ESF A;  2RDP A;  5LGT A;  4I09 A;  1FYL A;  3WGG A;  1G3W A;  1FPQ A;  2BV6 A;  2NS0 A;  3TDU C;  2M87 A;  2DTR A;  1JHF A;  1BN5 A;  1HST A;  1ZRE A;  2PQ8 A;  3TOA A;  3BPV A;  2HFH A;  3K1N A;  3LST A;  3CDH A;  1J0R A;  4ETS A;  3QP6 A;  1P4A A;  1ZG5 A;  3VOD A;  3KE2 A;  1KU7 A;  1W5S A;  1EH8 A;  5HLH A;  2Q2E A;  3F8N A;  2JZY A;  1I6X A;  2NYX A;  1IXC A;  1IF1 A;  3CUQ A;  3C7J A;  1BIA A;  1RNL A;  4RGX A;  2A6H F;  2O0Y A;  4U7D A;  1I5Z A;  4MEX F;  3Q9V A;  3WTW C;  2ESH A;  4M6X A;  4I0B A;  2YSR A;  1Z05 A;  2A6E F;  3JTH A;  3KLN A;  3MFK A;  5TRD A;  2X0L A;  4M9S A;  1W7P A;  4O5V A;  4PDK A;  4M6Y A;  1FWZ A;  1W4M A;  4FX0 A;  2PG4 A;  2Q0O A;  1FSH A;  2CG4 A;  3GXO A;  1ULY A;  4M9X A;  1O3R A;  2RN7 A;  5A2Q Z;  3BDD A;  4WXH A;  1BC8 C;  4ZYH A;  3VB2 A;  4KDP A;  1O7L A;  2HEO A;  4L9V A;  3RYR A;  1CF7 B;  1TNT A;  5LEJ A;  2G9W A;  2A61 A;  2W57 A;  1SAX A;  2Z33 A;  4ESB A;  3ISP A;  2ACJ A;  1IRG A;  4G7O F;  4G8X A;  5LBQ A;  2O03 A;  2DBB A;  2HR3 A;  1T0F A;  4LK0 F;  2FF4 A;  3JSP A;  3O3K A;  2G7U A;  4A2U A;  5CVR A;  5FO5 A;  4ON0 A;  1K7A A;  2QBY B;  4GCV A;  3SZT A;  1PP7 U;  2QBY A;  1T6S A;  2YX4 A;  4G94 A;  4LLL A;  2F2E A;  4KN7 X;  3E3V A;  5JR3 A;  1K78 A;  4LMY A;  3C1D A;  3GFM A;  5D8K B;  3HTU A;  4NHJ A;  3GF2 A;  1RIO H;  3MEX A;  2XKO A;  3BP8 A;  3E5U A;  1U5T B;  5HDG A;  4LFU A;  2P5L C;  5E17 F;  5DUK A;  2GA2 A;  2XKP A;  2K02 A;  2W24 A;  4HQE A;  3F8F A;  1BI2 A;  1BC7 C;  1QGP A;  1OYI A;  1MJB A;  3QU3 A;  2FXA A;  4XSZ F;  4F7Z A;  1LEB A;  4ZYD A;  4BNC A;  2EJR A;  4YII A;  3R6S A;  4XLP F;  3BJO A;  2F5C A;  2W25 A;  4LGW A;  2VC0 A;  2V9V A;  4ESJ A;  3F72 A;  1BI1 A;  3EQL F;  4G6D A;  5F1R A;  2QLZ A;  3E5Q A;  4MHG A;  1OYW A;  2MH9 A;  1V4R A;  2P5K A;  3WOD F;  5D5U B;  3PQJ A;  4RGS A;  4WK8 F;  1F9N A;  2VBW A;  3GFJ A;  4AIH A;  2DT5 A;  2R7F A;  4NQW A;  4L9J A;  3GFL A;  1S6L A;  2D1H A;  3BJA A;  1O57 A;  3W6J B;  2EA4 A;  2M1B A;  1XSV A;  2PLY A;  1T2K A;  3V7C A;  1FSE A;  3RPU A;  3LFK A;  1J75 A;  4HOB A;  1YIO A;  2XVC A;  4A0Z A;  3BZ6 A;  5LGN A;  3GVA A;  3VFZ A;  5EEG A;  1G6N A;  2H27 A;  1KA8 A;  3BWG A;  1R58 A;  2F5E A;  2OBP A;  3P9K A;  1R1T A;  3QPT A;  1KQ8 A;  1W7P D;  3GFI A;  1Y0U A;  3L09 A;  1U8R A;  2V1D A;  3KP3 A;  4XLN F;  3O6B B;  2GXB A;  1MDM B;  2O6G E;  1DPU A;  3B73 A;  2VOD A;  4KA4 A;  1Z6R A;  1R36 A;  2XIG A;  4I2O A;  1ZLJ A;  3M1E A;  4EJT A;  2VOP A;  4AIJ A;  4R79 A;  2V1U A;  2HKX A;  2OAZ A;  1S29 A;  1HQC A;  1D8K A;  3FF5 A;  1UHW A;  1R00 A;  1ZHF A;  1G3Y A;  5D5X B;  2WWY A;  1RZ4 A;  3HHH A;  1R23 A;  2FSW A;  4Q5S F;  2VOO A;  4XBF A;  2YX7 A;  3ROU A;  2GZW A;  3QOP A;  4EJO A;  2IRF G;  1XB4 A;  3MCZ A;  4OIR F;  5D5V B;  2VXZ A;  2COM A;  2DLL A;  3ERE D;  2J5O A;  3K0L A;  2KKO A;  1OYY A;  3FM3 A;  4FHT A;  5FLX K;  4K2E A;  1IN7 A;  5J8F A;  4KIB A;  3KZY A;  3FXU A;  5ILU A;  3VOE A;  2XAF A;  1HW1 A;  4GGG A;  5E8G A;  1SMT A;  5KK1 A;  3T0Y A;  2V1X A;  3T8R A;  2B0L A;  1J7K A;  2K86 A;  2L02 A;  3T8T A;  4MQ9 F;  3JTG A;  2DO7 A;  1RI7 A;  5A2Q K;  1IN8 A;  1Z6T A;  2VN2 A;  3WU0 A;  3T5X A;  2Y0M A;  2ZNY A;  2W84 A;  3V7R A;  1ZRD A;  1JGS A;  2BBY A;  3R61 A;  3F8C A;  3RI4 A;  3K69 A;  3TDZ C;  2P5V A;  2YPR A;  4P9U A;  1U6G A;  5DDG A;  3CUQ B;  1FC3 A;  4HBL A;  4P5O A;  1HBX G;  5H20 A;  1U2W A;  1MDM A;  4EVI A;  2PN6 A;  2WV0 A;  3HRU A;  1SD6 A;  4OIN F;  5JI6 A;  3NRV A;  5D5W B;  3KZZ A;  3KCC A;  4KFC A;  2OZ6 A;  2MBF A;  5BMZ A;  4O3M A;  1B6A A;  1VTN C;  1O3S A;  3I4P A;  2ZFW A;  4MTD A;  2H6C A;  2V6C A;  5LEK A;  1HKS A;  4L9T A;  2FNA A;  1LDK B;  3MZH A;  3TO7 A;  4ZYG A;  3HSR A;  4RAY A;  1B4A A;  1P6R A;  1XMK A;  2MA3 A;  3OV8 A;  2WTE A;  3P7N A;  1MGT A;  3DF8 A;  3H92 A;  2HTJ A;  1J59 A;  1UST A;  4KN4 X;  3SQN A;  2XAG A;  4RB2 C;  3LA7 A;  1PUE E;  1AWC A;  3U1D A;  2RC4 A;  2VT2 A;  1WRJ A;  4ASN A;  4QLC U;  2PFB A;  3FM5 A;  4I98 B;  4UVB A;  2QQ9 A;  1IW7 F;  5L3C A;  2XAQ A;  1KQ0 A;  3I53 A;  2ESN A;  4JK1 X;  1S3J A;  3REO A;  4HX7 A;  1YLF A;  2FBH A;  4OIQ F;  1XGO A;  3NEU A;  4YFN F;  1UCR A;  3DV8 A;  5L3B A;  4AWX B;  2LF7 A;  2VT3 A;  5IT9 Z;  1I27 A;  2C6Y A;  5FGM A;  3WTU C;  2EFN A;  3MWM A;  1ZH5 A;  2ISZ A;  4RB1 A;  1J2X A;  4CDG A;  2OA4 A;  2DQL A;  4P96 A;  4R8H A;  5JHU A;  4YIF A;  4BYY A;  1FOK A;  5AIQ A;  1GXQ A;  4PCQ A;  3TGN A;  4Q48 A;  4BXU A;  2YR2 A;  2IA0 A;  2F5D A;  1HW2 A;  2CFX A;  4L18 B;  5IT9 K;  4RGU A;  4IHS A;  5FLX Z;  1TQM A;  4GXO A;  3E6B A;  4RAZ A;  1ONV A;  4KIC A;  1ZRC A;  5E1X A;  2KIU A;  2O61 A;  3I64 A;  3ZMV A;  1CF7 A;  3PFI A;  2ADU A;  1TW3 A;  4UNO A;  4KMU X;  1HSJ A;  3G3Z A;  4I01 A;  2LDU A;  1XSD A;  2CWE A;  1XDS A;  3SFZ A;  3CO7 C;  3IKV A;  4HDV A;  1FNN A;  1QZY A;  1B59 A;  1FYK A;  1WWX A;  1TQI A;  5E20 A;  5ICF A;  3WTY C;  1DUX C;  3R0A A;  5JFR A;  3IHU A;  4EM2 A;  1LEA A;  3RYP A;  2RNJ A;  2AS5 F;  3E97 A;  3I0T A;  1W5T A;  2QEN A;  2ELH A;  5EEH A;  2LNB A;  4ENJ A;  4L5I A;  2BE5 F;  2HOE A;  3ZN1 A;  1SD7 A;  2M30 A;  4WXD A;  3GZ6 A;  1KQ9 A;  3RJP A;  4A5N A;  5DCM A;  1C0W A;  5DV5 A;  3CO6 C;  1P4X A;  3G73 A;  4BHC A;  2XV4 S;  3BOQ A;  3CUO A;  4E70 A;  3L2C A;  3ELK A;  5LGU A;  3T1B A;  1B9M A;  2XGX A;  4IRH A;  2VE8 A;  4U0V A;  2DW4 A;  5D4R A;  1WQ2 A;  2JPC A;  2HQR A;  1FLI A;  2L4M A;  1Q1H A;  4MEY F;  3QRF F;  3J80 K;  2FA5 A;  1R7J A;  3CTA A;  3I71 A;  1RUO A;  1ZN2 A;  2FQ3 A;  2UXX A;  2LKP A;  3FZV A;  1SD5 A;  4LJZ F;  2FOK A;  2BGC A;  1JXS A;  3HOT A;  3C18 A;  4OMZ A;  4XRF A;  1ZLK A;  2DQR A;  2G7H A;  2QWW A;  2EB7 A;  2K27 A;  3WGH A;  3DPL C;  4HF2 A;  1LDJ A;  6PAX A;  5ED4 A;  3KEQ A;  2CW0 F;  2M5W A;  4EQQ A;  2STT A;  3EUH A;  4HLY A;  2QUF A;  3E5X A;  4IXA A;  2NNN A;  3D5L A;  2GXG A;  3GYH X;  4B09 A;  5DEQ A;  3FMS A;  4OU0 A;  2A68 F;  2D45 A;  3ML6 A;  5ERI A;  1ZAR A;  4ZH4 F;  1IUY A;  5CVV A;  4CYD A;  4N9H A;  3N97 A;  3V8J A;  2MH2 A;  3EYI A;  3F23 A;  4HYE A;  1I1S A;  4EM0 B;  2EK5 A;  1FX7 A;  2QYO A;  2MD5 A;  5BS6 A;  1IXS B;  3F3X A;  4PGH A;  4HQM A;  1F4K A;  3L00 A;  5HLG A;  2W85 A;  1D3Y A;  5DCM B;  4S04 A;  2FEZ A;  3ECO A;  1FP2 A;  4CGZ A;  2CQK A;  2KIF A;  1U5T C;  5TJJ A;  4LB5 A;  4A5M A;  2DU9 A;  5DCF A;  2ZNZ A;  2XAH A;  1P92 A;  1KGS A;  4M71 A;  4WWC A;  4A0Y A;  3HSF A;  2GWR A;  4U0W A;  3FXQ A;  5CVI A;  4WCG A;  4L0Z B;  2IA2 A;  1RUN A;  5IT3 A;  2V79 A;  1EH7 A;  3EDP A;  1G3T A;  4HF1 A;  3V8K A;  4GO1 A;  1SFU A;  1YQA A;  1R5G A;  3K1P A;  2H09 A;  3LWF A;  1YG2 A;  2RGV A;  1MZB A;  2L54 A;  2QM3 A;  4EMS A;  3M8E A;  3L9F A;  5CVJ A;  3J81 K;  2IVM A;  4ZZL A;  2NRA C;  2HWV A;  5L3G A;  2LF8 A;  4LLG F;  3RPQ A;  3W6K B;  2GQQ A;  3V4G A;  2JT1 A;  4OMY A;  3FX3 A;  2O8X A;  2K4B A;  3LQQ A;  2Y75 A;  1SFE A;  5CVU A;  3IC7 A;  3P9C A;  1ZGA A;  2CYY A;  1QNT A;  2JPB A;  2VBY A;  4R1H A;  4UXN A;  1OPC A;  1D5V A;  3IKT A;  1GVJ A;  5K5R A;  4JQF A;  2OU2 A;  4KIG A;  2HYG D;  1FP1 D;  4HLX A;  2MC3 A;  1K6O A;  2FE3 A;  2M8E A;  2EV6 A;  1B9N A;  1PP8 F;  3HSE A;  2PMH A;  3HRS A;  2D1V A;  1S7O A;  2Z9O A;  1GHC A;  4Y17 A;  2OQG A;  1T38 A;  5J8C A;  4WX9 A;  2E1C A;  4Q4Z F;  4LG0 A;  1AOY A;  5L3E A;  4HAM A;  2P8T A;  5F6F A;  1EH6 A;  1O3T A;  3KP4 A;  3I59 B;  3L7W A;  3E6C C;  2P6T A;  2ZCW A;  1YS6 A;  2RVC A;  2ZJ2 A;  4DNC A;  4UV8 A;  4ENN A;  2Z99 A;  3Q5F A;  4QWQ A;  2JSC A;  1GXP A;  3RIR A;  4I0A A;  1R22 A;  4I7H A;  4YG2 F;  4OIO F;  3QP5 A;  1YYV A;  2ISY A;  3IWF A;  2CO5 A;  2K7L A;  3ECH A;  1BJA A;  2XUB A;  4IF4 A;  4B8X A;  4HV6 A;  3BJ6 A;  3WTT C;  1IRF A;  3NQO A;  1FT9 A;  3QU6 A;  3MQ0 A;  4IPA A;  1PDN C;  2A07 F;  4RB0 A;  4CXF A;  2P7V B;  4D0P A;  1B1B A;  1YS7 A;  1XSX A;  2A5Y B;  3M9A A;  2A69 F;  2HS5 A;  2Z5U A;  3GX4 X;  3KP7 A;  3KEO A;  1HXD A;  2QQB A;  5LHG A;  3CJN A;  2OQR A;  3WGI A;  2ZBK A;  4EJW A;  2JTV A;  5CJ9 A;  3F6V A;  2GIV A;  1FBQ A;  2R3S A;  5LHI A;  2IT0 A;  4MQV A;  4LG0 B;  1ZRF A;  5L3F A;  2DPU A;  4Q47 A;  3I59 A;  5CYV A;  2Y48 A;  3J81 Z;  3GLX A;  3BY6 A;  4KT5 C;  5LLQ A;  5FB2 A;  2Z3Y A;  1G4D A;  4A6E A;  1KU9 A;  1XDU A;  2ETH A;  5H6Q A;  1V3F A;  1G3S A;  3HYI A;  4TV7 A;  4CZZ A;  1SD4 A;  2J5P A;  2QQA A;  4HZF A;  1K79 A;  4RGR A;  5DD8 A;  4L5J A;  4GYI A;  4L9N A;  3HRT A;  5ILV A;  1F1Z A;  3LA3 A;  4ENK A;  2OZU A;  2E7W A;  2HKO A;  4G7Z F;  1TQP A;  5H6R A;  5HVQ C;  4Z2Y A;  5D4S A;  1ZYR F;  5BPD A;  3Q9S A;  5E1W A;  3ZMZ A;  3JSO A;  1BOA A;  1ON1 A;  1BIB A;  1STZ A;  2RQP A;  3K2Z A;  3HIF A;  3K1M A;  1JHH A;  1SMY F;  2FNP A;  4MNU A;  1J5Y A;  4ENM A;  3KLO A;  5KVR A;  1KYW A;  1TBX A;  1L0O C;  2KRF A;  1JE8 A;  2RKH A;  2DI3 A;  3ABT A;  2PJP A;  3KP6 A;  3HRM A;  3MZY A;  2FU4 A;  3I54 A;  4BAY A;  3GEZ A;  4JBA A;  3TQN A;  3LA2 A;  1XGS A;  5D6F A;  1YFH A;  2ZXJ A;  2EFW A;  1MJA A;  5DD4 A;  1NHA A;  3VEP A;  1I1G A;  3FMR A;  5LRR A;  4U0Y A;  2NNY A;  1R1V A;  3LAJ A;  1XN7 A;  3DQV C;  4M9Z A;  1E17 A;  1X3U A;  2DFI A;  2VBX A;  4HF0 A;  5HLI A;  2ZME B;  2P4W A;  4UVA A;  3WTZ A;  3PQK A;  4WF2 A;  3IL2 A;  3JAM K;  3ZMD A;  2P6S A;  1TW2 A;  1ZGJ A;  4BHP A;  3WE3 A;  5HS8 A;  2IA1 A;  3BPX A;  4RS8 A;  2HTS A;  4IVN A;  1XGM A;  2XAJ A;  1ON2 A;  3LAP A;  1E2X A;  5FFX A;  1USS A;  1Z9C A;  4YFX F;  5HS7 A;  1TNS A;  3QAH A;  5FFZ A;  4CO8 A;  3WU1 B;  3OOP A;  3WTS C;  1MKM A;  1YW9 A;  3HUG A;  1QQI A;  1YW8 A;  4KMF A;  3RKY A;  5DUI A;  3MAJ A;  3ZMT A;  1IZ1 A;  1HKQ A;  4I02 A;  3F22 A;  3KFW X;  2MLG A;  1QZZ A;  3EYY A;  4IHT A;  3KP2 A;  1U78 A;  1LVA A;  1ZAO A;  5K5Q A;  1T98 A;  3FHZ A;  1H9T A;  1WSU A;  2BEO A;  1IN6 A;  1W7P B;  4IJA A;  2HGC A;  5D6E A;  3FWE A;  5J6X A;  1EV7 A;  4EGY A;  5BPI A;  1WKM A;  2ZME A;  2H6B A;  1P4W A;  4P9F A;  4M73 A;  4A6D A;  1L3L A;  2UZK A;  1HKT A;  3ZMU A;  5HDN A;  3K9T A;  2FRH A;  1Z1D A;  4LLN A;  3QPH A;  1O7F A;  3M7G A;  4UV9 A;  5CLS A;  2PBI A;  3F8M A;  2VE9 A;  4ZZD A;  2NAZ A;  2IJL A;  4OIP F;  3FMQ A;  1LDD A;  4Y15 A;  3FXR A;  2CSO A;  4OOI A;  1QBJ A;  3U9G A;  3O2P E;  1TLH B;  2EFO A;  4A12 A;  1IAW A;  5DYM A;  5FD5 A;  4G9Y A;  2HDC A;  1XMA A;  2RV8 A;  2VBZ A;  2VC1 A;  3TOB A;  2KIM A;  1UFM A;  4EJU A;  1U3E M;  2FBI A;  1DP7 P;  3AAF A;  3V8L A;  1R5H A;  2KJB A;  4KIF A;  1YO5 C;  1OR7 A;  2GA1 A;  1FBS A;  2DK8 A;  1U5T A;  1DPR A;  2A3S A; 
#chains in the Genus database with same CATH topology
 3MZ8 A;  4XON A;  4AYB A;  3TO6 A;  4NB5 A;  4U7B A;  3BG5 A;  5TIS C;  3HC7 A;  2JWT A;  4KUM A;  4YIR X;  4G7H F;  4Y7N J;  4EM1 A;  3R0J A;  4AUX A;  4HX8 A;  5IY5 H;  1A31 A;  4JP0 A;  1R4M B;  3FBN B;  2HZT A;  1VFC A;  2YU3 A;  2W82 A;  2FUG 2;  4XSX F;  5B5E C;  4E6K G;  3HUG B;  3P9I A;  5E1Z B;  3TW6 A;  3V7S A;  5BQT A;  4BQA A;  3WTX C;  1LQ1 A;  1IN5 A;  2K4J A;  3L2Q A;  4A3L J;  1XG1 A;  1FY7 A;  3H3U A;  5EGO B;  4MFE A;  4NC6 A;  3J7A O;  5AIP A;  2UXN A;  1UHM A;  3BR1 A;  4RAF A;  4F93 B;  3GO5 A;  3KP5 A;  5HDK A;  4BJT A;  3OYC A;  2H8W A;  2XHK A;  2QVO A;  4FT8 A;  4D5C A;  4BQQ A;  2EFQ A;  3D0S A;  4KT6 A;  1QPM A;  2M8G X;  2XF6 A;  3DFG A;  3GWZ A;  5HNH A;  1UG0 A;  1OCC H;  2A6T A;  1WI9 A;  3SFI A;  4LOC A;  2L4A A;  1FZP B;  2PMU A;  1KU3 A;  3F9K A;  3CES A;  2LK2 A;  2QA4 I;  3L2V A;  1Y56 A;  3I5U A;  2FMY A;  1R1U A;  1U9O A;  5FD6 A;  3LQR A;  1Y1V J;  2QQ8 A;  2AXL A;  1D0Y A;  5E8I A;  3CMA I;  3M07 A;  3ZQG A;  2Y9Z A;  1OLT A;  5GAE J;  3MKW B;  4UHT A;  1T39 A;  2R7X A;  1OMI A;  3DTI A;  2ZO4 A;  2DMU A;  2QSH X;  1ZG1 A;  3EET A;  2FML A;  3CCL I;  3IWZ A;  3RTR A;  2QZ8 A;  4IQJ A;  2XAS A;  3PFY A;  2GXA A;  3H3Z A;  1GUU A;  3PUF A;  3QQA A;  1D8J A;  3J80 Z;  2K9S A;  3H1C A;  2X4H A;  1FBU A;  1MJ9 A;  4M74 A;  4CH7 A;  4XOP A;  2DAO A;  2EIN H;  4PJ0 C;  1DQU A;  4PGG A;  1LNW A;  2YUS A;  4M72 A;  1IV6 A;  1SVO A;  1ORK A;  2DYR H;  2R7D A;  3S3O A;  1BBY A;  1IDY A;  2CV2 A;  2QSF X;  2STW A;  5AON A;  5L3D A;  2HYF A;  2VLA A;  2H94 A;  5JVT A;  2OD5 A;  2LYC A;  1YIT I;  1BI3 A;  5K5O A;  4HV5 A;  4H0E A;  3BR6 A;  2XRO A;  1SEU A;  3B02 A;  4JYK A;  3RDI A;  2LSO A;  3WTV C;  1DDN A;  2P7C B;  3OYA A;  4G6Q A;  4XRS A;  3K4K A;  1ZG3 A;  2PEX A;  3ZP5 A;  3BRO A;  2B63 J;  1YW7 A;  5E18 F;  1MBG A;  2K5C A;  2PI0 A;  3FIS A;  5ICG A;  5B3S H;  2ZXI A;  1LJ9 A;  3RKW A;  2FJ1 A;  2XRN A;  4N0B A;  2VJ5 A;  5HOD A;  2D2W A;  3ZMS A;  4IRI A;  3H0G J;  1EA3 A;  1I3A A;  2LP0 A;  5BOX A;  1BM9 A;  4MGR A;  1RKT A;  2E1O A;  1REP C;  2Q2E B;  2Y30 A;  4YFK F;  3CLQ A;  3ZQ7 A;  2NOJ B;  4J01 A;  3JAM Z;  1BR2 A;  3CJQ B;  4I76 A;  4WXC A;  2JVG A;  4HDU A;  5LHH A;  4AIK A;  4ZYE A;  4FX4 A;  3M8F A;  2BYV E;  3ZGK A;  4FE7 A;  5E79 C;  1JJ6 C;  2CH0 A;  3I58 A;  1P7J A;  2GAU A;  1IN4 A;  2KIQ A;  4A3J J;  1YTY A;  2VON A;  1FTZ A;  4NBQ A;  2VQC A;  4GRI A;  4DQ2 A;  4MTE A;  1LB2 A;  2M45 A;  3DP7 A;  5DTD A;  5EJC A;  4RA2 A;  2HPI A;  4AVP A;  2X1D A;  1F5T A;  3C3W A;  3CC7 I;  3HOS A;  1ODD A;  3F21 A;  2L3D A;  2ZKZ A;  2E1N A;  3DXJ F;  1MIJ A;  5ILS A;  3S2W A;  3ULQ B;  2DXI A;  4XRS G;  3KET A;  3DLL F;  3NAR A;  4IRG A;  3N4M A;  1WJA A;  3ZQQ A;  3DKW A;  2X6W A;  2L01 A;  3IRQ A;  1BI0 A;  1QO0 D;  1WJF A;  4IHW A;  4P55 A;  4HA8 A;  1OKR A;  2IS6 A;  2FBK A;  5HS9 A;  3ZN0 A;  3E6D A;  4RB3 C;  3DEU A;  4ABZ A;  4AD9 A;  5F64 A;  2EZK A;  4HW0 A;  2NS8 A;  2YU9 J;  3K2A A;  3HTS B;  1H0M A;  4S05 A;  3LL7 A;  3F8B A;  5HOO A;  2W7N A;  4M3D A;  3RPU D;  3HGY A;  3K70 D;  5M5Y J;  2UWM A;  2JUC A;  1XGN A;  2DJN A;  3DBH B;  4L5E A;  4LB6 B;  2CS3 A;  1BOB A;  2Q8K A;  2KJC A;  1UZC A;  1S8N A;  3ABU A;  1D1C A;  3FK7 A;  3M4O J;  2TDX A;  1MD0 A;  4E7J A;  2IS4 A;  1IXR C;  4U87 A;  2ZB9 A;  4PZJ A;  1XD7 A;  2IP2 A;  4XOR A;  3E0J B;  2DDB A;  1J9I A;  2ID3 A;  1FYM A;  2L0K A;  3VYR B;  4DIQ A;  3RKX A;  4M3E A;  2F5F A;  3F6O A;  1FOW A;  4HNV A;  1YRN A;  4KYW A;  2XF7 A;  2EIM H;  2BVM A;  4EJV A;  5D8L B;  4BH9 A;  4LD5 A;  5ICE A;  2CQ7 A;  1X19 A;  2Y0S A;  3SZP A;  5DM6 F;  3TKY A;  4L0Y B;  3W2V A;  5IYC J;  2EV5 A;  5J4Y A;  2OTL I;  3JRH A;  2O3F A;  5K7Z A;  1YJN I;  2HQN A;  2HYJ A;  4EGZ A;  1JKR C;  1QPI A;  3SXY A;  3E6M A;  3BLY A;  1ZK8 A;  2EWN A;  1UB9 A;  4IKF A;  5GPA A;  1H9G A;  2COB A;  5IYB J;  3I4N J;  3HHG A;  3VYT B;  3WE2 A;  3PIO F;  1XCB A;  2L7Z A;  1K4T A;  1TTY A;  3SDG A;  2DK5 A;  4BE2 A;  3E1S A;  1O3Q A;  2DA3 A;  1A04 A;  3CMY A;  3HDD A;  3GZ5 A;  2Z1D A;  1MNM C;  3R4K A;  2CRG A;  2W1O A;  1SFX A;  2E7X A;  3FHN A;  2IW5 A;  3FBI B;  2XPV A;  1K78 B;  3CUQ C;  2WV1 A;  3ABM H;  4CCN A;  4BQN A;  3OYD A;  1U0J A;  1Z91 A;  1KU2 A;  2M7B A;  2WC2 A;  3DU6 A;  3CLO A;  2VKD A;  2R5Z A;  5K1Y A;  4Y13 A;  4BAC A;  2DT6 A;  5LRS A;  2X6O A;  1S72 I;  2EIL H;  4ZYA A;  4U88 A;  3TO9 A;  1KYZ A;  1S9H A;  3R60 A;  2EA2 A;  4UVC A;  3SHF A;  4AID A;  3DPT A;  1MBH A;  4UUV A;  5TGT A;  3U2R A;  3GW2 A;  3S1N J;  3FXK A;  1CGP A;  4E7K A;  4KNY A;  5F0C A;  2DA6 A;  3WG9 A;  1MMG A;  2CGP A;  3IRR A;  4HX4 A;  3JRB A;  1S7E A;  3EUH C;  2IPQ X;  2KP6 A;  1IJW C;  2EFP A;  1OFC X;  1JUS A;  3J7Z I;  3JW4 A;  3COA C;  2JRT A;  1P2F A;  1Z7U A;  3DBL B;  4C2M J;  4BS9 A;  3RSN A;  3CCJ I;  1HW5 A;  2EV0 A;  2PX9 A;  2JQ7 A;  2VAS A;  4IHV A;  3HM5 A;  4XQF A;  2DPD A;  1FEX A;  1BJZ A;  2BXZ A;  3ZPL A;  4LK1 F;  4EV0 A;  5ICC A;  1NTC A;  1UEL B;  1S7A A;  4GYG A;  4P1W A;  3IH4 A;  2ME6 A;  4NDL A;  1N25 A;  3GUD A;  4O6J A;  4A0X A;  1XCV A;  4CHU A;  4CIC A;  5FKM A;  4N9I A;  2MLK A;  1MSE C;  5E3N A;  4BHB A;  4ESF A;  3OOU A;  3K6G A;  2RDP A;  5LGT A;  4I09 A;  1LE8 B;  1FYL A;  3O8G A;  3WGG A;  3L2R A;  1G3W A;  4MIM A;  1FPQ A;  1R49 A;  4A3K J;  3X2Q H;  2BV6 A;  2E5Z A;  2EIK H;  2M3A A;  2NS0 A;  3IP4 B;  5M3M J;  3TDU C;  1OCT C;  2DYS H;  2M87 A;  2DTR A;  1JHF A;  1BN5 A;  4DZJ A;  3HL2 A;  1Z3Y A;  2G0E A;  4A69 C;  2L9N A;  1HST A;  1ZRE A;  2PQ8 A;  3TOA A;  3BPV A;  2VPL A;  2HFH A;  3K1N A;  2NS7 A;  5IP9 J;  3LST A;  3CDH A;  4XN0 A;  1J0R A;  4ETS A;  1HCR A;  3QP6 A;  1R9T J;  1P4A A;  1ZG5 A;  3VOD A;  3KE2 A;  2DA4 A;  1W0T A;  2MG4 A;  1KU7 A;  1W5S A;  1EH8 A;  2JA5 J;  5K7F A;  1ITY A;  5HLH A;  1XPX A;  3PJR A;  3HJE A;  5E3O A;  2Q2E A;  3F8N A;  2JZY A;  2W00 A;  2E19 A;  1SFO J;  2R5Z B;  3FXJ A;  3HPG A;  1YJW I;  1I6X A;  2NYX A;  1M1E B;  2DFE A;  1IXC A;  1IF1 A;  3CUQ A;  3C7J A;  1BIA A;  1RNL A;  4RGX A;  1H88 C;  1IV8 A;  3IAM 2;  2A6H F;  2O0Y A;  1T33 A;  3M3Y J;  4U7D A;  1I5Z A;  1VQ7 I;  2E60 A;  2ZXH A;  4MEX F;  2JA6 J;  3Q9V A;  3S17 J;  3WTW C;  5FJ8 J;  2ESH A;  2Q1Z B;  3ZCO A;  4LIU A;  4M6X A;  4FAS D;  4IOC F;  2LMD A;  4I0B A;  2YSR A;  1Z05 A;  2A6E F;  3JTH A;  3K4N A;  3KLN A;  3MFK A;  5TRD A;  2GBY A;  4KIT B;  4G12 A;  3G4S I;  2X0L A;  4M9S A;  1W7P A;  4O5V A;  1TWC J;  4PDK A;  1VZ0 A;  4M6Y A;  1DU0 A;  2NVX J;  1FWZ A;  2IBD A;  1LPQ A;  1W4M A;  4FX0 A;  2PG4 A;  2Q0O A;  1FSH A;  2CG4 A;  3CZ6 A;  3GXO A;  1ULY A;  4IEJ A;  2L2O A;  2FQ4 A;  4M9X A;  4DOZ A;  5C44 J;  3OS0 A;  4C2U A;  1O3R A;  2RN7 A;  1X3W B;  5A2Q Z;  3BDD A;  4WXH A;  5IOY A;  1BC8 C;  2GIZ A;  4ZYH A;  2MGQ A;  1FIA A;  2O7O A;  3VB2 A;  4KDP A;  4GDF A;  3DU5 A;  1DP3 A;  3BR2 A;  1O7L A;  3B6A A;  4W97 A;  2HEO A;  3CC4 I;  2F6C A;  4L9V A;  3RYR A;  1SVL A;  4E7I A;  1TNT A;  1CF7 B;  4IQ4 A;  5LEJ A;  1SAU A;  2G9W A;  2A61 A;  2W57 A;  4DYR A;  1SAX A;  2HPM A;  2Z33 A;  4ESB A;  4PK4 A;  4OAZ A;  4UUT A;  4CUG A;  1QVU A;  3ISP A;  4HST A;  4RLQ A;  4FCY A;  2ACJ A;  1WI3 A;  4Y4R A;  4JX6 A;  2KFD A;  4G7O F;  1IRG A;  4G8X A;  5LBQ A;  2O03 A;  5JLW A;  2F4I A;  3CCE I;  4BL0 B;  3H5R A;  3JRG A;  2DBB A;  3U1K A;  2HR3 A;  1T0F A;  4FTH A;  4LK0 F;  4ZJZ A;  2FF4 A;  2EBI A;  1VQ8 I;  1HA8 A;  2OUM A;  3JSP A;  3O3K A;  1LUJ B;  2G7U A;  4D7N A;  4A2U A;  2VL8 A;  3BQY A;  5CVR A;  5HNF A;  3PM1 A;  5FO5 A;  3VYS B;  4ON0 A;  1V55 H;  3Q0V A;  1RKW A;  3MKY B;  3I4M J;  2OCC H;  3SJM A;  3UR3 C;  1YHQ I;  2HDD A;  1K7A A;  1WPK A;  1IUF A;  4XKB A;  2QBY B;  4GCV A;  3SZT A;  3K4C A;  1PP7 U;  2QBY A;  1T6S A;  2X6X A;  2UUZ A;  1T95 A;  2YX4 A;  2XPW A;  4G94 A;  4LLL A;  5FRO A;  1MH3 A;  2F2E A;  4KN7 X;  2QKM B;  3E3V A;  5JR3 A;  1K78 A;  4LMY A;  3ASN H;  3C1D A;  3GFM A;  5D8K B;  3HTU A;  4NHJ A;  3GF2 A;  1RIO H;  2BHY A;  3MEX A;  2XKO A;  3BP8 A;  3GTK J;  3E5U A;  4CA0 A;  2R7R A;  4E7L A;  1U5T B;  5HDG A;  3I9V 2;  3A1Y A;  4LFU A;  2P5L C;  4B44 A;  5E17 F;  1IRX A;  5DUK A;  3OSF A;  1RRJ A;  5C4X J;  2F4O B;  2GA2 A;  1Y6I A;  3KIO A;  3UNG C;  2Y0S N;  2XKP A;  3KX2 A;  4W1U A;  2K02 A;  2W24 A;  4HQE A;  3F8F A;  1BR4 A;  1BI2 A;  1BC7 C;  2X1E A;  1QGP A;  2VB6 A;  1OYI A;  1MJB A;  3QU3 A;  2FXA A;  2IAI A;  4XSZ F;  4F7Z A;  1LEB A;  4ZYD A;  4BNC A;  3CJR B;  5IPA A;  2EJR A;  2XSD C;  4YII A;  3OS2 A;  3K10 A;  2EZL A;  2LY9 A;  1FTT A;  2CV1 A;  3R6S A;  4XLP F;  3BJO A;  2E2J J;  3RZO J;  2F5C A;  2W25 A;  2M0C A;  1D1B A;  2DN0 A;  4LGW A;  3TMO A;  2VC0 A;  2V9V A;  4X0G A;  4ESJ A;  3F72 A;  3PSI A;  1OCO H;  1BI1 A;  1MMA A;  2JRM A;  3EQL F;  5IOZ A;  2IEK A;  2VXD A;  4G6D A;  3BTC A;  3VSK A;  2M9H A;  5F1R A;  2QLZ A;  2QF7 A;  3E5Q A;  3OYB A;  4MHG A;  4II2 A;  1OYW A;  2VKE A;  2MH9 A;  3H5N A;  1V4R A;  2P5K A;  3WOD F;  5D5U B;  3PQJ A;  1PUF A;  2LR8 A;  4RGS A;  4WK8 F;  1F9N A;  4IO9 F;  2VBW A;  1VQ6 I;  4PJJ A;  3GFJ A;  4AIH A;  2DT5 A;  2R7F A;  4NQW A;  2PMZ A;  3K70 C;  4IHY A;  4L9J A;  3GFL A;  1A5J A;  1S6L A;  3H9G A;  2D1H A;  3BJA A;  1O57 A;  2M4G A;  3W6J B;  1PYV A;  2EA4 A;  2M1B A;  1XSV A;  5CQE A;  2PLY A;  1T2K A;  3V7C A;  2V26 A;  2BY3 A;  1RPW A;  1FSE A;  2ZXW H;  3RPU A;  4X6A J;  4Y33 A;  3LFK A;  1J75 A;  2KIS A;  1H89 C;  1GV2 A;  4HOB A;  1YIO A;  3QYF A;  2JUG A;  4BBS J;  2XVC A;  4A0Z A;  1IO2 A;  3BZ6 A;  3HBL A;  3MVP A;  5LGN A;  3GVA A;  2ELK A;  3CCY A;  1LE8 A;  3VFZ A;  3MKL A;  2V6E A;  5EEG A;  4E7Z A;  1G6N A;  2H27 A;  1KA8 A;  3BWG A;  1R58 A;  3G1M A;  2F5E A;  3GTG J;  2OBP A;  3K4M A;  3P9K A;  1R1T A;  3QPT A;  1JTX A;  1KQ8 A;  1W7P D;  1J09 A;  3GFI A;  1Y0U A;  3L09 A;  1U8R A;  2DCE A;  3PSF A;  2V1D A;  3KP3 A;  2LBF A;  4B48 A;  2E1M B;  4LIT A;  4XLN F;  2XSJ C;  1EKE A;  3KEY A;  4KJZ A;  1OR7 C;  2DOA A;  3O6B B;  2GXB A;  1ETQ A;  2JVH A;  1UMQ A;  1MDM B;  3ZR8 X;  4RLF A;  2O6G E;  1DPU A;  2DFH A;  3B73 A;  3LSK A;  2DDA A;  4RM3 A;  4BEH B;  3CP2 A;  2VOD A;  2IGK A;  4A3M J;  2LC2 A;  1FMW A;  4BU2 A;  2WY7 Q;  3RKQ A;  1TWH J;  1ZR4 A;  4KA4 A;  1Z6R A;  2R7V A;  1R36 A;  4IX7 A;  2OV7 A;  5J1U A;  2BHZ A;  2M0M A;  2PMZ N;  2XIG A;  2XF5 A;  4I2O A;  1ZLJ A;  3M1E A;  5GTI C;  4EJT A;  2VOP A;  4AIJ A;  4R79 A;  2V1U A;  2HKX A;  1P9Q C;  2NVY J;  5J4V A;  2OAZ A;  1S29 A;  4B4C A;  1HQC A;  1D8K A;  3QYE A;  2LFB A;  3FF5 A;  3OYM A;  2CUZ A;  2VUM J;  2WB1 N;  3LSR A;  1R5I D;  1G2H A;  2HDW A;  1UHW A;  1R00 A;  1ZHF A;  1G3Y A;  3PNV A;  5D5X B;  2WWY A;  1RZ4 A;  3HHH A;  1R23 A;  2FSW A;  4Q5S F;  2DA7 A;  2VOO A;  3RQI A;  4XBF A;  2YX7 A;  3ROU A;  2LY1 A;  2GZW A;  2Y2Z A;  3QOP A;  4EJO A;  1ZTR A;  3FDY A;  2IRF G;  2M34 A;  1XB4 A;  3LSJ A;  1MND A;  2AO9 A;  2KLO A;  5GTH C;  1X2N A;  1W1W E;  1FOX A;  3MCZ A;  2K40 A;  4OIR F;  5D5V B;  2EIJ H;  3M1C A;  2VXZ A;  5EGO A;  1WCM J;  5FLM J;  2COM A;  3HKZ N;  2E5N A;  4BBR J;  2DLL A;  3ERE D;  2J5O A;  3K0L A;  2KKO A;  3V42 A;  3HOX J;  1OYY A;  2ECC A;  3FM3 A;  4FHT A;  5FLX K;  4K2E A;  3QPS A;  1IN7 A;  5J8F A;  4CSW A;  2B9S A;  2I10 A;  4KIB A;  2ZJP F;  2LTP A;  1E0E A;  4V19 K;  3KZY A;  3FXU A;  5ILU A;  3VOE A;  1PUF B;  2XAF A;  1HW1 A;  4GGG A;  5E8G A;  1JUP A;  1SMT A;  5KK1 A;  2HOS A;  4Y52 J;  3T0Y A;  1OQY A;  2V1X A;  1K4S A;  3L2W A;  2R7Q A;  3A03 A;  1YRN B;  4NQW B;  1OCR H;  3T8R A;  2B0L A;  1J7K A;  4QPO A;  2K86 A;  3WHC A;  1VQL I;  2L02 A;  3T8T A;  2KPM A;  2LY2 A;  4MQ9 F;  1EJ9 A;  3JTG A;  1ZR2 A;  1FIP A;  2DO7 A;  5J40 A;  2X6Y A;  1RI7 A;  5A2Q K;  2F48 A;  1IN8 A;  3SZG A;  2R93 J;  1Z6T A;  2VN2 A;  3WU0 A;  3T5X A;  3KYD B;  1GV5 A;  2BW3 A;  2Y0M A;  2ZNY A;  3KPH A;  2QCO A;  2W84 A;  3B6C A;  3BG6 A;  3A4C A;  3HOU J;  3KZI C;  3ZXS A;  2IGO A;  3CDL A;  1GLN A;  3V7R A;  2W48 A;  3VWB A;  1ZRD A;  1JGS A;  2JA7 J;  5E3M A;  2BBY A;  4MLO A;  4ZDO A;  3R61 A;  3F8C A;  3RI4 A;  4HSR A;  2E2I J;  3K69 A;  4NNJ A;  3TDZ C;  2P5V A;  3OR2 C;  2OJE D;  1AHD P;  2Y31 A;  5EF6 A;  1X4P A;  2YPR A;  3BG9 A;  4DYQ A;  4P9U A;  1T8I A;  3HG9 A;  5GP9 A;  1U6G A;  3W2W A;  5DDG A;  3CUQ B;  1FC3 A;  4HBL A;  4P5O A;  1B72 B;  2K9Q A;  1ETY A;  5H20 A;  1RES A;  4D5F A;  5GAG J;  1U2W A;  1HBX G;  4BXX J;  3G1O A;  4AC0 A;  5GAD J;  5EYR A;  2CQN A;  1MDM A;  4CCM A;  4EVI A;  2PN6 A;  2WV0 A;  2YS9 A;  3HRU A;  2Y9Y A;  1SD6 A;  4OIN F;  5JI6 A;  2DMQ A;  1Z21 A;  3NRV A;  3KZZ A;  5D5W B;  3KCC A;  3HEF A;  3PNT A;  3FK6 A;  1VQO I;  3F0C A;  4UB6 C;  4KFC A;  2BY0 A;  3BR3 A;  2OZ6 A;  2MBF A;  5BMZ A;  4O3M A;  1B6A A;  1VTN C;  1O3S A;  3I4P A;  3AFH A;  2ZFW A;  2E2H J;  4MTD A;  2H6C A;  2V6C A;  5LEK A;  1HKS A;  2A5W A;  4L9T A;  2FNA A;  1LDK B;  3MZH A;  5K7H A;  2MW8 A;  3TO7 A;  4ZYG A;  2L5Q A;  2HQ5 A;  3HSR A;  4RAY A;  4RMN A;  2BY2 A;  3A01 B;  3QWL A;  1K61 A;  1E3O C;  3C2B A;  4XLF A;  4A93 J;  3A02 A;  3I3L A;  2R7O A;  1B4A A;  3JRI A;  2V9K A;  2BXY A;  2WAF A;  1P6R A;  1XMK A;  2MA3 A;  3OV8 A;  2WTE A;  3P7N A;  1MGT A;  3DF8 A;  3H92 A;  2HTJ A;  2MC4 A;  3H9J A;  1J59 A;  3W2A A;  1UST A;  4KN4 X;  3SQN A;  2XAG A;  4Z6Y A;  2PJR B;  1LVK A;  3OY9 A;  4RB2 C;  2IGM A;  3LA7 A;  3PL8 A;  1PUE E;  3CF2 A;  1AWC A;  1JKP C;  1JUM A;  2Z2S B;  1QHG A;  2LBF B;  3U1D A;  2RC4 A;  2F4M B;  3OL4 A;  4Y3O A;  3RZD J;  2VT2 A;  1VQ5 I;  1WRJ A;  4ASN A;  4QLC U;  2PFB A;  3FM5 A;  4I98 B;  4NC8 A;  3FXM A;  4UVB A;  1KZH A;  2QQ9 A;  3OYF A;  3DTK A;  1IW7 F;  5L3C A;  2HNH A;  2XAQ A;  5BNG A;  1KQ0 A;  3I53 A;  1OIS A;  1JT0 A;  2ESN A;  4BEH A;  4JK1 X;  1S3J A;  3REO A;  4HX7 A;  5KAI C;  1YLF A;  2FBH A;  4OIQ F;  1XGO A;  3NEU A;  4YFN F;  1UCR A;  3DV8 A;  5L3B A;  4AWX B;  2LF7 A;  4LG3 A;  1WVR A;  5IP6 A;  2VT3 A;  1IC8 A;  5IT9 Z;  1I27 A;  5CKT A;  4DBR A;  2C6Y A;  5FGM A;  2K9L A;  3WTU C;  4IOA F;  1DGW Y;  3TP0 A;  2EFN A;  3MWM A;  1VQM I;  1MNE A;  2ISZ A;  1ZH5 A;  4RB1 A;  1QZE A;  3OL3 A;  4DJA A;  1XX5 A;  2WA0 A;  1J2X A;  4HNU A;  3OYG A;  2VJ4 A;  4CDG A;  2OA4 A;  4RAG A;  2DQL A;  4P96 A;  4BY1 J;  2DA5 A;  4R8H A;  5JHU A;  4YIF A;  3CC2 I;  4BYY A;  3OYN A;  2WAE A;  1Z7L A;  2E1M C;  1FOK A;  5AIQ A;  1GXQ A;  4PCQ A;  1BW5 A;  3TGN A;  4Q48 A;  2HQA A;  4BXU A;  1MBE A;  3GME A;  4YEJ A;  1I50 J;  2YR2 A;  2IA0 A;  2F5D A;  1V5E A;  3SDB A;  2OC6 A;  5J1R A;  3BQZ A;  3GLL A;  3VPR A;  3DBR B;  1FOY A;  2KDO A;  5FKK A;  1HW2 A;  2CFX A;  4L18 B;  4FQG A;  4RGU A;  5IT9 K;  2CUF A;  2E36 A;  2BZT A;  3IH2 A;  4IHS A;  5FLX Z;  2L9S A;  1TQM A;  4GXO A;  3E6B A;  4RAZ A;  4BXF A;  1ONV A;  4KIC A;  3TBI A;  3ZQL A;  1D0Z A;  1S5L C;  2XGC A;  1ZRC A;  3Q0U A;  5E1X A;  2KIU A;  2O61 A;  1HF0 A;  3I64 A;  3ZMV A;  2RAE A;  1CF7 A;  3PFI A;  2ADU A;  1TW3 A;  3FXL A;  4UNO A;  4KMU X;  1HSJ A;  3G3Z A;  1B72 A;  3OIO A;  5FKN A;  4I01 A;  2LDU A;  3GTQ J;  3CCQ I;  1XSD A;  2CWE A;  1KON A;  1XDS A;  2BOL A;  2ECB A;  2WB1 A;  3QPL A;  4OAY A;  3SFZ A;  3CO7 C;  1GT0 C;  4PJN A;  4IHX A;  3IKV A;  4HDV A;  3ZQF A;  1FNN A;  2GOM A;  5B1A H;  1AA7 A;  4IZZ A;  2LRE A;  3OYJ A;  1QZY A;  1B59 A;  1FYK A;  2XRL A;  2JJ7 A;  4XM3 A;  4M3F A;  1WWX A;  1TQI A;  4JX5 A;  5E20 A;  5ICF A;  2VJJ A;  3WTY C;  2X1C A;  4PSX A;  1DUX C;  3R0A A;  2ZSH B;  3DEW A;  3CCV I;  5JFR A;  4EAT A;  2QKL B;  3IHU A;  4EM2 A;  1MBK A;  1LEA A;  1X1A A;  2RNJ A;  2XAU A;  1UHS A;  3RYP A;  2KZG A;  1QA6 A;  4S0H B;  2AS5 F;  3E97 A;  3I0T A;  3QOD A;  1W5T A;  2QEN A;  3S8P A;  3Q3S A;  2V7F A;  2ELH A;  3OYI A;  5EEH A;  2LNB A;  3HKZ A;  2F5V A;  3PIP F;  4ENJ A;  3LSM A;  4L5I A;  2BE5 F;  2HOE A;  3ZN1 A;  1SD7 A;  1XS9 A;  2M30 A;  4WXD A;  3GZ6 A;  1KQ9 A;  3RJP A;  2OCE A;  2A05 A;  3JRD A;  4A5N A;  2JN6 A;  2M7A A;  2EPF A;  5DCM A;  4C3J J;  2MSY A;  1C0W A;  3HB9 A;  4HG2 A;  1ZKG A;  2CQX A;  5DV5 A;  3H36 A;  1P4X A;  4B3A A;  3G73 A;  4BHC A;  3CO6 C;  4CYC A;  1JGG A;  2XV4 S;  3BOQ A;  4RBO A;  3K7A J;  3K4J A;  5FKL A;  3CUO A;  3DTE A;  1GDT A;  4JOM A;  5CQG A;  4E70 A;  4BE1 A;  3MD2 A;  4RDU A;  3L2C A;  1JJ8 C;  2ZJR F;  2NVT J;  3ELK A;  4I99 C;  3HOV J;  5LGU A;  3T1B A;  2VQH A;  1X4O A;  1B9M A;  1F43 A;  4ZTJ A;  2XGX A;  4IRH A;  1LFU P;  2VE8 A;  4U0V A;  1W5C C;  4XN3 A;  2DW4 A;  2K85 A;  4B3X A;  5D4R A;  2CUJ A;  1WQ2 A;  2JPC A;  3ESW B;  2LKS A;  3L1P A;  2CUE A;  2HQR A;  3HPH A;  1FLI A;  2L4M A;  1Z67 A;  4V2G A;  1OJL A;  1T56 A;  5F1J A;  1Q1H A;  4MEY F;  2TRT A;  3OIQ A;  3QRF F;  3J80 K;  2FA5 A;  1WJ5 A;  5CPR B;  1R7J A;  3CTA A;  3I71 A;  1MBJ A;  4IL6 C;  2GM4 A;  2EQR A;  4F55 A;  1VND A;  1RUO A;  1K83 J;  1EF4 A;  2LRD A;  1ZN2 A;  2FQ3 A;  2VI6 A;  2HVS A;  2UXX A;  3A01 A;  1TT5 B;  2LKP A;  3FZV A;  4F3Q A;  3MN2 A;  2EZI A;  1SD5 A;  4LJZ F;  1G59 A;  2FOK A;  4A3G J;  4A3B J;  2BGC A;  1JXS A;  1JKO C;  4J00 A;  4BE0 A;  1N75 A;  1MMS A;  3HOT A;  5EEA A;  3D5R C;  3A0B C;  4I6Z A;  3TED A;  3C18 A;  4OMZ A;  4XRF A;  1ZLK A;  2DQR A;  4H4K C;  5FLV A;  1DGR M;  2CV0 A;  2G7H A;  2QSG X;  5IYD J;  2QWW A;  2X51 A;  2EB7 A;  2K27 A;  3WGH A;  3RQ4 A;  3CMM A;  3DPL C;  4HF2 A;  1LDJ A;  3ZOB A;  1Y39 A;  3S15 J;  3S3N A;  3SEQ A;  6PAX A;  3L2U A;  5ED4 A;  3KEQ A;  2CW0 F;  2M5W A;  4EQQ A;  3KYL A;  3EUH A;  2STT A;  4HLY A;  3EUK L;  2QUF A;  3CJT B;  3I55 I;  3E5X A;  3OS1 A;  3CCM I;  2XB5 A;  1D5Y A;  4IXA A;  2NNN A;  3D5L A;  2GXG A;  2GLO A;  3VSL A;  3GTP J;  9ANT A;  2NVQ J;  3GYH X;  4B09 A;  1JTY A;  5DEQ A;  2JSP A;  2R7W A;  2CU7 A;  2EZH A;  3FMS A;  4OU0 A;  4XMY A;  2A68 F;  2D45 A;  3ML6 A;  5ERI A;  2O9L A;  1NK3 P;  4D1Q A;  2X48 A;  1BL0 A;  1FJL A;  1VQ9 I;  3HOZ J;  1V5G A;  2DMN A;  1MSF C;  1ZAR A;  1NG7 A;  5DM7 F;  4ZH4 F;  4XKW A;  3S3M A;  4ITV A;  2M2E A;  3BR0 A;  1IUY A;  5CVV A;  4CYD A;  3ASO H;  4ZTF A;  4N9H A;  3N97 A;  3HOW J;  2I5U A;  3V8J A;  2MH2 A;  1VQN I;  3EYI A;  2V9P A;  2VJI A;  2Z16 A;  4QPQ A;  2LG4 A;  3F23 A;  3K4B A;  3AL0 B;  4HYE A;  3CCR I;  1I1S A;  2EK5 A;  2QYO A;  1FX7 A;  2HOA A;  4EM0 B;  2MD5 A;  3IV5 A;  2KT0 A;  4E7S A;  5F0H A;  5BS6 A;  1IXS B;  3F3X A;  2FD5 A;  4PGH A;  2K9M A;  4HQM A;  1F4K A;  3L00 A;  5HLG A;  2W85 A;  1D3Y A;  5DCM B;  1VQK I;  1E3H A;  4F91 B;  4CZC A;  2FEZ A;  4S04 A;  3G6E I;  3ECO A;  1FP2 A;  1G8X A;  4CGZ A;  1AKH A;  2CQK A;  2DA2 A;  2KIF A;  2DT7 B;  1K6Y A;  2DA1 A;  4ZDP A;  1TZL A;  1U5T C;  3ZRG A;  3N05 A;  3SYT A;  5TJJ A;  3H0D A;  4A5M A;  4LB5 A;  2DU9 A;  5DCF A;  2ZNZ A;  3AG3 H;  3W3C A;  2XAH A;  1P92 A;  2AQE A;  1YX5 A;  3H3V K;  2ICW G;  1KGS A;  5F08 A;  2RNG A;  4M71 A;  2DMP A;  2MD0 A;  4WWC A;  1WJE A;  4A0Y A;  3HSF A;  3AG4 H;  2GWR A;  4U0W A;  2NVU B;  1X2M A;  2N8G A;  3FXQ A;  5EZH A;  5CVI A;  4WCG A;  1TL8 A;  4L0Z B;  1JT6 A;  2HI3 A;  2IA2 A;  3PO2 J;  1FMV A;  1RUN A;  1YJ9 I;  2K9N A;  5IT3 A;  4JX4 A;  3QOE A;  1UJ8 A;  1ZQ3 P;  2V79 A;  1EH7 A;  3EDP A;  1G3T A;  3H5A A;  4HF1 A;  3GBG A;  4QSH A;  4XOT A;  3V8K A;  3WHB A;  4EEF G;  1ACI A;  4GO1 A;  2TCT A;  1SFU A;  3DWL E;  1UG2 A;  1QVT A;  4N4O B;  1YQA A;  2CW7 A;  3FIW A;  1R5G A;  3M8J A;  1TP4 A;  3K1P A;  4C2T A;  2H09 A;  3LWF A;  3DLA A;  1YG2 A;  2RGV A;  1MZB A;  5H2F C;  2L54 A;  4XL9 A;  2QM3 A;  4EMS A;  3M8E A;  2MAB A;  3L9F A;  2ZSI B;  5CVJ A;  1ETV A;  2ELJ A;  3J81 K;  2IVM A;  2BVL A;  4ZZL A;  3BZC A;  1NH3 A;  2NRA C;  2HWV A;  5L3G A;  2X9D A;  2LF8 A;  4LLG F;  3RPQ A;  3W6K B;  2GQQ A;  3LFU A;  3V4G A;  2JT1 A;  2XGE A;  2BY1 A;  4OMY A;  3OWT A;  3FX3 A;  2AXT C;  2O8X A;  2HU9 A;  2D5V A;  4UY8 I;  1VQ4 I;  2K4B A;  3LQQ A;  2Y75 A;  1HC8 A;  1SFE A;  5CVU A;  3CCU I;  3IC7 A;  4XKV A;  3P9C A;  2PJR A;  1ZGA A;  1R4N B;  2CYY A;  3CP8 A;  1QNT A;  1MH4 A;  1TT0 A;  2JPB A;  2E35 A;  4BQO A;  2VBY A;  3LMM A;  4R1H A;  4UXN A;  1ENH A;  5KCM A;  4BKX A;  3W6V A;  2LKX A;  4XK4 A;  1OPC A;  3KYC B;  3JRF A;  1D5V A;  3H9Q A;  2ID6 A;  3IKT A;  1GVJ A;  1YE9 A;  5K5R A;  4JQF A;  2OU2 A;  2IGN A;  4KIG A;  4BDZ A;  2HYG D;  3BR5 A;  1FP1 D;  1I6H J;  4HLX A;  5EZG A;  3OIP A;  2EH3 A;  2MC3 A;  3CME I;  1K6O A;  2FE3 A;  5KNL A;  4E4H A;  4BUP A;  2M8E A;  2EV6 A;  1B9N A;  4V2F A;  3VDX A;  2ZME C;  5IP7 J;  4XID A;  1PP8 F;  2IS1 A;  4C9Y A;  3OMY A;  3G71 I;  1RC9 A;  3HSE A;  2PMH A;  4A3F J;  1T0F C;  1RET A;  4C3I J;  3HRS A;  3IH3 A;  2D1V A;  3WG7 H;  1S7O A;  2E71 A;  3EUA A;  1SC7 A;  2Z9O A;  1GHC A;  3JRE A;  1XC5 A;  4Y17 A;  3NWS A;  2OQG A;  3ONQ A;  1T38 A;  3NWT A;  4QIW N;  5J8C A;  4WX9 A;  2E1C A;  4Q4Z F;  4LG0 A;  4M3B A;  1AOY A;  5L3E A;  4HAM A;  2P8T A;  5F6F A;  1EH6 A;  4XLA A;  1O3T A;  4XIC A;  1TC3 C;  3KP4 A;  3I59 B;  2WBM A;  3L7W A;  3E6C C;  2P6T A;  2ZCW A;  2NOG A;  5EG0 A;  2RRE A;  1Y0N A;  5F04 A;  1ETX A;  4BGD A;  1YS6 A;  2RVC A;  1NK2 P;  2R92 J;  3S14 J;  4C30 A;  2ZJ2 A;  4DNC A;  2CJJ A;  2R5Y B;  1D1A A;  2HVR A;  4UV8 A;  4ENN A;  2Z99 A;  2Y69 H;  3BZK A;  2LD5 A;  2WAD A;  2FX0 A;  3Q5F A;  4QWQ A;  4UUS A;  4CCL A;  3FKJ A;  2JSC A;  1W36 D;  2LH9 A;  3NAU A;  2H8R A;  1GXP A;  3RIR A;  1Z77 A;  2KRH A;  1WH7 A;  1O4X A;  4I0A A;  1R22 A;  3ZQH A;  4F92 B;  3BT9 A;  4I7H A;  4YG2 F;  1B8I B;  2IXS A;  3QP5 A;  4OIO F;  1X1C A;  1YYV A;  3BC8 A;  2ISY A;  3IWF A;  3ABL H;  2WAQ N;  2L9R A;  2CO5 A;  2K7L A;  4HRI A;  3ECH A;  1BJA A;  3DKY A;  3FXO A;  2XUB A;  3HOY J;  1JI8 A;  3BTL A;  3OR1 C;  4IF4 A;  4B8X A;  4HV6 A;  2M4K A;  3BJ6 A;  2UV1 A;  5C4J J;  3WTT C;  1IRF A;  3NQO A;  2ZFU A;  2H1L A;  1FT9 A;  3FKI J;  3QU6 A;  2NXN B;  3MQ0 A;  4IPA A;  1PDN C;  2A07 F;  1VI0 A;  4RB0 A;  3CDI A;  3GTL J;  4CXF A;  2P7V B;  4D0P A;  1Y8Q B;  1B1B A;  1YS7 A;  2DFF A;  1XSX A;  2A5Y B;  3M9A A;  2A69 F;  1QRY A;  1MBF A;  2HS5 A;  2Z5U A;  3OYK A;  3GX4 X;  3KP7 A;  1ERD A;  3KEO A;  5B66 C;  1HXD A;  2QQB A;  5LHG A;  4F52 A;  1MMN A;  4XNF A;  1I3Q J;  3CJN A;  2OQR A;  2R4G A;  3VYU B;  3WGI A;  2VKH A;  2ZBK A;  4EJW A;  2K3P A;  2JTV A;  5CJ9 A;  3F6V A;  2GIV A;  1FBQ A;  4HNT A;  4B47 A;  1A35 A;  3JR9 A;  3K4L A;  4II3 A;  3GTO J;  2R3S A;  5M5W J;  5LHI A;  2IT0 A;  4MQV A;  5B1B H;  5C3E J;  4LG0 B;  1ZRF A;  5L3F A;  2HZD A;  2H1K A;  1RR8 C;  3PNY A;  3OYL A;  4A3I J;  2DPU A;  4MO7 A;  4Q47 A;  1U8B A;  3I59 A;  2XDV A;  5CYV A;  2Y48 A;  2BW3 B;  4AVZ A;  3J81 Z;  1IG7 A;  2VKV A;  3GLX A;  2O5R A;  3D5S C;  3BY6 A;  4KT5 C;  1ETO A;  3LOC A;  4BJ6 C;  5LLQ A;  1DU6 A;  1I39 A;  5FB2 A;  5F27 A;  4HEA 2;  3TW7 A;  2HVQ A;  2FOW A;  2Z3Y A;  3RCO A;  4DBQ A;  2KDZ A;  1G4D A;  4RM2 A;  2IS2 A;  3AG1 H;  3ZQC A;  4A6E A;  1KU9 A;  3O8H A;  1X58 A;  1XDU A;  2ETH A;  3HGG A;  5H6Q A;  1LFP A;  1V3F A;  2R5Y A;  4B1R A;  1G3S A;  3HYI A;  4TV7 A;  4CZZ A;  1HLV A;  4BDY A;  3EPZ A;  5KHD A;  1BW6 A;  1SD4 A;  2J5P A;  2QQA A;  4DYC A;  3I56 I;  4HZF A;  3BTJ A;  1K79 A;  1R6R A;  1IGN A;  2O8K A;  4RGR A;  1E3P A;  5DD8 A;  4L5J A;  2VPR A;  4GYI A;  1ETK A;  4L9N A;  3HRT A;  5ILV A;  1F1Z A;  1TWA J;  3LA3 A;  1AU7 A;  3CCS I;  4ENK A;  2OZU A;  2E7W A;  3E7L A;  1XTA A;  2HKO A;  1WFX A;  1TQP A;  2CW8 A;  2ME0 A;  4G6T B;  4G7Z F;  4M6V A;  5H6R A;  5HVQ C;  3PUB A;  4Z2Y A;  5D4S A;  1F36 A;  1ZYR F;  5BPD A;  3Q9S A;  1HDP A;  4XLC A;  5E1W A;  3ZMZ A;  3GTM J;  3JSO A;  3CD6 I;  1A36 A;  1BOA A;  1ON1 A;  1BIB A;  3PO3 J;  1STZ A;  3ABK H;  2RQP A;  1Q1V A;  3K2Z A;  4CCO A;  1YOV B;  2RQQ A;  3HIF A;  3K1M A;  3LSH A;  1WJD A;  1JHH A;  1SMY F;  5EDN A;  2KZV A;  2FNP A;  1V5F A;  4MNU A;  2JMW A;  3P5J A;  1J5Y A;  4ENM A;  2L7M P;  3KLO A;  1APL C;  5KVR A;  4UUS B;  1KYW A;  3LSG A;  1TBX A;  1L0O C;  3IUO A;  4A3D J;  2VIX A;  4CYC B;  3AG2 H;  2KRF A;  2WY8 Q;  4XRM A;  1B8I A;  4NUB A;  1JE8 A;  2RKH A;  5LD2 C;  4DGW B;  2AHQ A;  4QTR A;  2DI3 A;  2HOT A;  2KL4 A;  3JRA A;  4GFB A;  4XKC A;  2R7U A;  2ZC2 A;  3ABT A;  2PJP A;  4BJ5 C;  5FRM A;  1SFK A;  2V1N A;  3KP6 A;  3HRM A;  1N78 A;  3MZY A;  2FU4 A;  1SAN A;  3IAS 2;  3SEZ A;  3I54 A;  3LSP A;  1VF9 A;  1ETW A;  2OF7 A;  4BAY A;  3GEZ A;  5J47 A;  2HXO A;  4XR6 A;  4JBA A;  3TQN A;  4D7M A;  3LA2 A;  1XGS A;  3MMY B;  5D6F A;  5JHF A;  1YFH A;  4E7H A;  2ZXJ A;  1X1D A;  4CCJ A;  2EFW A;  2VQL A;  1MJA A;  1Y1W J;  2L7F P;  5DD4 A;  1HDD C;  2KMU A;  3BCB A;  3C2H A;  1NHA A;  3VEP A;  2CMP A;  1I1G A;  3FMR A;  5GAH J;  1YI2 I;  4CCK A;  5LRR A;  5M5X J;  5EG0 B;  4U0Y A;  2NNY A;  1R1V A;  3LAJ A;  1XN7 A;  3DEE A;  3DQV C;  4M9Z A;  4PFP A;  3CQZ J;  1X3U A;  1E17 A;  2DFI A;  2VBX A;  4HF0 A;  4PFO A;  4OWR B;  5HLI A;  2ZME B;  3S93 A;  2P4W A;  4UVA A;  1IRZ A;  3WTZ A;  5J1Y A;  5JLX A;  3PQK A;  4WF2 A;  3IL2 A;  5DS9 A;  3Q0W A;  3JAM K;  3A2K A;  1N77 A;  1WJB A;  3OYH A;  4X1E A;  3ZMD A;  2P6S A;  1TW2 A;  5FKO A;  1ZGJ A;  4BHP A;  3OSG A;  3WE3 A;  3S2D J;  5JVG F;  5HS8 A;  2IA1 A;  3BPX A;  4RS8 A;  2HTS A;  1PVE A;  2KRC A;  1POG A;  4IVN A;  1XGM A;  2B7E A;  3DPU A;  2KHM A;  1A6I A;  3BTI A;  2P81 A;  4PSW A;  2XAJ A;  1ON2 A;  3TL4 X;  3LAP A;  1E2X A;  1HOM A;  5FFX A;  1U9N A;  1USS A;  5KAF C;  2OTJ I;  1WZ2 A;  3G1L A;  4ANJ A;  2L9V A;  1Z9C A;  4YFX F;  5HS7 A;  5FRN A;  2XB0 X;  1TNS A;  5GPC A;  1V54 H;  3S2H J;  3QAH A;  5LFA A;  5FFZ A;  4CO8 A;  1X1B A;  3WU1 B;  1WH5 A;  1SVM A;  3OOP A;  4AYB N;  3WTS C;  2R0Q C;  2R7S A;  3CF5 F;  1ZGW A;  4D9J A;  4PJM A;  1MKM A;  5J3L A;  1YW9 A;  4A3C J;  3HUG A;  1QQI A;  1YW8 A;  4PJL A;  4KMF A;  3RKY A;  1MW7 A;  5DUI A;  3MAJ A;  2XPU A;  2MYS A;  3ZMT A;  1D0X A;  2AQF A;  2DOD A;  2MFZ A;  2GOX B;  1IZ1 A;  1HKQ A;  4I02 A;  2VQG A;  2P0W A;  1LKX A;  2CFO A;  1GVD A;  3KFW X;  2MLG A;  3JRC A;  3F22 A;  2K3F A;  1QZZ A;  2R7T A;  2JK3 A;  5E3L A;  5M3F J;  2HXI A;  4DZP A;  1Z3X A;  3EYY A;  4DW6 A;  4IHT A;  3KP2 A;  4LIV A;  3GZN B;  3HXL A;  4FE4 A;  1PJR A;  3LNQ A;  1U78 A;  1LVA A;  1ZAO A;  1ZEL A;  5HLT A;  3LSI A;  5K5Q A;  4J19 A;  1T98 A;  3FHZ A;  4UB8 C;  1WSU A;  1BR1 A;  1H9T A;  1UAA A;  2R7Z J;  1IDZ A;  4AU7 A;  2V4J C;  3S32 A;  3S1M J;  2BEO A;  1T08 B;  1IN6 A;  3S1R J;  2I8D A;  1W7P B;  4IJA A;  2HGC A;  5D6E A;  3D1N I;  3AKZ A;  3FWE A;  3OYE A;  5J6X A;  2CQQ A;  1EV7 A;  3J7A Y;  2LLK A;  4EGY A;  1AKH B;  3QYB A;  5BPI A;  1WKM A;  2ZME A;  1VQP I;  2WAQ A;  1R71 A;  2H6B A;  1P4W A;  4P9F A;  1MMD A;  4M73 A;  2XGD A;  4A6D A;  1L3L A;  2JA8 J;  1WGX A;  4ZC3 A;  2UZK A;  2KQR A;  3ZMU A;  5HDN A;  1HKT A;  3K9T A;  2JA2 A;  3DCF A;  1X3Z B;  1A6Q A;  2DOE A;  2FRH A;  2DOF A;  1BA5 A;  1XMX A;  2DJI A;  1Z0X A;  1Z1D A;  1W36 C;  4LLN A;  1NG6 A;  2QEX I;  3QPH A;  4XLE A;  3DKX A;  1O7F A;  3M7G A;  4UV9 A;  5CLS A;  1OCP A;  2DTZ A;  2PBI A;  1YIJ I;  2X85 A;  1WJC A;  3F8M A;  4YEL A;  4PUS A;  1OCZ H;  2E34 A;  3AL0 C;  2VE9 A;  3WU2 C;  3H35 A;  1QHH D;  4ZZD A;  2NAZ A;  3A0H C;  3BCA A;  2IJL A;  2LVS A;  4OIP F;  4N4N B;  3FMQ A;  1LDD A;  4ZDL A;  4XLH A;  4Y15 A;  3FXR A;  1JKQ C;  1W0U A;  2CSO A;  2DMT A;  4OOI A;  4FIS A;  1QBJ A;  3U9G A;  1P7I A;  4HPQ A;  1TWG J;  3O2P E;  3C2G A;  1TLH B;  2EFO A;  4A12 A;  1RR7 A;  1YX3 A;  3MKZ A;  1TWF J;  5DYM A;  1IAW A;  3GCM A;  5FD5 A;  2ZJQ F;  4G9Y A;  2HDC A;  1XMA A;  4NC7 A;  3ZQI A;  3BG3 A;  2RV8 A;  1CQT A;  2VBZ A;  2VC1 A;  2OPT A;  5F0F A;  4FET A;  3UKG A;  2W4S A;  1X1P A;  3TOB A;  4AM3 A;  2KIM A;  1UFM A;  4A3E J;  3BG7 A;  3ERM A;  4MFD A;  4BY7 J;  4EJU A;  3G2B A;  1U3E M;  2FBI A;  3HZJ A;  1LFB A;  1DP7 P;  1Y8R B;  3S1Q J;  3AAF A;  3V8L A;  1R5H A;  2KJB A;  4M3G A;  4KIF A;  4KIS A;  1YO5 C;  1WHU A;  1QU3 A;  1OR7 A;  2LOO A;  2GA1 A;  1H8A C;  3U21 A;  4C3H J;  2XC7 A;  4YRV A;  1FBS A;  3J7Y J;  2DK8 A;  4B43 A;  3S16 J;  2QGU A;  1U5T A;  1DPR A;  3TP3 A;  3JCU C;  2A3S A;  3GTJ J;  2L7K A; 
#chains in the Genus database with same CATH homology
 3TO6 A;  4NB5 A;  4U7B A;  4G7H F;  4KUM A;  4EM1 A;  3R0J A;  4HX8 A;  2HZT A;  2YU3 A;  4XSX F;  3P9I A;  5E1Z B;  3V7S A;  5BQT A;  4BQA A;  3WTX C;  1LQ1 A;  1IN5 A;  2K4J A;  1FY7 A;  3H3U A;  3J7A O;  5AIP A;  2UXN A;  1UHM A;  3GO5 A;  3KP5 A;  5HDK A;  2XHK A;  2QVO A;  4FT8 A;  2EFQ A;  3D0S A;  1QPM A;  3DFG A;  3GWZ A;  1WI9 A;  1FZP B;  2L4A A;  2PMU A;  1KU3 A;  3I5U A;  2FMY A;  1R1U A;  5FD6 A;  3LQR A;  2AXL A;  5E8I A;  4UHT A;  1T39 A;  1OMI A;  2ZO4 A;  1ZG1 A;  3EET A;  2FML A;  3IWZ A;  3RTR A;  2QZ8 A;  2XAS A;  3H3Z A;  1D8J A;  3J80 Z;  4M74 A;  2X4H A;  1FBU A;  1MJ9 A;  2DAO A;  4PGG A;  1LNW A;  4M72 A;  2R7D A;  1BBY A;  2STW A;  5AON A;  5L3D A;  2HYF A;  2H94 A;  5JVT A;  2OD5 A;  1BI3 A;  5K5O A;  4HV5 A;  4H0E A;  2XRO A;  3B02 A;  3RDI A;  2LSO A;  3WTV C;  1DDN A;  2P7C B;  4G6Q A;  1ZG3 A;  2PEX A;  3ZP5 A;  3BRO A;  1YW7 A;  5E18 F;  2PI0 A;  5ICG A;  1LJ9 A;  3RKW A;  2XRN A;  4N0B A;  2D2W A;  3ZMS A;  4IRI A;  5BOX A;  1BM9 A;  4MGR A;  1REP C;  4YFK F;  3ZQ7 A;  3JAM Z;  4WXC A;  4HDU A;  4AIK A;  5LHH A;  4ZYE A;  4FX4 A;  3M8F A;  2BYV E;  3I58 A;  2GAU A;  1IN4 A;  1YTY A;  2VON A;  4DQ2 A;  4MTE A;  1LB2 A;  2M45 A;  3DP7 A;  4AVP A;  1F5T A;  3C3W A;  3HOS A;  1ODD A;  3F21 A;  2L3D A;  2ZKZ A;  2E1N A;  3DXJ F;  5ILS A;  3S2W A;  3ULQ B;  3KET A;  4IRG A;  3N4M A;  3DKW A;  2L01 A;  3IRQ A;  1BI0 A;  1QO0 D;  4P55 A;  4HA8 A;  1OKR A;  2FBK A;  5HS9 A;  3ZN0 A;  3E6D A;  4RB3 C;  3DEU A;  4AD9 A;  5F64 A;  4HW0 A;  3HTS B;  1H0M A;  4S05 A;  3F8B A;  5HOO A;  2UWM A;  1XGN A;  4LB6 B;  2Q8K A;  2KJC A;  1S8N A;  3ABU A;  2TDX A;  1MD0 A;  1IXR C;  4PZJ A;  1XD7 A;  2IP2 A;  1J9I A;  1FYM A;  3RKX A;  2F5F A;  3F6O A;  4KYW A;  4EJV A;  5D8L B;  4BH9 A;  4LD5 A;  5ICE A;  3SZP A;  3TKY A;  4L0Y B;  2EV5 A;  2O3F A;  2HQN A;  4EGZ A;  3SXY A;  3E6M A;  2EWN A;  1UB9 A;  1H9G A;  3HHG A;  3WE2 A;  1XCB A;  1TTY A;  2DK5 A;  1O3Q A;  1A04 A;  3GZ5 A;  3R4K A;  1SFX A;  2E7X A;  2IW5 A;  1K78 B;  3CUQ C;  1Z91 A;  1KU2 A;  2WC2 A;  3CLO A;  5K1Y A;  4Y13 A;  5LRS A;  4U88 A;  3TO9 A;  1KYZ A;  3R60 A;  2EA2 A;  4UVC A;  3SHF A;  3DPT A;  4UUV A;  3U2R A;  3GW2 A;  1CGP A;  4KNY A;  3WG9 A;  2CGP A;  3IRR A;  4HX4 A;  2IPQ X;  2EFP A;  3JW4 A;  3COA C;  2JRT A;  1P2F A;  1Z7U A;  1HW5 A;  2EV0 A;  2DPD A;  3ZPL A;  4LK1 F;  4EV0 A;  5ICC A;  1S7A A;  4GYG A;  3GUD A;  4O6J A;  4A0X A;  1XCV A;  4CHU A;  4CIC A;  4N9I A;  2MLK A;  4BHB A;  4ESF A;  2RDP A;  5LGT A;  4I09 A;  1FYL A;  3WGG A;  1G3W A;  1FPQ A;  2BV6 A;  2NS0 A;  3TDU C;  2M87 A;  2DTR A;  1JHF A;  1BN5 A;  1HST A;  1ZRE A;  2PQ8 A;  3TOA A;  3BPV A;  2HFH A;  3K1N A;  3LST A;  3CDH A;  1J0R A;  4ETS A;  3QP6 A;  1P4A A;  1ZG5 A;  3VOD A;  3KE2 A;  1KU7 A;  1W5S A;  1EH8 A;  5HLH A;  2Q2E A;  3F8N A;  2JZY A;  1I6X A;  2NYX A;  1IXC A;  1IF1 A;  3CUQ A;  3C7J A;  1BIA A;  1RNL A;  4RGX A;  2A6H F;  2O0Y A;  4U7D A;  1I5Z A;  4MEX F;  3Q9V A;  3WTW C;  2ESH A;  4M6X A;  4I0B A;  2YSR A;  1Z05 A;  2A6E F;  3JTH A;  3KLN A;  3MFK A;  5TRD A;  2X0L A;  4M9S A;  1W7P A;  4O5V A;  4PDK A;  4M6Y A;  1FWZ A;  1W4M A;  4FX0 A;  2PG4 A;  2Q0O A;  1FSH A;  2CG4 A;  3GXO A;  1ULY A;  4M9X A;  1O3R A;  2RN7 A;  5A2Q Z;  3BDD A;  4WXH A;  1BC8 C;  4ZYH A;  3VB2 A;  4KDP A;  1O7L A;  2HEO A;  4L9V A;  3RYR A;  1CF7 B;  1TNT A;  5LEJ A;  2G9W A;  2A61 A;  2W57 A;  1SAX A;  2Z33 A;  4ESB A;  3ISP A;  2ACJ A;  1IRG A;  4G7O F;  4G8X A;  5LBQ A;  2O03 A;  2DBB A;  2HR3 A;  1T0F A;  4LK0 F;  2FF4 A;  3JSP A;  3O3K A;  2G7U A;  4A2U A;  5CVR A;  5FO5 A;  4ON0 A;  1K7A A;  2QBY B;  4GCV A;  3SZT A;  1PP7 U;  2QBY A;  1T6S A;  2YX4 A;  4G94 A;  4LLL A;  2F2E A;  4KN7 X;  3E3V A;  5JR3 A;  1K78 A;  4LMY A;  3C1D A;  3GFM A;  5D8K B;  3HTU A;  4NHJ A;  3GF2 A;  1RIO H;  3MEX A;  2XKO A;  3BP8 A;  3E5U A;  1U5T B;  5HDG A;  4LFU A;  2P5L C;  5E17 F;  5DUK A;  2GA2 A;  2XKP A;  2K02 A;  2W24 A;  4HQE A;  3F8F A;  1BI2 A;  1BC7 C;  1QGP A;  1OYI A;  1MJB A;  3QU3 A;  2FXA A;  4XSZ F;  4F7Z A;  1LEB A;  4ZYD A;  4BNC A;  2EJR A;  4YII A;  3R6S A;  4XLP F;  3BJO A;  2F5C A;  2W25 A;  4LGW A;  2VC0 A;  2V9V A;  4ESJ A;  3F72 A;  1BI1 A;  3EQL F;  4G6D A;  5F1R A;  2QLZ A;  3E5Q A;  4MHG A;  1OYW A;  2MH9 A;  1V4R A;  2P5K A;  3WOD F;  5D5U B;  3PQJ A;  4RGS A;  4WK8 F;  1F9N A;  2VBW A;  3GFJ A;  4AIH A;  2DT5 A;  2R7F A;  4NQW A;  4L9J A;  3GFL A;  1S6L A;  2D1H A;  3BJA A;  1O57 A;  3W6J B;  2EA4 A;  2M1B A;  1XSV A;  2PLY A;  1T2K A;  3V7C A;  1FSE A;  3RPU A;  3LFK A;  1J75 A;  4HOB A;  1YIO A;  2XVC A;  4A0Z A;  3BZ6 A;  5LGN A;  3GVA A;  3VFZ A;  5EEG A;  1G6N A;  2H27 A;  1KA8 A;  3BWG A;  1R58 A;  2F5E A;  2OBP A;  3P9K A;  1R1T A;  3QPT A;  1KQ8 A;  1W7P D;  3GFI A;  1Y0U A;  3L09 A;  1U8R A;  2V1D A;  3KP3 A;  4XLN F;  3O6B B;  2GXB A;  1MDM B;  2O6G E;  1DPU A;  3B73 A;  2VOD A;  4KA4 A;  1Z6R A;  1R36 A;  2XIG A;  4I2O A;  1ZLJ A;  3M1E A;  4EJT A;  2VOP A;  4AIJ A;  4R79 A;  2V1U A;  2HKX A;  2OAZ A;  1S29 A;  1HQC A;  1D8K A;  3FF5 A;  1UHW A;  1R00 A;  1ZHF A;  1G3Y A;  5D5X B;  2WWY A;  1RZ4 A;  3HHH A;  1R23 A;  2FSW A;  4Q5S F;  2VOO A;  4XBF A;  2YX7 A;  3ROU A;  2GZW A;  3QOP A;  4EJO A;  2IRF G;  1XB4 A;  3MCZ A;  4OIR F;  5D5V B;  2VXZ A;  2COM A;  2DLL A;  3ERE D;  2J5O A;  3K0L A;  2KKO A;  1OYY A;  3FM3 A;  4FHT A;  5FLX K;  4K2E A;  1IN7 A;  5J8F A;  4KIB A;  3KZY A;  3FXU A;  5ILU A;  3VOE A;  2XAF A;  1HW1 A;  4GGG A;  5E8G A;  1SMT A;  5KK1 A;  3T0Y A;  2V1X A;  3T8R A;  2B0L A;  1J7K A;  2K86 A;  2L02 A;  3T8T A;  4MQ9 F;  3JTG A;  2DO7 A;  1RI7 A;  5A2Q K;  1IN8 A;  1Z6T A;  2VN2 A;  3WU0 A;  3T5X A;  2Y0M A;  2ZNY A;  2W84 A;  3V7R A;  1ZRD A;  1JGS A;  2BBY A;  3R61 A;  3F8C A;  3RI4 A;  3K69 A;  3TDZ C;  2P5V A;  2YPR A;  4P9U A;  1U6G A;  5DDG A;  3CUQ B;  1FC3 A;  4HBL A;  4P5O A;  1HBX G;  5H20 A;  1U2W A;  1MDM A;  4EVI A;  2PN6 A;  2WV0 A;  3HRU A;  1SD6 A;  4OIN F;  5JI6 A;  3NRV A;  5D5W B;  3KZZ A;  3KCC A;  4KFC A;  2OZ6 A;  2MBF A;  5BMZ A;  4O3M A;  1B6A A;  1VTN C;  1O3S A;  3I4P A;  2ZFW A;  4MTD A;  2H6C A;  2V6C A;  5LEK A;  1HKS A;  4L9T A;  2FNA A;  1LDK B;  3MZH A;  3TO7 A;  4ZYG A;  3HSR A;  4RAY A;  1B4A A;  1P6R A;  1XMK A;  2MA3 A;  3OV8 A;  2WTE A;  3P7N A;  1MGT A;  3DF8 A;  3H92 A;  2HTJ A;  1J59 A;  1UST A;  4KN4 X;  3SQN A;  2XAG A;  4RB2 C;  3LA7 A;  1PUE E;  1AWC A;  3U1D A;  2RC4 A;  2VT2 A;  1WRJ A;  4ASN A;  4QLC U;  2PFB A;  3FM5 A;  4I98 B;  4UVB A;  2QQ9 A;  1IW7 F;  5L3C A;  2XAQ A;  1KQ0 A;  3I53 A;  2ESN A;  4JK1 X;  1S3J A;  3REO A;  4HX7 A;  1YLF A;  2FBH A;  4OIQ F;  1XGO A;  3NEU A;  4YFN F;  1UCR A;  3DV8 A;  5L3B A;  4AWX B;  2LF7 A;  2VT3 A;  5IT9 Z;  1I27 A;  2C6Y A;  5FGM A;  3WTU C;  2EFN A;  3MWM A;  1ZH5 A;  2ISZ A;  4RB1 A;  1J2X A;  4CDG A;  2OA4 A;  2DQL A;  4P96 A;  4R8H A;  5JHU A;  4YIF A;  4BYY A;  1FOK A;  5AIQ A;  1GXQ A;  4PCQ A;  3TGN A;  4Q48 A;  4BXU A;  2YR2 A;  2IA0 A;  2F5D A;  1HW2 A;  2CFX A;  4L18 B;  5IT9 K;  4RGU A;  4IHS A;  5FLX Z;  1TQM A;  4GXO A;  3E6B A;  4RAZ A;  1ONV A;  4KIC A;  1ZRC A;  5E1X A;  2KIU A;  2O61 A;  3I64 A;  3ZMV A;  1CF7 A;  3PFI A;  2ADU A;  1TW3 A;  4UNO A;  4KMU X;  1HSJ A;  3G3Z A;  4I01 A;  2LDU A;  1XSD A;  2CWE A;  1XDS A;  3SFZ A;  3CO7 C;  3IKV A;  4HDV A;  1FNN A;  1QZY A;  1B59 A;  1FYK A;  1WWX A;  1TQI A;  5E20 A;  5ICF A;  3WTY C;  1DUX C;  3R0A A;  5JFR A;  3IHU A;  4EM2 A;  1LEA A;  3RYP A;  2RNJ A;  2AS5 F;  3E97 A;  3I0T A;  1W5T A;  2QEN A;  2ELH A;  5EEH A;  2LNB A;  4ENJ A;  4L5I A;  2BE5 F;  2HOE A;  3ZN1 A;  1SD7 A;  2M30 A;  4WXD A;  3GZ6 A;  1KQ9 A;  3RJP A;  4A5N A;  5DCM A;  1C0W A;  5DV5 A;  3CO6 C;  1P4X A;  3G73 A;  4BHC A;  2XV4 S;  3BOQ A;  3CUO A;  4E70 A;  3L2C A;  3ELK A;  5LGU A;  3T1B A;  1B9M A;  2XGX A;  4IRH A;  2VE8 A;  4U0V A;  2DW4 A;  5D4R A;  1WQ2 A;  2JPC A;  2HQR A;  1FLI A;  2L4M A;  1Q1H A;  4MEY F;  3QRF F;  3J80 K;  2FA5 A;  1R7J A;  3CTA A;  3I71 A;  1RUO A;  1ZN2 A;  2FQ3 A;  2UXX A;  2LKP A;  3FZV A;  1SD5 A;  4LJZ F;  2FOK A;  2BGC A;  1JXS A;  3HOT A;  3C18 A;  4OMZ A;  4XRF A;  1ZLK A;  2DQR A;  2G7H A;  2QWW A;  2EB7 A;  2K27 A;  3WGH A;  3DPL C;  4HF2 A;  1LDJ A;  6PAX A;  5ED4 A;  3KEQ A;  2CW0 F;  2M5W A;  4EQQ A;  2STT A;  3EUH A;  4HLY A;  2QUF A;  3E5X A;  4IXA A;  2NNN A;  3D5L A;  2GXG A;  3GYH X;  4B09 A;  5DEQ A;  3FMS A;  4OU0 A;  2A68 F;  2D45 A;  3ML6 A;  5ERI A;  1ZAR A;  4ZH4 F;  1IUY A;  5CVV A;  4CYD A;  4N9H A;  3N97 A;  3V8J A;  2MH2 A;  3EYI A;  3F23 A;  4HYE A;  1I1S A;  4EM0 B;  2EK5 A;  1FX7 A;  2QYO A;  2MD5 A;  5BS6 A;  1IXS B;  3F3X A;  4PGH A;  4HQM A;  1F4K A;  3L00 A;  5HLG A;  2W85 A;  1D3Y A;  5DCM B;  4S04 A;  2FEZ A;  3ECO A;  1FP2 A;  4CGZ A;  2CQK A;  2KIF A;  1U5T C;  5TJJ A;  4LB5 A;  4A5M A;  2DU9 A;  5DCF A;  2ZNZ A;  2XAH A;  1P92 A;  1KGS A;  4M71 A;  4WWC A;  4A0Y A;  3HSF A;  2GWR A;  4U0W A;  3FXQ A;  5CVI A;  4WCG A;  4L0Z B;  2IA2 A;  1RUN A;  5IT3 A;  2V79 A;  1EH7 A;  3EDP A;  1G3T A;  4HF1 A;  3V8K A;  4GO1 A;  1SFU A;  1YQA A;  1R5G A;  3K1P A;  2H09 A;  3LWF A;  1YG2 A;  2RGV A;  1MZB A;  2L54 A;  2QM3 A;  4EMS A;  3M8E A;  3L9F A;  5CVJ A;  3J81 K;  2IVM A;  4ZZL A;  2NRA C;  2HWV A;  5L3G A;  2LF8 A;  4LLG F;  3RPQ A;  3W6K B;  2GQQ A;  3V4G A;  2JT1 A;  4OMY A;  3FX3 A;  2O8X A;  2K4B A;  3LQQ A;  2Y75 A;  1SFE A;  5CVU A;  3IC7 A;  3P9C A;  1ZGA A;  2CYY A;  1QNT A;  2JPB A;  2VBY A;  4R1H A;  4UXN A;  1OPC A;  1D5V A;  3IKT A;  1GVJ A;  5K5R A;  4JQF A;  2OU2 A;  4KIG A;  2HYG D;  1FP1 D;  4HLX A;  2MC3 A;  1K6O A;  2FE3 A;  2M8E A;  2EV6 A;  1B9N A;  1PP8 F;  3HSE A;  2PMH A;  3HRS A;  2D1V A;  1S7O A;  2Z9O A;  1GHC A;  4Y17 A;  2OQG A;  1T38 A;  5J8C A;  4WX9 A;  2E1C A;  4Q4Z F;  4LG0 A;  1AOY A;  5L3E A;  4HAM A;  2P8T A;  5F6F A;  1EH6 A;  1O3T A;  3KP4 A;  3I59 B;  3L7W A;  3E6C C;  2P6T A;  2ZCW A;  1YS6 A;  2RVC A;  2ZJ2 A;  4DNC A;  4UV8 A;  4ENN A;  2Z99 A;  3Q5F A;  4QWQ A;  2JSC A;  1GXP A;  3RIR A;  4I0A A;  1R22 A;  4I7H A;  4YG2 F;  4OIO F;  3QP5 A;  1YYV A;  2ISY A;  3IWF A;  2CO5 A;  2K7L A;  3ECH A;  1BJA A;  2XUB A;  4IF4 A;  4B8X A;  4HV6 A;  3BJ6 A;  3WTT C;  1IRF A;  3NQO A;  1FT9 A;  3QU6 A;  3MQ0 A;  4IPA A;  1PDN C;  2A07 F;  4RB0 A;  4CXF A;  2P7V B;  4D0P A;  1B1B A;  1YS7 A;  1XSX A;  2A5Y B;  3M9A A;  2A69 F;  2HS5 A;  2Z5U A;  3GX4 X;  3KP7 A;  3KEO A;  1HXD A;  2QQB A;  5LHG A;  3CJN A;  2OQR A;  3WGI A;  2ZBK A;  4EJW A;  2JTV A;  5CJ9 A;  3F6V A;  2GIV A;  1FBQ A;  2R3S A;  5LHI A;  2IT0 A;  4MQV A;  4LG0 B;  1ZRF A;  5L3F A;  2DPU A;  4Q47 A;  3I59 A;  5CYV A;  2Y48 A;  3J81 Z;  3GLX A;  3BY6 A;  4KT5 C;  5LLQ A;  5FB2 A;  2Z3Y A;  1G4D A;  4A6E A;  1KU9 A;  1XDU A;  2ETH A;  5H6Q A;  1V3F A;  1G3S A;  3HYI A;  4TV7 A;  4CZZ A;  1SD4 A;  2J5P A;  2QQA A;  4HZF A;  1K79 A;  4RGR A;  5DD8 A;  4L5J A;  4GYI A;  4L9N A;  3HRT A;  5ILV A;  1F1Z A;  3LA3 A;  4ENK A;  2OZU A;  2E7W A;  2HKO A;  4G7Z F;  1TQP A;  5H6R A;  5HVQ C;  4Z2Y A;  5D4S A;  1ZYR F;  5BPD A;  3Q9S A;  5E1W A;  3ZMZ A;  3JSO A;  1BOA A;  1ON1 A;  1BIB A;  1STZ A;  2RQP A;  3K2Z A;  3HIF A;  3K1M A;  1JHH A;  1SMY F;  2FNP A;  4MNU A;  1J5Y A;  4ENM A;  3KLO A;  5KVR A;  1KYW A;  1TBX A;  1L0O C;  2KRF A;  1JE8 A;  2RKH A;  2DI3 A;  3ABT A;  2PJP A;  3KP6 A;  3HRM A;  3MZY A;  2FU4 A;  3I54 A;  4BAY A;  3GEZ A;  4JBA A;  3TQN A;  3LA2 A;  1XGS A;  5D6F A;  1YFH A;  2ZXJ A;  2EFW A;  1MJA A;  5DD4 A;  1NHA A;  3VEP A;  1I1G A;  3FMR A;  5LRR A;  4U0Y A;  2NNY A;  1R1V A;  3LAJ A;  1XN7 A;  3DQV C;  4M9Z A;  1E17 A;  1X3U A;  2DFI A;  2VBX A;  4HF0 A;  5HLI A;  2ZME B;  2P4W A;  4UVA A;  3WTZ A;  3PQK A;  4WF2 A;  3IL2 A;  3JAM K;  3ZMD A;  2P6S A;  1TW2 A;  1ZGJ A;  4BHP A;  3WE3 A;  5HS8 A;  2IA1 A;  3BPX A;  4RS8 A;  2HTS A;  4IVN A;  1XGM A;  2XAJ A;  1ON2 A;  3LAP A;  1E2X A;  5FFX A;  1USS A;  1Z9C A;  4YFX F;  5HS7 A;  1TNS A;  3QAH A;  5FFZ A;  4CO8 A;  3WU1 B;  3OOP A;  3WTS C;  1MKM A;  1YW9 A;  3HUG A;  1QQI A;  1YW8 A;  4KMF A;  3RKY A;  5DUI A;  3MAJ A;  3ZMT A;  1IZ1 A;  1HKQ A;  4I02 A;  3F22 A;  3KFW X;  2MLG A;  1QZZ A;  3EYY A;  4IHT A;  3KP2 A;  1U78 A;  1LVA A;  1ZAO A;  5K5Q A;  1T98 A;  3FHZ A;  1H9T A;  1WSU A;  2BEO A;  1IN6 A;  1W7P B;  4IJA A;  2HGC A;  5D6E A;  3FWE A;  5J6X A;  1EV7 A;  4EGY A;  5BPI A;  1WKM A;  2ZME A;  2H6B A;  1P4W A;  4P9F A;  4M73 A;  4A6D A;  1L3L A;  2UZK A;  1HKT A;  3ZMU A;  5HDN A;  3K9T A;  2FRH A;  1Z1D A;  4LLN A;  3QPH A;  1O7F A;  3M7G A;  4UV9 A;  5CLS A;  2PBI A;  3F8M A;  2VE9 A;  4ZZD A;  2NAZ A;  2IJL A;  4OIP F;  3FMQ A;  1LDD A;  4Y15 A;  3FXR A;  2CSO A;  4OOI A;  1QBJ A;  3U9G A;  3O2P E;  1TLH B;  2EFO A;  4A12 A;  1IAW A;  5DYM A;  5FD5 A;  4G9Y A;  2HDC A;  1XMA A;  2RV8 A;  2VBZ A;  2VC1 A;  3TOB A;  2KIM A;  1UFM A;  4EJU A;  1U3E M;  2FBI A;  1DP7 P;  3AAF A;  3V8L A;  1R5H A;  2KJB A;  4KIF A;  1YO5 C;  1OR7 A;  2GA1 A;  1FBS A;  2DK8 A;  1U5T A;  1DPR A;  2A3S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...