3QU7A

Crystal structure of pyrophosphatase from bacteroides thetaiotaomicron, asp13asn mutant complexed with calcium and phosphate
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
221
structure length
221
Chain Sequence
KLKAVLFDMNGVLFNSMPYHSEAWHQVMKTHGLDLSREEAYMHEGRTGASTINIVFQRELGKEATQEEIESIYHEKSILFNSYPEAERMPGAWELLQKVKSEGLTPMVVTGSGQLSLLERLEHNFPGMFHKELMVTAFDVKYGKPNPEPYLMALKKGGLKADEAVVIENAPLGVEAGHKAGIFTIAVNTGPLDGQVLLDAGADLLFPSMQTLCDSWDTIML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INORGANIC PYROPHOSPHATASE
publication title Divergence of Structure and Function in the Haloacid Dehalogenase Enzyme Superfamily: Bacteroides thetaiotaomicron BT2127 Is an Inorganic Pyrophosphatase.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
total genus 78
structure length 221
sequence length 221
chains with identical sequence B
ec nomenclature ec 3.6.1.1: Inorganic diphosphatase.
pdb deposition date 2011-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3qu7A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3qu7A01
1TJ4A 4ZEWA 2X4DA 3DNPA 1PW5A 3KD3A 2YBDA 2JAUA 3ZWKA 4UM7A 1YDFA 1NRWA 4UMEA 2YJ5A 2I54A 2BDEA 2R8ZA 1TA0A 2YN4A 3ESRA 4UATA 2HCFA 3L0YA 3ET4A 3L7YA 2NYVA 2ZBGA 1VJ5A 4RESA 3NASA 1T5SA 2PR7A 2EAUA 2MU2A 3U7FB 3ZUPA 1Z88A 3MN1A 2B1RA 2RB5A 4AS2A 4I9FA 2O9JA 2BY4A 2FPUA 5AI4A 5AESA 3W5CA 4BEVA 4XQ0A 2FUCA 4O8CA 2GHTA 4E88A 3W5AA 1AQ6A 2I6XA 2G09A 2YJ4A 3DV9A 1Z4MA 4RETA 4FYPA 5AM4A 3WK9A 3KZXA 3BA6A 4CF5A 3OCZA 1Z5GA 3CZ4A 3QU4A 5AI8A 2IOFK 2ZBFA 2B30A 2G0AA 3QUCA 2D2VA 5ALLA 1L6RA 3QU9A 4Y2VA 2YMQA 2B8EA 2HO4A 2P69A 3ZWDA 2RARA 5T41A 2I55A 3A1CA 5AKEA 3OCUA 2P27A 4G63A 3E58A 5ALEA 3QYPA 3BWVA 2OBBA 2QYHA 4Y2YA 3L8EA 2ZG6A 4OD0A 5ALTA 4KNWA 4J03A 4CNQA 4JB3A 4UASA 2IYEA 2G08A 4EZEA 5AIAA 3AR2A 5AVUA 3A1DA 3AR5A 1QH9A 3L1UA 4IG4A 3ZTYA 1Z4NA 1Y8AA 3ET5A 3L1VA 5AI6A 1Z4QA 3I1YA 4UMDA 3QX7A 4NABA 4B6JA 2R8YA 3ZX4A 3UMBA 3OCVA 4HAIA 4UW9A 4HYTA 1Z4JA 4PNHA 5AKYA 2IOFA 4J2TA 1RMTA 2YMMA 3B9BA 5A3RA 5AM3A 5AVZA 4NV0A 3SHQA 3UMCA 3OCWA 5IT4A 2EARA 4QJBA 5AVXA 3SMVA 4C4TA 3NANA 2OA0A 4XOUA 3EF0A 2I34A 2WF6A 3FVVA 3NAMA 3WKDA 3ZU6A 2GHQA 3FZQA 2CFRA 4CE6A 1NNLA 3OCYA 3L0CA 5AVTA 4UU0A 1WPGA 1RMYA 4C4SA 2ZBDA 4EEKA 3F9RA 1XP5A 2NO4A 3AR7A 2R8EA 2GFHA 3WK8A 5AW7A 4F71A 5AIBA 4NWIA 1SWVA 4EX6A 4OHFA 3U19A 3SLRA 2HEGA 5AKJA 5ALUA 4Y2JA 3SKYA 3N5KA 1U2SA 2YJ3A 5AW6A 1RKQA 2HSZA 1WVIA 5AKLA 5ALWA 1U02A 3N28A 4YCLA 2CFSA 2AUTA 5A3SA 5ALJA 1S8OA 1L7OA 2Q4TA 1Z4KA 2CN1A 3ZTWA 1Z4LA 3B9RA 5ALXA 3WKBA 2HOQA 3U7GA 5AM1A 3QGMA 2P11A 1LVHA 1L7NA 2C4NA 4FFDA 2MU1A 4YIHA 2G06A 2CFTA 4CF4A 1Z5UA 3ZVLA 3IB6A 4I9GA 1ZJJA 3OCXA 1ZRMA 5AM2A 2FDRA 4ZEXA 3U26A 3WGUA 3ZW7A 3B8EA 1Z4IA 1L7MA 1SU4A 3D6JA 5ALPA 4HGPA 3KOOA 3DDHA 4Y3UA 5AVVA 3L8HA 2PKEA 1RLOA 2ZXEA 3NIWA 3QUBA 5AM5A 4F72A 2FI1A 3N1UA 1WR8A 2EATA 3SKXA 4HGQA 2FPXA 2YY6A 3PGVA 1ZS9A 1F5SA 3KDPA 4BKMA 1LTQA 2G07A 3AR3A 2AMYA 4BNDA 2WF8A 2NO5A 1QQ5A 3WKAA 3U7HB 3R4CA 4EELA 5AKGA 3UMGA 1YMQA 2HF7A 5AKZA 5AW5A 1L8OA 1Z4OA 1O08A 2WFAA 5ALSA 4QQFA 4XPZA 4UAUA 1Q91A 5AKHA 4UARA 1YJ5A 1KYTA 4KYTA 3SD7A 1RKUA 3ESQA 4Y2TA 5IS2A 3KC2A 5ALHA 5AK3A 2WF9A 1NF2A 4BBJA 1RC8A 5AK6A 5ALQA 1TJ3A 3QUQA 1T5TA 2JGAA 1ZOLA 1EK2A 5AW3A 4UAVA 1XPJA 2C8LA 2PQ0A 2RAVA 3R09A 3QU2A 3N8GA 3WKCA 3QNMA 1N8NA 3CNHA 4BX2A 3M9LA 1RLTA 4CF3A 4HGRA 3M1YA 2HX1A 4Y2QA 1K1EA 4L57A 4UM5A 3I76A 3VAYA 4H1WA 3W5BA 2B82A 5ALDA 3SF0A 1RRCA 1U7PA 5AW0A 3IRUA 4Y2UA 5ALFA 1RMQA 1RPZA 3L8FA 2IOHA 4HGNA 1QQ6A 4GIBA 1VJRA 2ODAA 4KX3A 5AI5A 4L6AA 3L5KA 4HGOA 2BDUA 3PCTA 4DW8A 2FPSA 5ALKA 1X42A 1S2OA 4ZEVA 1JUDA 3AR6A 3L8GA 5AK5A 5AI0A 3QUTA 2W4MA 1ZD2P 1RDFA 5AW1A 3OTQA 2HF2A 1QQ7A 5AW8A 5ALYA 2HDOA 3HYCA 3E84A 2O2XA 2G80A 3QXGA 5AW9A 3ZI4A 3S6JA 4YGYA 4BEWA 3FGOA 4DWOA 3ONNA 5A3QA 3A3YA 1FEZA 4OCZA 5AKIA 2I7DA 4AS3A 4JDPA 1TJ5A 3FPBA 2AGVA 5AKXA 1L8LA 1MH9A 1CQZA 4BYGA 2B1QA 2AH5A 4AP9A 3MC1A 4L6CA 3GYGA 3EWIA 1TE2A 1ZD4A 2W43A 2C9MA 2IA5A 2WF5A 2JAWA 4KN8A 4OFZA 5AK4A 2B8JA 4GXTA 3E8MA 1YV9A 3AR8A 3RFUA 5ALOA 4Y2RA 3U13A 1Z4PX 3NRJA 1Q92A 4DCCA 4FE3A 3WK5A 3EF1A 3ZVMA 4DFDA 3HLTA 3WGVA 5IT0A 4YIKA 1U7OA 4C4RA 3DAOA 4YH1A 2ZBEA 2HHLA 2C88A 5AVRA 1ZD3A 3FM9A 2OM6A 2YJ6A 1YS9A 4BX0A 4Y2XA 4NAVA 3MMZA 3P96A 1VFPA 2W11A 1CR6A 1ZD5A 3PGLA 5AI9A 3KBBA 3AR9A 2WHEA 4YCMA 2G1AA 3WK4A 1YNSA 5AKKA 1EK1A 5E0OA 1L7PA 5AICA 3WK7A 4Y2SA 3QU5A 3AR4A 2B0CA 5ALZA 2VKQA 4MWOA 3ZX5A 2QLTA 5AVQA 3K1ZA 4G9BA 3WKEA 5AHXA 1WZCA 1QYIA 1XVIA 4XE5A 5ALRA 2R8XA 5AW2A 5AVSA 3ZVNA 3WK6A 2C8KA 3J7TA 3A1EA 4EENA 3U7EB 3IJ5A 4BX3A 3OPXA 1J97A 2Q4RA 2MSNA 2YFYA 1RQLA 5JJBA 5AVWA 4BNDB 5AW4A 2WM8A 1J8DA 2GMWA 3NALA 2HI0A 4Y2PA 1RKVA 2YMLA 3RF6A 2ZOSA 5ALIA 3W5DA 5ALNA 2FPRA 3I28A 5ALVA 2Q5EA 3E81A 5AVYA 2JARA 3R9KA 3UM9A 1T9ZA 4EX7A 5FP0A 3QLEA 4NFLA 1SWWA 3PDWA 4UU1A 3TLMA 3ED5A 3NUQA 1N9KA 1ZRNA 1IWOA 3I6BA 2P9JA 1RLMA 2GO7A 3EPRA 2OYCA 2I33A 4KNVA 2DQSA 3QU7A 2WF7A 2RBKA 3MPOA 4UMVA 4MUMA 4UMFA 5ALGA 3FPSA 4YCNA 5AM0A 1RQNA 1U2TA 2YMPA 4KX5A 2FEAA 1O03A 2JAOA 3N07A 2FUEA 3L0BA 4IFTA 5ALMA 2FPWA
chains in the Genus database with same CATH superfamily
4PFSA 3F0TA 1P2DA 3DUFA 2GN6A 4PPGA 4NXZA 3OZRA 3LLMA 2DQ4A 3R4VA 3K6JA 3H9EO 4FIZA 3PY8A 3FNHA 7ICGA 5EZYF 4BLTA 3L7MA 2V45A 2YX8A 3QW4B 3HXPA 2WWGA 3M5WA 4DJJA 3H2KA 4GG1A 2YR0A 4EB6A 2P2SA 5FR2A 1OI7A 1L6RA 2BPFA 2HDNB 5KT6A 4ZVNA 4GL2A 4YEDA 3K8QA 5CRXA 4W8HA 4G63A 4KN9S 2J9XB 1GPWB 1NFQA 5BN4A 2L18A 1QNLA 3TUIC 4FYWA 1GTSA 5K0EA 3S5UA 5KC8A 1R9MA 4CTMA 1DC3A 4LJLA 1TLFA 2XUHA 4J9UE 3ZIAA 2Y1GA 4GWKA 1AQJA 4FFWA 1C9JA 3HKEA 1AZSC 2BFOA 2QW1A 3B36A 3D2BA 2ETXA 1CQWA 2ZE5A 1GL6A 5TEVA 1DGSA 5DCYA 4R40A 1XMQB 1OFGA 2FR8C 5CB0A 5EKUA 2A8YA 3BFKA 3I6IA 3D5TA 1RI3A 2EZ8A 2X23A 5JI2E 4BO2A 4B3MB 5J9FA 3UFXB 3FOFC 1TAQA 3CVXA 4NWIA 1ZQPA 4RVHA 1CP3A 1L6NA 5D5QA 2B2NA 3HCCA 3LUGA 1QSYA 3SSOA 3E5RA 2CUZA 2AV6A 1P2BA 4ZMRA 3EGVA 3NQ41 3H1BA 4I4TB 1X7DA 4OHZA 2R7AA 3C3MA 4MRMA 5AM1A 4FNAA 1M1UA 1LDGA 1AGYA 1TK2A 3OCXA 2DLNA 4AFNA 2A1AA 3IP6A 1W0KA 1RHUA 1Z2PX 3AF4A 1A50B 1NM5A 1PFKA 4FHCA 2ZB2A 2XDQB 3GLRA 4HB3A 2B8NA 1CDZA 2NO5A 4MV6A 3DVAB 1KY5A 1KA9H 2FGKA 3GUHA 1C29B 1X6VA 5M2QA 2K4PA 2OZEA 4MLZA 2ZAOA 3ESQA 5FLKA 5DX0A 1SUFA 4I2EA 1BSVA 1M1YB 5IULC 2P9FA 1TFRA 1JAYA 5FI0B 1W44A 4LG1A 4RJ2A 4F1WA 4A8HA 4FBGA 3E23A 4YQYA 2C84A 3ZWVA 4S1TA 3NEYA 1VKHA 4PHGA 5IMBA 4BQOA 4UXHA 2MMGA 3UW1A 5HHIA 4Q9LA 1MENA 1Z2CA 2CNWD 3N9IA 1WV0A 1SQ6A 4DVJA 1MABA 5JTUA 1PT7A 4BEWA 5B6IA 5KB3A 4LRXA 4EI2A 2JIDA 5KKAA 3A3YA 2LE0A 5IXJA 2XMCA 3V1TC 4AC9A 2XCOA 1XMJA 3N2LA 1PJAA 3HADA 4KJXA 1CK4A 2NU7B 3DR5A 1I4EB 1FYFA 5J0XA 2PWZA 1CUZA 4J0GA 3K9LA 3O26A 10MHA 1GN9A 2FPPB 2ZGVA 5CLJA 3FAZA 1W1UA 3COWA 2PYIA 5EZSA 3VYRB 3JQFA 1NASA 3AFIA 3ZHXA 1UODA 4C1BA 2OCBA 1M5RA 3FMPB 1F20A 2G40A 4KMRA 2DT5A 3K0CC 4KIGA 1RI1A 1Q0RA 3K1AA 4Q4HB 3VR3A 2JDID 1A8UA 1YVDA 3CUTA 1Y33E 2WHPB 5A1TA 2QTMA 3N7TA 3SIRA 1EM8A 3PYLA 3SN6A 1E3SA 3PTAA 3HUDA 1TQHA 2ZS7A 3G2HA 2K4HA 1G5PA 4R5MA 3Q11A 1HI9A 2XVXA 4JV5B 1WHSA 1KK2A 4N7RA 1VJDA 4U7PB 2Y2VA 1HM5A 3FJOA 1XDWA 1U8ZA 1Q2XA 1XD9A 3RHZA 3HVRA 1NBMA 4RZUA 2XGGA 1ZITA 2QB0B 1CS0B 5LVAA 5MN5A 3G0HA 3F4LA 4XWYA 4NYMR 4WZ6A 1ST3A 4XGNA 1BKSB 1FFCA 3EC7A 2QM8A 5D51S 2WWYA 1BJTA 3F8TA 3NWPA 1DFGA 4PRYA 4A8JB 3CLRD 2QEQA 1LVGA 1XTPA 4H0NA 2MU2A 3THSA 3LGAA 4WE3A 9ICXA 4KDCA 1XWWA 3CLSC 1NOJA 1YQUA 4NYJQ 2QA5A 3BWCA 1GKLA 3NOOA 4MQFB 3SNHA 3V6MA 1YR7A 1Q6ZA 2ZBFA 4PHFA 2ORVA 2NRZA 2HO4A 3R7AA 2QU7A 5FPSA 2B4RO 3WDSA 4CQJA 2QARB 4HY3A 3D6VA 3KR0A 5MFPA 4D80A 2DKNA 2VZEA 3H4TA 3CINA 2I0FA 1EFPB 1VLQA 3HGMA 2M1ZA 3AC0A 3ANNA 1DEKA 1L4NA 4EZEA 1THGA 4D8WA 2W2QA 5A9RA 3GILA 4UNQA 1R8SA 3BJEA 3BZCA 5HM6A 3A6EA 3ITDA 5IH7A 5TX7A 2VAXA 1T2CA 1M75A 2O6LA 1HF3A 2Q0XA 5C2JB 2XTMA 4V2UA 5LWQA 5FI1B 3DVSX 2QJOA 3DZGA 4IXNA 1MB2A 1ZQYA 2WKQA 5JY1A 2O1EA 1U8AA 3EVGA 4PGAA 3VMFA 3FYUB 2H7XA 3GFRA 4FMBB 5DK6A 1I3MA 4YC7A 4ZZ0A 5L3RA 1S8OA 4EM6A 1HOXA 1SUPA 3D3KA 3I4CA 3KKPA 3EOZA 4AP5A 2H3VA 1XEWX 1HY3A 4EQ6B 4CIAA 4Q7QA 3KQLA 2XCPA 1C9MA 4BO8A 5IVKA 3PLRA 1C3LA 5ER6A 3AKDA 4MGZR 2BTQB 2V7UA 5B3AA 5HK9A 2NRWA 2FZGA 3MWKA 4B87A 4WOJA 2UU9B 2AMJA 5CD1A 1XJQA 3E7DA 3GCXA 4ZAFA 3MWEB 1J5XA 3C6MA 1QAOA 4KGXA 2HVIA 4WOBA 2D3DA 4K5QA 1DXQA 3F78A 3T3DA 3Q6NA 4JBWA 1UMDB 2P2YA 5IJAA 4TUYF 3OJOA 2NAPA 2EJCA 1MG5A 3U3OA 2X8BA 4RUKA 3N6VA 4KIJA 3BBPA 2AQ0A 2I80A 5ILQA 4YAJA 2OB1A 2E89A 2ECPA 4Q12A 3ROKA 3ZJTA 4EVIA 2H92A 4EJ0A 3CZRA 2PM8A 1YGPA 3C1ZA 4E5KA 4KN6A 2OFWA 1HQDA 2XXAA 1UK9A 3WIBA 3LXMA 4OL0A 3OZBA 1VSUA 1CRZA 2O0MA 3NNNA 4Q05A 1I6KA 4FZVA 1LQTA 4ITUA 2GYWA 1AKTA 2O8FA 1W46A 2QJTA 2VATA 2XCUA 5DHSA 3E5MA 3TPZA 1GZ4A 4OUDA 4LE0A 4JELA 1QCZA 2J46A 4PSUA 4EHAA 5B57C 3N2IA 8ICAA 2JASA 3SAJA 1TU4A 5JS1A 3WB0A 4JGBA 4L9AA 1Z5NA 3DE7X 2IUYA 3EQ7A 1Y1LA 2IXFA 4ZMBA 2IU6A 4HBGA 4BO7A 2O2ZA 1X94A 3GIJA 3TTVA 3NJRA 4J4BA 5FBQB 2OILA 4E07A 3FDZB 5L40A 1RJFA 1TM7E 2O0JA 521PA 1E7WA 1S9HA 2ZRDA 4D42A 1CUSA 4XQ8A 4DS4A 3WX0A 4O33A 2I9PA 2OBXA 4IQ8A 3QPCA 1SBTA 2HHUA 5CT4A 1POWA 2I4LA 4MW1A 1MO3A 1A5BB 3RIYA 1PEAA 4GPBA 3IH5A 4E22A 2FEMA 1FFUA 2GD0A 2E1FA 2ZU6A 1QIIA 5B1DA 1V5IA 8ICWA 3EVAA 3K70C 1ZCFA 2XIQA 1I4LD 1TL7C 1WCWA 2KN7A 2EP8A 1XQWA 1MEJA 2D2FA 3SM3A 2RIPA 1E66A 3B6MA 2RHBA 1TECE 5LMZA 4P0PB 4PSDA 2IT1A 5J2EA 1IAQA 1JQBA 4AB1A 3B3FA 4PNPA 3EYAA 3SQXA 4FFVA 1MX5A 2W7OA 4AQDA 4YLGA 5LZ4A 3OICA 4IZ6A 4UDOA 3GUUA 4TLBA 5CG2A 3GLHA 2QZPA 2HWUA 3DMNA 3C2MA 5JZVA 1PR9A 2ZJYA 1VZ2A 1KI3A 4ZO4A 3RC8A 3V4LA 4DA8A 2P27A 1VXRA 3PF8A 3HJBA 2VBGA 2P6PA 1Y8CA 2YIVX 2C82A 1PQPA 3OPYB 2OO5C 3E4DA 1W52X 4XWKA 2R00A 4KXWA 3QNWA 4MZXA 1EDZA 2IZ6A 3U3ZA 2PDAA 2RKBA 3TI7A 1AHNA 4PGQA 1JKJA 2ZYAA 3UMBA 1YRBA 3Q5DA 3FMGA 3VM6A 2X58A 3IN5A 4QTYA 4MKXA 4K9DA 3NS1A 1KQGA 4UM8B 5EIBC 1ZCJA 3H5OA 1T6YA 1KL7A 5K4GA 2V65A 4Q9HA 4ON9A 4EZBA 4N5NA 5AJXA 1USKA 3PLNA 2ASJA 4UHBA 4PYMA 4OPMA 2JK1A 1ZNXA 3OQ1A 1CF2O 4G8BA 4PLFA 3K53A 5AIBA 4HWSA 5C7IO 4XSHA 4EJSB 2I4MA 5EAIA 1ZQJA 4OMCA 2E8PA 3IKJA 3KAPA 3JY6A 3DE2X 3HKDB 2W70A 2QRLA 4J9MA 1KFTA 1N2XA 2ZUWA 2W9CB 1R4MA 1KDZA 3G2MA 1TYZA 4JXXA 2AUMA 4Z0HO 3Q2IA 5I9TA 1A2BA 8ICLA 3UXYA 2WTNA 2NZXA 5TT1A 1N75A 2G0TA 4P4SA 2PQ6A 3EHDA 3K8OE 2JGNA 1G8HA 5AM5A 4BMYA 2GUWA 5HBRA 1NVKA 3RBXA 1CZHA 1XFDA 1SK9A 3PGVA 3BD7A 3CR3C 1DTSA 3EPHA 5IX8A 2DPXA 3X1XA 3EMDA 4HB4A 3UPUA 1E9RA 2BKAA 2QVGA 1Z3EB 4AVYA 3M34A 4JBXA 2BKEA 1PFWA 1VHWA 2CEKA 3NWEA 2WWTA 1MB3A 1Y80A 1Z28A 2Q2VA 4NDZA 2X8WA 1HKUA 1RCUA 3FCAA 1EP9A 3DZJA 2CKDA 1QSGA 4TXMA 3LBHA 1SCQA 3M6MD 1SOMA 5EP1A 6NULA 4X6XA 1UOPA 5JLAA 4RZRA 1KNQA 1Q14A 4CN9A 3BCUA 3H83A 1S0UA 4F6RB 3FCEA 4PGHA 5L6LB 3SEAA 5BN3B 3UQ2A 3LUCA 4HWRA 1NONA 3W6PA 3TAUA 4R41A 3DE4X 4MV9A 1AM4D 1IWPB 3F6PA 4YMWA 1FXWA 3HKZF 3AUXA 4EY4A 5K3SA 4P3OA 2KVCA 4NXNB 5EHZA 3A4MA 3AUKA 4ZAVA 3IELA 3OP4A 1PFYA 4EHLA 1HT2E 4RA9A 1HE8B 2NXNA 2ST1A 3QWIA 4TKUA 4HZUA 1BTOA 2GZ2A 2CGEA 2QTZA 3WHPA 3RB8A 1YUMA 5C8DA 4Q1CA 5LA6B 3WO1A 3BE4A 3ADKA 5C3MA 1OGJA 2WU4A 3E9DA 4GMDA 4QHYA 4YJFB 1VIMA 2PG3A 1TVAA 4MB2A 5THXA 4PQRA 2FMKA 3AETB 5DYGA 3ZQKA 4CUKA 5DNYB 4RQTA 1I9CA 2D2XA 3VSEA 2QE7D 4QICA 1HR0B 2BPCA 4O6VA 4O2RA 3I04A 1K68A 4GBED 4M6WA 1FRNA 2ZK7A 4HPWA 5C4MA 3KEMA 5KNLA 1DC8A 1JNYA 4ZVOA 4L2IA 5HOQA 5FL3A 4QZBA 4RADA 2F7SA 3EVFA 1E1DA 2JD1A 1IJBA 2UZ4A 4UVGA 3RBVA 2IV2X 4RQBA 5GGXA 1GSAA 1NC1A 4QRDA 4FEEA 5EYPB 4YMNA 2FCAA 1KRHA 3OLYA 4RTKA 3B7WA 3EGEA 1VA4A 4B4OA 5GIOE 3T8YA 5CDTA 4TSRA 3TSCA 4G07A 1IEWA 2YBDA 3RAQA 2H1WA 4BX8A 3BXXA 1WMSA 3FWKA 3ESRA 5KQLA 3ET4A 3O92A 3BIJA 4Y67A 1G5QA 3MJCA 1GRQA 2QIPA 4U00A 4AZ3B 4HATA 3PC2A 1PNVA 2A0XA 5DQIA 5CXQA 3DV9A 5JSZB 1K88A 1Q0UA 1C8VB 3QUCA 1BDMA 1GKYA 4RVOA 1J23A 4BMNA 3B5JA 1TAHA 3K9CA 5EE1A 3KQTA 1HFKA 2QK4A 4L16A 3RIGA 1OZGA 3QW2A 5BORA 1EZ1A 4BPRA 4FXPA 2ZAMA 2Z8YA 1IRIA 5MDHA 1D5WA 4IXDA 4D9KA 4IGIA 3PXAA 4DCGA 2AEJA 4IG4A 4OQLA 2DWUA 1CB0A 4ZODA 2FE9A 4IRKA 1SR8A 4PLGA 4KTVE 2GA8A 1NXSA 2CNKA 3B52X 3RS7A 4LZWA 1NK7A 3QZUA 2VNAA 3LUKA 4HEJA 5AVXA 3NANA 3FKJA 2F44A 4EB3A 5EJEA 4K1XA 1Q19A 4B9EA 4YLEA 2J6CA 2NO4A 2OOKA 1YKGA 1NMEA 1A5AB 3OZ7A 3RHFA 5JXWA 3DNMA 4LZOA 3CYFA 2YJNA 3NBMA 3ZZTA 1KE1A 1WM1A 4MITA 5AW6A 5E6SA 4U6NA 2O2JA 3KJHA 1HLDA 3VR5A 2NXWA 2SCUB 1IY8A 4B7AA 1A7AA 2O2DA 2L82A 3RREA 1HFWA 1FFAA 4AK9A 3QJYA 1HUZA 5C34B 3KUXA 3UC5A 3Q41A 2PRIA 5G0WA 1EP3B 4W5QA 3MWFA 3BRSA 3ZW7A 3FMVA 1O94D 3G89A 5JVDB 4PICA 1PLJA 3ZGXA 5KOHA 3CW9A 2C92A 3S68A 3IQEA 3SSNA 3AZPA 3MTIA 1TA4A 5EPEA 2YRFA 3HEBA 4EYEA 7ICLA 2X0IA 3VJMA 3HVHA 1P2FA 2J32A 1XLUA 1RAGA 3CRNA 1MZPA 2WYVA 3SYKA 4DQQA 2QE6A 1N6KA 2WB1C 1M5TA 3OEYA 3BBLA 3DOUA 2QMUA 2FLWA 1VM6A 3TQSA 2BBSA 4J2HA 5FUMA 2IOQA 2R8KA 2NRXA 3O8CA 4ZJPA 4XB1A 1JWLA 4HWTA 3BQ0A 3FMOB 4ZHQF 2E4WA 1L5WA 1BCSA 5CJPA 1DNPA 3AL3A 3SKVA 3V55A 2Y9PB 4YX9A 2AI2A 2D0IA 4P0TA 3QWBA 3PIDA 3EIHA 3NKLA 4NOKA 2EFCB 2H4FA 2AGVA 1LPNA 1W88B 5CH3A 1RBQA 4AG6A 1SL2A 3NYWA 4TX1A 1JHVA 3WLTA 4LYHA 3QE2A 4RANA 2ID4A 2P67A 2OYYA 4ND8A 1FE8A 4NRDA 2ZJ5A 4PQGA 4B9AA 5AVRA 2VRNA 2EFHB 3MUFA 1XD8A 4CM4A 2V7QA 4LRTB 1G3MA 5CB4A 2P4SA 3NM5A 5HQ3A 5FOVA 2V9WA 3GH1A 5KFYA 2R9VA 2PD3A 3U4QB 4KGZA 1Z06A 4QOJA 4KXVA 3MILA 1RWWA 4L4UA 2GN2A 5J47A 4UAWA 2DPHA 4B46A 4HUTA 2X8AA 2EERA 2NO9A 3IXLA 1DIOB 4RY0A 3GV0A 1UM9A 4XUEA 3GIMA 4YI3A 1JSZA 2FWNA 1VSVA 5ES4B 4W5JA 3BICA 1NPYA 4Z4QA 1E58A 2AEFA 3NUQA 1X7WA 2C1EA 4EO9A 3EPRA 3MPOA 4OY3A 2ZI4A 1E2PA 3M3DA 3V8QA 4RORA 2Y3IA 3BG5A 3S8EA 3NC0C 3F73A 1HQYE 1WB4A 5COAA 4EA6A 2FVXA 2IQIA 3A10A 2OSBA 3A9SA 4PV7A 3FDFA 2Q8NA 4HMOA 4YI5A 4XUCA 5DLPA 1US8A 4L0MA 2J41A 4CMKA 4HLDA 3ZZNA 4R9RA 3VU8A 4PZAA 3UBTA 4WKNA 2EKLA 1O6BA 1IZ9A 1YONA 2JW5A 2C8VA 4X92A 2GNPA 2NU6B 3BMOA 5K4AA 2AK3A 3IXMA 3DLTA 3OMXA 1CCWA 1U9IA 3ASVA 4MHSA 1JIXA 3KZIU 4UEJA 5L7YA 1JIJA 3IVCA 1SFRA 5G1PA 4R3UC 1MRNA 4J16C 4IMIB 4M8KA 3DQZA 2HXSA 1AKNA 1NAIA 4LVSA 5I7SA 4DFPA 1P8AA 4RZHA 5GV7A 1LBIA 4RU9A 2OA0A 1N57A 5BQ5A 1GPDG 4PG8A 3QV2A 1H66A 4JLWA 5LCXA 3MGIA 1GL9B 1V35A 2PRYA 2XC9A 4DL5A 3O4IA 3TL6A 3QVJA 1SWVA 4MRSA 1YXMA 4OJ6A 1WSDA 3IQXA 4LOAA 4C9BA 5JS2A 2EFJA 2G82A 3PVSA 2DQKA 4JHLA 2GF9A 3RYCB 2HQOA 1F8UA 1YCHA 3HXKA 2JJ1D 1NHWA 1QR2A 1CV2A 2MYUA 4AQ7A 4NPHA 4KC0A 5BRNA 4EARA 4I1RA 1T24A 4J8PA 3MINB 2RH4A 1TA9A 3RW9A 1XTKA 4JKYA 5HDQA 4P5PA 4F4IA 5KSWB 4F85A 4ARCA 1NJFA 5F3RA 4BKMA 2G07A 1F4PA 1F7VA 4UQOA 5AJHA 1BH6A 1XCMA 1PSZA 1DPFA 2IVZA 3KXKA 5ELMA 1L5MA 3RS0A 1T4CB 2Z2ZA 1P7ZA 1FRZA 3R0QA 4ETWA 1XZKA 5KFDA 3R3YA 2PNFA 1CUAA 1E7MA 3WGHA 3Q3VA 4ZVKA 2Q6LA 4OFXA 4IMRA 2W6JD 3TW4A 5IBPA 4B81A 1KXJA 3D1LA 4U9HS 4NS1A 4CMHA 3L40A 4KPFC 1JR3E 5FA8A 1NJ2A 1PS9A 3FGNA 3BZBA 2QRZA 1QCKA 3I62A 2R7KA 1I30A 4EI7A 4HDMB 2I7XA 1KDHA 4I2CA 4P7FA 3C4JA 2WD7A 4FO6A 5K6RA 4G0VA 4YN4A 1L7EA 3UMRA 4C6SA 2XW6A 2AUNA 5EE0A 4A0RA 3FC4A 3X0DA 2CHVA 2O2CA 2IODA 2J9FA 1PDWA 4GUAA 1D2AA 2PZEA 5EINA 2WTUA 3NBKA 2IXGA 4C8OA 2CMGA 5HKOA 1JLRA 4AU1A 4DJEC 3BH6A 3WRYA 1SUAA 2WVJA 4I2VA 3AKEA 2V9ZA 1VLZA 2HBKA 3G1TA 4NYIQ 2IEYA 2XZTA 3TQFA 4UM9D 3WGLA 4UHFA 1T8YA 4Z7NB 4AZ0A 3N8HA 1OUMA 1ZN8A 3QA3E 4PQEA 1E2BA 3DDOA 1A2KC 3AWDA 1XZEA 4O2BA 5C0OE 2PVSA 3HRKA 4KLLA 1AV7A 2XMGA 2ZJ3A 4GSLA 3AHJA 3EH1A 2FSFA 4OJLA 3DOOA 4P6VF 5KJFA 4M1ZA 2FEAA 3VDMA 4C3ZA 3N07A 4RQMA 1JBEA 4B6GA 4UD2A 4DIFA 4INZA 2F90A 3ZWKA 3N4MB 4YCXA 3STTA 2WVGA 5B3JC 5D3MB 3MD9A 2QNIA 5I7HA 4QBTA 3GRFA 2AMLA 3D4PA 3EVCA 4KDEA 4IHQA 4X1IA 2VSFA 5AJZA 3NAQA 3L8ZA 1EGHA 3ZY5A 3UENA 2P9ZA 4Z1MD 4DLSA 3EDOA 3EBPA 3LFUA 2BELA 4OH1A 4E5UA 2J7PA 2K8CB 1TEHA 4N6GA 3GR6A 1SBIA 1TMGE 1S0MA 5F3WB 1ZMOA 3M70A 3FNFA 1RVDA 1XMVA 3KKEA 3BE5A 1NWCA 3ZG6A 4HEA6 3K0FB 3QMMA 3ZDXB 5FQNA 5JBIA 1T2FA 2QD3A 4MGEA 1ONOA 1DS6A 1JHYA 1BAPA 2B3TA 4MCHA 4N8DA 3RJ5A 4CPDA 1PZGA 4J0JA 2I4OA 4BO0A 3ZU6A 2COUA 5AR1A 5ICGA 2Y99A 2YHIB 1E1CA 2XXJA 3W7BA 1T29A 1EXNA 3SKYA 2QQGA 1A9OA 1VLJA 1JYSA 1RP1A 2Q5HA 4PO1A 1XQ9A 1MORA 4EP1A 4WZAA 4N39A 4GRDA 1WB6A 2L19A 4G25A 2F76X 5ANRB 4QQNA 5AOVA 4C7VA 1JH8A 2IVFA 3VJLA 4JT9A 3UJHA 3GMIA 3U26A 2J8ZA 2HHAA 4DA9A 3UJDA 1I5EA 1GAQA 1K5DA 3NB0A 2RK6A 4FEGA 1MDBA 8ICKA 1ODTC 1TM2A 2VLIA 1E0DA 1KJWA 1QH1A 2AOTA 2XWSA 1ES9A 1II9A 2K8BB 2FEXA 4FS3A 1KYTA 5TISU 5JROA 4QPZA 4G4GA 5HRCA 3ZLTA 5MN4A 1MAVA 3NVDA 1WXHA 3RYFB 1V38A 3DSRA 1QLHA 1R9NA 5DM60 2RGWA 3EZXA 2OD2A 3PC3A 2KTQA 2GVDC 1RJ9A 4CM6A 1ZNYA 4EF4A 3L8FA 4TRNA 5CAEB 1UA0A 1IXRA 3SAFA 1K2VN 2YYYA 3JVUA 1M1YE 1QRRA 2ZJFA 2W4MA 1KQQA 2B3DA 2I2FA 5JYDA 4MWGA 3FNIA 2QG6A 4TLCA 2GCIA 1AKRA 2L42A 1GNQA 4OFZA 1D8AA 3TEJA 2R4TA 2X1LA 1MVOA 2EKPA 2WJVA 3DOHA 3H97A 5FAKA 5F21A 1DINA 1X9SA 4Y0AA 1UA1A 1WCIB 5JD3A 3CYMA 4JUIA 2GD2A 2QUAA 4DADA 5LYJB 1PK7A 2HD4A 1QP4A 2NZYA 3WDMA 5F23A 2AG6A 2BFCB 1K89A 4ZTBA 4EMSA 7ICJA 3B70A 4MQ5A 4A16A 5HZHA 2VC2B 5BV2P 3WOHA 3DBVO 3TBFA 2FMHA 4KPUA 1J0EA 4O2AB 2EJUA 4TTTS 4X63A 4DSIA 4PRZA 1WXXA 8ICRA 3AOEC 4CM9D 3K0SA 3B1WA 3QKTA 5BV8A 2UV8A 3OT1B 4MARA 2VPXA 3FNGA 4OQZA 3IUSA 2Q8PA 2AZXA 4JXKA 3ED5A 2NV2B 2X0DA 1XRMA 4C87A 3OJSA 4BLUA 4C7ZA 3KCNA 1OB5A 3FJ1A 4H18A 1NIJA 2FUEA 4HUQB 4B6QA 3GFFA 4AICA 4G97A 3RSHA 2EBUA 1OZFA 4MQ4A 3BGVA 4J0DA 3U37A 3AEQB 4ARSA 1XP8A 2PL3A 3SR4A 3BQMB 2UDPA 4HR7A 3ESBA 2ONZA 1F2TA 3C1OA 3G2QA 3WBBA 1JJFA 2GERA 5JWRA 4LA4A 3CGGA 1X7ZB 3ML1A 4CCYB 1Z00A 3ZI7A 1N5RA 2CWDA 1VPTA 4O4HB 3RTDA 4OJ5A 1E9FA 2JBAB 2VNKA 3W3AH 4FGSA 1BXGB 5J0OA 1CEQA 2OYSA 4QEZA 2WM3A 4B4VA 1TCUA 4YJGB 2XMBA 1HE4A 3I8SA 2IYEA 4TKVA 2WAQF 4F4XA 3AOGA 4EYQA 3PU6A 5DG8A 3A1DA 4GM1A 3L1UA 3MK31 2LYAA 4RTJA 3SK0A 3WWDA 4DSZA 4H3KB 1A9QA 4I99A 4DXHA 3MR3A 1B8VA 1BOFA 4JR1A 2HLNA 3UQ0A 1WQ4A 3TFOA 4LEIA 2OAQ1 4GS5A 3KR9A 3LIPA 3NS7A 4Z86A 5GJBA 4HQ0A 1VBKA 5HR6A 3FVVA 2CFRA 3TB6A 3NOXA 1RS0A 1OBVA 1CUVA 4R1OA 3F9RA 3ROXA 3IAEA 1OYWA 1ORVA 2XE7A 5CEEA 1G3RA 1X9HA 3IOEA 3JPYA 1Z0DA 1CZRA 3O8DA 1QG0A 1T6XA 2Q4TA 3PNOA 2R1ZA 2BKUA 4K6CA 2WP8J 1ESZA 3QOXA 4YAIA 4N41A 4N5IX 1RAHA 5JCXA 4GOXA 4X71A 3HWX1 5D85A 2N42A 5G1NA 1HSZA 1ZQBA 1KAEA 4X20A 4E1VA 2O8EA 2GK3A 4RA6B 4TGLA 5JS7A 3RRHA 4BNDA 2C7OA 1UAYA 5GPBA 4LW8A 1ZH0A 1Y0BA 5AUQA 4AL4A 5ES3A 4UAUA 1G18A 1Z2DA 5C7LO 3TPCA 4LRUA 3CUVA 1BOOA 1NRJB 4A03A 4V0MA 1TK8A 3GJ7A 1D1SA 3HBAA 5BSKA 4BNNA 3HB4X 2PT6A 2ESRA 2H11A 1RMQA 3QXXA 4O4JF 5TDHA 5KTTA 1V41E 1TLLA 3Q3CA 3VI3B 1NK6A 5JC1A 1PE0A 2JLAA 3MELA 2BH2A 1KEZA 2FW1A 4ZYZA 2VJAA 2XAAA 4XIGS 4OQQA 3E9NA 2VH1A 3KYCA 2O48X 1T1EA 4Q4JB 1MDFA 3O73A 1M7HA 3HNPA 2PUGA 3LC1O 1F06A 2DQYA 3D6TB 4A82A 5KTRA 2JLCA 2OV1A 3BHMA 3P0EA 1H05A 2QN2A 2OR3A 1LZLA 3ZIDA 2WJ4A 4CM7A 1BS9A 1DJLA 3P52A 2AT1A 3IQWA 4G4JA 3KKKA 7ICRA 1ULHA 3N2KB 3V4RA 4LRYA 1E62A 2P1DA 2CXNA 4RZQA 3RAPR 3HU2A 1COZA 4P3XA 2JI6A 3ETHA 5TB5A 1UBKS 2JXJA 3SI7A 5KFZA 3GDHA 3IDZA 1XRSB 4D46A 1P0CA 3DDSA 3UOWA 1YNSA 1BC5A 1X0VA 4G0ZA 2ZI5A 4KQXA 4QZCA 3CF6R 3WKEA 2CLKB 1B8PA 2R68A 5CTJA 5FI5A 5FV4A 4QC2A 1GYRA 4Y7CA 2DUJA 3AXTA 5IIJA 4KEAA 1E1QD 1E2DA 4FYMA 2H1OA 3QFHA 3PDIA 3I2JA 1P0PA 5GZ3A 5D00A 2A0KA 2ADFA 3DO6A 2GPJA 4H60A 4PHDA 2WFLB 3M1LA 3UJ7A 1SIUA 5KFWA 1GQ2A 2ICAA 3RWBA 4F5YA 1YDMA 3MGGA 4RULA 4B3TB 1NVVR 1W8DA 3KT3A 1R2QA 1KO7A 4KLOA 2P5SA 4RMNA 3E9MA 3GFPA 1Y8QB 4BO9A 3OU7A 4M1QA 4BFLA 5KVQA 1UK6A 2V6FA 4FT2A 3GPIA 4NYMQ 3D0RA 2Y4NA 3C7KA 2MRLA 4E2XA 2FPUA 1QG4A 1KSHA 5BUQA 4BB6A 2VPTA 1RQGA 1TIPA 2R5WA 4Z9BA 1BU8A 4A10A 3VH2A 1LZKA 3QKSB 4GI3A 2BEUA 2JZBB 3EXHB 5A4JA 4Q3EA 1NUHA 4PCVA 2CJXA 3TNJA 4D43A 1J22A 1JR4A 3QVMA 3M9NB 4H77A 4DLZA 3LUBA 5EZYB 1EFAA 1V5EA 1Y63A 3ZGVA 4EFMA 1OB2A 4NLCA 1D07A 3O8QB 2X9NA 4BQNA 1Z6YA 1ZESA 3AF1A 3GRUA 3KFVA 2ZYDA 3OQ6A 4G5QA 3VO8A 4WBSA 2Y1CA 4M0FA 4OGKA 3I9MA 1CW2B 2ZUTA 1R4NB 2HJRA 2X3FA 1GCIA 3E8SA 3GT3A 1CRLA 4PU0A 5JRZA 4RVUA 4GW3A 5HMMA 4WFJA 3WKDA 3UTCA 2FWIA 2H3EA 2XTNA 1TMKA 4UTNA 4QHSA 3R3HA 3MGHA 1OI3A 2WMOB 3IMCA 4PZZA 3LHIA 2VPZA 2QPTA 5C5JA 3GQBB 2AG1A 2C4HA 4ZO9A 3Q40A 3IPXA 5JJKA 1V8OA 5HJ7A 3KFLA 1KAGA 2Q4EA 3KNZA 4R2LA 3VR1A 4RH0A 2FN8A 3V32A 4PANA 1WLSA 5E6UA 1FLDA 1KARA 3OX3A 4GPAA 3S2ZA 2E5SA 3WIVA 5DMXA 1JLMA 4RQ6A 4FFNA 2I71A 1IM4A 1VL2A 4CVNA 2NUPB 2NP6A 3O8LA 1Q12A 1I5OA 3LSYA 2VSOA 1XRPA 1TIKA 1SV0A 4Z8XA 3RSOA 1FTYA 1EE9A 2JKZA 4K4HA 1RM3A 3MOSA 4K4IA 4DBLE 2Q9AA 1ZR2A 4NEGA 3RVNA 2HMXA 3UKJA 2FX2A 3NC4A 1XZ8A 4RNNA 2JGEA 5T5QA 5B3LA 3VTFA 4JAVC 5TT0A 2X5XA 4HC4A 4RD3A 1YIDA 3FOAA 1TC1A 1N2CB 2I7VA 2WRZA 3FFXA 4R2XA 1W4RA 1X80B 4MS1A 4BFXA 2R11A 5DLFA 4OG2A 1ZQDA 3QWHA 3KR2A 1VE9A 4L8GA 2OZLA 3R74A 3RG2A 4DBZA 5IWCA 4KX3A 1JNXX 1QFZA 5KQPA 4IOLA 4TLDA 2ZYGA 1KE2A 3J80A 2NQTA 4JWNA 2Q5FA 3H19A 3JD2A 5YASA 4DUGA 2HF2A 4YJ2A 4LZJA 4CTNA 3A2KA 3M9OB 1TO6A 3GJZA 1ZG3A 3QK7A 3JQCA 1RC0A 3VC3A 9ICVA 3T5LA 1T3ZA 2LCIA 4GX0A 4PO9A 2I2WA 2JD0A 4Q16A 2XT9A 1MJ5A 1QFYA 3ZQ4A 4EW2A 1YZTA 2E55A 3GUVA 3BM5A 5IRCD 2Z6QA 3SAGA 1QV7A 2X41A 4YRNA 1QHHA 3BA1A 2F8MA 2BCEA 4QVKA 1FSZA 9ICMA 3D2CA 1ZD5A 3HR7A 4D02A 2VPWA 3QG5A 3JPTA 3FTFA 3AT1A 4IX1A 2IYRA 3CH7A 5AKKA 2EJVA 5E0OA 1FYVA 1F6BA 2VUSA 1QDEA 1BX3A 3T1VA 3GFBA 4LSMA 1ZIXA 1OYOA 5DHQA 2XY5A 1XDUA 4NLGA 2FLKA 1H6DA 3VOAA 4C4OA 4H17A 3P45A 3GVIA 4MVJA 3E3OA 2NO0A 2P3QA 2HJWA 2HPVA 2UUCB 3DLAA 3Q1LA 1MLDA 3EWNA 4D41A 2H3ZA 4N7MA 4F5OA 1K75A 2CNNA 1F8GA 4YCAA 5LNK1 3EIFA 2GN1A 3AK4A 4WNIA 4EO4A 1JWAB 4HPXB 4PQFA 1FFDA 2FGJA 1BMFA 4PCLA 4YVFA 4DY6A 3OPYI 1DQRA 2Y0PA 1HUOA 3T5HA 3PE6A 1HX7A 4Z2AA 4Z9YA 1GZVA 2JEJA 1M1NB 3ZHSA 1AHIA 2CZCA 2XNCA 1UKEA 2XB8A 4OBXA 4NZPA 1KFBB 4IQVA 3X2SA 1IXKA 1E3MA 1AZLA 3DCJA 1UOOA 1I36A 3TAPA 4L76A 1WVMA 3CJQA 5K3FA 2XE8A 3CX3A 5A03A 1S2DA 3HY4A 2QRJA 4TV8F 4ZI3A 2ISCA 1TJYA 1A72A 4IDQA 2G6TA 1JALA 4HH0A 3A1CA 2FN9A 3WISA 4BV3A 2W8BB 3BD6A 2OGTA 2A2ZA 3TKLA 4EYGA 2KJ9A 2D6FC 4OD0A 1Q77A 1FYWA 3KEFA 1AZTA 3WR5A 2A1JA 2WSLA 2UZAA 3VDNB 4QU8A 1PJ8A 4IZIA 3AX6A 5TY0A 5BRJA 3OVMA 1E79A 2ZRAA 3MS4A 1XCOA 1JSRA 1Z0SA 1NMXA 4KQWA 5BPHA 1JKMA 3SM9A 3RAXA 4YFVA 4GNRA 3MCZA 5LQCA 3ZLVA 3NJ8A 2EARA 2DETA 1QVWA 3G6KA 4I29A 1IB0A 2ADMA 3V80A 4CT5A 2NIPA 1RD4A 2XNSA 1E2JA 2VHVA 2GETA 1E2MA 1LH0A 1X3LA 4U6QA 2HHQA 5ALUA 1U0EA 2G5TA 2CFSA 1E59A 2HA2A 2WILA 3FH0A 3ZJ5A 5DDIP 5HJEA 1W49A 1KK3A 4C08A 1FZTA 1SCUA 2C4NA 4JX8A 4BASA 5CFLA 1GIAA 3RAFC 2O3TA 1P5RA 1OLSB 1MF7A 4UBOA 4A0HA 4RCZA 3IOBA 1U9LA 5JJ5A 4R8LA 3B1JA 3NIWA 3EUFA 3QE9Y 2SHKA 4Q7KA 2AR9A 2FPXA 1M2KA 1N1EA 2EG9A 2H52A 2DRIA 3AR3A 4C76A 3G85A 2AN4A 1X13A 1SCKA 2WJAA 1K6IA 4MS4B 1JT9A 2H06A 5DXAA 2EYQA 4KK4A 5HF8A 3P32A 1SXQA 1R6BX 5FI3A 3E2MA 4RYDA 4C14A 1XCBA 2N3ZA 4JK3A 5JYEA 1IY9A 4DL3A 2ZS8A 1G2IA 3L6CA 2IBKA 1N5OX 5LBIA 1M6EX 2ONCA 3JRXA 4F5EA 1NVGA 1FOEB 3WXMA 5L1JA 4AMYA 5ABPA 1UFVA 3NLLA 1QH8A 1Q3KA 3O4JA 4KLEA 1LPSA 2BGMA 4QGSA 2WWHA 4MAMA 2QNBA 1K97A 4TUYB 5EWMA 1IK6A 3DB1A 3RJHA 3AKCA 4BAGA 2NXJA 1NM5C 5BRAA 4W8OA 3KTFA 3W3AD 3ZWWA 4JLSA 2V5VA 3QYJA 7AT1A 4ZIRB 3WWYA 1BQ3A 1MX1A 1I3CA 1YBMA 4ZWNA 3FR7A 6Q21A 1P1FA 1VLVA 3CRMA 2BCJQ 5DWVA 4C4YA 3LVQE 5IW8A 2GPTA 4RLSA 4KXLA 5GJCA 2ZSUA 3CH6A 2QD4A 4Y2SA 2M6KA 4LUCA 4TMVA 4BLRA 4QZFA 1O5TA 5L3SA 1WDMA 5F33A 2AHOB 2RGCA 3H13A 4EL5A 2R8HA 4NAHA 3MTAA 3PVCA 1L7RA 1G8SA 4KP7A 4N76A 3ANXA 4LN1A 3WGNA 2A5DA 2PGJA 1FXSA 1ULAA 1GTRA 3IAXA 4G0YA 5ULLA 3OY7A 1P5FA 3FUUA 1FMTA 1MW8X 5JZMA 3LAWA 5CXUA 3GFTA 1IG6A 4X45A 4DREA 1DEAA 4V1CA 1T2EA 4B9UA 1GPNA 4WKBA 5J0PA 2YMPA 3NIBA 1PG2A 1Q95A 3AVQA 5H0IA 3DPUA 1W4LA 3FZNA 3FIJA 2QMHA 1WNFA 4CL2A 3JQ8B 4X8HA 3H5AA 4NONA 4MW0A 3H8JA 3L0YA 3R1IA 3G0IA 3H1FA 4IJVA 4J9OA 4YVZA 4CR6A 4WZZA 2BHNA 4ZT4A 1R0BA 3T3FA 2JVIA 1Z4MA 1ZYQA 4J75A 3VR2A 2FF5A 5T6MA 4QTTB 5CNMA 3LQ4A 4IHKA 1C0LA 1FFYA 1JLSA 3HJAA 2PZGA 3A8TA 5BMVF 3T5MA 4LDNA 4TV9A 4FYXA 2KIWA 1FTGA 2XDAA 3P9KA 1T5IA 4GLXA 1E4EA 3OP1A 5E4FA 2NUAA 1XWLA 5KYUA 3I01A 1XAJA 4ZRDA 1LV7A 4Q3KA 4QWBA 3OZSA 4GYKA 2LNDA 4QJ5A 2VP4A 2IYUA 4HYQA 1Q84A 4WCFB 2OHOA 3C3WA 1HSOA 4G8CA 2NU9B 4K9QA 3L04A 3VKGA 3GF4A 4TWIA 2WDPA 3CRW1 2K2WA 1YDHA 5J5CA 4IM7A 3FWPA 4H6WA 3LPLA 4YROA 2O1XA 2WK1A 1MQ2A 1YA4A 3P2OA 1ZQIA 3AI7A 4E32A 5JIBA 5DX1A 5HKLA 1BHO1 3O21A 5SY4A 1U02A 3D8BA 1T4DA 2AGPA 3BE8A 4B8ZA 1G6Q1 3IE0A 3KJNA 3TECE 2D8AA 3JPOA 2H59A 4PGXA 3ONEA 1REQA 5K8JB 4ZEXA 2E4ZA 4B43A 4LWOA 3NWJA 1M0SA 1N0HA 1UCVA 3I6MA 4N6NA 3R24A 3N1UA 1AXEA 3EG9B 2B98A 4R0MA 1WYGA 4B3FX 2GZDA 4C20A 1DBPA 2NNWB 3AY7A 5C1OA 4TRMA 4NE7A 4INJA 1M7GA 1VG8A 3IDWA 3V7YA 1G8YA 2REOA 1CP2A 4ZV9A 1OASA 5CEJA 1YB7A 2XMQA 1F1JA 8ICYA 2ATCA 4C43A 1C4WA 4F1JA 4V2IA 1WMEA 3ABIA 3BDVA 3GLIB 4FEAA 3SX2A 1JLHA 5HR7A 3LZ6A 1N8NA 5KG6A 4F3KA 1TJPB 4ZT5A 2W9AA 5T64A 4DSNA 4Z9XA 4ESHA 3V2GA 1E6EA 3RUFA 4E0DA 3SR0A 4LTNA 1MOSA 7REQB 3ICOA 1QQBA 3W34A 1IPHA 3GLSA 2P5YA 5EWLB 1N5IA 1CY0A 2BHTA 4OXYA 1U7WA 3QE4A 2GVZC 1F2VA 1RFLA 4DL9A 4UJ5A 2F3NA 1CC1S 3MT8A 4CTOA 2NTNA 2E82A 4C80A 3WLAA 1OZHA 4UAGA 4MWTA 3H05A 4QW8A 1HDRA 3KPYA 5KWJA 4CG2A 1QHGA 4PVDA 4UAYA 3K2BA 2CLLB 3L0IB 1ZD3A 1IJEA 1SZPA 3TLKA 1R27A 2GK6A 1M1XB 4UBMA 4B9NA 2P68A 1PGPA 5D3ZA 1VJGA 3INTA 1AQNA 4L28A 1NZJA 3OWXA 5KFIA 1JFFB 4BMZA 1K6EA 2PJUA 3OEEA 4UOEA 1H9BA 1W75A 3GRYA 1Q22A 4TVSA 5EVJA 2B4QA 1BNOA 2VNSA 1A98A 3X44A 1AMUA 1RYRA 3RSFA 3PXEA 2Q3JA 4MDHA 3NALA 4I50F 1ODJA 5IU6A 4IIBA 4R1SA 2WJZB 1X1SA 2QVZX 1PK1A 2CEAA 3HP4A 1C4OA 4KDRA 4BWMA 5DNUA 1ZRNA 2C2KA 3KB1A 2NSHA 3LUFA 1S8AA 2VK2A 2ZSJA 3K20A 3BMQB 5LUBA 2B21A 2PSDA 4LWPA 2Q5IA 3TPFA 1UF9A 2C5GA 3KD3A 1UJ6A 3UC9A 4MUYA 1JEAA 4KLRA 2IHTA 3GA5A 3BOSA 1K8RA 3UAOA 2AFHB 2FR1A 1D2MA 1N5KA 3P20A 2GPSA 3ZYCA 2WHXA 3B8HA 1X9IA 3ZOZA 1JHRA 3UTDA 3RJ9A 5FBZA 4IDFA 4I9FA 4NLLA 1T3TA 4R1QA 4G5RA 5LP6C 2APJA 3FOBA 4PHTA 3Q8SB 3MAAC 1U81A 1BNCA 2I3ZA 3QVOA 1WPXA 4QSMA 2FUG1 4NATA 3I5YA 3UUGA 1P33A 2BCRA 3EF3A 2Z5GA 3UV7A 3TL3A 3RRZA 3P2MA 2COKA 2RD2A 3PC6A 1J6UA 3D6NB 3MTEA 4MVYA 3OJCA 4GC9A 1WSAA 4A15A 1EWRA 1JAIA 5HE9A 4Q45A 5DH9A 3CJRA 1KAOA 5EP4A 2OXIA 4AMBA 1JVSA 4H1UA 4LOJA 3T12A 1K6XA 3ZWBA 4HYTA 5DNWA 2AJTA 3HN2A 4J94A 4Z4IA 1QFJA 1E7YA 3LYLA 3AU2A 3SMVA 2VNHA 3ZKAA 1BMQA 2VYVD 2WKPA 1A04A 4HNQA 3L9XA 3HQ4O 5FO1A 3HACA 2W2XA 1DADA 4ARBA 1R6DA 1A5SB 1AXRA 3T1NA 2X1VA 4WTOA 4DQUA 2OZKA 4GOND 4HJXA 5BVGA 1TZMA 1DZ3A 1GJRA 4X3OA 1XLVA 5IF3A 3P2IA 4WJKB 3DXXA 5BSGA 1CY2A 2P11A 4L72A 2FRVA 2JRCA 4WA8A 2WIJA 3HCWA 2QS9A 5E6RA 3QE0A 4TTPA 3E48A 3IB3A 2IYQA 4ND7A 2CVHA 4NICA 3UT6A 4ID3A 1MC8A 5ALPA 2O20A 3GQVA 2ZAGA 3G5TA 4MPRA 3EIQA 2NV0A 4X6UA 2EW8A 2R00C 4LXYA 5BWLA 1H2ZA 4R7ZA 2FRDA 4BRUA 4MUNA 1Q7BA 2LCQA 5L45A 3TTUA 4ZQEA 1ODIA 4GXKA 2C2GA 2VNIA 4W1SA 3HPRA 4M37A 1EX1A 5DPMA 3UXNA 4Y2TA 2C96A 4LV5B 2EKQA 5KFCA 1WOYA 4IBOA 4A0SA 1ESDA 5LYYA 2R0QC 1PF7E 1QU2A 1P1BA 5HUQA 3RLFA 1FFWA 4WBXC 3NV7A 4OLAA 1D1TA 3K0EA 4HXEB 4DA7A 1SBHA 4YQWA 3CEAA 5BVHB 4OHBA 3PX7A 1DGJA 2HWYA 3AI3A 1YR2A 3EPKA 3O8BA 1GQYA 4AY4A 5FL7A 4MV8A 3WY9A 4NZOA 4OFWA 1F12A 1JN3A 2H48A 4HNTA 5H1YA 4B47A 2VK8A 3A3NA 3THWA 1CEEA 1N5JA 3U4DA 1EWQA 4JASB 4ZHQB 5BSRA 2WF5A 1UBOS 3RHTA 2ZEJA 4B4KA 2C03A 4EW1A 2IH2A 4D4HA 3BIXA 3VZQA 2Q6IA 2I3AA 2AJQA 1A7UA 2W98A 4GF5A 3BREA 5CMLA 3L8MA 5K0BA 3R8CA 5CBPB 5JADA 4NH4A 4JMLA 1EVZA 2D74A 4JT2A 4L9WA 1CZUA 1S8NA 4C1NA 3CMMA 3OM0A 1XROA 2W37A 1U94A 1CDDA 1E94E 4NBWA 4M21A 4L1KA 3DV0B 3MWGA 4G9BA 2M32A 1GP2A 2OKCA 3BK2A 4EENA 3STYA 4FN4A 3SLGA 4XD7A 3RJMA 5FNVF 4ALJA 1G5RA 5ALNA 1EBUA 2NSJA 2VP3A 1IOLA 2XOXA 4HDSB 5KYKA 2IZOA 2BR0A 3K16A 2ZYWX 3HXOA 3SS9X 2GS9A 1DG3A 1XD2B 5B1SA 4HAWA 4LQCA 3VFDA 1G2QA 1UK7A 1WSBA 1LQUA 5EC8A 3DZ8A 5G4KB 1TQ4A 2J0EA 3QITA 1QTNA 2HU8A 3SBEA 1BD4A 5HEKA 4WN3A 5HDBB 3CVWA 1G2OA 4ESEA 1YZUA 1T5HX 3L0ZA 5T14A 1QFSA 4Q3AA 4G9GA 2GCOA 4UREA 2AN5A 4V3CA 3FUWA 4G23A 4GZ6A 4ABTA 1TCVA 2DECA 1M2HA 4J90A 2IOFK 4WXRA 1SCBA 2P2ZA 2TYSB 4MCAA 3GN1A 5B7PA 1C30B 2VWHA 2WV9A 3DUWA 4JI8B 1KFSA 2PMCA 3OCUA 1KOGA 1SBNE 2UVDA 2RGNA 1N62A 1EGQA 1L4UA 3LHDA 4YREA 4CDMA 1W59A 1W4CA 1W85B 2V59A 1OWLA 5IH3A 2YFKA 2IYTA 2YC2C 4MRRA 5BOLA 2BFEA 1LLUA 4C3UA 3B3GA 4ZVRA 1EUCB 3EGOA 4F4HA 2OE2A 2GEDA 4TS9A 4L4YA 4QBIA 1NUSA 2A9RA 2JH8A 3UEOA 3RRYA 1VMKA 2YWXA 3C45A 4R9VA 1LBHA 3FTCA 5GVSA 5LLDA 1PR3A 1KYQA 3U60B 3OC0A 2ZIVA 3KV1A 5H02A 4BKQA 2EDCA 1PL7A 2PKWA 3VGJA 2FEWB 1B6GA 4HZIA 5TQJA 4NPAA 3OFND 4OQEA 5JAOA 9ICHA 1P80A 4LYGA 4ANFA 3OZGA 2BFDA 4DA6A 1LWNA 1BQ4A 2VQ3A 1EXWA 4YP6A 4RNMA 2OBNA 2Z6AA 1QHEA 1E7RA 3NHKA 5A0VA 1GAXA 1II8B 3CUSA 5JNRA 1W36D 3D8NA 1C8KA 4RSHA 1LDMA 1IULA 9ICOA 1YB5A 4Q3NA 5LKAA 5JTIA 1E4YA 2Q0HA 4M87A 2BUAA 4D9NA 4US8A 3RKSA 4JKOA 3JASB 3BZWA 1YFKA 4R2HA 5JECA 4CL3A 4QZ9A 3VH3A 4I1UA 5G3ZA 1FYDA 9ABPA 1TKBA 4FWTA 4I3HA 3OZVA 1QGAA 1JG7A 1GQRA 3FCYA 1Z22A 1GU1A 5IAOA 3GEIA 1EZZA 4RPYA 3PFIA 1EPUA 4MYSA 2YNMA 3V46A 1XTUA 4QX6A 2FEPA 5CDFA 4JUCA 1S0VA 1A96A 3EZFA 5TQ0B 4AZSA 3WZ2A 2XWPA 3LKVA 1IVSA 3IPRA 3D5EA 2G0NA 1ST2A 3L8GA 1ESNA 3T7IA 4DR5B 4F5QA 3EQZA 1EAYA 4M9NA 2O2XA 1PYGA 4E6EA 1KORA 4DF8A 2DFKB 1GZHB 1M76A 2HWWA 2DCMA 1U0NA 2UUPA 5KSPA 3WRXC 1D8BA 3OFVA 4XJTA 1RJEA 4BWYA 2XZDA 4KQGA 1QP7A 4MUEA 1E3EA 4LHYA 3GU3A 5HIKA 7ICTA 4WNYA 1W30A 1MQ3A 2Q49A 5AHRA 4YRJA 1SHTX 4QUIA 2CHEA 1AKUA 2V54A 1D6SA 5A0TA 2WYUA 5I5EA 4BQIA 3IT1A 3ABZA 1M2OA 5I5GA 3NHSA 3KKAC 4DOAA 5HX7A 5BWNA 2C3UA 3OLXA 2SECE 1ONBA 4UPDA 1XC9A 1YVUA 3BMCB 4YY3B 5I7FA 2H85A 1GQQA 3OUZA 1DKOA 5A71A 3T7AA 2DJ5A 3EMKA 3LC2O 3ZDYB 2DJIA 4KOAA 1W4AA 1KKXA 2CPRA 4NMXB 2FFQA 1WHTB 2HBQA 1KBZA 1RYNA 4KR7A 4QD3A 1XT6A 4ZVVA 4D9MA 5DM1A 2IBMA 1YWGO 5IKXA 1PK9A 4ZT3A 3X1YA 3UWPA 2WM2A 2IDMA 1DAGA 1MQAA 2F43B 2A0FA 1EGMB 1OZAA 3N75A 4IDGA 5JJIA 1DTWB 2PIDA 3TJZA 4M0KA 3SXUA 4EPYA 4M4SA 3S1AB 4ECWA 3HYLA 3BD9A 4NENB 4G0WA 2R97A 4HDRB 3BA6A 4AZTA 2JLXA 3CPSA 2QAGC 3ZBQA 5K6TA 1ILEA 5H68A 4CNBA 1SK8A 4NM1A 2IS6A 2X7JA 1CTQA 1SH7A 5KBYA 1Y4DE 1USGA 2JATA 1DOQA 2GEUA 3H18A 1NW8A 1NJWA 3PHJA 3MGAA 1A8PA 3OFJA 1E96A 1ZGGA 3GN2A 3D2SA 1OHHA 1QM5A 2HCJB 1P4AA 1ZM4A 2PSJA 3KKOA 3TZEA 3JAWB 1JA9A 1UZUA 3WNVA 2WE7A 1BMDA 3TTTA 3UMVA 3C6BA 4JUBA 1HLPA 1CD5A 3KLOA 4TMXA 1G8KA 5JJCA 2ACKA 2RLTA 1JFVA 2ZRIA 3GFGA 3TOSA 3O0DA 3WK8A 3RHSA 3DDNA 3MTQA 1QIMA 2NTJA 3DMHA 1KI6A 2EU8A 4OGFA 4J0HA 3EZ5A 4BNJA 1YT3A 3H42B 5HHHA 2PO7A 1Z4KA 1K4MA 4CETA 2XX3A 4RO0A 2XKAA 4HVCA 2P9TA 1PKXA 2E87A 3IAAA 4D9JA 4HAXA 1BVSA 1TTPB 1ID1A 1V9PA 3HE3A 3LH5A 3LBIA 3QKIA 1U9IC 4WBNA 1T2NA 1Z35A 4P7BA 2WWFA 1NKSA 1RXEA 1DC6A 1SQGA 1U3DA 3M7DA 2GJ4A 2IF0A 1XMXA 2W9BA 1KZHA 4V38A 3BDPA 4J9SA 4EF6A 2FXVA 3GDFA 3OPQA 4YQFA 4ES6A 3TARA 1KO1A 4GI5A 3RV4A 2QSJA 2FUKA 3RKUA 3NHAA 5I48A 1P9LA 3PFCA 5DLGA 2W7TA 5BN5B 4JQCA 2IYSA 5MGNA 3RUPA 2W8KA 3HR8A 4MYTA 3LCUA 4LOHA 4EHFA 4PGMA 4C22A 3NHJA 4YTEA 1N2CE 1IQPA 1UJ4A 4LNUA 4G1CA 4KREA 3M1AA 2PGOA 3O1IC 5FBWB 3UCEA 4I4NA 1LLQA 3S6JA 4UUNA 5HKKD 1FFEA 1YT5A 3L8YA 4MQBA 2G5CA 3IFSA 2A67A 2W03A 4X5VA 4R71A 1Q3VA 3M82A 3OUTA 3TNYA 2E4AA 3TW8A 1EM6A 2OMKA 3P4UA 5CA1A 3GG9A 4B2LA 2JAWA 3GEPA 2FK8A 3IP7A 1H4QA 4PIPA 1CX9B 1NX6A 4ED0A 4ZV4A 5LZ9A 3GCGA 2FZEA 3HLTA 3QEJA 3PI7A 5DO9A 1I7DA 3HLKA 2EH9A 4QARA 4MR8A 3HU3A 3RKRA 4R0VA 3FMIA 5T8KA 3GARA 4GYWA 3K0AA 3PGLA 1JIQA 3IKMB 1FJXA 1CJBA 1ATZA 1NR1A 3GGSA 2FG6C 1RADA 1P73A 1NG9A 1ZHOA 1UQTA 5ICFA 4GYJA 3K1ZA 3FNQA 3N2EA 3PUYA 1KTQA 1H9AA 3J7TA 2MDTA 4DR7B 4DFMA 3MEQA 4JYPA 3JQ7A 3O0FA 3B53X 2KG5A 1QGOA 5DNEA 3GVPA 4IXWA 4UQPA 4AROA 5ALVA 3VTKA 4DCUA 2PBRA 1KC1A 1RPAA 3IVRA 1UBJS 5GJVC 4CG0A 5KL8B 3QKRB 1OIXA 2YZNA 1QLJA 5LUAA 1PZNA 2WF7A 2GN9A 2IHBA 2NYUA 3SYRA 1ZBDA 4Q1EA 5CVVA 2JBWA 3I9V1 5LBTA 2HRQA 2M6RA 2P9GA 2IZ7A 4TL7A 1DWOA 2O7RA 1RU3A 1YZ3A 3QPUA 3P5SA 1G60A 2V8BA 3QUAA 2BDEA 3PITA 1TA0A 5KTYA 1XK6A 4FGJA 1CUWA 1E3JA 3ZHUA 1UBGA 5JFOA 3I6YA 1E0SA 1N2SA 2DBQA 4PL1A 5KG5A 3H0LB 1YZHA 3JD3A 3NEPX 1YL7A 3VNRA 3HV0A 2P0EA 2UYGA 2GM9A 2GKSA 2KMDA 1RYMA 3AF3A 1NXOA 4BJ3A 3HP7A 1JMKC 4OP3A 3OQMA 5ERYA 4F56A 5E9WA 5KYYA 1U2RA 4Y0NA 3SZMA 2KBEA 1R0YA 4TWRA 4EYKA 2HQ1A 3N76A 5LZ5A 5KFMA 3JQ9A 3EA4A 1D03A 4F4DA 4YRPA 3O1LA 4X95A 3W8EA 3GFKB 3WJ1A 1V6SA 2O0HA 1RG6A 4F38A 1KPHA 3KHLA 4OL9A 4XJSA 5CNJA 4F4KA 2FN7A 2AG5A 8ICVA 2CNOA 2LIVA 4KRYA 2R1VB 4X5OA 9ICLA 5LQAA 5IIKA 4I5IA 1JU3A 2BDPA 2DAPA 1HE3A 1PBNA 5JCPA 3M9XA 1C3OA 1OWPA 1EX6A 2O3SA 3DKPA 3DT8A 1AX9A 1PHRA 2X2EA 1E7SA 2JAXA 5KHLB 1CQXA 3AU8A 5J2UF 5I8PA 3UAZA 4CZ2A 2B61A 2X0NA 5GV8A 2R44A 4N18A 3DF7A 4DJTA 1ZQRA 4CF4A 2ZZNA 3DZDA 3OEHA 4WOPA 1ZRMA 2REXB 1ZETA 5JE8A 3HJNA 4R8SA 4GX1A 2ADOA 5LD2B 4QRIA 3PO5A 4MYCA 2D8CA 3IUQA 3LYUA 4DJDC 3BK7A 1Y89A 1XDSA 3C14C 2M1XA 3GAFA 3FHOA 2K2QB 3LDUA 1GPKA 4IOMA 3L07A 5U1PA 2Z58A 3HJRA 5J2KA 4M9ZA 4P3PA 1LXCA 4KLQA 2LKCA 2BSAA 4GC7A 1BU5A 3CWZA 3OLWA 4BLPA 4D3ZA 2K4MA 2ZSEA 1N0UA 1NR5A 3CNOA 1M83A 2YVKA 4Y2GA 1U4OA 3OZEA 2FZVA 1W93A 4HYEA 1SC1A 5EXXA 2PFOA 3NFRA 3G7SA 2JLYA 5BW4A 3IMEA 4J7UA 1UMCB 3FBWA 4IFBA 3JR3A 1KEUA 1S7CA 4Q7MB 2ODGA 2PMBA 4D0LB 4RL4A 1E1KA 3RO7A 1DUVG 1P39A 5A3JA 1NVTA 5LZ8A 5A5DA 1X70A 5JWOA 5GONA 2AK2A 3IUMA 3OT4A 2JGIA 4M0EA 4FE3A 3L82B 2K6GA 1NVBA 1E2LA 1DELA 3REQA 3RU2A 5ECDA 2VA9A 3T9FA 3JYHA 4OQNA 3LHKA 3A6KA 4DNPA 3MGKA 3OQJA 5CHGA 1KP3A 4G26A 2R8PA 4PYKA 3KKMA 5IWAB 2HLHA 3IEPA 2N46A 3ECAA 2C5FA 1FNDA 3BSWA 4RK7A 3K9WA 4TVBA 3CPJB 1K5PA 1VYTA 2IYVA 2KQUA 2L69A 2VTDA 1BHJA 3LWLA 1VYUA 2PUAA 3VHXA 3M0EA 5ER9A 4CL8A 4WKCA 2PFSA 4L5AA 4CKEA 1NLMA 1BX1A 1O97D 2XYRA 3BL5A 4ZREA 1H23A 1AUOA 4F3RA 3QLEA 1EFUA 4EMUA 2WJWA 1N7JA 2IY7A 2MA1A 1A9TA 3NU1A 4Q8FA 1R9GA 1V3QE 1NK9A 4AXXA 1OBHA 3B9QA 3IEUA 5J4LA 2B20A 2ZYSA 3ELYA 4DL4A 2OQ2A 3T61A 4OXRA 4RTQA 2G67A 4N4AA 4KACA 3D3NA 2VJ5A 1OD6A 2Q3BA 3ZVKA 3QHQA 4QATA 2II6A 3C70A 4IS3A 4ZI7A 5B2ZA 4XZ3A 5TRTA 3NR2A 1XVTA 3UH1A 3SQWA 2QRVA 3WGYA 1G63A 2QXTA 2FX3A 3G5MA 5DRYA 4QVGA 1DBRA 1D4ZA 2HQSA 5FBLB 8ICSA 5CYFA 4NL9A 5JQGA 2WD9A 3EB9A 1T2VA 4JC0A 4FFBB 3GGJA 3SQLA 3PQ5A 2CL6X 1GGVA 4LDQA 4MUAA 3V7WA 1Z16A 3C5CA 2FW0A 2R6ZA 4TL9A 5TJ9A 2EL9A 1KBOA 1YR3A 5CITA 3F3MA 5KYVA 5K3EA 3L1VA 3H9BA 3I64A 4HDNA 3GFOA 3CLUD 3PYMA 4LZZA 1FC0A 5CVJA 3BMNB 5J43A 1ZQOA 3KAQA 1EWYA 4PAWA 2WYOA 2H5IA 1CEZA 4JYMA 1MIOB 5ARDA 1GLGA 4LHSA 1IAVA 3KZMA 3LVRE 1J70A 3I6ZA 3H7IA 4PPQA 4ZT2A 3BHJA 3JQGA 3H5NA 2V4UA 3PSAA 2VQSA 1EP1B 3FCXA 5CFMA 2FSGA 4BP1A 4K6GA 8ICZA 4FN5A 1NXQA 4G5FA 4JQOA 4RUCA 5CW2A 3RADC 1T1IA 2YJ3A 3GEMA 4N49A 2A35A 3O2SB 2FP3A 1P4GA 3ISCA 4P2BA 4Z6DA 2NN3C 2PHZA 5BOSA 3UFBA 1L5KA 3UWKA 3W4JA 4XW2A 1GCGA 4G5GA 2O4CA 3PENA 3QWFA 4YMVA 1YBAA 3M83A 3A4VA 2ORYA 3W3ZB 3IV6A 1OW3B 3A1NA 3D7NA 1MMFB 3LW8A 4Y18A 4HGPA 1E8MA 4Q6WA 3UMMA 4PGFA 4M0AA 1H4VB 4QOHA 4EFKA 3CE9A 4QELA 5JQWA 4NS4A 3IAUA 3LK6A 3C3XA 3K5WA 1B22A 1U9ZA 3IVMA 1OV6A 3LF1A 2R79A 2O8NA 4KBFA 1XFAA 2QP9X 1RZVA 1H1LA 3ANYB 2QTRA 4ZYXA 1YACA 2V9PA 4BFWA 2J09A 2RGDA 1NW5A 2P1RA 1LKYB 2EZ4A 4Y2QA 3JU3A 3G7NA 3WYBA 1WF3A 4FB4A 4BVEA 4DPKA 5FTMA 3GLIE 2X7HA 3QENA 3QUTA 3TLJA 3E84A 4TTIA 5L53A 1YGYA 2YJGA 4WJZA 4Y8VA 5DBOA 3QXGA 1YRHA 3K7EA 3ZHOA 4DL6A 2VXCA 5K4HA 4B3XA 3O4VA 1AGXA 4OHXA 4CQLA 2W04A 4MSUA 3UPTA 2JFBA 3AVOA 1SKYB 3MBOA 2ZJ6A 3UGQA 2A4KA 5TSDA 3G2LA 1YFLA 3LXRA 3SIPA 2CXXA 2XD4A 4N6OA 2PH3A 2OBMA 1JE1A 4TXNA 4FUTA 2TMGA 1OTXA 2G6BA 4MLDA 4EHBA 3B20A 3DULA 4B3HA 3MMZA 2XTAA 1I2MA 4BFSA 5IDXA 1W2WB 3KZVA 1AK2A 1L5VA 1ISSA 4MB0A 4BKPA 1W0JA 1WKBA 4BFYA 2B0CA 1N4DA 3WJ7A 1JLLA 4GLFA 1VSTA 3PX2A 2CJYA 2HBRA 1QJ4A 4B7ZA 3R3UA 1QO7A 4YRFA 3I5MA 2GN0A 4NZ9A 5E4YA 2YQZA 4DTIA 4IYJA 3N6RA 1G8AA 2R1TA 4HDCA 4K28A 2M2IA 1PR6A 1IBLB 3F6EX 4YJHB 3RC3A 1PJSA 4D2IA 1WW3A 3NT2A 4IJ5A 5FADA 4ZZ2A 2RBKA 2M9MA 4GKJB 4M86A 4RPGA 1O6GA 2VTKA 3WP0A 2KMLA 1EQ2A 1FL9A 3TTYA 3JXEA 2N75A 4ZEWA 1ZUNA 1JYEA 1A1VA 1YOVA 1NRWA 4JYZA 2WIBA 2WWRA 1LW6E 3VHLB 2A1UB 2R7NA 3BFPA 3IIEA 4BJ6A 1SZJG 3PXDA 1ZQMA 4DBVO 2PD4A 4JLBA 3ICCA 5J4KA 2ID8A 2PKXA 5LMCA 3KEQA 1Z36A 4QFMA 3AQ4A 3S2UA 4NY8A 1P7VA 1XDGA 5J2DA 2XO7A 1F2UA 3KJFA 2AFHE 2HY7A 4M8NE 4WX2B 4PXAA 2IYOA 2AJLI 1KO4A 4OAPA 5KYNA 3B1YA 2PRJA 2Q41A 4FP9A 3ENKA 3O91A 5DBBA 2C1ZA 4D98A 2W8LA 5KFSA 2DGDA 2FHPA 4DCMA 1W35A 1IOWA 2ISSD 1WXWA 1IBRA 1QIFA 3QX7A 3OLCX 4TV8B 5C52B 3KJZA 5H7XA 3N7AA 2VLBA 2F3RA 2QKQA 1QWOA 2PZKA 1EB8A 4AWAA 1RXYA 4I9NA 1K0UA 5JEDA 1IHYA 3KZOA 5FPTA 4U3JB 4E6PA 3BYZA 2V1UA 4X54A 4O8ZA 4Y1RB 3DZHA 4B3GA 3A6FA 4P4LA 1PUIA 3GFVA 5BYJA 1U0OC 3GGPA 4M89A 2O2SA 1FRFS 3HR4A 3RVOA 3EGXA 1FUIA 2IH4A 4YT8A 3TADA 4AY5A 3SVTA 2DHDA 2HJVA 1FU7A 4MYUA 3A6JA 1G6OA 2DUNA 4EVQA 3QVVA 4EBFA 2CLCX 5TQ2B 4QGHA 1ZAKA 4FDUA 1GTVA 1JHOA 2BMAA 1XZHA 3REOA 4DS3A 4Z9FA 1QP8A 1QMPA 3LO5A 3SYMA 3B13B 2R60A 5KEIA 2H18A 1XCJA 4M60A 1CUUA 3VNUA 3GJ5A 1KEWA 3LQ1A 3G82C 1YB2A 4WSOA 2CE7A 1OT5A 5DTQA 2O3JA 1U6KA 4Q9AA 1OILA 1M8PA 3GRAA 2D4AA 5AXCA 3C8UA 2GDZA 3WBJA 1ZOLA 5GVRA 3RYIA 3QU2A 5BSVA 4ZU1X 1E89A 2Q50A 4HN2A 1YA8A 2C99A 2O23A 2ODAA 4CM8B 4ZYYA 3SZOA 1N2GA 5BR7A 3FTDA 1EE2A 4BMXA 3PQ8A 1JDPA 5AI0A 1X1EA 2GJSA 1U1FA 2O5EA 3WIDA 3HTXA 1TT7A 4PBRA 4HFMA 1WZEA 3ONNA 4F9EA 4PC3A 1M0EA 1QG2A 4ELUA 5AQEA 3PS9A 4DMKA 4FYVA 5FLXA 5HFAA 1E0JA 2WVAA 3D6AA 1GGMA 3KX2A 3DPIA 4I2FA 3RFUA 3W1EA 2KLBA 3I1IA 3JQFC 2FW7A 1V26A 4JEIA 4JP8A 2RJ3A 3BHNA 3AM9A 4LYFA 5IT0A 5DP2A 1FU4A 4M1OA 4S24A 1EA7A 4JUAA 2E4VA 4F3NA 1B0AA 4RJJA 1TC2A 4K0RA 5J2TF 3CY6A 1MBZA 2WB4A 1A9XB 4REQB 2HTFA 3R41A 5K0TA 4G09A 3PQ7A 1KFDA 5FYDA 3FCCA 4U5QA 3P0RA 3HJGA 2VANA 5ALZA 2H6EA 1THMA 4MOWA 4FX2A 2ZVDA 3TRKA 2H3IA 1JN0A 3QV1A 2Q4RA 4A0FA 2M0NA 4KYVA 2WYIA 2OD7A 3ER8A 1U8CB 4EW3A 4KXNA 4AP6A 3FYSA 2QDXA 1MR3F 1QAMA 4F45A 3MJVA 2DH5A 2FETA 1GWNA 4DR3B 2YRXA 2X0JA 1OAOA 3JCZA 3KOYA 2XMSA 1Z2EA 1P31A 1XRNA 1M54A 1NVUQ 1ZM9A 1J49A 3I73A 5F78A 1XMSA 2Z8YM 3N3BC 1DRWA 1ED1A 1WUHS 4ZDIA 1IN7A 4XUSA 1UIRA 2DFVA 3OX1A 3EGDB 4M55A 4DYVA 3AUSA 3HEAA 1TZKA 4YAWA 4AWXA 4YR2A 4CQMA 3TLGA 2C29D 2UZ0A 4DLWA 4BJQA 1VDZA 4EGJA 3AFGA 3ZDEA 2VRCD 2ZJ4A 5JYCA 4YRQA 1H5NA 2Z1DA 3CO0S 5JWHA 2C5HA 3WI7A 3ET5A 4M9JA 4P98A 2DHEA 4G1MB 1ECCA 5C4IA 3VU3A 3KVVA 5K7SA 2B25A 5BMVB 1W36B 4HX2A 1PJ3A 3SQMA 3NBZC 1GARA 4JITA 5I7OA 3EHEA 5CVEA 3IHLA 1XZFA 2VI5A 5HG0A 4DE5A 3S27A 1X7YA 3P9XA 4DKJA 3CX6A 1R6XA 2G88A 1XL0A 1XU4A 1LA2A 2O7QA 5KTMA 1EG7A 2YZ7A 3AKYA 4M1TA 3NUGA 1XSLA 1LJUA 3W9SA 4CDRA 4V3BA 4EGSA 4PF1A 4IRMA 3K6SA 1XA0A 3IDAA 4FZ3A 1A4IA 4UM9B 1N77A 3KCQA 3PEYA 4IH9A 3AMVA 3QGMA 2Z8ZA 4DCJA 2BUCA 2D5IA 5KVAA 2MSCB 4DMCA 1SXPA 3P1JA 4XLZA 2DY1A 1U8FO 2CL0X 4LJSA 7ICKA 1N9ZA 4XWWA 4ARUA 2SNIE 4A6XA 4O9MA 2FQXA 1S3SA 4IIGA 2IDZA 4RLFA 3N7UA 1PWZA 3R7WA 3LOPA 2CCJA 5KDOA 2GZAA 5KNDH 3AKZA 1YMQA 4LPSA 2JIBA 621PA 2HR1A 4KLTA 4KUGA 3ZXIA 2GLTA 4J0KA 2R86A 3AEXA 5J2CA 3HDGA 5IASA 5L4SA 1R0CA 3OJXA 2FPIB 3CWQA 4UAVA 3CPHA 3UT0A 4HGRA 4XUGB 2ZR9A 2OK7A 3W5BA 5EIHA 2GK4A 4NI5A 4N0QA 4QUHA 5I47A 4DW8A 4B3CA 1UPAA 1ZXIA 5FLEX 1GGHA 2XNDD 4H7HA 2YWHA 5KFJA 5LC1A 2LV8A 1LU9A 3QEKA 4FW8A 1V6AA 4RACA 4FYJA 1MAUA 3UJBA 1N9GA 2ZVPX 3PHIA 4UTOA 2J0SA 3LJKA 3AQFA 2XVYA 4LYYA 4F4YA 9ICSA 2ERYA 4K9PA 1XI2A 1E8DA 4MQEA 2VAWA 3GRKA 2ZUFA 4DMGA 3NYQA 3WC4A 1QVVA 3IAS6 5E1BA 4D8YA 4I55A 3BEDA 1NK4A 1B3BA 3QLTA 1O95D 3BZUA 1VKNA 3JTEA 4FJ1A 3FFBA 2WJ3A 3PQDA 1VC2A 4F4WA 5CLGA 5GY7A 2ZIXB 2BT4A 1XHLA 3A58B 3N0VA 1CYDA 5DEOA 2VUTA 5H83A 1JHXA 1A5ZA 1UDBA 2O0LA 5HQTA 1J9GA 1B6SA 1RAIA 3I9NA 1EQAA 1KPIA 4OHVA 3PVXA 2Q9CA 4NJEB 3BT7A 4QRHA 4DM3A 1UWVA 1QPZA 2C3MA 4XQEA 5JDCA 2J59A 1JXMA 2N1MA 2IYXA 4TYNA 2ZUBA 2ECQA 3HB9A 3UM9A 2GGSA 2INGX 3ODPA 1Z15A 5FWXB 2JEIA 5GJWC 5K0FA 1EYZA 2ODEA 3JTMA 3GA7A 4FOTA 4OHKA 4YCNA 3ZY2A 4PHCA 5JT1A 4B8WA 4HVLA 3VC8A 4JVSB 3TQOA 3SDSA 2GWRA 4I50B 3IJEB 1GA1A 1GOTA 4RXUA 2PS1A 1X87A 3V1UA 1FYEA 3M81A 3UHOA 1HNZB 4EH1A 4QOEA 1Z88A 1SQSA 2C20A 1FDIA 1KJNA 3G8CA 2B9EA 5EL0A 4GKBA 4RETA 5AT1A 3ZTTA 2H5JA 1Z75A 5B36A 1VECA 3PQ3A 4OXXA 3I23A 3DO8A 4YRIA 4QT4A 5DRTA 2IBTA 4RE6A 4EDFA 5C7OO 1WXEA 2P9BA 2ZW9A 5IKPA 2H4JA 2ZE7A 3PD7A 3FR8A 4F0JA 4CBVA 3FDJA 4QDXA 1USUA 4RQ2A 5IJ0B 3WQQA 2VDLB 1EFHA 4YXWD 4IJQA 2WD8A 1SA0A 3W2EA 3LYHA 1H38A 3H0MB 3D64A 2O8BB 1IPEA 4JYAB 1CJCA 5CVCA 3MJDA 4ITRC 3F7NA 1Z4JA 4DR2B 4PH5A 3Q10A 2VDRB 1Z13A 1SHKA 3IEVA 3DHVA 2RE8A 2O6KA 4O4IF 5DSXA 3OCYA 5DGBA 4LJ5A 2O2HA 1XP5A 3UHFA 4H08A 1FNNA 3FKSA 4D8XA 1FTSA 1DJMA 3GLTA 5C5EA 3IM1A 5ETJA 1S7GA 3NVAA 3PE4A 4KITB 4R68A 4QPDA 2H17A 1NKVA 2ZWMA 1KS9A 3OKAA 3J81k 3IPCA 2J0UA 4C2TA 4FDMA 4X1KA 1MA3A 4WXEA 1XDDA 2AC4A 4EA8A 1NNI1 2C2OA 1DQSA 1U28A 2QX7A 1NTRA 2QOEA 5LBUA 3WDKA 4HQRA 3ZWCA 1I24A 4KXFB 3F4BA 5GQSA 1GNLA 4BAUA 1SXJD 4DMRA 3FPGA 4MCJA 3ND9A 5BSTA 1Y3FE 4CCSA 1ADYA 5LN1A 4NE9A 5IS2A 3SBDA 4DAEA 4I1SA 3R3VA 2J5RA 3OQOA 2GZSA 1NVWQ 3LA8A 5TLSA 3GT4A 1KDRA 3JD4A 3R6WA 1ZVMA 1LVUA 1J2TA 2H3FA 1SCAA 3CN9A 3F46A 1UZAA 1YR6A 2Q2WA 4DN6A 3ZDQA 5KG4A 2H0AA 3SAHA 3CH5A 2C5AA 5ALYA 3ZCPA 5KYXB 3V8VA 3VU9B 1P2UA 2BZGA 2GN8A 2OCAA 1O6FA 1HFJA 3NHRA 4WNCA 1QHIA 1S97A 4GX5A 1LD3A 1I2ZA 1SN7A 2IGTA 3C8HA 2PZFA 1E69A 3I2HA 1SU6A 3VZDA 4B3RB 2D0DA 2IXAA 1QHXA 5CCDA 1Y9AA 5HVNA 2ATXA 1W73A 5EJ8A 4WEQA 4KFTA 1NBEA 1I51A 1P4RA 2WUEA 5AFSA 1T3GA 1FTWA 4KQKA 4ZGGA 2AWOA 4QYMA 3NFYA 1CT9A 1V1RB 2FJ6A 2VR1A 4Q9JA 2IZ0A 5JH7A 1XXHE 3THVA 1T4MA 2AQKA 2AQ8A 4GX2A 2A0WA 3OQIB 3QU5A 1LX6A 3M6UA 1U0HC 3WSTA 1J2EA 1C14A 2MYTA 3TZHA 2CL5A 3EDMA 2A84A 2OHXA 2H1HA 1KYYA 1BQEA 5A2QA 3R9XA 4N8SA 4ZYTA 5JAPA 5BYBA 3TN7A 3LD9A 4IIEA 2DE0X 1DK3A 1XEWY 4KFCA 1RWQA