3QU7A

Crystal structure of pyrophosphatase from bacteroides thetaiotaomicron, asp13asn mutant complexed with calcium and phosphate
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
221
structure length
221
Chain Sequence
b'KLKAVLFDMNGVLFNSMPYHSEAWHQVMKTHGLDLSREEAYMHEGRTGASTINIVFQRELGKEATQEEIESIYHEKSILFNSYPEAERMPGAWELLQKVKSEGLTPMVVTGSGQLSLLERLEHNFPGMFHKELMVTAFDVKYGKPNPEPYLMALKKGGLKADEAVVIENAPLGVEAGHKAGIFTIAVNTGPLDGQVLLDAGADLLFPSMQTLCDSWDTIML'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INORGANIC PYROPHOSPHATASE
publication title Divergence of Structure and Function in the Haloacid Dehalogenase Enzyme Superfamily: Bacteroides thetaiotaomicron BT2127 Is an Inorganic Pyrophosphatase.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
total genus 78
structure length 221
sequence length 221
chains with identical sequence B
ec nomenclature ec 3.6.1.1: Inorganic diphosphatase.
pdb deposition date 2011-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3qu7A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3qu7A01
3OCWA 5AI4A 3I76A 4CF3A 3ET4A 1T5SA 3MC1A 3QLEA 2AH5A 2HO4A 3ZX4A 5ALTA 2FUEA 1S2OA 4BYGA 1TJ5A 1RMQA 5ALXA 2AUTA 4EENA 2HF2A 4I9GA 1RKUA 1RQLA 2W4MA 2YMLA 4BX0A 3W5BA 2VKQA 1YV9A 5ALQA 1YMQA 3L8GA 5ALEA 5ALKA 1NNLA 5AW5A 2I55A 3FPBA 4CF5A 3EF0A 3MN1A 5AW0A 3ZU6A 5IS2A 3QUQA 1YJ5A 3L1VA 4UU0A 1WZCA 4QJBA 2YY6A 4UAVA 3SHQA 3WK5A 3U7FB 2B30A 3QU2A 1Z4JA 3ED5A 3QNMA 1RKQA 2BDEA 1O08A 2HHLA 5AM2A 2PKEA 1J8DA 4G63A 5ALFA 3BA6A 4F72A 5ALRA 4UW9A 5AM3A 1ZD5A 5AK6A 3L8EA 4HGRA 5AVWA 5IT0A 4FFDA 4ZEXA 5AKKA 4KNWA 2ZBGA 1QQ5A 1Z4NA 2I54A 2FPXA 3R4CA 3B9BA 3N8GA 4PNHA 2FI1A 2JAWA 1Z4QA 4C4TA 2QLTA 4H1WA 2ZBEA 3IB6A 5ALVA 1ZS9A 1FEZA 2RBKA 2WF7A 4FYPA 3ZW7A 1F5SA 3AR6A 4BX3A 3WGVA 1QYIA 1Z4PX 3OCUA 1QH9A 2W43A 4OHFA 4J03A 1WR8A 5ALHA 2OA0A 2IA5A 3QGMA 1T5TA 5AW7A 1RLTA 1U2TA 3OCYA 4L57A 1Z4MA 4OFZA 3KC2A 1RRCA 4HGPA 3E84A 4JB3A 3ZWKA 4AS3A 1ZRNA 1Y8AA 3AR8A 2CN1A 4BBJA 2I6XA 5AVXA 4NV0A 3QUCA 1T9ZA 1ZD2P 2NO5A 4YGYA 3QU7A 1ZJJA 2FPUA 3QU9A 1Z4KA 5ALGA 3SD7A 4DFDA 1N8NA 2G80A 3DV9A 4CE6A 1XVIA 4ZEVA 2HOQA 2G1AA 1S8OA 3I6BA 2B82A 4BNDA 4L6CA 3WKEA 4KX5A 3NRJA 5ALUA 4MWOA 5JJBA 2CFSA 1ZD3A 5ALDA 3WK9A 2G06A 5AVSA 1RC8A 3I1YA 5AM5A 4FE3A 5AVZA 3DDHA 2RB5A 4HGQA 4BEVA 1WPGA 5AKZA 2WF5A 1QQ6A 2D2VA 2MU1A 2YBDA 1RMYA 2ZG6A 2YFYA 4EELA 3NIWA 4Y2VA 3DNPA 1YNSA 2C9MA 3QXGA 3AR4A 2FUCA 2FPSA 2ZBDA 3W5DA 5AW9A 3FVVA 1YS9A 3NANA 1RQNA 1RLMA 3ESRA 5AVTA 5ALYA 4GXTA 3FM9A 4YIKA 3HYCA 1L7MA 2YMQA 1U2SA 2R8EA 3VAYA 1L7OA 3F9RA 4EX7A 2EATA 3WKAA 3TLMA 3FZQA 2AMYA 3SLRA 3ZVLA 4NAVA 2YJ3A 2B1RA 1U7OA 3EF1A 3L0CA 3PCTA 5AM4A 2AGVA 5AI0A 3KOOA 2P69A 1MH9A 3QU4A 4YCLA 2G0AA 3L8FA 5AI9A 5ALOA 5AKLA 3CNHA 2DQSA 3BWVA 3ZX5A 4GIBA 1K1EA 1L8OA 2B0CA 1YDFA 1EK2A 3IRUA 3L1UA 3ZTWA 3W5CA 2W11A 2B8JA 2PQ0A 2R8ZA 3AR5A 3SKXA 3QUTA 5A3RA 5AESA 2G07A 3DAOA 4C4RA 3M9LA 2RAVA 4XPZA 3ET5A 2P9JA 1KYTA 1VJ5A 1RDFA 5AK4A 2HX1A 3GYGA 1U7PA 5AK5A 5AKYA 2OBBA 3N28A 5IT4A 2YMMA 3M1YA 2HEGA 5AVRA 5AKXA 3KD3A 3K1ZA 5A3QA 2C8LA 4Y2YA 3A1EA 3A1DA 1TA0A 5AI6A 2Q4TA 4UU1A 4CF4A 5AM1A 3I28A 2GO7A 2ZXEA 2MU2A 1WVIA 2EARA 4UMEA 2WF9A 1ZOLA 3RFUA 5ALIA 3EPRA 4L6AA 3UMBA 3UMGA 3QYPA 3S6JA 2GHTA 3SF0A 2WFAA 3QX7A 4Y2PA 1ZRMA 4AP9A 5AW8A 3OCXA 1L7PA 3CZ4A 3KDPA 3WKCA 5ALJA 2P11A 3B9RA 5AI5A 3PDWA 3ZVNA 3N07A 5ALWA 1XPJA 3SMVA 3U13A 5AKEA 5E0OA 5AW1A 4E88A 2JARA 5T41A 5AKHA 2QYHA 5FP0A 1TE2A 1LVHA 3WKDA 2FPRA 3KBBA 2O9JA 1CR6A 4QQFA 2FPWA 3ZI4A 4Y2TA 2Q5EA 2BDUA 3U7EB 1VFPA 2CFRA 3E8MA 4UM5A 4RETA 3L0YA 5AVQA 3D6JA 4IG4A 4YCNA 5ALPA 1X42A 1L6RA 3ZTYA 2NO4A 4UATA 5AICA 2CFTA 2FEAA 2ZBFA 4HGNA 4HYTA 3OPXA 3R09A 3MPOA 2O2XA 3SKYA 1RMTA 2ODAA 3N1UA 3WKBA 1J97A 2GFHA 3ONNA 1AQ6A 4F71A 4G9BA 3MMZA 3UM9A 2HF7A 4XE5A 3PGVA 3WGUA 2R8XA 4J2TA 2IOFK 2JGAA 3AR7A 2B1QA 2HSZA 2GHQA 2HCFA 2I34A 4YH1A 2HDOA 1RKVA 1L8LA 4EZEA 1CQZA 2X4DA 5AW6A 2MSNA 4Y2XA 3UMCA 4KX3A 5AI8A 2BY4A 2JAOA 5ALMA 2NYVA 1SWWA 4O8CA 2I7DA 1XP5A 2Q4RA 3L5KA 2RARA 2YJ5A 3AR9A 4KYTA 4UMFA 2YMPA 3OCZA 1NRWA 3WK6A 3N5KA 3WK7A 4Y2JA 3NASA 1Z4LA 3U19A 1Z5UA 4C4SA 1L7NA 5AHXA 1Z4IA 1VJRA 1Q91A 4B6JA 5AVYA 5AIAA 4XOUA 3E81A 2B8EA 1RPZA 3A1CA 3ESQA 5A3SA 5AK3A 1ZD4A 2YJ4A 1QQ7A 2YN4A 2WHEA 2GMWA 4UASA 2OM6A 4MUMA 3FGOA 2ZOSA 3J7TA 1IWOA 3L8HA 2FDRA 3QUBA 1NF2A 4RESA 4KNVA 2IOHA 4UARA 5AKJA 3IJ5A 1TJ3A 3U7GA 4Y2QA 2C4NA 1PW5A 1RLOA 3NAMA 4JDPA 4Y2RA 2JAUA 3R9KA 3PGLA 4CNQA 2C88A 2IYEA 1Z5GA 1U02A 1N9KA 4KN8A 2WF8A 2WM8A 3QU5A 2YJ6A 2I33A 3ZWDA 4Y2SA 4OD0A 5AW3A 3A3YA 4XQ0A 1SWVA 2R8YA 3EWIA 4UMVA 3NALA 3RF6A 4DW8A 4OCZA 4EEKA 4YIHA 2P27A 4AS2A 3WK4A 2G08A 3AR2A 4EX6A 2HI0A 5AKIA 5AM0A 1O03A 3OTQA 3AR3A 3NUQA 4HGOA 1EK1A 1Z88A 5AVVA 4Y3UA 4HAIA 3E58A 4IFTA 4UAUA 1Q92A 4BNDB 4Y2UA 5ALNA 2EAUA 1Z4OA 3ZUPA 5ALSA 4UMDA 4NWIA 3L7YA 2OYCA 3U26A 2PR7A 5AVUA 3B8EA 5AIBA 5ALZA 5AW4A 4NABA 2G09A 4NFLA 3OCVA 4I9FA 3L0BA 4UM7A 5AKGA 3ZVMA 1LTQA 3WK8A 4DWOA 3W5AA 2C8KA 3U7HB 4ZEWA 3HLTA 4YCMA 5ALLA 3KZXA 4BEWA 2IOFA 3FPSA 4BKMA 4DCCA 1TJ4A 1JUDA 1SU4A 2WF6A 3P96A 4BX2A 5AW2A
chains in the Genus database with same CATH superfamily
4J7UA 3TOXA 4RMJA 3W7VA 5DBEX 3I76A 3AHEA 2R79A 3F5FA 2VLBA 1ZQQA 4FS8A 1JSLA 4OL0A 3OTGA 4HWOA 4GC9A 2B9EA 1QHEA 2R8IA 5IJ9B 2I2CA 5IS2A 1VB5A 3I2FA 3E7DA 3DF9A 1TA9A 1CZRA 5DTMA 3P9SA 2RBEA 5FWXA 2IP1A 1YQXA 4XUGB 2JRCA 5JSFA 2ZXUA 4WEQA 5IXSA 4WZBB 2QTNA 1UWCA 4YP6A 5JOQA 4DT1B 1SD2A 4NFHA 4NFSA 5I3CA 4ZHSA 1PI3A 1XAJA 2QN9A 2FWPA 1QLWA 3TRKA 3TRHA 1UBFA 4XQEA 4PHCA 3JD0A 3HSYA 1WMDA 3K3PA 4EI9A 4O3OA 2OLJA 3DBVO 5DT2A 3HRIA 3FKQA 5BSGA 2N1RA 5KNDD 4N1AA 3AR8A 3CLRD 3RYTC 4Q37A 1M9NA 2FR8C 3IP5A 5EC8A 4H0NA 1KQQA 4M0EA 2CEAA 3HNOA 1XVIA 2TYSB 4YRFA 5DNWA 3G5TA 2PZMA 4NICA 1C3VA 4KLRA 3HY4A 2PT9A 2BZ1A 1U2GA 1HMPA 3GLIB 2OXRA 1U94A 4Q21A 5ELLA 1MO2A 1Y7HA 1CT9A 4M7PA 2QRGA 3E9CA 2AG1A 2PMEA 1VGVA 4QZDA 4U6QA 1VLBA 2JGJA 3WHPA 4Y8VA 5KG6A 1W8DA 2ONZA 3Q87B 4IFEA 1A8PA 4CF7A 3WGQA 1M1NB 3W6PA 1A95A 1XVLA 2GFIA 2FMIA 1XR3A 1OWPA 3ZE6A 1T8EA 1WTAA 3BGSA 4DFJA 4CEIA 3OAAD 4QARA 2DGZA 4YV2A 4U2EA 5AHKA 4B6PA 4MAMA 2P4EA 3RVMA 3HG7A 1NW7A 2I3ZA 2CJWA 4WECA 4OU4A 2IP4A 1M8PA 3VR6A 1UMBA 1ZMBA 5K05A 3LYLA 3TNLA 3X0DA 2JIOA 1EX9A 4QE3A 1UC9A 4RQBA 1XFAA 3QUSA 1UBSB 4C9BA 1QF9A 4D4JA 4HATA 3X2FA 3O2QB 4IY1A 3MUNA 4D99A 1SKYE 1RJWA 4Z3OA 1QB7A 1Z0AA 2WC1A 3MINA 4C0LA 3V1NA 3T5MA 1P9LA 3AM5A 2Q5LA 1KRXA 4QECA 1WHTB 2WYOA 4KVAA 4C8OA 2RH8A 2QR2A 5BYAA 2XI4A 3K4PA 4H60A 2XZDA 2FSVC 3PC6A 1QH8A 3X1XA 3DL0A 1UUFA 3ROQA 3B3GA 2SKDA 3QEAZ 4HC4A 1D2HA 5EN4A 7ICFA 2QP9X 4HAWA 2HAEA 1DFGA 3M6VA 4EB6A 3LU1A 3WYNA 5DBIA 3CKLA 1RKVA 4DL4A 3BS5B 3LYAA 1YQTA 3BRSA 1KSFX 1U98A 3AJ9A 4BMPB 4ZV7A 4JI4B 2I4RA 4R7GA 1ANKA 1NTRA 3GN2A 4N7BA 1NXXA 1TQHA 2R751 4YJFB 3N0XA 3FGOA 2BMVA 2ZOSA 1IWOA 3OTIA 2IZ5A 1ZQIA 3EYAA 5CHGA 2BM1A 3KSRA 4MLPA 2WJYA 2XRFA 4H27A 3AVVA 3ZE9A 4JI5B 2GF0A 3KFUF 1R5BA 1IN7A 1GTL1 3EIOA 4BX8A 2WM3A 3RF6A 2JVIA 3AR2A 4M88A 1NW9B 1U0RA 2JLAA 5AVVA 1Y5MA 4KLHA 2I91A 4XTRA 2SNIE 2J87A 2IBTA 4GOMD 2HMAA 2ZBVA 5CFQA 4NYIR 3VSDA 3KUDA 3EMVA 4FYHA 6Q21A 4PQRA 5ICGA 4XIYA 2I1VB 4GPBA 2H0RA 5IYZF 3OP4A 3B6IA 1WCIB 3QMWA 3AIMA 2BSAA 1FSFA 5DGAA 1I5RA 4M89A 1QHIA 2ZROA 2W2MA 3FRIA 5A4MS 4M60A 3P27A 2HO4A 1I6WA 2ZUWA 4XSGA 2JIQA 3WYAA 1M6EX 5EIAA 3I1FA 3G1UA 3BWXA 4QPCA 1ZVKA 4YCJA 2YOHA 5KVVA 1KI8A 3ZVRA 5JBNA 3V9PA 3PTAA 4LZNA 2VT3A 4FT4A 4GICA 2B30A 3N2YA 4DLYA 1CU1A 2BDEA 3AVQA 4EGQA 1ZLYA 4Y1RB 2WTXA 4CLHA 3AP1A 1ZC4A 4K4GA 3OIWA 4E6EA 1CHNA 2BFCA 4U7GA 1QS0A 4XUSA 3FCCA 1N36B 1JR3E 1I6MA 4LEIA 2G1PA 3VH4A 1SU8A 1ZKDA 3U81A 1ICIA 2V1UA 5ILOA 3M8KA 5BW6B 5JYDA 4JELA 4RQ7A 1U0BB 1ZRNA 1PG0A 5CLQA 3ZY4A 3FRJA 5IZCC 3UC5A 2FGJA 3OFND 4L4ZA 3WJAA 3O8RA 3TDNA 4YQZA 1YAJA 1USVA 1PP4A 4PM4A 4M1OA 4MMYB 4EHLA 5KVQA 1BJRE 1GKIA 5KB3A 3RC1A 2CEKA 5FFFA 3TPCA 4L0QA 3HN2A 4RD0A 4JIMA 3BSSA 3O3OB 4YCXA 2NO1A 5I9LA 2IHJA 1D6SA 3Q2KA 3BQ1A 2JJ8A 2P9TA 1XZFA 5LA6A 5F12A 4QWEA 3A9CA 3FDZB 5HBGA 4YRLA 2YWRA 2YMQA 4FB4A 4PZLA 4K8RB 1AN9A 1ZEMA 1VFNA 3I32A 4DPMA 4CT4B 1Y3HA 2JMGA 2GS9A 4LBZA 4BP3A 1MVLA 4JKYA 1K1EA 3JPSA 3I2GA 1TU0A 1QHYA 3U4QB 3H4IA 2C7RA 4MI6A 4A0SA 2CXSA 2J9YB 1E8NA 5I9NA 2DHQA 1KC1A 1KYTA 1RRVA 1KWKA 5K3CA 2VRNA 1JH9A 3CEHA 3IGFA 3VGJA 2OZPA 1IOZA 2C8LA 4YJ2B 2A9KA 3LX5A 4ZYUA 4X92A 5G4KB 5CHYA 1EIZA 1KO5A 5DK6A 3NVWA 1NP7A 4IDAA 5HDBB 1IZ7A 1M33A 1E6MA 4ZCLA 2D6FC 2VYFA 9ICRA 3RNLA 3OMWA 4TWBA 1YB1A 1WXIA 2OUKA 2VDVE 1XZLA 1W93A 5B3JA 1B00A 2WTEA 4MEJA 3FZYA 2WAAA 4L0CA 3BGVA 1NMQA 1HT2E 1LVHA 3U5TA 3WDSA 4LRXA 1NUPA 5LR6A 1CRZA 2JJ2D 5J2AA 2W6MA 3E8MA 4CNBA 2AKEA 4Y67A 1I3LA 5REQB 4K26A 1XRNA 1WSWA 1U0GA 3PEFA 1X1RA 4WNAA 2JRZA 3BQTA 3DKVA 1XC9A 2N42A 4XE5A 1SBHA 1QP8A 5KEIA 3PFBA 3E8XA 3FNIA 2V4MA 2NPFA 2I3GA 2AOUB 2D7CA 2VHXA 5JD5A 1E98A 5IH3A 3QZ8A 1T0HB 1DDOA 3QWIA 4J0GA 1RTTA 1V1MA 2N9UA 5DDMA 3LG2A 4MA0A 4M99A 4XZ3A 2QX4A 2EW1A 3KYCB 2YFKA 1MPTA 8ICQA 1SQGA 3K0CC 1IH8A 5ESDA 3HH8A 3GJ8A 4PAWA 4OJMX 1BKSB 2O07A 3ELWA 3NYWA 4US2R 4F4WA 4UASA 4LSMA 4ND6A 1BHO1 5K01A 3ZHQA 2OKCA 2ZXIA 2OOKA 5IPFA 1U3WA 4JUDX 3WXBA 3QSYA 3FYCA 1S77D 2QHXA 4LTDA 2WWVD 8ICEA 5K3DA 1FSSA 2NXJA 5LJIA 2H07A 3E7PA 3S55A 8ICMA 1L8QA 3AEXA 2Q0SA 4BGVA 4ED6A 1F60A 3AYXB 3UAYA 3AI2A 4A9AA 2Z5LA 2A5GA 3RV4A 3FR8A 4TKUA 4L2IB 4DPLA 3R9XB 4BWVA 2D0IA 3ZVKA 1TJ4A 4IWNA 2JCXA 2VWGA 4P4NA 2C7BA 1IUNA 4DQRA 5HXAA 1BH2A 1WUDA 2C99A 2ZBRA 2GKSA 3CLTC 2FGKA 5TLSA 2JFYA 2BMWA 3JRWA 5J2DA 1D2AA 3GFKB 5ERGB 1QE0A 2DWUA 4KFRA 1QKIA 3D8NA 3HXQA 1WYGA 3NMUF 1VLLA 4FFPA 3L1VA 2NZUG 1NR5A 1U3FA 1ZNQO 3ZGLA 3Q6MA 1Z7WA 2BDTA 3T7CA 3KVVA 2CSXA 4HJRA 3L8EA 1OW5A 2XT9A 2FYTA 5ICMA 4X5OA 4RMHA 1I13A 4PG5A 1TL7C 1JQBA 3ZZMA 1V45E 1QSLA 1N7IA 1QK3A 2CW5A 1A5BB 3OQPA 3ENKA 5GZ6A 4BMOB 4KN7A 3AVUA 3LQ4A 8ICGA 5JRZA 3OZDA 4CDNA 3SX4A 1Z0FA 1MW8X 5BUQA 3PDJA 4CUJA 1FU4A 4UD2A 3BMQB 3F71A 5L1IA 2ZFUA 4JITA 3WMGA 2A1TS 2IYAA 4E7OA 3OJCA 2OCAA 1WM1A 1X6VA 2X1LA 4V3BA 2OEPA 5JCXA 1TADA 4K4IA 4R98A 3ESRA 1KFCB 1B8OA 4MR7B 1V71A 3C1ZA 4PVCA 3FFTA 4PC2A 5LWQA 3SLRA 1QG4A 4GPTA 5SYAA 2OO5C 2ZANA 2ADOA 1V1JA 2PQ6A 4BFVA 3RRGA 2ZI3A 5KKCA 1YUNA 1BQ3A 4E5NA 4Z2AA 2I3AA 3TM4A 4RQ1A 4UE2A 2O7RA 3KPVA 2CFCA 4KR3A 1BCRA 3K0FB 3MJEA 1IVYA 1BWSA 1I32A 3A6HA 2W8KA 4LCEA 3KJQA 2WPNA 3W2GA 3H5RA 3F8TA 3QY0A 5EKSA 1FFEA 1KFTA 3FPKA 3T4UA 3CRRA 2IUEA 2EQBA 4DSEA 4EYHB 2VHUA 4G6ZA 2FPIA 4QGHA 3O1IC 1D6MA 4LC9A 4BJ1A 2IF0A 1CR6A 4FHDA 4JFAA 2HVHA 1BG6A 3KKKA 4HDKA 3H2ZA 3HN7A 4B3RB 2EF1A 1ZCBA 3JRXA 4M21A 5EERA 1TUIA 3OPXA 3KYIB 4XH9B 1FXWA 4A5OA 4DLZA 2ID8A 4LZDA 3NBAA 4BATA 1IJFA 1RVDA 3OY7A 1EBFA 1J0BA 2VF4X 1P8JA 2YS7A 1KO1A 4R2XA 4AMVA 1Z8FA 1X38A 4E2YA 5K3FA 4J75A 3F1KA 1CUGA 1V7QA 1GCOA 3D7MA 3C3EA 4P3KA 4WXRA 4RF5A 4D81A 4MUNA 3GEPA 2XY6A 2ZRDA 4UC0A 3KJEA 1QSYA 3CTPA 2RGRA 2O48X 2C5HA 1Z8NA 4EPWA 4KQ9A 4OMCA 3KFVA 3VYWA 2YV3A 2CV2A 2A58A 5G0WA 1J2JA 2Y4OA 3LO5A 4A2QA 5CDYA 1UJNA 3GXBA 1ESMA 1EX7A 2X42A 1Z5WA 2PMWB 4EBDA 4JDPA 3OU6A 1JHRA 4YQEA 2HHXA 4WLUA 4RTLA 3W5VA 3OE5A 3I1IA 4BLPA 4CQMD 4FS1A 1J9ZA 4DUZB 4B2IA 1P60A 4H4EA 4U5XA 1HETA 3LCUA 4HAIA 3WSTA 4M2YA 1ORHA 2RCNA 3AL0B 2MYPA 1TEZA 3UK1A 1QIIA 9ICNA 5L3QB 1C14A 4U2GA 1UADA 2QROA 2RDJA 5EPEA 4YBZA 4BEWA 1DRVA 3L82B 5H59A 3EEFA 1YWGO 1J56A 1R27A 1OHHA 3CV3A 3T54A 3OQJA 5JW6A 4L4YA 2VNKA 4M7RA 3B2NA 1K6MA 3PY8A 3CR7A 4H7IA 1B6RA 2JV3A 1GU7A 1DSSG 3BM5A 1PJZA 1WNTA 4JQOA 3QFSA 3OIUA 3EAFA 1A2OA 4ND2A 4E5MA 4L9RA 2ZW9A 4WTOA 1IDN1 5CA1A 5J47A 4I3HA 4AKTA 5L1LA 2I9KA 3HJUA 4M1TA 4ZN6A 3WADA 1VA5A 1KP2A 3I9FA 4AKHA 1E1CB 1EM8B 4V0RA 3OEEA 2WUEA 4YQWA 2Z8YA 1VDZA 3M4XA 1I8TA 1M74A 4WASA 3MXOA 5K8JB 4CM4B 4G0QA 3QE4A 3BIXA 4S05A 2IHYA 2XVYA 3HB4X 2Z4TA 4CDRA 2IUTA 4HPWA 1L5VA 3ADCA 1W9MA 2I1WA 1YC2A 3OF3A 3N3AC 2P9CA 5B5EU 4DY6A 3HRKA 4K2AA 2ID9A 2OHHA 1K6EA 5HFNA 5TS3A 4HGZA 3P5SA 3ZU4A 4DYDA 4XIIA 1TTQB 3A06A 3N6RA 1SL1A 2ORYA 4MI3A 4AZ3B 4NAUA 4ALKA 3QVGB 4DJTA 4YDHB 1JQDA 3WBFA 2ILTA 1DTWB 1ADCA 4JV5B 4NOJA 4MW4A 3IAM1 1YCDA 3SZ2A 2GA8A 4RZ3A 4KTQA 3OZFA 4QNMA 2OENG 5IJ9A 3ZS9A 4P93A 4S2UA 2ZYHA 3TYXA 2DWQA 3PUWA 4YAOA 1IXRC 4U2BA 2RHDA 4OOEA 3J7AC 1J2UA 5CURA 1XF1A 2BH2A 4KV7A 3QBEA 1ECPA 1W47A 3QM1A 4YALA 3QX9A 4WZBA 4DT1A 4CM9D 4M9XA 4MS1B 5ALIA 1AKVA 1M1XB 4DBZA 4Q3NA 3G6XA 5PNTA 1YR7A 2CF6A 3EZNA 4CN8A 4F4ZA 1EFRA 4INPA 2ANBA 1G9XA 4B34A 2EWWA 3CH6A 4XTCS 5F9LA 3IAM6 4B75A 3IEMA 4F8RA 4MSUA 2V54A 1C9MA 1LBSA 1E2PA 4QSMA 4I4IA 4GFJA 1EESA 3WKDA 2ECOA 2BDPA 2C2MA 5CDSA 5BQOA 3L92A 1WU7A 3WO1A 4A92A 3P52A 5G4LA 3RQSA 4PG6A 1YMUA 3GLIA 3UG7A 3SYRA 1ZUHA 1LDGA 3FGPA 3W9BA 1MAUA 4K2HA 4QXQA 4S04A 2YVUA 2BW0A 1L4MA 4OQYA 4PC6A 1SOVA 4MDFA 3UMCA 3IVCA 2VIIA 3WY9A 1M1NA 4E07A 2D5LA 4MW9A 2Y1IA 5JAHA 2RHFA 1TC2A 6YASA 2JZBB 1NQUA 2F77X 3RKUA 3WHLA 3KHKA 5K2OA 1EP9A 3BSFA 4JK3A 5JS6A 3SSMA 1W25A 2BJHA 3L07A 1QCDA 1O3YA 3H4DA 2IY9A 3K9BA 3AKEA 4FFRA 1ZCJA 4Z4CA 3TL2A 5L3RA 1FDVA 3RWMB 2VSNA 1PE0A 3K94A 2HPVA 5EIWA 2C97A 3IP6A 3ISVA 4JIGA 3TKAA 5CYPA 4E0BA 3RH6A 3V32A 2VFAA 5AP9A 4I2EA 3EGDB 4R1MA 3ZE8A 4L1KA 3ORHA 2R87A 3ZU2A 2OYSA 4Z54A 2Q1XA 2A0WA 2FZEA 5EMNA 3D8UA 4P31A 4FHGA 1OLOA 5KQPA 3WZMA 3WLLA 4LDJA 4ZVOA 2J41A 3IUMA 2KLHA 3UWSA 2O06A 5E9AA 5KYUB 4HNUA 2DZDA 3Q12A 5GTDA 1Q3KA 2GEBA 2Y1CA 5GM1A 1NBEA 2PX0A 3TEMA 2HQOA 3PZBA 3ZWPA 3VZRA 1V8DA 3W6UA 5LQNA 3ZTTA 4YG2A 1Z2CA 1ZYUA 2YY7A 3SFVA 4UAVA 2H00A 1PR6A 5AQEA 2NN3C 4M2LA 3LECA 4D3YA 3KVOA 3LPAA 1HXHA 2BI7A 2XY5A 3QG1A 4QNNA 4F5NA 4BO5A 3NV9A 3PGXA 2R6GA 2POQX 4XQ9A 1EAMA 4ATNA 4NG5A 2Z04A 3NZEA 2Q2QA 3QXSA 3DEYX 1IPFA 3KKAC 3PI6A 3UAVA 1FIQA 1ZW6A 2WSBA 1D0SA 3F6SA 5FDFA 4QWDA 5AJHA 3OFVA 1WSDA 4OSPA 4DOBA 4O3FA 3BE4A 1Q95A 5FD8A 2ZR0A 4KE8A 4FOLA 1USWA 2ZR9A 1L7QA 3HMQA 3H99A 3IFSA 3L7LA 1KDZA 4FE4A 2HHVA 1V8ZA 1IQPA 2BYTA 5G1OA 1WCIA 2E4ZA 1B0AA 1JRPA 1N5IA 3GZNB 4TVBA 3EQ6A 4OQFA 3CH5A 2DM6A 1Q0TA 2J3LA 2E5LB 5BRJA 5DP1A 2XE6A 1FE8A 3LBFA 1XKTA 2HBLA 4EY3A 4PLCA 1XPRA 2R2AA 1KVRA 2CBGA 4N3CA 2HNAA 3OZCA 1PX0A 3T79A 4DMCA 5C3MA 1IY8A 2ZKIA 4YR3A 4XSVA 1P4RA 5J58A 1RZTA 4EIWA 4Y1RA 1AT1A 2ZYRA 3ETJA 1UPUA 2GBGA 1D1TA 1DZIA 2Z1NA 3RUHA 1YVPA 3TACB 1KQPA 4XX0B 2FMXA 3N05A 1SC6A 2SECE 4KXXA 1NK6A 4U7TB 5A4KA 2WFAA 3QPCA 3W90A 7YASA 2SKCA 3ZN2A 3WNDA 1U2ZA 1U2GC 5JPCA 3NW9A 1X14A 3A9UA 5FV7A 1XA3A 4U1RA 1S0OA 2V7VA 4N54A 4XI9A 1VZ2A 4EVQA 3U1TA 3DS8A 1UQUA 4OATA 3MMSA 2PS0A 5JJLA 1QYCA 4FDUA 4GAEA 2QTBA 4B76A 2QUKA 4G2NA 3KJHA 1PV2A 2XGGA 3SKYA 4NZOA 1JRLA 3B5IA 3I58A 4HEA1 3ROMA 2Z1MA 4OI0A 2VP3A 3G2HA 2Z2IA 4LJ8A 3PGJA 3GIDA 1G21B 2GYWA 3VI3B 1BFUA 4HLNA 3B3JA 3FDZA 5K8VA 1PHRA 1QZ3A 3OHAA 5EJ2A 1DNPA 3LWBA 1Z0DA 4I2DA 4A73A 1WQ4A 1G7RA 2NU6A 4FLMA 4QRIA 1L5HA 2V4UA 5KOYA 1COOA 3TTTA 3NASA 3LPCA 3P4XA 3U4QA 2H3FA 1QSSA 3TLCA 4PYKA 3QBDA 2O8EB 3C70A 5H82A 2IS2A 1EWRA 3ZHOA 4YJ2A 5I8WA 1DI0A 1V2GA 2W6CX 5AUQA 5G4KA 4QBGB 1P80A 1Z5GA 5KSOA 1ISGA 1TYAE 2Z5GA 4U02A 5JPDA 3O2SB 4F4YA 1DFHA 5KT3A 4Z0HO 5BQPA 4OD0A 1QTRA 3KALA 3DFMA 2A0YA 4NQZA 3D6AA 2Q4OA 1XC7A 2XHZA 5GP1A 5A4IS 2NPIA 3IEKA 2WLSA 5IIOA 2XLBA 5IDQA 4CKZA 1UZNA 2W6QA 5REQA 5TMPA 7ABPA 3B1WA 4HLCA 4YMIA 3D2SA 4I4TB 3JVDA 1JU3A 5ABPA 2ZU0C 4LJ6A 4DVJA 4HYKA 3M4ZA 2JFVA 4UTXA 5LBTA 1XD8A 3E1KA 1FDRA 4BZZA 3PDIB 2V45A 2AOUA 4S1NA 3ZGNA 3KZKA 3A1WA 3CG0A 3QEKA 3L4JA 1L5NA 5AD1A 2R11A 3RR7A 4QJIA 4XYBA 4XLZA 2O3SA 1M72A 5DKWA 3INTA 2I55A 3G23A 2Y0BA 2KJ8A 4EB3A 1GPAA 2FPLA 5BNWA 1V41E 1JDTA 3BOSA 5EMJA 3NU1A 1NJWA 1QOPB 1PRYA 4X1YB 4OOFA 1TXGA 2BHLA 1DAKA 4C05A 3A4LA 2PU5A 2O2HA 1PLJA 1Z5ZA 1MFPA 3AUXA 3CMCO 5DB8A 3DMRA 1KVSA 4FHFA 4GZ6A 2YB1A 5ALHA 1KI2A 3DM5A 1N5RA 4H7HA 4RACA 4IQWA 1P31A 4WLVA 4CCHA 2E89A 2XWSA 5EJ7A 3TG8A 3CNNA 3JQBA 3I2IA 4EDFA 1MOQA 3RH0A 2FDCA 1NZFA 2YHAA 3SEQA 3N74A 1C0LA 3FOZA 3PJEA 1VP9A 2JHPA 5CLLA 2ZAIA 1L4NA 2HWWA 3TZEA 1ZH6A 1G0OA 2WD9A 3II6X 3ELBA 2FOLA 3DMDA 4L2IA 4JCOA 2IP2A 1ULUA 4DDKA 3N7TA 1NXVA 2ZAMA 4UEQA 1CUIA 1I0LA 2RGNA 2W6JA 5E1OA 1FFCA 3ZIDA 3GCDA 3MRVA 1WCWA 3EF1A 3L0CA 4M0FA 4KLQA 3I5AA 3I5YA 4AWXA 3ZW8A 4EO7A 1E4VA 4P32A 5D5PA 1NF8A 1J0AA 1N6NA 4Q47A 1TW2A 2KLBA 4Y0NA 2IZ6A 1MRSA 5J1TB 4LF7B 5H7XA 3TZQA 3ETEA 5AK5A 3P9RA 4A2PA 4O5EA 1HDRA 1AS2A 3RK0A 1EX6A 4WHMA 4D80A 5TJ9A 3Q8QB 5JNVA 3I30X 4Z8XA 2IY7A 3HY6A 4RQTA 2IW1A 3IEUA 1K7CA 3ZWVA 1RYZA 1CDZA 4IDBA 3BEOA 1PJLA 5EUBA 1AXEA 1G20E 1ZVQA 3C28A 3E9DA 1W59A 3FNBA 2HXGA 1W6UA 1R0LA 2XQJA 2XDAA 3AXTA 2Y1LA 3N07A 3JQEA 4G4SP 1UK6A 5ADVA 5AKHA 3Q5EA 3AB3A 1K7FB 1P75A 4XR4A 4D7AA 2P9ZA 3JPTA 4EBFA 3OJSA 2R6JA 5CFNA 2GF2A 1X39A 4DB2A 2JA1A 4NMLA 4RQ5A 1G19A 4AX8A 3KQTA 1Y1SA 3FJYA 2DFDA 1M6NA 4JLNA 3HB7A 3V4SA 3QPVA 4RAOA 4E4RA 1NXPA 2DH5A 1PEAA 4DFKA 4G2TA 3RGWS 4YV7A 2C5EA 3DNFA 3ZH2A 2W2XA 4MR7A 3AZOA 2R1VB 3DXXA 4K0RA 2CLDX 1Q57A 4FBGA 3E3OA 3G2KA 4DC0A 5HE9A 3GW8A 1N8TA 1YFKA 3KPYA 5TRTA 4ZOAA 1KGSA 4QWBA 1GADO 3AVWA 1Z4LA 3WC4A 3SVTA 3AJEA 1ZM7A 8GPBA 1XK7A 4OU5A 1JE0A 3EQ7A 3DTTA 1PO7A 2KSQA 3FI0A 3LNCA 4FKBA 3T7KA 5B3JC 4CCSA 3RVDA 5HIKA 3PF8A 3A6JA 3U7GA 1S76D 2CNKA 3UXMA 1R5NA 1FFAA 4ZGWA 2JCSA 4IICA 1JKJB 3B9JA 4KGZA 4J9SA 1PR0A 4MKIA 4ZU1X 2I8AA 1LVUA 3L41A 1O2DA 1OC2A 2WAYA 4QBTA 1YL5A 2Q99A 2FZGA 1YRBA 3UMFA 2FMSA 1L8XA 2MHCA 4ZKEA 1P0MA 5CB6A 4H7FA 3HZHA 1SKMA 4IRMA 3QHPA 3UJ3X 3IEXA 3ILHA 4YT2A 2BMDA 1N6IA 1T5SA 2FUG6 3L8ZA 3NC0C 3O0TA 1HE5A 2BFFB 2NO0A 2YMLA 2PI4A 4Q48A 1U0HC 4IDNA 4G4GA 5C18A 1APBA 1YK1A 3FPBA 4WKGA 3PT5A 2V0GA 4M1SA 1Z6QA 2GGSA 5M2QA 1ADBA 2DWOA 4G1MB 1F38A 1OFIA 4BKQA 3O7MA 3PVXA 1PJBA 2ZRFA 4R2IA 2PRYA 3DLBA 3IC5A 4Z53A 1YFLA 1H23A 3BJMA 4LJSA 2G63A 3FCXA 2VNIA 4HGRA 9ICEA 1NVWQ 1HLDA 4YRCA 1NNUA 4C4TA 2ZSHA 1NSFA 4E33A 1OIWA 4CU2A 2EFJA 1PNTA 4J0DA 4LECA 1N56A 2AV6A 4IIDA 5H4GA 1YFZA 4XLLA 4YAFA 2XA2A 3G88A 3CR8A 2AFVA 1UK9A 4C5AA 3LC7O 2NZ8A 1DHTA 3PFWO 5KFJA 1FRNA 1Y37A 5HP4A 1YJCA 4E1AA 3LUBA 3EVGA 5KU7A 3UT5B 1I6LA 2AD1A 3I6BA 1QYWA 3LVWA 3CIFA 3PUZA 4CRWB 3VUFA 2XUAA 4G65A 3C6YA 5L3QA 4DBLC 1U48A 1GHTA 3IPRA 3NTUA 3ND8A 2CE2X 2R48A 1VYUA 4WJLA 2K4EA 4Y2VA 4MUXA 2XICA 3OICA 5UKDA 4US8A 2C9BA 3W3AD 3NX4A 3K1YA 4MVXA 4HFJA 5LYJB 1VPLA 4BVGA 1PJ3A 3BTVA 5KTNA 4DMLA 5AJZA 5HNKA 5D4BA 2C92A 4IH1A 1XCOA 3C98A 1E92A 1THGA 4J16A 4FWTA 4DN6A 1YRHA 3VH1A 5KG4A 4OI1A 4WFKA 3PNOA 2FLKA 1R6VA 1FX0A 4AK9A 3RVNA 4B84A 3FDXA 2IX9A 4IGFA 1G3IA 3F7OA 4DS4A 1Q6YA 4Q00A 1EM8A 2BEJA 2I3DA 2GBIA 4Q3LA 4AG5A 2ZXEA 2MU2A 4RVUA 3ZLBA 2N0SA 1ABFA 4O3MA 4LOJA 1P7ZA 2IV3A 2APJA 3QTTA 4EW3A 3HXKA 2WUGA 3RR2A 2EZXA 1P5JA 4Q8FA 3VOSA 4Q9JA 3B52X 2P1RA 4CM4A 1OSNA 4FYYA 1C0KA 2OHVA 4RNMA 1EDEA 1T9BA 3CEMA 2D5BA 5E3IA 1IBMB 4CZ2A 2NZWA 1LLFA 4BQEA 1CCWA 4XWTA 3E53A 1MLDA 2FZ5A 3TJMA 5FXMA 4RJJA 1I1NA 1DADA 3NYRA 4AJIA 2YWEA 4LDNA 3A6LA 4C3UA 1BXZA 1EUDB 1ZQEA 4LBYA 5C34B 4YUYA 3RRMA 2HF7A 4KXLA 3A0BU 2R8XA 2IOFK 4TS3A 2H1CA 4J0HA 4IKOA 5KNCH 5E7QA 4AZ3A 2KEYA 2NSDA 2ZR8A 2DT5A 3QVGA 3PXUA 1KSHA 4RPLA 4Z4GA 3HR4A 1QYRA 2CK3D 4WWHA 5DBOA 3BWMA 4FNAA 4DSLA 1NT4A 1XTUA 4OHYA 1XEWX 3NBQA 4AKEA 2A1IA 2OILA 5KDLA 3I8XA 1AROP 4BV2A 5BMVF 3U60B 3O2JA 5JI2E 3MGKA 3HM9A 1L5KA 5AQ1A 1E2HA 4IDEA 3LLVA 3UFBA 3IURA 4LKOA 1MENA 1XVAA 4EY4A 4RE5A 2Q5QA 1L3BA 1F2UB 2PE5A 2PX6A 4DMUB 1JFFB 2BFBB 5IM5A 1R74A 4EA7A 4NH4A 3BREA 4TKVA 3HDGA 1JEYB 3QU5A 4KQWA 2LP4Y 4ZJYA 5JNSA 1Z0KA 1XNGA 1VZ3A 3HBAA 2F8LA 4K3VA 5FQNA 4EX6A 2I7VA 1VLZA 3AR3A 4A16A 3KTAB 3RVOA 1DWPA 2I1LA 3DWFA 3N75A 1F6BA 5CEEA 1KH2A 3S0JA 3OQMA 2G09A 4NFLA 1VSBA 3W5AA 2ZS9A 5C8XA 2AX4A 3I0ZA 3WQHA 3Q8MA 2XJ9A 4PHFA 1USIA 4RPKA 1X1AA 1U0TA 1IOVA 5JCJD 1QUFA 1TVCA 1W4RA 1NOKA 4PLGA 2ZAOA 2XKKA 4FZLA 2G7ZA 1BWPA 1J49A 1FUKA 4JVSB 4J9MA 3TGPA 1E79A 2O52A 3VXKA 1N6KA 2YWGA 2CT8A 5IUNC 1G41A 1GGHA 3K8OE 4AY3A 4N76A 2QG4A 1GPKA 4CR7A 5CDTA 2B34A 3BH0A 2JZBA 5L4NA 3KSZO 4PYNA 1DAFA 1KKUA 4OQMA 3JR7A 3I2KA 5J8YA 3WGYA 1GRCA 5SZHB 2GZMA 1ONNA 3DWEX 1XRPA 4HX2A 1NQWA 1P2SA 3B1FA 4FUTA 1JIQA 4AI6A 4BPRA 2XGJA 4MEYA 2X9GA 3P0JA 4JMPA 3JD4A 1P7CA 5BNZA 4URXR 2HZBA 4HRVA 3HCBA 3UPTA 4PIPA 2RHHA 1RKXA 2ZYTX 4CIXA 2OQRA 4LMPA 2I6XA 1Z19A 1GPMA 4JC5A 4MXDA 4K6KA 3W8DA 2XXBA 2QIOA 1HE4A 4UDNA 2M2IA 5AVZA 4X84A 2RB5A 1A96A 3FUCA 2CE7A 3DSRA 1Z2OX 3H65A 2ZG6A 2AN5A 4TTQA 3HEMA 1WJGA 3ANXA 3MEQA 2ZIXB 2PRZA 5KYUA 4ZZIA 1HZZA 1R0WA 4CMKA 1TAMA 4WH0A 4I2IA 4AC9A 5KU1A 1A7JA 5LNK1 1L7OA 1QGED 4K9MA 5KG2A 2VSXA 3KHSA 1NUTA 4OG2A 2ZRLA 1QX3A 5HOEA 4CGZA 2KK0A 1X66A 1NVBA 2PYZA 4BO9A 2E4XA 3COJA 4HB0A 4YI5A 2JW5A 4RKRA 4YPVA 4XIGS 1P18A 3WV5A 2V5UA 4LRSB 5MF6A 1ATIA 2ZCUA 2PL9A 3HW8A 5AI6A 5KFMA 1JBEA 5EKXA 4Q34A 2ZB7A 4BJQA 5BV0A 3H5LA 3RT9A 3M6AA 3M6XA 1WMSA 4KXMA 3HU5A 2GYVA 3U3KA 3H2IA 3T6KA 5FLXA 3GP3A 1KEKA 2GCPA 2OCGA 2H3HA 3P7MA 1JFTA 2DQYA 3OZEA 5THXA 3TKLA 8ICZA 5H02A 5K3AA 1V96A 2JFBA 3C7DB 5HCUA 1RE0A 4OEHA 1JG2A 1KWGA 5J5CA 3G0CA 2FRVA 4Z86A 2AG8A 2X8WA 3KKOA 2C3UA 4UB8U 3FWZA 4AAYA 4JJ4A 1M2GA 1VC2A 1YS6A 5HR7A 4MYCA 4PYMA 2BGJA 4H2DA 3EYWA 1DQYA 2FSPA 2JGIA 2HK8A 1X19A 3PD1A 3QA3E 3D8TA 2HVIA 4PHDA 3GZNA 4KPFC 1POXA 5HEKA 1W6RA 1PWXA 4DANA 4AUKA 2DFLA 4L4UA 5HJEA 2BGTA 2JASA 3LXRA 1CY1A 4Q4AB 4QZIA 3DEHA 4AM8A 1N48A 1P9WA 3KV3O 4IZOA 4I8DA 3QMPA 2PT5A 3BUSA 3SYLA 4LC1A 2H85A 2UZ3A 3QVVA 5CVVA 2BHRA 5JVDB 4ES6A 1S3IA 5C32A 3HV0A 2W90A 4XX0A 1A50B 1CUUA 1E62A 3WXMA 3OSZA 5KFOA 1Y1TA 3C3WA 2EFCB 1ZY2A 4MUKA 1V5IA 3PX0A 1P7DA 1JEAA 1OJLA 1OU4A 1OH8A 3MTJA 2HW3A 3HB0A 4NBNA 4BO4A 1T8PA 3O8DA 2PFQA 4WESB 5F9NA 1SY7A 3U17A 1Z2NX 1H5NA 3PB3A 1QF7A 1GILA 2OB2A 4XQ8A 3L5OA 3S5UA 3CSUA 4HH1A 4R69A 2XEDA 3C7TA 1ZXBA 4UCXA 4K3UA 3VSBA 5AW4A 1E4EB 3DDOA 4RWEA 3T3PB 4BN4A 4N5MA 5LUAA 1ZJWA 3F53A 2JLXA 3MWJA 1D8TA 1LPOA 1NKEA 1SU7A 4Z9YA 1G21A 5K0LA 3FKJA 2IXEA 1W73A 1M5UA 4M0DA 3RG2A 5T3UA 4F4IA 5I4IA 4BQNA 3V80A 5LQMA 2JKVA 1B0ZA 1OT3A 4IVPA 1NPDA 3EZFA 1HNXB 3GVIA 3PGA1 4ZOLF 2YNMA 1CY4A 1YJQA 2ODGA 3B1KA 2VRWA 4BO8A 1LJLA 1TK8A 3OPYB 2MSDB 4B0PA 2WVAA 1RWKA 1JS1X 1L7EA 4RD1A 1DIRA 3IAUA 5AKKA 4MUIA 4QUKA 3EIFA 1IEWA 2I80A 2OESA 4HO1X 1LSSA 2O8EA 3TOZA 4ZALA 1L5QA 3ACBA 3VDXA 3NH6A 5AJUA 3ZQ6A 3SF8B 1VLQA 3VUEA 4PBTA 3AV0B 5SY9A 2BPCA 3RSHA 7ICVA 3B82A 2GJAA 5CUQA 2BBSA 2F1RA 3B6ZA 1QONA 1FK8A 4LA4A 4YJHB 4MFAA 8ICOA 2C9CA 1Y3CE 3T38A 4URUR 1RAAA 1PNOA 4FZ5A 1V2HE 2L5YA 4J0CA 4EY8A 1JAIA 4IIJB 4B46A 2VHEA 4H6PA 1G2OA 3R6DA 1D1SA 2EGHA 3NR2A 1A8IA 4TURA 5DCWA 4KTTE 3NUZA 3BQ0A 3U5ZB 1Y0BA 4IKPA 4RQUA 4BKUA 1GUAA 2QUHA 4IZIA 4QD3A 2HCTA 5F21A 3ROFA 4EY7A 1WDTA 1QJCA 3A4MA 1OI7A 3SZRA 2KM1A 3KDSE 4TL9A 3DAOA 2JD1A 5GADl 3OT5A 3QPAA 1VJ5A 1PQ4A 2FPPB 1W94A 4X1YA 2PK3A 3Q7RA 5FFNA 3ZHBA 4MVJI 3QLJA 3W2EA 1TIKA 4MB0A 1GVHA 1YNOA 4V02A 1XTTA 1HTBA 1FMLA 2BBOA 3SHWA 2IMWP 5JAPA 4NZPA 4ZMRA 5JCOA 5BV1A 4IR9A 4WXPA 1NVMB 4EATA 1QR6A 1V16B 3NS1A 2JCVA 3RVKA 4BY9E 9ATCA 3SJ7A 1LY1A 4WVLA 2CHVA 2VJYA 1JAHA 1DEKA 5TE9A 2EVWX 2HMVA 4X6UA 2EJUA 5LP6B 4C4XA 2I71A 2D8CA 3M5PA 4ZPJA 1Q7EA 1JDJA 2A0XA 3LSYA 4FIZA 2IY8A 5DU2A 4PHPA 4AY5A 4V1CI 1YK0A 4Z3DA 2VP5A 3EF3A 3LWLA 2HCFA 5J2UB 1PW7A 1RYHA 1PVDA 3IEVA 4KLGA 4WI1A 4MI1A 2YTUA 1SXJB 5EP4A 3GWGA 1QP4A 3V7FA 3H5VA 3UATA 4KUGA 3K9HA 2Q4RA 1RLIA 2CHUA 2EP7A 1TF2A 1MHTA 3HZZA 3H5OA 4YP9A 9ICHA 1Z5UA 4MV5A 2WUWE 5K0SA 4UBBA 2HBRA 1L6IA 3TZCA 4RE6A 4YCAA 1G64A 2ZIVA 2J3JA 3DMNA 4DUGA 2WM9B 4OJ6A 4BV3A 2RG7A 1QR2A 1TAGA 4ZXFA 1JIUA 2ZB2A 3PGLA 1H2AS 5DGXA 4FMDB 4UNRA 2QVBA 4O4HF 3V00A 1HSOA 1DXOA 1SUIA 2VDMB 4XQ0A 2ZM5A 4CTOA 1F44A 4XB2A 1B1AA 1ZI8A 3HVIA 3RIYA 1V26A 2VZ8A 4PU0A 4QQ8A 4FOSA 4Q4JB 1XELA 4NOLA 3PQ2A 4HLUA 2JGLA 2FW8A 1T2VA 3UGJA 3B8EA 5AIBA 1Q0LA 1ZL2A 3BK1A 1XWLA 4ARZB 4MCHA 1GPBA 2XJ4A 3FPSA 2KD1A 1YRAA 4BRUA 2C1XA 2VJCA 3UQ0A 1E9FA 2HLDD 2ASVA 2R1VA 1H65A 1ADYA 2K60A 5K2MA 3GFBA 3HGMA 1BX0A 1NT2A 3BQNB 3T3FA 4N9QA 4M8LA 3PL1A 1GXSA 3DAGA 1W36B 1VL6A 3KAQA 4BLRA 1YTLA 5L1KA 4ZK2A 5E3HA 2LZ0A 5IT0A 2F6RA 4G0OA 2PH3A 1Q7RA 2BF7A 3E18A 3SOZA 4YROA 4ZCTA 4E2WA 3SQMA 1DO8A 3WNVA 1F4VA 1FSGA 2QMQA 5CA7A 3BDAA 2NZJA 1EA5A 4KQFA 3DJFA 1MP0A 3BJZA 1JKJA 2JLCA 2WJ3A 4HGPA 4PGQA 3ASZA 2DSTA 2BWJA 1IHDA 4PPFA 3NXKA 3O4RA 3K9QO 3JQFA 3IDZA 2EOAA 3LXMA 5CB4B 4UZEA 1P77A 1CE8B 1MO6A 2BTOA 1BA3A 4KYIB 1U7TA 3I6YA 3TN7A 3RIEA 2OZKA 4CL0A 4A4DA 1SC9A 3B3FA 4UVEA 1SA0B 3JYLA 3QNWA 4FEAA 3SV3A 3RTBA 3O4HA 5E6RA 2WM2A 4RTKA 4ED9A 3PQFA 1G1AA 3EZYA 3ZX5A 1QXSA 5TVKA 3AR5A 2XSZA 3G7SA 4M53A 4O4JF 3A2MA 1IZ8A 3EQ2A 2IYPA 3H8JA 2C2WA 2DTEA 3SYZA 4TV9B 1HYEA 3V6LA 3JQBC 4HR7A 3V8NA 4RZIA 3WGZA 3KLPX 5K8LA 4ZMBA 3A2NA 1RXUA 3KOUA 1NKCA 2VAPA 5CR0A 1AQNA 3T12A 3CZ4A 3P1JA 4JS0A 5G3ZA 4OJKA 3DL4A 2C2YA 4AY4A 3ITNA 4J7AA 2NTEA 4LXYA 1M1ZA 1LLQA 3KO8A 1MU0A 1P5FA 5KT5A 4MW0A 4PZZA 4ZVPA 1LDYA 2FPRA 4O2AF 3LMKA 1QMPA 4DRYA 1UJ5A 2RGNC 4HL6A 1Z0IA 2HHQA 4BLSA 2IDMA 2ZT6A 2QL6A 3CJRA 5I5EA 6REQB 1G8FA 3ZBPA 3K96A 5AJYA 2REBA 3HLKA 1KYZA 1UAYA 2BOVA 3HCWA 2RGGA 3AU8A 2OXOA 1WCLA 1NUUA 4YACA 1RHJA 5LYJA 2X4DA 1P2GA 2ZIZA 1I1OA 2MSNA 4OFXA 2DL0A 3H5TA 4JUFA 4BQQA 4CMIB 3L1IA 5FLKA 2YJ5A 4OJTA 4TKLA 3VH3A 3N5KA 4U7JA 4P0TA 1Z83A 4H7DA 1Q91A 1TYBE 3IESA 1REQB 3RJJA 4DZZA 2EP5A 4D3ZA 3A4TA 1Z63A 1QIFA 3R5JA 5KFWA 4GMHA 4ZVTA 4RV4A 2FDRA 5JSKA 2AUNA 2PGJA 2F1HA 3GFPA 4F91B 2ES6A 4HBZA 3N39C 4QDUA 2DEUA 1RPAA 1GEEA 2Z1DA 2A67A 3AFHA 1MIOB 2JLVA 3AQ4A 2QI9C 3OJ0A 5JRDS 2PV0A 5FKJA 1QOZA 5H9VA 2CJPA 4OMDA 3EW7A 2HPZA 2ZSIA 2V96A 5SICE 3NNDA 1L7VC 3CRZA 3FCAA 3FTDA 5AJVB 4BKRA 5FR2A 3L7YA 3OO0A 3USZA 1OY1A 4JB2A 3AFNA 2GM9A 2XI9A 3T1HB 4RIIA 4USAA 3EVFA 2YXBA 3TKYA 3MJDA 4N03A 4G56A 1EAYA 3OHMA 5D87A 5IIJA 1GA4A 1ISPA 3KELA 3ULKA 1AUQA 1R0CA 4HVTA 5KFAA 4GT1A 3UOWA 1YCGA 4TLBA 3NHJA 1TEXA 1FP2A 1D7OA 4FI3C 5F9FA 1Q16A 2YQEA 1OFUX 1YJ8A 2BR4A 3AVXA 3SI8A 3CLTD 4BXOB 3COSA 1EQUA 2QX9A 1ZD9A 3INGA 4LF6B 2NACA 3DBRB 2IBKA 2I5HA 5IVKA 4MEBA 3UTDA 3H4VA 3T9DA 1TJPB 3QU2A 4TWAA 4EQZA 4WGFA 3DMYA 1I4OA 4G63A 3H18A 1BCSB 4KAFA 1P7PA 2FWRA 3OQHA 2RKWA 3GUZA 4Y0VA 3UBMA 2AC2A 4DCOA 1QFZA 5L9XA 2GXQA 3JZIA 1YZLA 5C4MA 4I1RA 1F2UA 1T6BY 1JFFA 2BFBA 1JEYA 1P33A 2DUYA 5FOXA 3UCFA 1UXJA 3ZXIA 3URMA 2D3WA 3RFFA 1ZD2P 4AU1A 2VDPB 4K9RA 4RNOA 4I14A 4PNEA 2R1UA 4ZEVA 3LLMA 3DE7X 4KXNA 1X9XA 1PT7A 2JIMA 3KTAA 4RHCA 1JBQA 2JG3A 1KW4A 3Q3VA 3U6KA 4OJLA 1E7SA 1WP9A 1JHQA 1X77A 3H8MA 2Y27A 3Q4GA 1RMYA 3QJ5A 3W5DA 1NJ5A 4L3WA 5HKBA 3KK0A 1CUKA 1YZ3A 3KXDA 1RZ3A 1ZICA 5K0ZA 5KFSA 1SUFA 4RDXA 1JALA 3VV2A 2HJGA 1QKKA 3CIOA 4OXNA 2QAJA 3WDMA 1GQQA 5ESRA 2P69A 4X63A 4MV9A 5C3UA 2GPBA 1PZFA 3C8ZA 3LLUA 3WA7A 3TMAA 2HRDA 5LOVF 3A0UA 5HJ5A 1VA4A 3AF2A 1YUMA 3PXEA 1FL9A 5JSYA 1YH3A 4QTZA 1WABA 1BYIA 2W3RA 3GJZA 3FB1A 4KZPA 4C2AA 1HORA 1RKBA 5JALA 1NQ5A 2HT1A 2Q0XA 1E32A 1R8YA 3M7DA 1ZZEA 3S2IA 1Z2PX 3RIHA 3AL0C 1HL3A 4IUDS 5BR7A 3EX7C 2CB9A 1PGJA 5ED0A 3G8YA 1F51E 4BAGA 3GIMA 2C78A 2G76A 3CGWA 2WIKA 3KTFA 3P20A 3EMDA 4UCFA 4ME6A 3RE1A 3G7UA 1A97A 4UM5A 4NTZA 4H3HB 2IS6A 4LCJA 3CH7A 1U3CA 2WAQF 5DTIA 4C4PA 4J94A 1WHTA 2EEZA 4QDKA 1HDEA 2CLSA 4DV3B 1GY8A 3BIOA 4LV6A 4RKYA 4GXJA 4H0FA 1FNSA 3IHTA 4J16C 2ZIXA 4DOCA 3EHDA 3CZQA 4MGKR 1Y8RB 1U7DA 2NO9A 4L16A 4DY4A 1F1BA 2D0OB 5E8JA 1ESCA 3MD9A 5EA2A 3LPNA 4NONA 2R44A 2PI5A 2CLIB 4JOQA 3V4FA 5KFYA 5B3LA 4R2HA 3RSLA 3BS5A 2DUNA 4FOPA 4LI3X 2ZI4A 3FSRA 1Q7BA 4G0UA 3FVQA 4UPVA 3LRXA 3GPIA 1YS7A 2VXCA 2XKBA 4NEGA 3FTCA 4H0CA 3N53A 1SZCA 3C4QA 3WYBA 4LYEA 4PEVA 1W5EA 1AGYA 4YJFA 1KOLA 4DPKA 3KPWA 3DC7A 2Z95A 1UM8A 1JMSA 3L04A 2WHXA 1RM4A 1VJDA 3TW4A 3JWPA 4FFWA 1GSAA 5CYFA 3P2YA 3LZDA 1VJGA 1H69A 3K20A 1J23A 3AOGA 2NUBA 1PJSA 5ALSA 4CCWA 2GZRA 5F9HA 4A6EA 1WLYA 3R75A 3CNOA 3DLHA 3DZJA 4I9FA 2QGNA 5E8RA 4L51A 5DBAA 3P32A 3KB1A 1QV6A 4RXTA 1SIOA 3WGLA 2H52A 4NZMA 1WCNA 1NM5A 4B3HA 4JBLA 2EKQA 2ZDGA 3PUKA 2GHRA 1VHTA 1T8TA 5LVAA 1RT9A 4TT3A 2GTPA 1F8UA 4R2KA 5FJJA 5H1YA 1CQWA 1ZVMA 1GNRA 5EKTA 1TKDA 4B4WA 3QTLA 4GOND 5SV2A 1Y1RA 2BF4A 1K68A 3DW3X 4F6RB 5KHOC 2IWRA 2WU8A 3W78A 1CUEA 4GR5A 2VAWA 3BQ9A 1T2FA 1V9LA 3CO5A 1RKQA 1R7RA 3SQLA 4JT9A 5JVDA 3N8GA 1RHMA 1N1MA 4CKYA 3RSSA 4B6RA 4I7EA 1YKGA 1BD3A 3NBMA 1PK8A 4G4SO 1RYBA 1XTPA 3RT7A 1NQVA 2VVTA 5ECWA 3EGWA 4JB3A 3NORA 2CN1A 5AVXA 3LFUA 4IPTA 1PSZA 4WNYA 2W98A 1S5PA 2QTGA 4J3FA 4WESA 1P9OA 2IUFA 3L7DA 5LQUA 1LSUA 5BN4B 1XQYA 2QXTA 2XCLA 4HYQA 4YP7A 4FE3A 4RLSA 3FH0A 4I81A 5GONB 2FMTA 3B6MA 1E4EA 3UK0A 1AUVA 2V58A 4TLCA 2ZZKA 3ZJUA 3SBXA 4TUYB 3AVPA 2DPLA 3HTXA 3A04A 4JNCA 1ITZA 4WK2B 2DULA 2IPNA 1GFIA 5EOVA 2G0TA 5HKKD 1B41A 3AILA 2R8EA 5J8YC 5DG7A 1MZPA 4G0YA 4COOA 2KBFA 5H81A 5JISA 4FFNA 1NLMA 5AI9A 5A5GA 2AR0A 3H9QA 1DKLA 4BMSA 1V8BA 4CT5A 4GGMX 1CVLA 1DKQA 1TA4A 1NBMA 5HZGA 2NU9B 1A04A 4MVJF 8ICAA 3OPYA 5U9CA 4K8OA 1YE8A 3R8CA 5JZBA 2YKGA 1QGZA 2AGPA 3Q8PB 2Y1OA 5JECA 3AW8A 4JL8A 3JPOA 2Q0QA 4NHEA 2AD5A 1KBOA 4UAYA 1VRWA 3BRWD 4HEA6 3B60A 2GHTA 2NQ8A 3W4JA 4HRAA 3ZZ0A 1KQFA 3MJ4A 3SF8A 3M6MD 3FZEA 4PXSA 3CNQS 3D8SA 1U8UA 2BLLA 4GKVA 4WY5A 4ZA2A 4RCVA 1OKKD 1QPGA 2X7XA 1QIGA 1Y34E 2PKCA 3OO1A 1HZZC 4YJHA 4GU5A 3QZ7A 4PFKA 3DT8A 3GRAA 1NASA 4IIJA 4OLFA 2Q1TA 1CW2B 5EHGA 1R8QA 3AK4A 3C5CA 3H9GA 3NPAA 4RHUA 1U2QA 1VPDA 5B7QA 1FLAA 1RAEA 3MCAA 3ELDA 4OBBA 1J7JA 2DLNA 5AW6A 4LJ5A 1U45A 5D6OA 1Z8DA 2PUDA 3VYTB 2HTFA 3EGXB 3U56A 4BEJA 4PVDA 4IQVA 1X15A 1TVEA 3LNTA 4JX9A 4MJLA 3KYCA 2X6TA 1WVMA 2VT2A 1JJVA 2JB9A 1U81A 3W6OA 2A7XA 2AFHB 3BHJA 1SXHA 1EK0A 1NW3A 4M9UA 2FPPA 1UFRA 4D0RA 2EL7A 3PFNA 1FDSA 4RMIA 3W2HA 3H8SA 5DM1A 5HOQA 4C0KA 4C87A 3DR5A 2Q6KA 1VE9A 2XCRB 3Q41A 2X0IA 4E4TA 4NZ9A 1E2BA 2WOOA 1XV5A 3EASA 2GXAA 4NY1A 3KJNA 1KMIY 2Q5FA 1WKCA 3C3AA 1TZBA 1BS9A 2VWQA 4PBSA 3NONA 4LRTB 3ZV7A 1ZQTA 3GVPA 5CNMA 3P9IA 1CB7A 1K06A 5ISMA 5LP6A 1DCMA 1NV9A 1Z06A 3KZXA 2GYUA 4JI3B 3AFGA 2P4QA 4HYEA 3ZNQA 3SYKA 3R9IA 1TKCA 4BX2A 3W2TA 3WDKA 3R9XA 5CYOA 2A5JA 5J2UA 2Y1GA 4BL5A 1IXYA 4NQRA 3WAKA 2X1MA 4MCJA 5DG9A 4PPYA 3G89A 3H6KA 3IQFA 4D0NA 4QBKA 3QBTA 2ODEA 3IIEA 4J2OA 3K9WA 2IPLA 5A9SB 3EWNA 2O8DB 1NQTA 2OB1A 2NRTA 2KOBA 3P94A 4ZGGA 3ZLJA 3SYNA 3VC1A 3G7NA 4I8IA 1SUBA 1A1SA 4I3FA 4O2BF 3BE8A 1BVUA 4H08A 5EESA 4QA9A 2VYVD 2ZAGA 1D4FA 2EG5A 4NARA 1ZQDA 3I9V1 4BLQA 4Z1MA 3R8XA 2PZEA 4BE7B 4PZ0A 1MF7A 2WU3A 7ICQA 4UFNA 2CMKA 1QYXA 3Q98A 1FPMA 1WCV1 3T3GA 2Y0CA 3LT5A 5AVSA 6NULA 1ZQ1A 5A1TA 5HGXA 1W44A 4YLGA 5EJ6A 1MX9A 3BMQA 2C07A 4CM8B 1P1IA 3CRNA 5EWGA 1GPLA 3OOEA 3IT1A 4YR0A 1A5ZA 5FV4A 4RY9A 3I9V6 2YWBA 3IXMA 3C29A 2WMNB 2M6LA 2P2CA 3RVQA 2YNMC 3CPEA 1VI2A 3GJSA 1UQVA 2QVXX 5F73A 2Q49A 1E3JA 2ODNA 2YR0A 1G5QA 1A0PA 1Z22A 4GSLA 1J6UA 2WP0A 4ENRA 3FOFC 2YTZA 1PL8A 5CVTA 4WZAE 1AMNA 3SN6A 2XBMA 1DC5A 2GK3A 3SKXA 1I7QB 1PU2A 3X44A 3ZV5A 4KLFA 4H1UA 1LJ8A 4TTRA 1V11B 3GV8B 4NJ8A 2WYIA 4QFDA 2Y92A 1H0HA 1GUYA 4M8IA 4MARA 4B32A 1BE0A 1KEPA 5J0QA 3G1WA 3K0FA 4TV8F 1L4FA 3PVSA 4K5QA 2QT9A 5DCUA 2QX7A 3LOPA 1AC5A 4QTUB 1F48A 2Z43A 3ZCRA 4MLCA 1OYOA 4R01A 1HOXA 3QQ5A 3GRVA 3KZOA 3OP1A 1WDWB 3Q9UA 5CB4A 4LDZA 3A27A 4TQ9A 2C98A 4ECSA 5EZSA 3BGDA 4L8YA 4RD2A 3PSIA 1LF0A 3W8EA 4HQRA 4KLCA 5AUOB 2PFNA 2XD9A 3TNYA 1JKIA 1NSTA 1HQYE 1K63A 3UB2A 3IUBA 4UUBA 2ZULA 3PWKA 4JBIA 1HRDA 1Z33A 3V4OA 4G8JA 4DFMA 4TRNA 1Z47A 5DYIA 1SA0A 4QGAA 1C3LA 3NYQA 4G89A 1U6IA 4QYIB 4R8VA 5DSTA 5CH8A 3O4FA 2ZETA 1SCDA 2O8FB 2FSFA 3VDNB 3NTXA 3V7JA 4GUAA 4FU0A 4D9MA 3PR1A 1WV1A 3VR6D 3UHOA 4IMRA 4PX2A 1ZYQA 1J2TA 4ETNA 2XGPA 2FQYA 2GJ8A 5JCOC 4IJUA 4JLAA 1XZQA 3AF5A 4YRSA 4MULA 2BFNA 4TV9A 1Y3FE 2I3BA 1SOMA 3T34A 2X4GA 3OWOA 4LQDA 5SZJA 1XJWA 3U3OA 1DEOA 3EVEA 2YUIA 1ACMA 1JJFA 4RHTA 4C0QC 4MQBA 3KOWA 1L4GA 3GF4A 1N9KA 1XKLA 2CV1A 5BR4A 1MIHA 1E2FA 1V95A 3LDAA 1ZIDA 3CWQA 3QVMA 4FGLA 1Z17A 1P5ZB 4IX9A 1SMKA 1U3GA 2GN2A 3K0AB 3ETNA 3DMFA 1T8WA 4FTWA 3E5NA 2VJKA 4KMMA 3ICCA 3FWPA 5FOSA 4FMCF 3K1RB 1ZW1A 1A2BA 1CNMA 3C1UA 1UC4B 5LYYA 5C9ZA 4YV0A 1YDEA 2IC5A 2F1JA 4S1PA 4HZUB 3QXCA 4M8SA 4E3WA 1ZGBA 2GZHA 3MJCA 4TN5A 2ISSD 5IVIA 2VQ3A 4LXQA 4C7MA 5CFRA 2DKOA 5AH0A 3RTGA 1ZJ6A 5LQAA 2WQZA 4S1OA 3RPEA 1E0SA 1RQLA 2D3DA 3B6EA 5ED4A 3IQIX 3CE9A 4CMIA 3UVEA 1KK1A 3GLHB 3CUKA 3ZWYA 1B8NA 9ICQA 1VTKA 4QJBA 1AQJA 3WVNA 1SB8A 1WOYA 2C1EA 4IGAA 2HOIA 3AJRA 3AFOA 5I8PA 4DJDC 1L1FA 3DC2A 4TUQA 5AK6A 2BCUA 3HJRA 4PTYA 8ICVA 3ZD7A 5BSRA 3FUVA 1E1CA 3CY6A 4YUVA 2IE0A 3AR6A 4XWOA 4F56A 2HY7A 2H3ZA 4HLUC 1WHSB 1T91A 3ZIAA 2AQ4A 4BRWA 4BFWA 5K4GA 5GM2A 1MBZA 4LY3A 4RSRA 4G81A 1NG1A 3FDFA 1K86A 5C1DA 3HJNA 2IKQA 4XYEA 3NOQA 3DBLB 5C0YA 3L8CA 2LGJA 1QQ6A 1ZO8A 4QNLA 4IRDA 7ICUA 4FYMA 4DA4A 5DBHX 1KDVA 2P67A 3PT9A 4QVGA 1KXZA 1M76A 4OH7A 2PEZA 2Q7XA 2IHKA 4IHKA 1L1EA 1XHLA 2P9QA 1UQRA 3B2QA 1FTGA 3HV2A 5IM4A 3TQTA 2RAUA 2K7FA 1T9GS 5CPBA 5BPCA 5LQCA 3EWAA 4Q1FA 1DTWA 3LQKA 2VQEB 5KTKA 3K1AB 4BXOA 1OT5A 2GAFA 3LDHA 1E0KA 3DDNA 3VBEA 3DBRA 3L7OA 3NFRA 1WMFA 2BVNA 3AKZA 4G0NA 3FW1A 4EFLA 2P9JA 2J59A 4HX5A 1XZPA 2NSYA 1BCSA 4G5RA 2AR9A 1XSEA 3A1DA 4P80A 3RVJA 4EG8A 3G0HA 1GKYA 2FLNA 1FVFA 3DFIA 4F4HA 3JQFC 1GZVA 3RS7A 2WWXA 3RUCA 3FHJA 4MS1A 1CY8A 4OI2A 4O2RA 2QQFA 2V7XA 2PH5A 4QTTB 3TAHA 4KQJA 4OXYA 4NY8A 2HMSA 4W99A 8OHMA 3H97A 4W5QA 4PAOA 3U7EB 3MGVA 1K0FA 4J49A 3D6JA 1Z6GA 3ZYCA 3PW2A 4ISCA 3HJHA 4ER0A 1V85A 4BB6A 1ECWA 1KAGA 3DCNA 5FR1A 4QEDA 3VR5A 3GGJA 1TMYA 4B43A 4R71A 1KZ6A 4E15A 3AEKB 1CLUA 1WF3A 4FZRA 1HYGA 1OTYA 3PV0A 3NM4A 1MTZA 2ZJ8A 4EHFA 9ICWA 2XY7A 3R74A 2NRXA 4KX3A 2NGRA 5AI8A 3KWLA 2R6FA 4PICA 3RJZA 1VDVA 4PZEA 4D8UA 3BYZA 1M2WA 3V1YA 3CWCA 5B57C 1NUSA 2OXFA 1GFSA 1TM3E 4D5GA 3ZXXA 4CKXA 2IRWA 2LBOA 1J8YF 4ETMA 3CRMA 2BAGA 4LVSA 2GD1O 3CJQA 1TJ3A 4DQQA 1R9NA 1J0DA 3ALRA 3IO3A 5G40A 1TK3A 2QM0A 3T5KA 4NE7A 3WLMA 2XQFA 5L6MB 3GDGA 1SQ0A 3ZXYA 5CJJA 1KFBB 3UPQA 3ZD6A 1WUKS 4HNQA 1MZVA 1QZTA 2I2AA 1TM7E 1DVRA 3T5CA 4G37A 4C29A 1PS0A 3EGDA 3U26A 4PQGA 3SLGA 4W5WA 2R62A 1DKPA 1X7YB 2QL9A 2H9YA 2NZ2A 2PFOA 1QDUA 3DNMA 4KGXA 1KYYA 3QMMA 2H06A 4UUAA 4DCMA 3M6FA 3GBSA 1CRXA 7MDHA 3DWGA 4WDRA 4MWZA 2OL4A 3VBCA 4NLBA 2UYHA 3K75D 3ZHSA 2JJ1A 4KAJA 5A5VA 1OTXA 4AMYA 2J0QA 5YASA 5JANA 4LY0A 4U3JB 1JHUA 1LK7A 5JEEA 5JAUA 3HZOA 1NC3A 5IVHA 2JH3A 2YCLA 4DRZA 4KV9A 1EDDA 4XGKA 4EABA 1KS9A 4OJYA 1K7XB 2I4NA 2R85A 2Y9TA 2P6MA 3BZCA 3ZCQA 3UJ7A 4UVDA 4BFYA 3VNSA 4F72A 1TMKA 2B9VA 2PGAA 1FFUA 2JFUA 3T41A 2I54A 1ECGA 4R3NA 4TPKA 1Z29A 3PPWA 1PFQA 4E22A 5LMCA 1TQ6A 2B7CA 2JFQA 2Z98A 4PYRA 1EGHA 1N25A 1RPJA 2CGEA 5LNK6 5LIPA 2Z7JA 3E84A 2G5CA 1QVRA 3SK0A 3A9RA 2I4TA 4FX5A 4WQMA 3RC3A 1ZD1A 2QSYA 4C0ZA 1WAMA 1LF5A 1FP6A 4AY2A 2OFXA 3O03A 2VF7A 3U4HA 4L5YA 4RORA 4ZVSA 3T0FA 5THQA 2PZLA 3I6ZA 3U1BA 4RQMA 1CDOA 4LYJA 4UEJA 3EFEA 1CUZA 4KWIA 1XL1A 4J0FA 4ENUA 3DFUA 3OLWA 4HPXB 5HS6A 4N0PA 3H4TA 4ZARA 3CN7A 2P5SA 3D3KA 3X1ZA 3DXZA 2F55A 4LXXA 5ADWA 3PSAA 3BJYA 1ZI9A 1LTHR 1T34A 1PKEA 3SHFA 2Q28A 3DKKA 1QCKA 4NEHB 4QDJA 4DLXA 1GV0A 3WBKA 4MGZR 1HGXA 3NCHA 3F6BX 3NFYA 1QTNA 4R51A 1DV1A 1I0IA 3B53X 4XDYA 1OF1A 2PZ8A 2KE5A 1S0VA 1NA5A 1ZOLA 2Y2VA 3EA4A 4J3JA 3NRBA 4I5FA 4HNRA 5K8IA 3HXPA 2VAVA 2TS1A 2C29D 4IXWA 2N1MA 2NQ2C 4K0KB 2GXUA 5HR6A 3UG6A 1A4IA 3OOJA 4M37A 2I67A 2JI9A 1PL0A 4MNTA 5L3ZA 5BN4A 4IVQA 4YRTA 3LLCA 4X6LA 1AGNA 2D2EA 4FLEA 4JUBA 4GLFA 5GONA 3U3MA 1GUDA 3CVWA 1V7ZA 3WKBA 4DJFC 4F86A 1XMQB 4Q3CA 3AUTA 4TUYA 1HNWB 4JR0A 1XDZA 3U37A 1XVTA 2ON6A 1UKBA 4RD6A 4MF8A 3U44B 1G6HA 4JVOA 3ZQ4A 2RK6A 1NZPA 1HRKA 3ZOZA 4QZ8A 2ZWMA 3RO7A 1AQYA 1SOWA 2E1RA 4TL7A 4B3IA 3NVVA 4EHJA 3MS4A 1YXMA 5D3ZA 1W9HA 4X8HA 2HWXA 2PGNA 1JFRA 3FY4A 3PVCA 4EO9A 3KJZA 2DFPA 3QUAA 4ZCMA 1YL7A 2NU9A 3ESQA 5CX4A 4BLWA 4JLPA 1GCIA 2V9PA 3O75A 5C8YF 2DHCA 4BFLA 1T1EA 5TDHA 4G3IA 4CEJB 1Y82A 1QE5A 1AA6A 3ZHXA 4I08A 2WM8A 3NIDB 5BT8A 1B16A 3A3YA 1NJ8A 4ZYLA 3AUUA 4BMVA 4LRYA 3ME5A 2Y66A 5COQA 2AUMA 2VNSA 4ZICA 4KR9A 1DHRA 4TXLA 2NO7A 2FQXA 3N2GB 1H3NA 5JO9A 1I4WA 4CTKA 4LQ4A 1RYYA 3FFBA 1JYEA 1AGPA 1DBWA 2DY1A 1ZIPA 4RTRA 4YJDA 5F4ZA 1Z38A 1EK5A 1M54A 4IO0A 2WHPB 4GLBA 3QVUA 4HLDA 4BNNA 4I4TA 2GBCA 3A0HU 1B0XA 1IUOA 4MRAA 4ZVQA 3JZDA 4X5VA 4BGDA 3GJ0A 5IAAA 2E37A 1S2OA 1FBTA 3R4VA 3PDIA 3GILA 4D9NA 3B1YA 3NHYA 3EGXA 4HQKA 4MDYA 2BMEA 1U49A 1GCAA 1Z00B 3DL7A 4LV8B 4QREA 2QGZA 4TQSA 1OD6A 3PF9A 3VR4H 5HQ3B 3TUZC 2W2PA 2AFHA 3UJ6A 3LJKA 2RGWA 8AT1A 1Z4NA 1MG5A 5E4JA 5KAPA 1GG5A 1PN3A 3QVJA 4JUCA 1BVYF 1ACLA 3R1IA 1QG0A 4B3GA 2WG0A 3I9LA 1MORA 2DFVA 4WEOA 5CNJA 1DBIA 1I14A 5ARCA 1UXHA 4TS4A 1JDUA 1NM5C 2AF3C 4ZVMA 3ZNPA 2IHZA 4FYKA 2QLLA 1SCKA 4F4UA 1XZ8A 5ALDA 1XGKA 1RC8A 1LX7A 1OHHD 3AZQA 3RUEA 4FSHA 2XO7A 3M1IA 2DPMA 2YDYA 2J5KA 4KLAA 1PS8A 1A8HA 5AVKA 4IIFA 1HT1E 5KTRA 1O6GA 2NZVG 2V98A 3UXPA 3BA1A 2CMGA 3ODPA 2E4WA 1XRQA 1U7OA 2A9PA 4LUCA 3PUYA 4C07A 4P4SB 1Y6FA 5CGQB 1GZUA 2DBQA 4KE7A 2V7QA 3PPIA 3B89A 1L4YA 1PFYA 3FUUA 4AMZA 1CRWG 3S27A 1UBEA 3OEED 1VXOA 3TGLA 3B3QA 1PR4A 1SU6A 2IHBA 4ZAXA 4QOSA 4Q1DA 1UKYA 2R96A 4YAGA 4Y9SA 1K2WA 2GZ3A 3IAFA 1U5AA 2Q4BA 4PGFA 3CW2A 4A23A 1ZQWA 3NKLA 2FHPA 3HPRA 4XVQA 2AI1A 2X76A 2G3YA 4PQYA 1ZG3A 4YN4A 3FCUB 3RRYA 4RYLA 2H5XA 1G291 4I2GA 1WWUA 1UL1X 5TMEA 4RMGA 1W0CA 3VKWA 5FHRA 1WUJS 1X7DA 1VDMA 1PQYA 2OVFA 3K2EA 4US1R 1DRGA 3SC3A 3E8SA 4KJZA 2Q2WA 1ZQKA 3VM6A 4PCLA 4ZI7B 4DKXA 3CPHA 3R0IA 3VKGA 1MXHA 5KNIA 3CUSA 2GILA 4QDZA 2OMKA 3EG9B 4Q4LA 3V2HA 4NBTA 2XNSA 2V5VA 3KUXA 4P83A 1ZR2A 3IMFA 1K5DA 1UXGA 2PZGA 2HA4A 3TQQA 2ORED 4TYNA 3S70A 3GIKA 3C1YA 3AY0A 1NK9A 1V11A 4C4ZA 3KYBA 1PFUA 4EITA 2PT6A 2VT7A 2GMWA 3UK2A 4F3RA 1EFRD 4YO7A 5G1PA 1L0BA 1G6KA 5AKJA 4EWLA 1IEQA 5HR5A 5JSUA 1RNLA 5NLLA 2ECPA 2OV1A 3MELA 1I7SB 2Z8YM 1JILA 3HP4A 3O8NA 4QU9A 1FDWA 4B6SA 1C9NA 1PUJA 2VTBB 1VG9B 1AK9A 4ZZ0A 2AWNA 3H9CA 1M0EA 2YFQA 4UAWA 4ZT3A 3V2UA 1KZ7B 1L5LA 5J4VA 3W79A 2O7SA 4G8DA 3G0IA 4D4GA 3SZLA 1A6SA 3D8HA 3Q3JB 4HNAB 5E2IA 1W8IA 4IQGA 4O3SA 2HRZA 3K1JA 3VU0A 4TQUS 3QKSB 3L0BA 5JFOA 5MGNA 2H2IA 4D9EA 1N5DA 4C03A 3GGOA 5P8WA 4LWQA 4F9EA 2Q7DA 2QF7A 1IY9A 3QYAA 2BFOA 4WBNB 3SQXA 2IHTA 4CF3A 2H17A 1XRRA 3PC3A 3AF6A 4REOA 1K3FA 4ALJA 4DQDA 4IHJF 4BKOA 4F2GA 3UMSA 3BFJA 3D7LA 5IULC 1K7YA 1N2EA 2JCYA 4QYIA 3AGQA 5DFAA 2WSIA 1Z35A 2P2SA 5J2JA 4ZCPA 4BX0A 2YWJA 2O8FA 4Q7JB 2WR8A 2BFFA 5LQDA 3Q5DA 3EGVA 1KETA 4P82A 5JS1A 3AY3A 4UVHA 3C4JA 3T9FA 4CG3A 3P0HA 4FQ5A 1RWMA 3KJGA 2W6OA 3GUCA 1NN1A 4RGYA 3GJ6A 3TIXB 3T7SA 1R6AA 3OI7A 3WLOA 2A9VA 3GJRA 2W6PA 3ZZ1A 4EPYA 1SR8A 2W43A 4XA8A 4CKWB 3D81A 2D5AA 1XBTA 1GAWA 1PWZA 3V1TC 4C30A 4E32A 3I01A 1IXZA 2WVHA 4KQKA 5LP6C 4BBJA 1IEXA 1UK8A 5A06A 3KJXA 4TSRA 1JE1A 1KFKB 1UWVA 3PMNA 1XN4A 1PUZA 4JODA 5DDYA 4PGXA 4FGWA 2J8ZA 2VTKA 4L4XA 4ABTA 1HZJA 1KJYA 3UT5A 3DDHA 1DKMA 5MN4A 4ZCIA 4BMZA 3ZZUA 4F8JA 3VSEA 4XVHA 3PYLA 4HZUA 2ZQ5A 4HNTA 1P2BA 5KFGA 3GUYA 4GXTA 3D3QA 2X6QA 1ZQVA 1M0WA 2EATA 2HJHA 2HADA 1MB9A 3E61A 3R3ZA 1BHSA 3GIWA 1VIDA 3KU4A 1QZXA 3PICA 1DXSA 1F0NA 1XTSA 4HZGA 4BO0A 2W11A 1D07A 5KAMA 3GEDA 4IS3A 4BO3A 1BPXA 5FBLB 5JZVA 4ZDKA 1BEUB 8ICBA 3S2EA 1MO4A 3S2FA 3COPA 5DXFA 4U7FA 3HCAA 1BROA 3TTVA 3NGMA 3GEGA 1SGGA 4H1HA 2LIVA 1TYDE 1ZQ1C 3F98A 4KIGA 1WHSA 2NT4A 5J2GA 3G0BA 4YEDA 1GSIA 2A86A 3RC7A 4G26A 3SQOA 2CXXA 3GG9A 5BW5A 3M3DA 3CYFA 2YVQA 4XWYA 1KDTA 1N33B 4MOWA 4K4HA 3ZPXA 3WTCA 3VPGA 1ZGHA 3DBLA 1OX6A 2Q8QA 4YK7A 4F85A 1E2GA 3OX4A 4MO9A 2L2QA 1EUDA 3DBHB 3UMJA 5K8TA 2BPGA 2P6NA 4QIWC 1UZLA 1SIJA 3B5JA 1C4WA 2PFGA 1FUEA 2F90A 2QW8A 1W36C 3G6WA 2VNJA 3W3ZB 1E96A 4B73A 4L9SA 4J76A 3FF1A 2YWCA 3KIPA 4NYJR 1XAGA 3K1AA 2OOSA 3KLBA 4DGSA 4B2LA 1S10A 4A1OA 1GN8A 5MHTA 5AOCA 3L7AA 1JQ3A 2PYIA 4WY8A 3MAJA 1L9XA 3L49A 2WMDA 1U8YA 1DKNA 2QQ0A 1V3QE 1D2CA 2OFOA 3ODGA 3PXAA 3MLAA 5F33A 1QCZA 2BHNA 3JATB 3EH1A 3UWOA 1XZJA 4PZAA 1SB9A 1P6UA 4TWZA 4OLAA 4IRKA 1V3TA 1L1QA 4Z9AA 3LGXA 5K0GA 5EL0A 1VE1A 4NP6A 2CF5A 4AT1A 5GIPE 4WW0A 2F76X 3RRFA 1ZK2A 4ECTA 5D2CA 2AQKA 2JGNA 2PNFA 1MTOA 2QRMA 3O4GA 4F4XA 1JDNA 1WL8A 4LDPA 1JG4A 2KV2A 4A6DA 1TYZA 4CKCB 2EFEB 1NFRA 5A9RA 5E3JA 1P2UA 3IA7A 1HKUA 2WILA 1VKJA 4WK0B 4JJ7A 1NX9A 4M6WB 4OJPA 2D1RA 1Z3IX 1E9EA 2YIDA 2GVDC 1FUUA 1JDPA 2XKJE 2BGRA 1DIOB 1NYQA 3O8LA 5KTYA 1R0BA 2BGMA 1UKCA 2A1JB 3KM0A 2C4VA 4OGWA 1YJAA 2VDOB 4RVGA 5JR3A 5JATA 3EEYA 1VHQA 2CL7X 1AHPA 1Z4QA 1CUXA 3K72B 2CUNA 4FBMA 1DAHA 2JGDB 4J4TA 1NVFA 2QM7A 2O8BB 4LNAA 2XQGA 1UBNA 3ESZA 3TLYA 4F46A 1E3WB 5B1DA 1OZHA 2R6HA 4N39A 4NLGA 4HT3B 2ZXFA 1J70A 4C78A 3PNKA 1TX4B 3Q8RB 2NO5A 2O3JA 2PR2A 4XQCA 2HXYA 3HK2A 4GMXA 3F97A 1PZEA 4QZFA 2P0YA 1P4AA 1H2BA 3GZ4A 1II9A 4JLVA 1J5EB 3N58A 4OHBA 1B2LA 1X7YA 3W0LB 3ZR4B 4ER5A 1BPZA 3KP1A 3M83A 2R7LA 3K9CA 1OVMA 4NYMQ 5CBKA 2FF7A 3D4OA 4JC0A 1FSPA 2YZGA 2FVYA 3LYHA 4FNMA 3PP8A 1T4MA 4C0BA 3WWOA 4ID9A 1J1UA 1C0PA 2Y2UA 3RBAA 2GAIA 4DNPA 4HQLA 4EP1A 3DHWC 1GYRA 2DVMA 4E70A 1JWAB 1R2QA 3NVZA 1J2RA 4IXMA 3ZGVA 1QO0A 1TNDA 5KG3A 1R5OA 1VL8A 1HOTA 4ZT6A 4MS4B 3QW2A 4KLOA 3H2JA 1A2KC 5KYVA 2E1PA 1S7CA 1X70A 3DULA 4RKWA 1CTQA 3BXZA 4E5SA 4CKEB 3CR3C 4EJFA 3M9OB 1CNEA 1DG9A 3X1JA 4A0FA 4RLFA 5AM1A 3A3PA 3E05A 4ZQHA 2BTEA 2EZUA 3E9RA 2E3JA 4DEVA 1JW9B 5FNVB 4NMXB 1UCVA 1ZQOA 2BGUA 3HJAA 3STXA 2YVKA 4RY2A 4UBOA 5B5SA 1A9ZA 2QD1A 4PO1A 4G0MA 3E9EA 3HYNA 4DNFA 3SXJA 4RFSB 3H1PA 4LOKA 1XNJA 1IIRA 3TQFA 2JEFA 3HMKA 5BSMA 2QU8A 4PNPA 4IKEA 1T1RA 3LP5A 5JXGA 3ID6C 4FEYA 4ELVA 2EKBA 4HAZA 2W6JD 3ZE7A 4DLKA 1D4AA 4HH4A 4EUKA 3FR7A 5KI6A 3IJPA 5LZ5A 9LDBA 2FOXA 4X41A 3VPFA 1YKFA 4OJNA 4AJKA 1KRPA 3ZIUA 2PMCA 1E59A 1WKVA