3QU7A

Crystal structure of pyrophosphatase from bacteroides thetaiotaomicron, asp13asn mutant complexed with calcium and phosphate
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
221
structure length
221
Chain Sequence
KLKAVLFDMNGVLFNSMPYHSEAWHQVMKTHGLDLSREEAYMHEGRTGASTINIVFQRELGKEATQEEIESIYHEKSILFNSYPEAERMPGAWELLQKVKSEGLTPMVVTGSGQLSLLERLEHNFPGMFHKELMVTAFDVKYGKPNPEPYLMALKKGGLKADEAVVIENAPLGVEAGHKAGIFTIAVNTGPLDGQVLLDAGADLLFPSMQTLCDSWDTIML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Divergence of Structure and Function in the Haloacid Dehalogenase Enzyme Superfamily: Bacteroides thetaiotaomicron BT2127 Is an Inorganic Pyrophosphatase.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
molecule keywords INORGANIC PYROPHOSPHATASE
total genus 78
structure length 221
sequence length 221
chains with identical sequence B
ec nomenclature ec 3.6.1.1: Inorganic diphosphatase.
pdb deposition date 2011-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3qu7A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3qu7A01
2CN1A 3ET4A 1MH9A 4B6JA 2MSNA 4Y2SA 3IRUA 5AKIA 4EZEA 2I34A 2RB5A 3OCUA 5ALFA 1L7MA 3A1EA 5FP0A 4UASA 2MU2A 2FPWA 1YMQA 1L7PA 4KNWA 4AS3A 3QU9A 3PGLA 3E8MA 5AVQA 1YDFA 4UATA 5ALUA 2O2XA 5AKXA 5ALZA 3KOOA 1WVIA 2O9JA 4BEVA 4DWOA 4BNDA 4I9GA 5AM5A 3FGOA 2YJ5A 3N28A 3UM9A 4UAVA 4UW9A 2YJ3A 2WF5A 2WM8A 4CNQA 3ONNA 2R8ZA 5AK5A 3MPOA 4L6AA 3WKAA 2ZBDA 3J7TA 2WF7A 2NO4A 3SKYA 2B30A 3WKEA 4BX0A 4BKMA 3OCWA 2Q4TA 4UAUA 2R8YA 1SWVA 3KDPA 1K1EA 2FEAA 2G07A 2HO4A 4XPZA 3U7FB 2I33A 3AR7A 4XE5A 1ZD2P 3A3YA 4NABA 1VJ5A 1U02A 2ZG6A 2C8KA 3QX7A 3QNMA 4C4TA 2EAUA 5IS2A 3QUBA 5ALXA 5ALMA 2C4NA 3PDWA 2G06A 3E58A 1N8NA 3OCZA 2X4DA 3L5KA 3K1ZA 2ODAA 1RLOA 1QQ5A 1RLMA 4HGPA 5T41A 4XOUA 2G08A 3I1YA 3ZX4A 2HCFA 3DDHA 2YMPA 4DCCA 2HOQA 1EK2A 1WR8A 3EF1A 3U7GA 3ZVNA 5ALYA 2FPRA 4NV0A 3SKXA 1RPZA 4JDPA 1FEZA 3OCVA 5A3RA 3A1DA 4FE3A 4YH1A 4QQFA 5AM0A 5ALVA 2IA5A 4UU1A 4O8CA 3MMZA 5AI4A 1XP5A 3ESRA 4IG4A 4YCNA 5AM2A 3U7HB 4G63A 3FVVA 3W5CA 5AI9A 2G80A 3P96A 4Y2PA 2C88A 5AKJA 5AVTA 4AP9A 4DW8A 3E84A 2GMWA 3KC2A 5AKGA 3HLTA 1RKQA 5AW3A 3QUQA 2D2VA 4HGQA 2FUCA 4IFTA 2RAVA 4FYPA 2WFAA 5ALIA 1T9ZA 3ZW7A 1ZD4A 4NAVA 1N9KA 3DAOA 1QQ7A 3AR8A 1U7OA 3EF0A 5JJBA 2YBDA 3S6JA 5AICA 4UMDA 2FI1A 1JUDA 5AKEA 2HX1A 3N1UA 3R4CA 1VFPA 4QJBA 2FPXA 2IOFK 3WKDA 5AVXA 1Z4PX 1AQ6A 1TJ5A 2HSZA 2ZBEA 1O03A 3QU5A 3QU2A 3FM9A 3QYPA 3UMCA 2ZBGA 3PCTA 4YCLA 1ZRMA 2WF6A 2YMMA 4C4RA 5AVSA 3RFUA 1L7OA 5AW4A 4UMFA 3NANA 4G9BA 3N07A 3TLMA 3L1UA 4MWOA 1KYTA 1RC8A 2QYHA 4AS2A 1J97A 2JAUA 2Q4RA 4KNVA 5ALKA 3W5AA 4EEKA 5AI8A 4BX3A 2OA0A 2R8XA 3ZWKA 1QYIA 5AIBA 3QGMA 2G1AA 3KD3A 4H1WA 4EELA 2RARA 4PNHA 1L8OA 2NO5A 4L57A 3MN1A 4J03A 5AI0A 3AR4A 1RKVA 4KYTA 3A1CA 3ET5A 3WK4A 2ZBFA 3ZUPA 4UM5A 1RMQA 2BY4A 4YIKA 1SWWA 2Q5EA 2YN4A 3AR2A 2OBBA 3CNHA 3ZVLA 3NIWA 1YJ5A 1Z4MA 3ZU6A 5AW0A 1SU4A 5E0OA 1TE2A 2C9MA 2B1QA 3WK7A 2W43A 1ZD3A 2FPSA 3W5DA 2B8JA 4UARA 1U7PA 1S8OA 3WK8A 1QQ6A 3B9BA 4Y2JA 3R9KA 5AVZA 2ZXEA 4OFZA 3NAMA 4UMVA 5AK4A 5ALRA 2CFRA 2HI0A 5AKYA 2G0AA 3KBBA 4Y2YA 1Q91A 2JARA 3SHQA 4YIHA 5AW8A 2MU1A 3AR6A 3CZ4A 1RMTA 5ALHA 4I9FA 1TA0A 1CR6A 1YS9A 3NUQA 1RMYA 3QU4A 3OCXA 1RLTA 2WF8A 2YFYA 3SMVA 3GYGA 5AKKA 4Y2XA 1F5SA 4DFDA 2B1RA 5AVYA 2P27A 1WZCA 3U7EB 1XPJA 3WK9A 3EWIA 5AKLA 1O08A 2NYVA 2I6XA 2P9JA 2GFHA 3I76A 5ALPA 2CFTA 2HDOA 2FPUA 3I6BA 2B0CA 4KX3A 1QH9A 4C4SA 4NWIA 2CFSA 3B8EA 3WKBA 5ALOA 1Z5GA 4HGNA 4HGOA 2PKEA 4KX5A 5AM1A 2BDEA 1J8DA 5ALQA 3MC1A 2I54A 3ZWDA 1RDFA 2I7DA 1WPGA 2B82A 2AH5A 4Y2VA 4Y2RA 2DQSA 1Z4OA 4EX7A 2GO7A 1L8LA 2QLTA 3FPBA 2P69A 3VAYA 3M1YA 4XQ0A 4NFLA 3PGVA 3U26A 5AW6A 3L0YA 2HEGA 3WGVA 1IWOA 3L0BA 4Y2TA 3L8FA 2IOFA 3N8GA 1Z4NA 2JAOA 5ALWA 5AVRA 4BNDB 3L0CA 5A3QA 5IT4A 2WHEA 5AK3A 3I28A 5ALEA 3U19A 1RKUA 3RF6A 4HYTA 5AI6A 1LVHA 1T5SA 3L7YA 3DNPA 2R8EA 4RESA 1X42A 4ZEXA 2G09A 3NASA 4CF5A 2YMQA 3SD7A 3UMGA 3SF0A 3WK5A 3WKCA 2VKQA 1NNLA 3ZTYA 1XVIA 4UU0A 2FDRA 2YJ6A 1VJRA 1U2SA 5AVVA 3DV9A 4MUMA 2OYCA 4Y2QA 4OCZA 1NF2A 5AKZA 3L1VA 3ZX5A 3NRJA 5ALSA 2AUTA 5AVUA 1RQLA 3L8HA 3ZI4A 2C8LA 1Z4QA 3AR5A 3KZXA 5AHXA 1Z4JA 2AMYA 4CF4A 3F9RA 3OTQA 3QUTA 1Z88A 4BYGA 4YCMA 1T5TA 4OD0A 4ZEVA 3ED5A 4EX6A 3OPXA 5A3SA 2I55A 1L7NA 3QUCA 3WK6A 2HF2A 5AK6A 4CE6A 1YV9A 5ALLA 4UM7A 4J2TA 3QU7A 4HAIA 2GHTA 1RRCA 2W11A 2P11A 5AW2A 4BX2A 4GIBA 2PR7A 1ZD5A 3FPSA 4UMEA 4YGYA 4GXTA 2EATA 1S2OA 4Y3UA 4JB3A 2WF9A 3U13A 5IT0A 1CQZA 4RETA 5AM4A 4HGRA 1L6RA 5ALJA 5AW1A 3WGUA 5ALGA 2RBKA 1ZJJA 3BWVA 3UMBA 2IOHA 5AI5A 3AR3A 2W4MA 4E88A 3QXGA 5AIAA 3L8GA 1RQNA 2IYEA 2ZOSA 2AGVA 3ZTWA 2PQ0A 3OCYA 4BEWA 3NALA 4L6CA 4CF3A 1Z5UA 3E81A 1U2TA 2YY6A 3R09A 2GHQA 3L8EA 3ESQA 2HHLA 1EK1A 2EARA 5AESA 1LTQA 2OM6A 4ZEWA 5AVWA 4KN8A 4OHFA 1Q92A 1Z4LA 4F72A 3SLRA 1NRWA 1Y8AA 2YJ4A 5AKHA 1ZOLA 2FUEA 3FZQA 3IJ5A 1TJ3A 3AR9A 3ZVMA 2BDUA 5ALDA 2JAWA 3B9RA 4FFDA 4BBJA 3HYCA 3IB6A 3W5BA 3D6JA 5AW7A 1PW5A 2HF7A 5AW9A 1YNSA 4Y2UA 2YMLA 3EPRA 5AM3A 1TJ4A 3M9LA 2B8EA 2JGAA 3N5KA 1ZS9A 4EENA 5AW5A 5ALNA 3QLEA 1Z4IA 5ALTA 1ZRNA 1Z4KA 3BA6A 4F71A
chains in the Genus database with same CATH superfamily
4DFMA 1XSPA 4ZVUA 3MVEA 2AHRA 3HJCA 4IC9A 2QG9A 1QCZA 1B73A 2R751 2OZKA 3DULA 5FYQA 4CL8A 5JAUA 4Y2SA 1JBKA 1JA1A 1PK9A 2B2XA 3PNVA 2YYYA 3Q0EA 4DCGA 3EIUA 1M2HA 2ALZA 1VJCA 2XQGA 2FEOA 4PICA 3LPMA 3W90A 5IFLA 3IT0A 1OWNA 4JMLA 1GD1O 3CRNA 3HN2A 1RQ2A 1H4VB 2J3JA 4HRYA 4M0MA 5EJFA 3NI2A 2JLYA 5TPWB 3UHOA 1Q44A 3DHEA 4IGEA 1DX4A 3BFPA 1KQFA 2PMWB 1L7PA 4RQMA 3PW7A 3LNCA 3GLGE 1O58A 2QTZA 1N8TA 1XR3A 4HNSA 4CUKA 2BHSA 1KAQA 1YDFA 2GAFA 2JIZD 3A4TA 2AG8A 3E4DA 5JSQA 3AEKB 3GDXA 4R69A 4GKJB 4XD7D 2WILA 1W19A 1TF2A 1RWWA 5J0PA 5C1PA 2JJ1A 4MTLA 4X3CA 4XGKA 5F73A 2VDRB 3SBXA 5K0TA 2XTMA 1GGFA 1KAMA 2ZB3A 4KFRA 3EJ6A 4OQXA 3U0VA 4D6XA 1G5FA 4KBYA 1G9SA 4WNAA 5KVQA 4BFSA 2VYFA 3R9WA 3E5MA 3EYZA 1EIZA 1P29A 1UL1X 1ZI6A 4NULA 2BH2A 4MPDA 3DE1X 2ZBRA 1NQAO 4Q1FA 4AIIA 2I1LA 3GN2A 3T3IA 1Z1VA 3M4JA 2VYCA 3AM5A 3GAZA 4MYCA 2FN9A 3RTVA 1XO0A 4GOOD 3QPWA 5TQ2A 4CDMA 5BSWA 1YTUA 1WB4A 2CLOB 3K4QA 3UK1A 1YCDA 2KE5A 3NWPA 4LE1A 4ROTA 3A04A 4WLOA 5DNEA 4BVEA 5JMWA 2DF4B 1GPH1 2F3QA 2BJVA 1IBRA 2WP0A 3BGOS 3F4LA 4NG4A 3QVWA 3VVMA 3M9NB 3QLJA 1XGKA 4IVPA 4Y98A 3U56A 4UAWA 5DIZA 4Q9NA 4G5GA 6GPBA 5CEEA 1CNEA 3MS2A 1I80A 2MHCA 3JZFA 2IYNA 5CT6A 3ROXA 4LOKA 2YZ2A 3MD0A 5EGSA 2BFDB 3W78A 8ICCA 1E7YA 1G6KA 2BGGA 4A4DA 2JLBA 1C30B 1R4AA 3KTQA 1UXKA 3EVAA 2VYND 3SM9A 4RJJA 3S55A 4G4GA 3LBAA 3ECSA 1XCBA 1DBSA 1U02A 1NK4A 2HA7A 5IP5A 2FMUA 1J2MA 3GX1A 3WHPA 5KHOC 2C8KA 5DV9A 4KRYA 2H3VA 1TU3A 2ECPA 5HIJA 4PTYA 2YN0A 4RSHA 5JAOA 1RAEA 3T1NA 1WWUA 1V6CA 3R3UA 5DX8A 4HH3C 4E33A 3TG2A 1O4WA 4NNPA 3E53A 2QN3A 1I8TA 2F8MA 2HPHA 3CVOA 4G0NA 2AF4C 3L02A 4IF6A 4L0MA 4DF8A 1DAKA 4OKNA 3DUWA 4P5DA 3E7XA 4RNNA 3RJGA 5HTKA 5MFZA 2WJJA 5LB4A 4W1SA 1P0MA 4NJEB 1ZL2A 2ISOA 2WWGA 1Y8RB 2G8NA 5EJAA 5BPHA 3AC0A 3AONB 1Z6AA 1SCUB 1HNNA 1HZZA 1KI1A 1R0KA 3GLFE 4Y30A 1SL0A 3GLFB 1ZRSA 4NLZA 3GJ5A 5C5DA 3OA0A 3IKTA 4BNUA 1EYZA 1DCKA 1C7RA 1KMIY 2C2OA 1VSTA 4MS4B 4V02A 2DHQA 2EX1A 4Z9AA 5I9NA 3WIVA 5KFPA 4HH0A 2L17A 3OBIA 4LY0A 2C83A 4DBLE 5KVSA 1H6CA 4NV0A 4KXYA 4DANA 2I67A 4R1QA 3OKCA 5FO1A 4DQ0A 2IPXA 1U2RA 3MOGA 3OCVA 5A3RA 5LP1A 5THKA 3RHZA 2A0FA 2WTMA 4P3XA 2EANA 1I7PA 4RL4A 3VHQA 3MMZA 5GTDA 5IARA 2JGLA 1JR3E 2A0XA 2DKNA 4R3WA 4YQFA 4GM4A 3JQGB 1BHQ1 5K0ZA 4MVJG 4G63A 1L3UA 2GXQA 1RADA 1K7EB 1Z62A 2HDHA 3K6KA 3PDUA 5T6MA 3ZE1B 4BGUA 4N7RA 2CJPA 1XXHA 4CFYA 3I3OA 521PA 4IO0A 4OKSA 1AXRA 4IFBA 4CDGA 1R37A 4Q4JB 2F00A 5C3UA 4MI3A 3D31A 4QUBA 2PFOA 1EUQA 4FFVA 1XU4A 1YXMA 3KZMA 5AKGA 1N5OX 4M49A 1MEEA 3V8EA 4RV9A 3C8ZA 1GGVA 1N6PA 1CEQA 3QUQA 1G8YA 1W49A 1TYAE 2CNNA 2Q9BA 3B51X 4IFTA 5EMHA 4AMGA 5HCIA 5B64A 2IEAA 4PN3A 4PLPA 1YDMA 5KFCA 4GC7A 1O5IA 1F9EA 1C41A 2CNKA 2FAXA 1T8EA 3DFIA 5DXJA 5EG5A 3KYCA 5EVCA 2IP4A 5M5BA 1QQ7A 4URXR 3AR8A 3PPWA 3IE0A 4J0DA 4Y9UA 1QNLA 4ZJZA 3U4QA 2O8FA 2JL1A 4TV8B 1ORWA 4L4UA 1WD7A 3HKZC 3AKEA 3F6SA 5EZYF 1NX6A 1YR7A 4Y18A 2OD7A 5ES4B 2OR3A 2XF2A 3MXOA 2PI5A 5EJ5A 2ZRDA 4FIDA 1HE3A 4LMBA 5AVXA 1T2CA 1AQ6A 1ZSYA 3WMGA 4BVJA 1U3GA 2FCRA 4BNFA 2P7HA 1ZRMA 3PUJA 3NU1A 1QO0D 4TS1A 3HPRA 1CFZA 1LSJA 2DBRA 5EPUA 4QGFA 3IP8A 5HILA 3VZSA 3ZE6A 5IK2A 3UFXB 4BU1A 1ZXIA 4UMFA 5D1NA 4PX9A 1GTSA 2WLSA 3LUAA 5IBRA 2WB4A 3I1FA 3LRTA 2XVZA 3ZBPA 3G9XA 1H0SA 4RHCA 5SZIA 1NKBA 4AC9A 4DA7A 4EA7A 5DGIA 1U5AA 4OJYA 4GXQA 1Z2OX 3UJCA 3WRVA 2AE2A 2CFOA 5ESRA 5EJMA 3HPQA 4U7HA 3PR4A 5CB6A 5IRCD 1VZ3A 4Q00A 1R0WA 2VJMB 5LQNA 2BZFA 2C3OA 1RLJA 1L5YA 2D3WA 4JV0A 3TWOA 3BS5B 4XA8A 2QDKA 2EAMA 1QYIA 3AINA 3HZZA 1E5VA 5EJ2A 1KFBB 1LBIA 4IGIA 4V1CI 3THYB 4CIWA 3SQWA 3IDAA 3OZAA 5FADA 5CRXA 1UDBA 3TMAA 1KKLA 3FPJA 2VJPA 4X5OA 1AIPA 4ZA2A 2ZAMA 3H8MA 4FZLA 2AZXA 5K3OA 2MSDB 3A1CA 2CJXA 4JI0B 4R63A 1OLXA 5HFNA 1A88A 2GPNA 1GA1A 3KWMA 1AHIA 1UWKA 1OX4B 4TT3A 2J7PA 4J0CA 2HSDA 9ICPA 1FLNA 3COPA 4Y6RA 4TKLA 3HY6A 4HTFA 5TQ0A 3CNHA 3ICQB 4ZCSA 2IXGA 1XZJA 4MQ4A 1U47A 1S0NA 4CM5A 1FJXA 3O8QA 2CVPA 1XMSA 2W58A 5EAIA 4C0SA 2IS2A 1TVKA 1QKJA 3V3TA 3W5DA 1LLDA 3KHGA 3ZZ0A 4U7FA 3OLYA 3X1JA 4TXJA 2AN3A 4A10A 3K6SA 3U3KA 2CHQA 1Y3DE 3V4ZA 1B42A 1R88A 9ICFA 5DCLA 4C0KA 1S3SA 2K4MA 3EZXA 3KLMX 1NOJA 3L7MA 1FTYA 1GN9A 3BMXA 1Z19A 2H0AA 1KAEA 2WJIA 2AVDA 3KEQA 4R84A 4F56A 2XY4A 4RQ5A 4I2GA 1Q91A 1RQXA 3LFUA 4IHAA 4JP2A 4WLVA 3I01A 2B3DA 5KDDA 4ZOLA 2YVAA 2RK6A 3Q88A 5B3LA 2JD1A 4J3FA 5HHHA 1SBHA 1NVXQ 5BW8A 5JQWA 5CNKA 1YS9A 1CR6A 2GHRA 4BGEA 1PUXA 4C0ZA 4MGZR 4PO8A 3LUPA 1TLLA 2P2CA 4H1TA 3SMVA 1U81A 1U90A 5A1TA 3NEYA 2B4AA 4YT4A 1ZA2A 3OOEA 1WZCA 1XPJA 3UJNA 4OGLA 2IHTA 2CT8A 2AKYA 4G1VA 3PBKA 2Z9DA 3MLBA 2K4EA 4FZNA 2J4CA 1RC0A 2BEWB 2I29A 3WZLA 5KDOA 3K0SA 3R8FA 4QYMA 1L4NA 3KEFA 3OOHA 1Z3EB 3JWGA 1D4OA 2ZWMA 3UKOA 1K6MA 1TCCA 1YVRA 3EAGA 4WFIA 1E3EA 1IOZA 1F6DA 1PIWA 1Q0QA 2HLDA 2P8JA 3NBXX 3GAAA 3RT9A 4XDZA 1UQRA 3OPVA 1TYZA 1QFYA 1O94C 4CXMA 4GP7A 3FDSA 3I64A 1UCFA 2Q0ZX 4WT7A 2HQBA 1IEQA 4JJ7A 2MRLA 4MVJI 4CF6A 3NEPX 4NYMQ 3SXJA 2ZRNA 1C2YA 5HIAA 1PJQA 5SICE 3TLAA 4ELTA 2H9AA 4L3VA 3B13B 3IP3A 4GPBA 1VXRA 2F1RA 2KLBA 1NMSA 1W88A 3IUNA 1NQ5A 4MEBA 4X60A 2Q4DA 3SHVA 2JFYA 2Q3HA 4YONB 4L4SA 4EX7A 5J9FA 2GZMA 1VMDA 1O9HA 1MLDA 5DGCA 3C4QA 3EA4A 4KOEC 1IHPA 3NIDB 2A9RA 2CLIB 2DETA 9ICCA 1I32A 4HWPA 3RABA 3N8NA 4FHFA 1ZCBA 4WKCA 1GLNA 2J59A 1WZIA 2ZUUA 3B7PA 2R7KA 3DC2A 4YT8A 3EZFA 3BWBA 4QQRA 3MJRA 3H0LB 1BCSA 3PE4A 2LPEA 5TMBA 2AR9A 2VSQA 2C4VA 1I2DA 4LNUA 4I2DA 5KB3A 3FPGA 4K8OA 1ABBA 1MPXA 4PNEA 4KV9A 2AJDA 1SRQA 1DLIA 1SCIA 3ZVKA 1HE5A 5HOQA 3GFKB 2UVWA 3CPHA 3IKJA 1AJEA 1LVHA 2ZRMA 4J9NA 4IH1A 4IUYA 4P22A 5EIBD 5BN1A 3OLCX 1U0NA 3AEQB 3IUEA 3B78A 3NC4A 4ZZ3A 1VECA 3B1YA 2FLVA 1YOBA 1BPDA 4MV1A 2QTNA 3DMFA 3VU0A 1NNLA 4I4TB 3HO8A 2Z09A 1KDYA 2P4EA 2C4UA 2WE8A 5HJ2A 3WB2A 5KX5A 4MUGA 2N75A 4PPNA 1NSTA 5AVVA 4IZIA 3QVVA 4MUMA 3AWIA 5A02A 2D0IA 3VRHA 1SCKA 1UXHA 4KGVA 6Q21A 2DCUA 4C1BA 1CW2B 5GP1A 4RJTA 3ZWYA 2HK9A 3C41J 3RGGA 1DL5A 4V0OA 1PZHA 5BOSB 4YR0A 4HN9A 1CE8B 1P73A 4RF5A 4TN5A 4X6XA 2ZR7A 4E32A 1KAHA 2DPMA 4N6NA 4PCVA 2BCSA 3OTGA 3PYMA 1Y80A 2XCLA 3MJTA 1GFZA 3SICE 4BVAA 3QVUA 3HP6A 1JA9A 4ERNA 1JSCA 2V0NA 3DVRX 3GFFA 2OCYC 4KDRA 4R05A 3LH5A 2GVZC 3C3JA 4YAFA 4B3JA 1OAAA 4DQVA 2EP5A 4DZZA 3MWFA 5AMXA 1RP1A 3TXYA 1H8ED 4BDSA 1G4UR 3HB9A 4HDKB 3U3ZA 3GVIA 4TSFD 3OZDA 4AJNA 1E4VA 1BH6A 2JCBA 3KOXA 2GPBA 5C8DA 1VG1A 4S05A 5KFXA 1WNTA 2ES6A 5DSZA 4I1PA 5ICGA 5C31A 1W75A 4OGWA 4DC9A 1G9TA 1UA1A 1KYZA 2BJWA 4HDRB 4QDXA 3ZCSA 5B2EA 4CT5A 4D0SA 1TAQA 4DT1A 3ZKAA 3AUXA 1MQAA 3CCCA 4YAOA 5BNZA 5FLXA 4QATA 5CDFA 3FFXA 1QLJA 1W2HA 3L41A 1EEXB 4W63A 1KVRA 1T9GR 3C1UA 1WX1A 3AERB 4ZT7A 2CYAA 1GLGA 4UULA 5JZOA 5A0LA 2FFHA 1DFIA 1V4BA 1V9SA 1X80A 2RIPA 3BM5A 2JI7A 4A2QA 2V54A 4X6LA 4EJ6A 1CQPA 4JROA 4EL5A 3IXQA 3NRZA 5FULA 5DZSA 1Q21A 4RETA 2WLTA 2REXB 5JSZB 2R6JA 3WAKA 5AH0A 4M1KA 2QGZA 1THGA 4IGAA 1U1DA 4Q9JA 4NDAA 4F9FA 5LKAA 4NJ8A 3DCJA 4MUHA 1XZQA 3ENNA 3TR0A 2XWPA 1KLNA 1BU5A 3BQ0A 4AX8A 3ER6A 3PEWA 1PLJA 4A0GA 5CA1A 4GGPA 3H9UA 4X7MA 4FINA 3CM0A 3EY9A 5IU6A 3NALA 3IURA 4HCJA 3O4RA 3QMWA 1L7BA 4HGYA 3DS8A 4HR7A 1GTRA 2JKZA 1FTSA 2IYRA 3K0CC 3LYLA 3VHLB 5C7YA 5LXTB 1JAXA 2WHQA 3T7SA 3WTCA 4WN3A 2HFJA 1PO7A 3L2OB 3K9CA 3TUZC 1PHPA 2FU5C 4S1NA 4F5YA 4X6UA 1QP8A 2PLRA 4KK3A 4CMIA 3L0DA 3BDIA 1J8VA 3OT5A 4K9DA 2C29D 4KVAA 4URHA 2RH4A 4XPIB 4ZEWA 3RJIA 3COYA 2O8DB 2WKQA 1LSOA 1WULS 1AQLA 2ZUBA 4Q9LA 4DDKA 5KOYA 3IPXA 5COAA 3IQGX 2ZT5A 5I9IA 1K0FA 2AFHE 4KMOA 3OZBA 2BGIA 4TMZA 1Q1AA 4X63A 3TRIA 1BGVA 4G0VA 3S2UA 3TIVA 1VG9B 4Y67A 5EHGA 1TJ3A 4RIIA 3RSCA 1QVZA 3A25A 3DZ8A 3PXXA 1SVSA 3DV0B 1ORIA 4BUJA 4DABA 4P4MA 2CNBA 4JP5A 4QFMA 1RAAA 4PJ0U 2I22A 1QRDA 3IKMB 1ECWA 1CY2A 2BKUA 3BXOA 3NT2A 1XU7A 5E9AA 1PJ4A 2AI2A 2QOEA 5F2EA 1O95A 4HX9A 3GWGA 4MROA 4Q93A 1R9JA 1U5CA 2DT8A 2K2QB 4YMWA 4FP9A 4U7JA 1VG0B 2O14A 3NVDA 1Y48E 4KIGA 1PZFA 3QBDA 1OUQA 4PGQA 1O5OA 2R44A 4EG3A 3WGIA 3K8QA 4CL0A 1JHXA 2GM9A 4TYMA 2H0RA 4CQMA 4QG3A 3KKOA 5C3MA 4NEHB 3U60B 4FSDA 2JLAA 3M6LA 1W46A 2CN1A 4LE2A 1D1PA 3AVUA 1QAMA 4Q9DA 1U04A 3AN1A 3EEYA 1KY5A 1FUKA 3I04A 4UNPA 4WUVA 5SYMA 2YWRA 4D02A 4G86A 4OXXA 1AXEA 1JALA 2MYPA 3GFBA 3AP1A 4C0BA 3L77A 1U3DA 4L02A 2VQ3A 9ICAA 2I78A 1C7QA 4FYWA 4ESEA 1C9NA 1J9EA 2BFBA 2OUKA 3GLIA 3KHRA 4PPFA 4A2PA 4RY0A 4ER0A 1A7JA 4Q4HA 1FDRA 3AEQA 4FW9A 3RYFA 3TW6A 2IYLD 1M0EA 4RUAA 5BWNA 3PL1A 4J49A 4NR0A 5FH9A 2G5HB 1FNSA 5CCXA 1T1SA 3GP5A 1T2UA 1A2OA 1X39A 4M88A 1AHNA 1IOLA 2DPJA 3WWYA 4ZRNA 3RU9A 1GQSA 1NIPA 4UW9A 1T9BA 4ZAYA 2PUFA 4UB6U 3DLHA 1M7HA 2X0RA 2C59A 4NF2A 4TTQA 5FA8A 4BY9E 3K94A 3OKFA 4BXOB 2OL4A 2QWXA 16PKA 2IEYA 4PZDA 1NMZA 4Y1FA 5E1MA 3VNAA 4DYDA 1ITZA 2B1GA 1BQ4A 5GTHU 2GBIA 3K0CA 4KLDA 1DC6A 5T14A 3E3NA 2XUPA 1V97A 3GEEA 4R68A 5B7NA 3EWNA 4KLRA 3FYUA 1R6UA 721PA 1G98A 1SZDA 3JTEA 1KQ3A 1R10A 2GM4A 2GETA 3HDYA 2X2PA 1CCWA 2NU6B 1T36B 4O2BF 4N8EA 3D81A 1SWVA 4AMYA 1ZJYA 3G6VA 1YBAA 2C2WA 2EBFX 3ZZ1A 4XJXA 3AHHA 1WLYA 2OBNA 4LRWA 3NIFB 1C3LA 1I3OA 4B35A 2WUEA 2J9YB 3OE4A 4PO1A 4OU5A 5K4GA 4DADA 3WVNA 1JR6A 1V95A 7REQA 4KRGA 4FFBB 2UZ1A 2FSVC 2XTNA 5L53A 2ODPA 4EARA 3GJRA 3IP6A 1AKNA 5P21A 4MAAA 4I0WB 3U4DA 4RKWA 2XKKA 1XQ9A 4PU0A 1NMEA 3Q10A 2C82A 3TL2A 1F2DA 1ULSA 2WFZA 2K7ZA 4HQKA 3UXYA 1ZUNA 2W6ID 3MQFA 2PN1A 1FYEA 1QHNA 3P5SA 1NJYA 4INJA 4NENA 3DQZA 1UDXA 5IJXA 4LVUA 1GCUA 2GEFA 4RQ4A 3LLSA 1N8NA 3MD9A 3RSSA 4EKDA 4KXXA 5CCEA 5CFPA 5IYZB 1Q3KA 2H7YA 1BO6A 2WHRA 3R20A 1JTFA 4KR9A 1D2CA 2W04A 3WHIA 2KV2A 5CCDA 1A96A 2C97A 3DVSX 4BGVA 1QQ5A 1ZNQO 4ZTUB 4OLBA 2CJWB 2IEZA 1PVPA 1YDHA 2B8NA 3PFBA 5KFDA 1Q1BA 4QIWC 3TPFA 3RTDA 3AERA 5KTMA 2FRDA 3KYDA 4I2IA 4DR3B 3CLRD 2IW1A 4BFZA 3THXA 1ORHA 3E5RA 4PN7A 2JZOA 1MOQA 1I9CA 4KH0A 2V9PA 4WWHA 3TLKA 1N9ZA 4K3VA 1T2FA 3GGCA 4R8MA 4ABTA 5FXMA 2PX0A 2FPPB 3V80A 1GT6A 1W5TA 3CX8A 5KFLA 1PTJC 2EX0A 3TGPA 2H31A 1VE9A 4QQFA 1LKZA 2HGZA 3DBRA 3TI7A 4ZCRA 1GA4A 3NDBB 5BNFA 2WTEA 4DDUA 1MQSA 2QZZA 4C3VA 4Q43A 3B1KA 4BKPA 2BELA 1KJIA 2Q9UA 1V1RB 4RF4A 5AI9A 2LBPA 3KHTA 4F5RA 4XWAA 3OX1A 2OFXA 1YR2A 4REOA 1KRPA 2RD2A 2XZTA 5J0RA 2XKJE 3PPYA 3PXEA 1OGJA 1TZJA 2E1RA 2O1SA 1WW8A 4WDRA 3E84A 3RG2A 1JKXA 3DMGA 1TJYA 4PPGA 4YDHB 1UC4B 2DBVO 2E48A 3D6FA 4L28A 1SVKA 1HDXA 2C57A 1F8YA 1XQXA 2UUOA 2YOFA 2HTEA 3BIOA 3H86A 2W6JD 3KLNA 4LOIA 1BDMA 5AW3A 3OSUA 1PJTA 1TM5E 3D0RA 3HBFA 1Z06A 3E7WA 4IKOA 5A4MS 3R24A 3LYHA 3W8NA 2IRWA 3KAQA 1E3JA 2NVUB 4B4WA 1T3LA 2LIVA 5BSMA 1N8KA 4B74A 4CMEA 1U49A 2PL9A 2DWOA 3PDCA 5BT9A 1RBYA 2DJ5A 2GSWA 1YK1A 1VL2A 3DO5A 3TO5A 3VC1A 2AQIA 3DB1A 4RSGA 5IM5A 5AOCA 4E21A 5CDYA 2NN3C 5FA5A 3UK7A 5CDUA 5JASA 3H5OA 2REQA 4RTSA 1ZC3A 2BM9A 4FB5A 2IYVA 4KWEA 1XL0A 2C4WA 2WWIA 3MA0A 4ZQGA 4DAOA 4ETNA 1ZBQA 4ZZ1A 4PLVA 4W5HA 3SK0A 1U0BB 2X58A 1GTMA 3K32A 1RCUA 1XK6A 5T4HA 1TJ5A 2WTNA 3ABRB 3QYPA 2RI1A 4BLWA 2ECOA 4AECA 1M73E 3ISBA 5HGJA 1L3TA 3RR8A 3BBPA 1P2SA 3FB4A 3P9RA 3QKUA 2FSVA 3E3LA 1O97D 2G77B 3P2JA 1F4VA 1W59A 2GRAA 3H1EA 3KKPA 3OQ1A 4EBDA 4XDGA 2GD2A 2HWYA 4RTPA 4QGAA 1V2GA 2AR0A 4Q1EA 5KNCH 3N07A 2ZTDA 2H1LA 3ESDA 3LDUA 2QN7A 3D59A 2XD9A 3ONVA 3ZWCA 2NO9A 3H2HA 4MWOA 5SY9A 4BWMA 1XPUA 3TQCA 2B34A 4TLMB 3ZK8A 4MO2A 1Y63A 5EYPA 1SCUA 2Z56A 5DLFA 2HPVA 3S0JA 1IMOA 3B3FA 3OIGA 1RYRA 4FEYA 1BDBA 1IATA 2PWZA 5JWHA 3L05A 4QOJA 5EPOA 3VUFA 3WL8A 7REQB 2DFTA 1QX4A 5IC6A 2XNDD 1RRGA 1SXGA 3M5WA 1UDRA 5IJZA 5EWMB 1BEEA 4N6OA 3H0KA 3E9DA 4TYQA 4Q01A 4X8HA 3AM9A 4IIFA 3MN1A 3OHSX 4C7MA 2BFDA 2NRZA 5DBIA 2HWWA 2O4CA 5AI0A 3LVRE 4PRYA 4HNRA 2IE0A 3HGTA 4MKFA 2Z30A 1B3RA 5C37A 3BXPA 3PC6A 4YCJA 3HGQA 2Q3LA 3C8UA 5TARA 5K0SA 3PIIA 5KTYA 4O3RA 3JQ7B 1XMQB 2W55A 1NTOA 1FTQA 2OBBA 3I72A 4RCVA 3QEAZ 4E09A 5KG6A 5K6TA 4XZ3A 1MDBA 1ODSA 4ZGWA 2FZVA 4PRZA 1RZVA 3PJEA 3RS7A 1MAAA 2G36A 3BK1A 3N4MB 2HK6A 4UD6A 3M3PA 2KYRA 4C21A 1GNTA 2UVPA 1BMTA 2HVIA 4S1WA 3SZRA 2VHJA 1RM5A 3F6BX 5KS2A 1ZRHA 3C1ZA 1IN8A 2Y67A 4ZCTA 2OCGA 2WD9A 1LD3A 3QIVA 3DM9B 1ZXBA 4HB2A 4YP6A 5NULA 5CB4A 4CRWB 2VF7A 5PGMA 3GBVA 5EMMA 3S99A 1A04A 4I14A 1YB4A 1F6WA 1Z6ZA 3DPIA 2HHAA 3P9IA 4GSKA 4L0CA 4DTIA 1TNDA 3A4LA 2QD4A 4PX3A 2FFAA 4QSHA 5ECGC 3GJXC 3VR4D 4YIHA 1E77A 1Y98A 2EFYA 2BCJQ 2IWHA 1XNRB 4DMKA 2VUIB 1MORA 1SKBA 4HX5A 1FP1D 1HQYE 2QU7A 1FFGA 5K2OA 3GP8A 3FOFC 3D0QA 3FOAA 4OPMA 2XKBA 3QNUA 3NHAA 4M22A 4F7DA 1ODIA 1M5UA 1PNOA 1V96A 3AO0B 3D7KA 5ECDA 2B1RA 2M98A 4WBSA 3W04A 1BCRB 1S7GA 2P27A 3R3YA 2CMGA 2GLXA 5FTLA 3FDIA 3EWIA 1JFFA 4NIMA 2ZZKA 2IXFA 4PYOA 3FX2A 4DIMA 2X0NA 3LE8A 2X9LA 1R15A 3QXXA 2BMEA 4M8SA 3OJFA 3TKYA 4MO9A 1L4MA 1BS2A 1ZK0A 1JHOA 1Z7YA 1ISPA 1NXTA 3FHLA 2ZW9A 1HDOA 3VR5H 2O3SA 2ACWA 4MV8A 3GHHA 3TOXA 5J2JA 2VTEA 1OB5A 1UEIA 3I5AA 4IBOA 3MCAA 1UQVA 2ZXHA 1F3OA 3BE8A 2A5GA 1REQB 3FYSA 1O9BA 2CJWA 4GSYA 4RVOA 3ZWDA 3JAMA 4DQRA 2VP3A 4BTLA 1V7CA 1KOGA 1QF6A 5JZVA 3RRBA 1I3CA 1MKYA 1R0RE 4LQLA 1W5BA 4B47A 4A5OA 1E2GA 2FSHA 1WXWA 1TZBA 3CH7A 4ZT3A 4PC6A 3S29A 2WKSA 1UZLA 1TD1A 3K6RA 4RULA 2B82A 3EG5A 3IR7A 3VH4A 1XUOA 2X5KO 1GZUA 1PR2A 5JAQA 5A06A 4AM8A 3GV7B 3B6KA 2W00A 5JO9A 2OOSA 4XQ0A 1P4RA 2WJAA 3TQQA 1NR7A 4KFTA 3TJMA 3T5HA 1UKBA 2C54A 1SL2A 3O9VA 4GQBA 3C74A 4RKYA 3VGPA 4XUEA 3VVBA 4XIIA 5LMZA 3N8GA 4LHEA 4EY7A 2I4NA 1GL6A 4ZVNA 1V45E 1OBFO 1NYRA 1K89A 1SUWA 2EZTA 2GCIA 1PQ4A 3B9JA 2XUKA 2ZYTX 5A3QA 1EVJA 3CVXA 1VI2A 1VLMA 5H1YA 3TB4A 3N53A 2P91A 3NHBA 5DM4A 5FL3A 5BR1A 3I28A 2NQTA 3NHPA 4M99A 4TLCA 4DSLA 3CLTC 5EZQA 1K6EA 3MQ4A 3PHIA 4DJEC 4EATA 3MMSA 4M1ZA 4V0RA 2ZQZA 4RESA 2JHGA 2ODQA 4HQ0A 3K6SB 3CW2A 1P2BA 3FAHA 1ZNWA 4E51A 4DZTA 3NYRA 1XJWA 1ZVMA 2FDRA 4XVHA 3ZKWA 4CTNA 5JVDF 3HNRA 1N5LA 4HAXA 4D9GA 3EGWA 5JY6A 5JJLA 5I7AA 1RZRA 3JWHA 3H97A 2B6HA 3OG9A 4OCZA 5EHQA 2KSOB 5LZ5A 3U44A 1HNXB 2QTRA 2D3TA 4M54A 1JXMA 5ALSA 4ZU3A 1ZJNA 4BQSA 3AVTA 1PFVA 4HDOB 2BEKA 4OAOA 4A0QA 4A0FA 3AF2A 1OASA 2O57A 5G3YA 4GLXA 5EP4A 5SZHB 3S1AA 4UEKA 3KZXA 5CEHA 4HOYA 4OQMA 3OPNA 1DWPA 2CVHA 1UIMA 3RD5A 4J9LA 2AXQA 4LF4B 4CT0A 3F3MA 4B32A 4JLAA 4L15A 3FWZA 3HKCA 1LK0A 1QO7A 1GQ2A 3EEBA 3QVXA 3ZHUA 2Y2UA 1R6XA 1UANA 1BFKA 3CPSA 4FLMA 1BPYA 5J4YA 2A1TS 2JD2A 2QAJA 2FW0A 3WLHA 1PVOA 3FDZB 1SC4A 2IHKA 4EX6A 1Q6YA 1XJQA 3CIFA 1ZOSA 4LZAA 2XNHA 3CVYA 4ALNA 4R2IA 4DMHA 2OHOA 1BWPA 1A9TA 4AY5A 2RHMA 3SS7X 2PV0A 1HYHA 4KQHA 4YDQA 4TTRA 5HM6A 3GELA 3QUCA 1OBCA 4BUZA 3K9FC 1J0DA 1YULA 3MT0A 3C2LA 2F59A 2HMAA 1LC0A 3F5AA 3PQ6A 4HPWA 4M1SA 3TINA 1S2DA 5BN5A 4RK5A 1U7UA 3D3QA 2UYYA 3LYUA 3QPVA 5H3HA 5HQ3B 4G0YA 2LV8A 2X1MA 3KP1A 1R5OA 1ZGAA 3EPHA 4U2GA 2R4QA 4Z51A 1JJVA 3BF8A 2Q2NA 2GN4A 2GF9A 1CY8A 3MCZA 1KO7A 3KQVA 1LVGA 4TKMA 1UKAA 3LL7A 1W6RA 3FTPA 3IMCA 4GW3A 1EWTA 4FU0A 3DL0A 3GLGA 1L6RA 5HEKA 3V8QA 2WV9A 5DG7A 3QH4A 1FLVA 3O2SB 3IMKA 3I73A 3PUHA 4QTZA 1Q0SA 3D7NA 4FI3F 3IUPA 4ZO4A 2LCQA 1ECBA 1NF3A 3LLCA 2G0TA 2JHFA 4TXNA 3UO8B 4I50F 2O4UX 1R5BA 5AIAA 3L8GA 3C1YA 4IDOA 4GM0A 2SNIE 3LX4A 3ZTWA 5AVKA 4AI6A 1SG9A 4XSHA 2E85A 3UN1A 7GPBA 1VDMA 2QROA 4PSKA 4BZZA 3K9GA 2ZE6A 2GK4A 3KJZA 1DEKA 2IUUA 4N12A 4G23A 3OD5A 1XX6A 4O3OA 3N8DA 3D0KA 3KELA 3PNPA 4NHEA 5G1OA 2AFIA 2VSOA 2FG7C 4OGFA 4YP0A 1R6TA 4MKGA 3UATA 3GARA 4FR2A 3T0FA 2VDQB 4TVOA 4KWIA 2RJOA 1L4HA 4KI0A 4UUQA 5JH7A 2O2HA 1R16A 2WAXA 2QTVB 3JWEA 2WT8A 4EGAA 4CM8B 3ISCA 1EZZA 3CH6A 1GNLA 5JU6A 3WWDA 3OZXA 4EMUA 5JNUA 1F4LA 2IP1A 5E6SA 2E4AA 3TNYA 4ENUA 4DL2A 1NLZA 2B61A 2WKRA 3BYZA 3ME5A 1B0XA 4UZEA 1L4EA 4R6XA 3MUFA 4INPA 1KOJA 3V7FA 4DJJA 3EEOA 1D03A 1L7AA 2M9MA 2WFMA 4JQYA 2O2GA 4MCAA 4BBJA 3T3DA 3CVVA 2QRPA 3CKKA 1KI9A 3ENVA 5AQEA 3GG2A 4KUHA 1E1DA 2HF7A 5BRNA 3DLIA 5LZ7A 3LWNA 1OXMA 1YNSA 4KCGA 4UVEA 5MN4A 2P2DA 3HUTA 2X8AA 4RPYA 3VJMA 4D4HA 1GPWB 3MCWA 3H1FA 5HHTA 5M04A 5TMPA 2FWIA 2IPOA 3ICPA 2PUEA 5HKLA 3FNGA 4RGVA 4GOXA 4WAUA 4EENA 5L3RA 2VZ0A 3IPCA 1XPRA 4DGSA 2OQRA 3R6LA 5T64A 3GIKA 4LWQA 1B7GO 2VRCA 2B2CA 3RNOA 3SE0A 3BA6A 3W6UA 3DE5X 4FJ0A 4MSUA 1V3UA 3INTA 1JHVA 3W2GA 5C9ZA 2DKZA 5EIFA 3IMEA 2VP2A 2ACVA 3J80A 1EDDA 121PA 1JEQA 3WL3A 1LH0A 3SCZA 2JFZA 2VHUA 3MGHA 3I5MA 3I9LA 3L18A 2R86A 1E9CA 4MS1B 1NW6A 3HCFA 4W7IA 3PW4A 1BKSB 2WKWA 3O1JC 5G3ZA 1IRIA 3TYXA 1T0PA 4AICA 3A1TA 4LF6B 4KTVE 2Q3JA 3MJHA 3OZ7A 1KMHB 4W9NC 2QX6A 1FUYB 1X7ZB 3OZVA 5AOBA 2UYHA 2CV2A 2FPWA 1CU1A 4X71A 1I33A 1AK1A 3PXUA 1WMFA 1H2WA 3HPOA 4B2PA 1KR5A 4HUJA 3W8EA 2EJUA 7ICSA 2FF5A 3TFSA 1FRNA 2H18A 2ONYA 1NY5A 3M9OB 3ANSA 3PC8A 2FYTA 3UHJA 2XMBA 5J2HA 1AGNA 3AF0A 3L01A 4HADA 4CUJA 1J4AA 1WVGA 4AJ4A 1EDOA 2H4HA 3NEAA 3R5SA 4IUDS 1Z9BA 1S76D 3KT6A 1AKTA 1QV7A 3QVKA 4GR5A 4LYJA 2W9BA 1CZUA 3KHUA 5DP2A 2W6IA 4EBBA 3KXIA 3TW4A 3GDGA 3FGOA 3QHQA 2XUAA 5KCZA 3L8DA 4HBZA 2R5WA 3BFKA 2ISCA 3VKFA 1SQFA 4F3KA 1R4MB 2XAUA 1R4ZA 3W5SA 1E9BA 4NE9A 1QIGA 2FQYA 4UUOA 1J1UA 1DDGA 2B35A 1N1MA 5B7GA 1P4SA 1VMKA 2ZBDA 3RAPR 4IJ5A 3O1LA 3QXJA 2B30A 4TKUB 1L6IA 1CVLA 1DADA 1Q12A 4ARZA 2RAFA 1U7ZA 4BX0A 5FWXB 5J2TA 1DK3A 1Y3FE 4QOGA 3F2BA 1QH0A 4FZ3A 4JI5B 2LM1A 2PS1A 2VDVE 4URUR 1E7QA 2CJFA 1NJ5A 3MGCA 1B0ZA 2CK3D 1LK5A 3N0VA 1R6BX 4RD2A 5B4VA 3T5CA 4KQ2A 1YZKA 1O94D 2HN9A 1UJ5A 1HL3A 5ER9A 2QENA 2CXNA 4HXEB 4DLSA 2PVSA 4KLCA 1T2VA 4F4DA 2F43A 2RGWA 1CUDA 1B16A 3FYTA 3EIHA 1HNWB 5DMHA 4XLTA 4ME6A 1OAKA 5D84A 1I4OA 4OJKA 1VYTA 5FUVA 3ZLJA 2XRFA 2GZAA 2QN1A 1F8FA 2OV1A 2X1LA 3C8MA 1SV0C 3NDRA 3QLUC 4RY8A 2RC5A 4NSNA 5BN5B 4CMJA 3JALA 3ORFA 3ZXUB 3KFUF 5EEHA 4C4TA 2X8JA 1SJ9A 3KL4A 5E6RA 3KHHA 3RC3A 3PV8A 1DJMA 2R6R1 3AY0A 1NHWA 3I6ZA 1WDWB 3R7AA 4NMXB 2IOYA 4JBGA 4KXMA 4EPWA 4EY5A 3I37X 3WBBA 1KI3A 3AJEA 4MVJA 2QL6A 1VB5A 1MA7A 3UENA 3OX4A 1Y5NA 1EBFA 2IJGX 2ZWPA 4J7CA 1DMRA 3NAGA 5K05A 1T0IA 3N76A 4ICIA 4COOA 1RJFA 1SBCA 5H59A 1V8OA 3KSUA 2ZROA 4INOA 3DYBA 1YGYA 1NBAA 3BD6A 3G5AA 3T4EA 4ZI7A 2VCEA 3ND7A 2BUAA 4JUCA 2XX3A 4WX2B 3KAPA 2JVKA 2ODEA 3NQ41 4HP8A 4MR9B 5E2IA 3EEQA 2XF8A 4F4IA 2SHKA 1P2VA 1SCDA 2OB1A 2B7LA 4U7TB 3L4SO 1D07A 1LY1A 4ENPA 1WR8A 3KE8A 3BH6A 3QLVC 1R27A 1E3DA 2JJ2A 2B92A 3EVDA 4NL9A 4FYVA 1EXNA 4ODIA 1TZKA 4FE3A 2YFQA 2ONKA 4IJVA 5KU7A 4XB1A 3OEED 5EJ4A 3GG9A 1UP7A 1OREA 2I7XA 3CTMA 1YCHA 5FPYA 5H83A 3I0NA 5I9LA 3NBUA 4IG4A 4EP1A 4FI3C 4LBYA 3EQZA 3QMPA 1J8YF 5ELMA 3W5CA 3I2IA 1PJCA 1B41A 2GZ2A 4A2CA 1N36B 1SGGA 3SE7A 2JA1A 1GUFA 3G7SA 3IV9A 4DS4A 3JRNA 3BWYA 3NCTA 4I8IA 4INAA 4JVOA 4PO9A 1T6ZA 3RV4A 3TVYA 4JJEA 4HC4A 4C2UA 4LJKA 4OHRA 2ANCA 1J0XO 1ZX1A 3NHUA 4GXKA 2ZI6A 3D6MA 3LMKA 1MNAA 4IOKA 2A1TR 4EUHA 2G40A 3HA7A 1NUQA 3FNFA 3NBFA 4ASUA 3ORQA 1PKEA 2DG2A 5A4IS 3LPNA 3OOJA 4RQ0A 2EFJA 2RAVA 2BSXA 2C0PA 2PSFA 3DSRA 1IY9A 3LQ2A 1U0GA 1A7UA 1WHSB 2DU8A 5GJCA 2KJ5A 3UWMA 2H29A 3JWPA 4UTNA 4JOQA 4OUKX 3L49A 3NEJA 5D5PA 3LUFA 1IBSA 3PHGA 3PX4A 2BPGA 1DC5A 2WFLA 3L4KA 5DGTA 4IXNA 5TVKA 2E1FA 4LNAA 3BE6A 5FLKA 2JFFA 2NT4A 2QMUA 1GEGA 1Z8FA 2Q3EA 3ID6C 5K0CA 1CZKA 3PSPA 2CL0X 4HWOA 8ICLA 3DMRA 4IG9A 3FSRA 1HUOA 3K7EA 3IQDB 2QJFA 4RGBA 3IEMA 1OBOA 2C2XA 3TE6A 2G7MC 1HO3A 5A2QA 2MMGA 1T34A 3TJZA 5HKAA 4TYNA 4NE7A 1Z4PX 3Q1LA 3RAEC 3PI7A 3PHJA 4KE7A 3G0CA 4IMRA 3QU2A 2AIRA 1EVEA 5P8WA 1FBNA 1H69A 1KJQA 3P27A 3M9XA 3PCTA 4MWTA 2J0UA 5JSUA 3NAQA 2J45A 3U49A 2P4QA 2ZM5A 4HDMB 1J33A 4C9BA 5B1HA 3II6X 2I80A 1FYFA 3T4XA 2UVDA 2OPBA 4O2AF 5J2UB 3U3XA 7ICJA 1H0HA 3BIXA 3GRZA 4O4IF 3HBMA 1O94A 2PXXA 5DVZA 3L1UA 1X7YA 2AI3A 2D0DA 1C8LA 3GQVA 1QRUA 3LY5A 1CD5A 4UQGA 2OHHA 3ZHVA 3IAHA 1KJNA 1K0UA 3B9PA 3O8DA 3BGIA 1WP9A 4Z9YA 2Y1JA 2XRYA 2IGBA 2NQ2C 4U2DA 4CIVA 5JVDB 1IHDA 1WJGA 1VCHA 3W5AA 3WNQA 4YNBA 5AI8A 2R85A 1JHUA 1T5HX 1CUSA 1NX9A 2ZE8A 5AIBA 1XN1A 4P0TA 4R1MA 4IH4A 3LSTA 1XLTC 3KD3A 4IOMA 4L07A 1FDTA 4B9NA 2R25B 1I3NA 4JX8A 1M72A 1NW7A 2NO5A 3UQ2A 1C29B 4KLOA 1I13A 1EP1B 1U65A 5DK6A 4ATNA 5BR8B 3KTAB 4I6JA 2YWJA 1KEKA 3AHDA 4U63A 5E0KB 5CLLA 1VL0A 3ORYA 4P3OA 3ET5A 1DQSA 1NW5A 2BEUA 3MWDA 1RMQA 4FE7A 3D9QX 1U0OC 4IMPA 4KVFA 2YN4A 2EKDA 1TQHA 4FC6A 4G26A 4JYCA 5CR9A 2UXDB 1K6IA 1SOVA 3H9QA 1RI4A 4M0AA 4Q24A 3TBKA 3M4ZA 3RYCA 2QF7A 2AX4A 2BVNA 1TFRA 2EVWX 3OQIB 2CWDA 4JA0A 2I6FA 2KVSA 3IDWA 2NXEA 2RIRA 2WWRA 5KTOA 2L19A 3WQBA 4O4JF 1G8SA 4V0SA 4PZEA 4QPDA 5SY4A 4GRDA 4YS6A 5K09A 1W1WA 1YJCA 1HKUA 3D8HA 2JFOA 1RLUA 4UMVA 4M0FA 4ARZB 1LB1B 5K2MA 1NK8A 4BJ5A 1J2RA 3EBOA 1RWOA 3RRHA 2DPIA 2QVXX 2HK8A 4WY5A 4I81A 1NNUA 1ZIXA 3K0EA 9ICSA 4M1MA 4Y2YA 4R81A 4YDRA 5JYBA 1Z5NA 3ZH2A 2IL1A 1BJRE 3O74A 1NN1A 1R6AA 1Y6RA 1ECCA 1YIAA 4F9GA 4D57A 4H3VA 5EFZA 4C7VA 3DDWA 1YB6A 3FKSD 3QA9A 5E7IA 2AU0A 4J6EA 4URFA 4URZR 4IS2A 2MOKA 4E3ZA 3HZOA 1I4TD 1T5DX 4EY3A 4JITA 3TFQA 4V1CB 3O4JA 3TGWA 2Q9CA 1DQZA 3DWEX 4QLOA 1VPWA 4C7OA 3ITEA 2TECE 4AO7A 4UOEA 4J0JA 4NDNE 3DMPA 1TDJA 5GV8A 1Z82A 1XCGB 4N5HX 4LWOA 1QP4A 1K1SA 1JH8A 3PVSA 2TSYB 2WJWA 4XD2A 3RDPA 2O6LA 2CHEA 2FE1A 1WO8A 3PQEA 1K7XB 3EJWA 1H9AA 4IXTA 1PT8A 3W06A 4HGOA 1E6UA 4KX5A 5AHOA 4R41A 4F2PA 4P4NA 2VXCA 3EFOB 1TT7A 2WNSA 3WRXA 3MC1A 4R2HA 2YNMD 3AM4A 4J0KA 5G41A 2PGJA 4JP3A 3RUFA 4F1JA 1UC8A 2O2JA 2R18A 2RGDA 5JSKA 5C32A 2V9ZA 1VCIA 4DVJA 1CUJA 2IH5A 2PJRA 1QOQB 3PNYA 1RZRD 1EXMA 2HBQA 5C5CA 3OA2A 4M46A 5IJAA 1WPGA 2LP4Y 2TRSB 5J0UA 1MC8A 2PZEA 4WZBE 4Y2VA 3I92A 2WA2A 2QM8A 3CR8A 3ER8A 1L8LA 3P9NA 1JYSA 1O3YA 2CLKB 2Q46A 4R2KA 3DT9A 3WWOA 5B6JA 1VHTA 1UT6A 3P4YA 5ENVA 1BQEA 3EZ6A 3ZE2B 4IHJB 2C31A 5DYWA 4G9EA 3CZRA 3GIJA 3LKBA 3C6KA 4QDZA 4K5QA 5F9NA 2BCUA 1WB5A 2YDYA 3NHWA 5CYOA 4JQSA 1EX6A 5I9BA 4EO4A 4X24A 2HMSA 1QIIA 4IIEA 1ADCA 2I65A 2RC6A 3IIKA 4KODA 4N18A 2P6UA 4M9ZA 5FWXA 2FEMA 4RDCA 5FUMA 5KYKA 2OV6A 4TL6A 4GLFA 3UXNA 3N0XA 3FMOB 3H16A 2UDPA 4MFCA 3CEJA 5H8WA 1FBTA 4KHZA 3AB7A 2I66A 2KS6A 2RONA 4LRTB 1NUAA 4HFRA 3CINA 3EFEA 4LF9B 2YC2C 5TX7A 5HR6A 2PT7A 4M9NA 4Q1BA 4IDQA 3FAKA 2FFBA 2QE6A 5J0XA 2AL7A 4HWTA 1U9IC 1S3IA 1JHMA 4K3UA 3ZTYA 1LGYA 1C1XA 1SU7A 3TOZA 1DAIA 1MHTA 1PEYA 3VSAA 2ZVQX 2H3QA 1Z6TA 5EE9A 1LPOA 3ZNNA 5K0BA 2F44A 2A58A 3K0AB 3EC1A 3ZX5A 4RKFA 2AUTA 3G6YA 2NG1A 3TTUA 1ZQGA 4BV2A 1IULA 4LJXA 2E6UX 1PVQA 3O0TA 1YZTA 2QN6A 4N7MA 4WDQA 5LZ4A 1AZLA 1JT9A 2G4CA 3RRJA 3L7CA 1ISIA 1IWPB 1MR3F 4IQTA 2QMYA 5FNZA 5JV5A 1PAUA 3EGOA 2H3ZA 3GJ6A 1XAHA 1C3XA 4YB8A 2C2MA 5B3AA 2G6TA 1QONA 3JPYA 3HRDD 3SF8B 3UAVA 4AZTA 3DKVA 4BZXA 4F2RA 1V5FA 4M8LA 1TGVA 1DUIA 1L5GB 1QU2A 2COUA 4L0DA 1NVVR 1OIVA 4IEEA 4NMLA 1AHHA 3MG9A 5E3IA 4BNWA 4QZBA 1ESZA 1UBGA 1PV1A 1XNJA 2JJ1D 1M1YB 3GLHB 4PBTA 4PLFA 5JH7F 4ESVA 1K97A 1AY0A 2ZU6A 3G13A 4ZK2A 2AS0A 3OPXA 4BJQA 3K9WA 4CGYA 3GCDA 8ICFA 2LVBA 2RBEA 3UGQA 3CEHA 4IGFA 2OD2A 1VSBA 1L7NA 2YB1A 3NOVA 1VP9A 2I3ZA 4LSZA 5G0VA 1OLSB 4G41A 2LBOA 2IYFA 1F5NA 5KFJA 1HT1E 2KFZA 3LHFA 3OHMA 2XDYA 4MLZA 2ZSAA 1A2BA 1YGPA 5IIOA 1NMYA 3EVCA 1YZQA 4BU0A 1DXOA 5BW6B 1QS0A 3FPSA 2DQKA 1E3QA 1NKEA 4N5IX 4NAHA 5DFAA 4OQYA 3SFZA 3L7NA 1X7HA 5IBQA 2VT2A 5HP4A 2FMHA 3OY2A 2UUCB 4WMLA 1NKCA 2OHFA 1GPBA 3OU6A 1B0UA 4FOOA 2VP0A 2HUNA 4S2UA 2OD9A 3Q3VA 3ZI0A 1P3Y1 2C95A 4G85A 2ZS9A 2Q1XA 4GPZA 3BJZA 4CMHA 1VJTA 3DUFB 2W48A 2OYSA 4KLFA 5CGZA 1DWQA 2V5UA 1GDHA 4Q37A 3TW8B 3D1JA 3RUDA 1QYWA 4LF8B 2GWRA 4L5IA 1ZJJA 2I9GA 5T8KC 3R0IA 1NC3A 3AR3A 1YQTA 3PTAA 4E7OA 3LQFA 3AUFA 4BKUA 4G3IA 4LOLA 4HB3A 8ICJA 2AGVA 1HRKA 2NU9A 3O2QB 4EEZA 4UJ5A 2GPAA 1NZPA 5FJJA 2I91A 2GBGA 2YN2A 3L92A 4JZYA 4LISA 1BFDA 4FM9A 3EUWA 1QSGA 1V9CA 1D9XA 4M04A 4B33A 1Z29A 4WJKB 4MA0A 5IKMA 1UPCA 4UUMA 1VKJA 4JXJA 3PQ8A 2PKQP 3PLAE 1P6UA 3UK0A 4Z4IA 1X1TA 1DKRA 5CPBA 2N47A 4XFDA 4LYAA 1G8PA 3V7NA 4PXYA 3BTUA 4LDPA 2A5JA 4PX2A 1CF9A 1DQNA 1SKYE 5A5DA 4U6SA 3QYJA 5LZ2A 4Q47A 4DM7A 4PG8A 1K3FA 4YRFA 1AKUA 1CSEE 1R3DA 4BNHA 4F6LA 4LV6A 4QYIB 2LE0A 1BA3A 1TT5A 2F3UA 2P9YA 5B37A 3LFHA 1FRZA 3ZU5A 5A6SB 1TJPB 1BW9B 3MJSA 3MUEA 3OUTA 5GJWC 4CV2A 1TQ4A 1NV8A 4H35A 1SUDA 4ZARA 3RSOA 4Q3DA 2Q1TA 4TPKA 4R71A 3W5BA 4A91A 3D6JA 1KTVA 3MF4A 4IZHA 5JRZA 5KAFU 1K92A 1B3BA 4QRHA 1E94E 4RZ3A 2I71A 3HHPA 2ZKIA 4DDTA 5IABA 5C8ZA 2HJGA 3G0BA 3NHKA 3LPCA 5FCDA 5JVDA 2ROQA 3VPXA 2BR5A 2YMLA 1G41A 2O8VA 2H54A 2VNKA 2DHEA 4B4VA 3ZDAA 5KUTA 2IPMA 4HL6A 3CVUA 2VHXA 3DVQX 3WI7A 2ZUWA 2P0AA 1BS9A 1QIFA 2QORA 3AZPA 3IAS1 4FNAA 5I47A 2PVCA 3JVIA 2H65A 1LFDB 2J9ZB 3FLEA 3JZIA 3LVQE 1NJXA 1PR9A 2R6HA 3HRHA 5GAJA 5TPZA 4IGKA 3UH0A 5K01A 3IGFA 5EXSA 3JASA 5GZ1A 3S2EA 4U6PA 3SC2A 3WZ2A 2C5GA 2DZDA 4ENSA 1SUAA 1VKNA 2P62A 3JYPA 5FI3A 3VFDA 4QZAA 4ZVKA 3MMXA 4QU5A 1GYRA 1MB2A 3B6EA 4PAWA 4AZ3B 4F5EA 3LUHA 4GOLD 2ZJFA 4KSYA 2WTUA 4BMYA 1WCYA 3DDSA 4TV8A 4Z6CA 2B20A 2HHJA 1EI9A 2M6RA 3IT2A 3CNNA 4FYXA 3VOTA 4P0QA 2EBHX 3C7KA 1MV8A 2NXJA 4MVJP 2BFWA 3GR6A 1QRAA 2BUBA 1NVWQ 5FV4A 5AT1A 2PH1A 1G8KA 2DY1A 4D96A 3QU9A 2GNAA 4GX0A 5FTKA 1H2EA 2QW8A 1M8KA 3D6NB 4PYKA 2OWOA 3TM5A 2PS9A 1CIPA 5B3JA 3LQKA 2JLZA 4FC7A 4OP3A 3MMNA 1CERA 3VA7A 2JZBA 4TWBA 1OTHA 1SOWA 3DVAA 5F9MA 5A3JA 1GSHA 1LPPA 2VJYA 1U28C 3PSHA 1OKKD 4JLPA 1EGHA 3BREA 4MW7A 4R1LA 1LPNA 1N6NA 5L1IA 3OHBA 1JX6A 2R0QC 4AQYB 2G7ZA 1BHSA 4KMMA 1Y5RA 1QWSA 1YB5A 3NXKA 2JGMA 3ONNA 1ZUWA 1QGOA 2A92A 1Z0FA 2DHDA 5F33A 3RTCA 3TUIC 4CQMB 3BIWA 5KHLB 1SOAA 3UUWA 1N6HA 3OUZA 4FTWA 4C5AA 2XYHA 3PZPA 1UODA 1GO3F 2FPOA 4W7HA 5EGNA 1LSUA 4P5EA 3OSZA 4OQ4A 4PONA 4PZ0A 4WOPA 2LYHA 2I6QA 5E9JA 2J3QA 4BKMA 4FILA 3GLKA 1O1YA 2FOLA 1DO0A 2D54A 1SUSA 3BS5A 2PMKA 2AQ8A 3VDNB 4AUKA 1AQJA 4OXYA 1MEJA 1XXHB 4B9UA 3K0AA 3ZU3A 4B81A 5HUJA 1R5NA 1GO2A 1TKBA 1ZINA 3QMMA 5A71A 3S27A 1OQAA 1QG0A 4EPYA 3WFIA 3KDPA 1L5ZA 4J4TA 4FYHA 1XA3A 2MYUA 1BGXT 2I33A 3ISVA 3MYRA 3IP5A 4FOLA 5CH8A 4ESOA 3V8PA 2VOJA 3O8OB 4PWZA 3I3SR 3VX3A 3O84A 5CNMA 2JJ2D 3VR5D 2RH5A 3FLMA 4QHYA 5LWHA 2ZDGA 1XRMA 1UJ2A 3ZCVA 1XJ5A 5IEBA 7ICUA 3L7OA 3IN5A 2YASA 3W3AA 1YO6A 4PHFA 3D5TA 4YP9A 3TSWA 2YQZA 2PO7A 2YZMA 1YR9A 5I4KA 4ZYYA 2OHJA 5CP2A 5JRTA 1PG0A 2XECA 1RJEA 2ZPAA 4ML3A 5DM1A 3Q3JB 5FTNA 3W77A 4RMIA 1UIRA 2Q1YA 4CZ2A 2C4NA 3GCZA 3PUIA 4IHQA 5LXTF 2CXXA 4LWPA 4Q1CA 3A9TA 3BL5A 1SK9A 1TM3E 5K6AC 1DQYA 5HQJA 3V4PB 1WWVA 4D46A 1QLNA 2XYQA 1XK7A 1U8TA 3E0QA 1F7VA 1T2DA 4IHJA 1HA3A 1DBRA 1YJQA 4JUFA 3HXMA 3WLRA 1EWKA 1H5UA 4H9GA 3U1TA 4WQMA 2ZXIA 4GC6A 3HL4A 6REQB 1BHO1 2EFHB 4HN4B 4DDWA 3H04A 3I1YA 2IZ0A 3HWWA 4L9RA 5C1DA 3AEZA 4OP2A 4ZAVA 2EC5A 4H7JA 5KWVA 2QJTA 3DCNA 3H9EO 4RA9B 2DERA 3WNBA 2YWBA 3TE7A 3QW2A 5ALYA 3A6KA 5ILOA 2QZ4A 4AJ9A 4BYMA 4O4IA 2VH1A 2F17A 4RA6B 2YUIA 3UAOA 3BCUA 2NYRA 1JG6A 5KYXA 4UU1A 1S96A 2UZ1B 4J2HA 4GICA 2IH4A 4EG8A 1BOOA 4Z0NA 1G59A 1R6DA 3JPOA 1T5OA 4Y6LA 5C2JB 2PNJA 1S0VA 3A6LA 4GE3A 1LNZA 3CVWA 1WXHA 2Q62A 3NVMB 4KWTA 4EO9A 1N33B 4PGAA 1RJGA 2GESA 4JOBA 1Q1EA 3N39C 4HEA1 3D2LA 5E4YA 2M6LA 3I45A 1P4AA 2G0NA 3B60A 3FMFA 4UUAA 1LTHR 2EW1A 1Z18A 4JJFA 4ZALA 4NS1A 3TRFA 3ZY5A 3N7RC 3PNBA 1Y7LA 2VAWA 3O0DA 5FPHA 4J9RA 4EPXA 1XMOB 1QH8B 4WK6A 1Z15A 2Y1GA 1U8UA 3R7FA 3IJPA 1XAGA 3P94A 1DHTA 2DM6A 2A1UA 1F7UA 3P5BA 4DEVA 4DIDA 4YV1A 3CX7A 3KR1A 3CR7A 2C2BA 4IP0A 3ND9A 3IL2A 2RE8A 1MTOA 5ITZB 3LL4A 4JELA 2PGIA 4LY3A 2HIGA 4F6CA 1DWOA 1Z35A 1OZHA 2HA4A 3HKDB 1P8AA 2PL5A 1ZIOA 1FS4A 3ENZA 4Q34A 3CWCA 2XAAA 2PSSA 1AKEA 3H2IA 3N0TA 4RTNA 3IRVA 2ES4A 3ROTA 1PL8A 1XTIA 2OYYA 4OUDB 2C03A 4I2FA 3BB1A 3LUKA 3QWFA 3ND8A 2FQXA 3BB4A 5F23A 2ASDA 1PK3A 1M1NA 1XHLA 4EJ0A 4PSCA 2VSYA 3WXBA 3P97A 2JAXA 3F98A 2J3MA 4YBZA 5CDSA 1E1YA 2ZWOA 3G8BA 4NLNA 1PD1A 5IJ9B 5JQGA 3V72A 2BLNA 3DOOA 1NJGA 5KFSA 4LCEA 4W8HA 1L7OA 1HTTA 2QKYA 3BSFA 3P2KA 3BA1A 4IINA 1M2VA 4DPMA 2JIRA 5BNIA 2HWKA 2O3QA 3SFVA 5DQIA 1E61A 2AOUA 3T54A 2NMVA 3P0JA 4UJ3A 3RRNA 5F35A 2C2GA 1P2GA 2D2FA 4MPJA 5FDFA 1LB2B 1DAFA 1Z0AA 4EYQA 5HWSA 4FHEA 1LS1A 2ZJAA 3H9JA 3AJRA 1ZQNA 2WHPB 1N1DA 3H0EA 4I4TA 7ICIA 4GZ6A 3GLVA 5TQJA 4P2HA 3C8DA 3F5SA 3WSWA 4A82A 4G24A 3RUAA 1SD5A 3CH5A 4NOJA 5K4HA 2ZIUA 1DK2A 3K9LA 2FX3A 2XEXA 4CODB 1CYDA 1KVSA 2G5IB 1Q3VA 3GNQA 1A9RA 1DIOB 2UVPB 2D8MA 3PTZA 4LMPA 3BQMB 5DTMA 5ANRB 4ZIRA 4PLCA 1EFVA 1RKVA 5JCOA 5CT5A 3ZY4A 1EJ0A 4TVKA 3DG9A 2CKDA 1IXRC 3SR0A 1NP7A 1NVFA 1T9DA 1GL3A 4P8RA 4UPVA 5D85A 5D46A 2RDJA 1OCEA 3AG6A 4Z9BA 5IAAA 1UMDB 3UB2A 3FJOA 1R5JA 1GZ6A 4GMGA 1JJAA 1E8MA 3PWTA 3CBGA 2AYYA 3ZVLA 2XCOA 2AQHA 1Z4MA 1MB4A 2HJVA 2IU4A 2IZOA 3G0GA 3COVA 4POAA 5E0OA 3A4NA 1NC1A 3THVA 1SY7A 3C3DA 2XPCA 4RTLA 4DV5B 3NTRA 4RTQA 2FR0A 2BZ0A 3P9PA 2OBYA 1I3KA 1BW9A 4FBGA 5CHYA 3WK8A 1J39A 1S2IA 3NWBA 4G07A 3H3XA 3O8OA 2GCPA 4PAQA 1W8IA 2C4MA 2FWRA 3O82A 4LK2A 3K5PA 1ADFA 5B58T 3M3DA 3H9CA 2QUHA 3IAUA 3NAMA 1P7CA 1FFWA 1XWWA 5DBFA 3Q3HA 3ZDXB 2OXTA 1W0KD 2CFRA 3JYOA 3FVQA 1KYIA 3MTBA 2PD4A 3SHQA 5HFJA 3KRTA 2R2AA 3DBLA 1AMUA 2HQOA 1EQAA 4YRKA 1VXOA 1GL9B 2QX8A 1A7AA 3AZQA 3MS4A 4BBPA 4KC0A 3LLMA 5C34B 1AMOA 1CR0A 1IEXA 1FDVA 3B3AA 3ILVA 2XZPA 3QF7A 4JIGA 2YFYA 3FIUA 4BNLA 4I5EA 4E5YA 5BOSA 4N3CA 5GINE 2HJWA 4LQDA 3BUSA 5LC1A 4JOCA 4FMBB 4KE8A 3DHNA 3EC7A 2I76A 3C48A 3HA5A 3CRXA 1R1DA 3A3OA 1ZGGA 3E61A 1W93A 4OHOA 4PFQA 5SZJA 2VT3A 3A1FA 1YRLA 3LXMA 4DJ5X 2XCQA 4FZVA 9ICGA 3NRWA 1NN0A 1RWQA 3EXEA 4M0PA 1NSYA 1V3QE 1A5SB 1M2JA 1XDUA 2H4WA 2VRNA 3ORHA 4FFOA 4PGMA 4QGBA 4PS1A 3I76A 1T0UA 1PYOA 1NNEA 1UOQA 2X13A 1XEAA 2O8EB 3MWJA 1XRJA 3JQAA 5K0GA 4HG2A 4IKEA 1UXIA 2JVIA 4Q3AA 1QGZA 3B8EA 3LC2O 4RM2A 3OMWA 2OENG 4IFEA 4D9BA 3NRBA 5AM1A 2IHUA 4JCOA 5BN3B 3BQ2A 2Q6IA 1KS9A 4DZRA 1AKYA 2O1EA 3N86A 3Q40A 4XPIA 1ZCZA 4DV1B 3LA6A 2MMCA 3C1OA 4F3RA 4JK3A 4KR6A 3T3PB 4P3YA 3PQ5A 3LFTA 5IUKC 5JCPA 3M6WA 1FZTA 2QSYA 3RVMA 4BQNA 5HRUA 4HYYA 1AKMA 2J32A 3VU8A 5EQFA 4FZMA 4PQGA 4EGCB 1QCYA 1VBKA 3EGXB 4D4JA 3GFQA 5F9FA 2ZYRA 3C16C 3HUUA 2H4XA 4JUIA 4Y2RA 1K88A 1Z4OA 3I2GA 1KQPA 4PGFA 2NZXA 4DA8A 1AKQA 4TVSA 3O3OB 3PZRA 3O38A 1TC1A 1T8WA 4RHUA 1WZUA 3KZNA 1DV2A 2YFKA 3ZDFA 1H66A 3DEJA 4PSVA 5K1ZA 1T8TA 1KTIA 1OGIA 3MBYA 4B6RA 4CLEA 1IG6A 3AEKA 4WJ3B 1WXFA 2NZ2A 3FFBA 2HHHB 3HYRA 1Z4NA 3FCUB 2BBOA 3EARA 5CT9A 4ZAWA 3QFFA 4H7PA 2EG5A 2I5PO 4IIYA 3LX5A 2XZDA 4I4CA 4TQ9A 3R6GA 4ILKA 2WR8A 4B80A 3BKXA 1GPUA 2VOEA 3HVJA 4OBEA 5IMBA 3N97B 4TRMA 1RKUA 3VU1A 2BEJA 3CLUD 3DXYA 4EYHB 4WBNA 1FSZA 4GKAA 5JAPA 2XNSA 1K8YB 4R66A 1RZTA 2R8EA 3GZFA 4FT4A 1E2DA 3LBYA 4R1OA 4RJLA 1PK1B 2ZIAA 4V1CA 4K9OA 3UUEA 3S1LA 4NCNA 3S8MA 1XHFA 1KEVA 1Z8DA 3DD5A 2JXJA 2M6SA 1JR4A 2Z1NA 1OB2A 4A03A 1ADYA 3GCGA 2GKOA 4FHDA 1EDZA 4ZP1A 5DHQA 5JQGB 3X2FA 1MB0A 5IF9A 1DRUA 4MQ6A 2QZJA 3QBEA 3QVSA 4CI0B 1VA4A 1I10A 1IK4A 3UZUA 2CUTA 1JQ3A 4D44A 4TYWA 2E4WA 1BX0A 1NSFA 2MT9A 3M82A 5HKKA 3AF1A 5IKPA 2VPZA 5JS1A 5CEJA 1LBEA 1N7HA 5GM2A 3AR5A 2AK3A 4PZCA 4F2SA 3EFHA 4EKIA 4IEFB 1JDSA 5A1JA 5KJ1A 4W6ZA 5J59A 2DR3A 3GL9A 1YZVA 3T79A 3I9KA 1Y4SA 4FD2A 8ICRA 3I8XA 1RAGA 1OMOA 3F9RA 4GBED 5JNRA 1BN7A 4Q3LA 3TFOA 3HW8A 2XVAA 3OJOA 4IJUA 2R1TB 9ICMA 4W8GA 3RFAA 2LYBA 1VOTA 4CLHA 4HUTA 5L45A 2YYZA 1NU6A 3HJEA 1DCMA 1X7WB 2OEPA 3GQBA 4ZEVA 3SQXA 1MJ5A 1WSWA 1XDDA 4D82A 2GTPA 5IH7A 2JFQA 1TRHA 4QNRA 3B0XA 2JPDA 4NOLA 2PS3A 4YK7A 1TK8A 1IHYA 2QAGA 2XGSA 3HMQA 4WHMA 5AVJA 1L5HA 1TRKA 1QYDA 3C3YA 4CE6A 3CF4G 4X93A 3WRYA 5J0TA 3A8TA 4RK1A 3G0DA 1KHHA 1RW4A 1YBMA 4UC0A 2ZUVA 4A92A 5A04A 1CQWA 1MFZA 3WLFA 2OO3A 1RM0A 1TU4A 2DUYA 2Z5GA 5A03A 3WJ1A 1JBEA 4BO5A 3L4PA 4G8DA 3NPAA 3RSHA 1V2HE 1U2PA 1XWLA 4P84A 1NA5A 2J3HA 3U3RA 4OHUA 5IF3A 2WJHA 4DILA 5A3VA 2NTNA 3EXHA 5LZ9A 2G5GX 3B5EA 4GYJA 4M1TA 4Y3UA 2ZFUA 1HNZB 1OROA 1HEIA 3B1ZA 1G4AE 4DEYA 3DBIA 4YUYA 2PXCA 2DKXA 1PT5A 3SX0A 5BWBA 3FTEA 3L0IB 4WA7A 3T1OA 1N5RA 2WPNA 4HNGA 2V3CC 1KNQA 3Q2KA 1UKCA 4X20B 3HB1A 3R9XA 1GA6A 2DHCA 5AW1A 1W85A 2LKCA 4YP7A 3S2ZA 1WQ3A 1AHPA 1CUKA 3OIYA 1JW9B 2IS6A 1LDGA 4F45A 3EGEA 3B89A 4X7PA 4JCCA 4ED0A 3AW9A 3QXGA 1EWVA 4LF7B 2FZGA 2IYEA 3OU7A 3KVYA 1RCFA 2WJ6A 4A0HA 3Q41A 2D1TA 3OCYA 2V7QA 3ZK7A 3I1IA 5AFSA 1TCBA 3GZJA 3E81A 3CIOA 4B3CA 4MVWA 1GTVA 3AOEC 1K8XB 3OH8A 3U80A 3R7LA 4EW2A 5LUAA 3URMA 2ET6A 1ECLA 4B9SA 2C61A 4PCLA 4QWEA 4CBVA 3O0FA 1EGQA 1TJNA 1Z22A 4C7BA 4UZFA 4Z4GA 3ZJ4A 3C5EA 4G09A 3MJDA 1JFTA 3A6FA 5BORA 3CS3A 1VSVA 4FFLA 1YT3A 1M33A 5K3EA 2FV8A 4JB8A 1JTEA 2ZJ4A 2Z8YM 3I9OA 2G83A 3X43A 5KYUB 2NUTB 5JW6A 3ENQA 4PSUA 4BTVA 1EH5A 5MHTA 4BLVA 1RXIA 4OI1A 1WU7A 2HPZA 2QSUA 3C24A 3IPYA 2FUEA 2ZWVA 4DQSA 1Z5WA 4WESA 2B21A 5EKXA 1M6EX 1US8A 3GRFA 2VP9A 3AR9A 1OI4A 1RTTA 4D5GA 5I5EA 1CZNA 2GRUA 2E87A 1ZIDA 2JAWA 3LUCA 1W34A 4GG1A 4EJSC 2C92A 2C9ZA 2EZ8A 2QQGA 2BEVB 3JZAA 4FSXA 2HVHA 2WINI 1SVMA 2HU2A 5AW9A 2BISA 2ZR9A 2J67A 1JQAA 4JAVC 4TMTA 3RWMB 5U4XA 1Q14A 4PZPA 5KKNB 2GTHA 2X9QA 2VJOA 4AULA 3JD2A 3KKAA 4X5VA 1JLKA 1ZHHA 2HADA 2ZIUB 1MFPA 3B9QA 1VL6A 2W6PA 2GARA 1U9YA 2JK1A 3BTVA 4ELUA 1K2WA 1D0VA 2IK8A 3F67A 3LT0A 3R7DA 5JRDS 1YHZA 1ZS9A 3QLUA 2JA2A 2YVLA 1XTZA 2C9BA 4QBTA 4DNFA 2MYTA 3GGPA 1EZ4A 5L95A 1Y5LA 3P2EA 2QMHA 2CJYA 1UFVA 2XT0A 2MWMA 2WC1A 3PW2A 2JIDA 3BSYA 3GZ4A 2K8AA 4Y1RA 1L5VA 2IVZA 1SQ5A 5LBTA 5CA0B 3LO8A 4NBUA 4RQBA 1EA7A 2I0FA 2E82A 2R00A 2WYHA 3SZGA 5LJIA 3MWKA 3V7YA 3HNOA 4CQLB 4FB4A 1ZEJA 2HXGA 3I2JA 4UBIA 3UFXA 1OC4A 2VJCA 3N7SC 2W9CA 3TARA 5LP6C 4F86A 5HOEA 3DB2A 1K8RA 3S44A 3ACBA 1WXIA 1U2QA 4JQOA 2PZFA 4MAMA 2JBAA 4BKOA 4GR9A 1A0PA 4HQLA 1GNQA 4OJMX 2KI5A 3NVKI 2PG3A 4Q4AB 4IQWA 5JTIA 2X9NA 1N56A 5F1YA 5J63A 2C78A 2Q8QA 3B6JA 3C6BA 3PQ7A 4JVSB 4MQ5A 2O2XA 1IVSA 1OLXB 5AKXA 3PVXA 4GZMA 4JV2A 2R11A 2Z1MA 5SV2A 1GNVA 5FIUA 2ZJ6A 2C2KA 3EIEA 4B48A 4EG5A 3Q3GE 3LZ6A 1YE3A 4DWOA 1O97C 5J23A 3U39A 4FS8A 4R2XA 5L7WA 1BS1A 2YFHA 1W88B 1TK9A 3LP5A 3Q3IA 3R5XA 3DCIA 5DM60 4QJ3A 2FLKA 4Z0TA 1ULUA 2B8TA 4C7XA 2RP5A 1KKUA 3BGVA 3CLUC 3GV5B 2DFNA 2KK0A 1P7ZA 1T1IA 2IZ5A 5ENDA 5FR1A 1H5QA 4TMKA 1B76A 2GYYA 3JU3A 3P0FA 5F77A 5GOTA 1P3DA 1LC3A 2C00A 4BAUA 5HZHA 3KZVA 2NO4A 2NQ8A 2PM8A 5U4QA 3SAGA 3AOEA 4KAJA 3SKYA 4CTOA 1FDWA 1CS0B 1UR5A 5FR2A 2XCTB 5IUNC 4US9A 3IBCA 4FGJA 1JQKA 3FLAA 2W7TA 2PXHA 4URWR 1AB5A 3T1TA 3VJRA 2DULA 1JZQA 3VTKA 1E0KA 4NEQA 4OQEA 1D8BA 1EJBA 4QUJA 2GUWA 2IY7A 5AJZA 2IWRA 3VPFA 4BP8A 5BQXA 5J2CA 4WCVA 1K1EA 2JFUA 1CY7A 2V7TA 4KU4A 1WCXA 3TDMA 2XADA 3OZIA 3VPHA 5CXQA 3QENA 3SDZA 1RYHA 4RZRA 1YJAA 2GBFA 4H7IA 4XPZA 4EG7A 3AR7A 3TDNA 2VWHA 4HX2A 3MRSA 3ADPA 4EHHA 4K4GA 2ZSIA 4B17A 5JXHA 4NI5A 1LXCA 3K2IA 3UJDA 3OEWA 1ZMOA 1CTQA 2HREA 4LDAA 1DP4A 2DPHA 3A06A 4TKUA 1PFKA 3HX0A 2QSZA 2ZANA 1XCPA 3NKLA 4W82A 5EXTA 3LDAA 2EYUA 2Q8NA 4IIJF 2HMUA 2LCFA 2ORED 2OGZA 4QZHA 5EHNA 1I4WA 2X2FA 1G21E 1Q57A 2ZRIA 4RWZA 3GUCA 3FKQA 2G06A 3ML1A 1J00A 5C4MA 5JYCA 1GDTA 1RQRA 4H3HB 5IVIA 4TWRA 3HJFA 4ZC8A 2QZ9A 3PX6A 4YJ3B 5FBLB 3H1AA 4BCBA 2O8BA 1SIWA 1KU0A 1HUZA 2GDJA 3PT5A 4W5OA 2OGUA 2Y2VA 4TTTS 2PZMA 3LT2A 2XCUA 3PJDA 3P2OA 4XOUA 2OTCA 4LWZA 5DNAA 3NIGB 3OPYB 5CHGA 1QAQA 2P1RA 4QHSA 1IBCA 5CFNA 1DSSG 3JQEA 4ZDIA 3KETA 4QW9A 1KFKB 3PTLA 5EZ5A 2IHNA 3GYBA 1JXAA 1GU7A 2ZTMA 2ZRHA 2WIJA 3E8XA 6ADHA 1D7OA 4IOLA 3QOXA 4JEHA 4OI0A 3N2KA 4L3WA 5F76A 4RQ8A 1ZO8A 2EG9A 3G2OA 2ZB8A 3HSKA 2WJ3A 3HT3A 3SOPA 2DLNA 1J7KA 3R5KA 5KTSA 2DTEA 2G9NA 3H99A 4B8WA 4EFDA 1AO0A 4EFNA 1F0YA 3QOFA 1RPTA 2QN2A 4YPVA 1DX6A 9LDTA 1WKCA 3PQ4A 1N25A 1ND5A 2C5HA 1S89A 2YV5A 4PX5A 1MO2A 1XKQA 5DBOA 2ZTSA 4CN9A 4BPBA 4MWDA 1LDEA 1NVGA 2Z2IA 1HG0A 1L1RA 4PYQA 9GPBA 3WYNA 1WUTA 4JC8A 4LYGA 4WVLA 3PSFA 2ZTVA 5IKEA 1FRVA 4MV4A 3X1MA 1KVTA 2HBZA 4UCXA 4OJQA 4O3PA 3MTAA 3L4EA 1WQ1R 4KVGA 3SV3A 3Q9SA 1G5RA 2IV7A 2Q5IA 2GEVA 2WJPA 3DE6X 1K3TA 4FOSA 3ZLVA 4BE9A 1TOAA 3MTGA 4RTRA 1XZ8A 2ZI9A 5J0YA 2PU5A 3CRQA 3VYUB 2I2AA 3EVGA 1L8XA 3PEVA 3KLBA 3KQLA 4PR0A 4FDLA 1K6JA 4CVNA 5K8JB 3OAAD 4U0JA 2VN8A 2ZJZA 4AZ3A 4HAZA 1ZEMA 2C5EA 3S2IA 4LYYA 4WIAA 2YBDA 2PGLA 1AROP 1Z0IA 3RVPA 3VI4B 4E7PA 3GRYA 5FI5A 3C1TA 1JWAB 1QJCA 1ZESA 2JD0A 4K9QA 4TMXA 4XCVA 3SJBA 2BR0A 1XTBA 3G0OA 3N1UA 4AQDA 2W3SA 1XWIA 1K8QA 3WKDA 7ICEA 1EQ2A 3DE3X 4DLYA 1WXDA 2AEEA 1THZA 3OLXA 3R0QA 1U2GA 4J7XA 3OI7A 1BVUA 1EM8B 3EZNA 4JLSA 4O1MA 3DMNA 5FWNA 3QFCA 4MGEA 2ERYA 4YJHA 1YL5A 1OI2A 4W6QA 2E8MA 3NM4A 3AF6A 3NX4A 1GGMA 4TL9A 2OZPA 1JI0A 1ZN9A 2PMZF 3FYHA 4JBYA 3R5JA 1UUFA 5FEMA 3U31A 4IDAA 1YMVA 2PLNA 4FZJA 1K9VF 3FH0A 1OW5A 4ZREA 9ICTA 1ZJ4A 4DIUA 5I7OA 3F1KA 4TXMA 4EG4A 1P31A 3WGMA 3W7AA 5J2EA 4EBEA 3DF9A 4YHHB 4PSAA 2GA8A 2YXPX 3BGDA 4RE6A 3ROFA 1ESMA 2JAUA 1O57A 2YZ7A 2Q4RA 3UK6A 4OMFG 4ECAA 4LV5B 2D13A 1NUUA 2PO5A 4D9NA 1IMJA 4ZV4A 4BX3A 3SZOA 4BRZA 1KN5A 1VHJA 4C4OA 1KXZA 3IODA 1FS6A 4EFMA 5HDBB 2ATLA 4BQRA 1AGYA 1Q1NA 2ZUDA 5JAZA 4YMVA