3QU7A

Crystal structure of pyrophosphatase from bacteroides thetaiotaomicron, asp13asn mutant complexed with calcium and phosphate
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
221
structure length
221
Chain Sequence
KLKAVLFDMNGVLFNSMPYHSEAWHQVMKTHGLDLSREEAYMHEGRTGASTINIVFQRELGKEATQEEIESIYHEKSILFNSYPEAERMPGAWELLQKVKSEGLTPMVVTGSGQLSLLERLEHNFPGMFHKELMVTAFDVKYGKPNPEPYLMALKKGGLKADEAVVIENAPLGVEAGHKAGIFTIAVNTGPLDGQVLLDAGADLLFPSMQTLCDSWDTIML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Divergence of Structure and Function in the Haloacid Dehalogenase Enzyme Superfamily: Bacteroides thetaiotaomicron BT2127 Is an Inorganic Pyrophosphatase.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
molecule keywords INORGANIC PYROPHOSPHATASE
total genus 78
structure length 221
sequence length 221
chains with identical sequence B
ec nomenclature ec 3.6.1.1: Inorganic diphosphatase.
pdb deposition date 2011-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3qu7A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3qu7A01
4HGNA 3ZVMA 2B82A 3OCVA 1O03A 1Z4IA 4Y3UA 3L0YA 4DWOA 3A1EA 5IT4A 4YCNA 4G9BA 1RQNA 3WGVA 3WKAA 2EARA 3W5CA 5ALUA 2YJ4A 2OM6A 1ZS9A 5AIBA 2R8YA 4KNVA 3KBBA 5AKKA 2B1QA 4HGQA 3R4CA 3BA6A 3ZW7A 2GMWA 3QUQA 1L7OA 3U7EB 3W5BA 5AW9A 4YIKA 5ALTA 4UMFA 5AM4A 4ZEVA 4JDPA 3SKXA 3MC1A 4UW9A 5AK3A 3ZUPA 5JJBA 3ZVNA 4Y2JA 4FYPA 2JAOA 1QQ7A 3QU5A 1YJ5A 2PQ0A 1JUDA 5AW6A 3NIWA 3ET4A 4UM7A 4Y2SA 2I54A 2ZBDA 3QGMA 2I6XA 4YIHA 3N8GA 5AW3A 5AKGA 4BX0A 5AVUA 1RKUA 2QYHA 3A3YA 3A1CA 2YN4A 3PCTA 2C8KA 3WKEA 5A3QA 1RLMA 3SD7A 2IA5A 5ALHA 5ALVA 1RPZA 3EPRA 3U26A 3L0BA 3SHQA 3U7HB 4CF4A 4YH1A 1WZCA 4BNDA 1ZD3A 3OPXA 2YMLA 2YMPA 5ALGA 5AICA 3ET5A 3WK8A 2RAVA 5AW7A 2WF9A 3N28A 1ZD5A 3W5AA 5ALZA 4HAIA 4UU0A 5AW0A 2NYVA 2YMQA 2HOQA 1L8LA 1YNSA 1K1EA 2FDRA 5ALFA 1Z5UA 3UM9A 5ALPA 1Z4KA 4HGRA 2YJ5A 3KOOA 2HCFA 1EK1A 3IB6A 3WKDA 2FPSA 4HGOA 2FUEA 2AH5A 3PDWA 4OHFA 4C4RA 3DDHA 1RLOA 2R8EA 4O8CA 4I9GA 5AVXA 3U19A 2IOFA 3NALA 1ZRNA 4UAVA 1LTQA 3L8FA 5AKLA 1Q91A 2WF8A 5AKJA 3QU4A 2CFTA 2CFSA 4BX2A 1Z4NA 3QXGA 2W43A 3NUQA 5ALDA 1U2SA 1AQ6A 3B8EA 2VKQA 2DQSA 4I9FA 1ZD2P 5ALRA 4AP9A 5AKHA 1T5SA 3QUTA 3WK6A 2W11A 4DCCA 1Q92A 2ZG6A 4NWIA 1QQ5A 4CF3A 2G06A 2CFRA 2HEGA 4H1WA 3MPOA 1XVIA 2OYCA 4UM5A 5AVYA 2WM8A 3AR5A 2I7DA 5FP0A 5AKYA 1X42A 2BY4A 4XOUA 1L6RA 2C4NA 2JAUA 2G09A 2B0CA 2AGVA 4CF5A 3WGUA 2EATA 2IOFK 3AR9A 4XE5A 4KX3A 2BDEA 5AVSA 5IT0A 1PW5A 1N9KA 2IOHA 1T5TA 4RETA 3ED5A 4IG4A 5AI9A 2MU2A 5AI8A 1QH9A 3AR3A 3B9BA 3FZQA 3FPBA 2ZBFA 3KD3A 4NV0A 4BNDB 3B9RA 2YMMA 4UMDA 4EX7A 3UMCA 3N1UA 1YV9A 3ZTWA 5A3SA 2I34A 3P96A 3MN1A 5AI6A 3L1UA 1S2OA 3L8HA 1ZJJA 2WF5A 2RARA 3I6BA 3DAOA 3NASA 3E58A 5AK6A 4F71A 2GFHA 3EF1A 4FE3A 4ZEXA 5AVWA 5AM0A 3QYPA 3ZX4A 2G80A 3ONNA 4FFDA 5ALMA 3L8EA 3E81A 3W5DA 2Q4TA 5ALIA 1N8NA 2ZXEA 4UU1A 4BBJA 2GHQA 5AW4A 1L8OA 3ESRA 2NO4A 5AW1A 4XPZA 1XP5A 2BDUA 2HDOA 4AS3A 4MUMA 1WPGA 2YY6A 1U7OA 4BEWA 2Q5EA 3UMBA 3NAMA 2ZBEA 3KDPA 2P9JA 3WK5A 1QQ6A 5E0OA 1RLTA 1L7MA 1YMQA 1RQLA 1TJ4A 5AHXA 4UATA 2YJ6A 3ZTYA 2Q4RA 3EWIA 4KX5A 4OCZA 4J2TA 3ZU6A 3U13A 4CE6A 3SMVA 2ODAA 1RKQA 2I55A 4ZEWA 4PNHA 2I33A 3F9RA 4L57A 3FM9A 4YGYA 1Z4MA 2GHTA 1RC8A 3ZWKA 5AVQA 2O2XA 2C8LA 3NANA 1RKVA 3A1DA 3CNHA 1J97A 4Y2XA 4UMVA 1NNLA 2B30A 4Y2QA 3RFUA 3OCYA 3S6JA 2B1RA 1RMTA 5AW5A 5AESA 1Z4LA 3SKYA 2HF2A 5AM3A 2HF7A 3WK7A 4C4TA 4GXTA 5AI0A 5ALYA 3OCZA 3QLEA 4DW8A 3FVVA 4F72A 3E84A 1Z4OA 5AI5A 2YFYA 5AKIA 2D2VA 3AR8A 2B8EA 1Z88A 3D6JA 4NAVA 3TLMA 3HLTA 5AVVA 3KC2A 2WF6A 5AIAA 1RMQA 2HSZA 4XQ0A 2C88A 5AW8A 2G07A 5ALXA 5AK4A 3BWVA 1YS9A 2AUTA 4Y2TA 4YCMA 1EK2A 1SWVA 2RB5A 2ZBGA 3VAYA 4KYTA 2W4MA 4NFLA 3PGLA 1Z5GA 4CNQA 3WK4A 4EZEA 3QUCA 5AM2A 3MMZA 1RDFA 4EELA 2FEAA 2P27A 3NRJA 3ZVLA 4Y2YA 4RESA 4Y2VA 5ALEA 3OCXA 4BX3A 3L0CA 3QUBA 1Z4QA 2B8JA 5AVTA 5ALLA 1L7PA 3QNMA 2JARA 5IS2A 3DNPA 3K1ZA 2AMYA 3FPSA 4BYGA 4HYTA 1T9ZA 3M9LA 2P11A 5A3RA 3HYCA 1Y8AA 2FPXA 4NABA 3I76A 3DV9A 4Y2PA 1TE2A 3ZX5A 4KNWA 1VFPA 1LVHA 2WF7A 1Z4JA 2FPUA 5AVRA 4J03A 1XPJA 2FUCA 2OBBA 3QU2A 1WVIA 1L7NA 2R8ZA 3ESQA 5ALKA 4QJBA 4L6CA 3SLRA 1NF2A 3OCWA 1ZRMA 3U7FB 2ZOSA 1U2TA 3L5KA 4MWOA 4UAUA 1J8DA 2X4DA 5AKEA 3I28A 4Y2UA 1YDFA 5T41A 4EEKA 4IFTA 2OA0A 3AR7A 2PKEA 1VJRA 2HHLA 3R9KA 1NRWA 1U7PA 5AM1A 1O08A 1VJ5A 2JAWA 1ZD4A 3N5KA 2C9MA 4EENA 3QX7A 1CR6A 2G0AA 2QLTA 3RF6A 2IYEA 1F5SA 3IRUA 3OTQA 2PR7A 3I1YA 2HO4A 1TJ5A 3IJ5A 3KZXA 4OD0A 1QYIA 4AS2A 2HX1A 5AW2A 2CN1A 3QU7A 2YJ3A 4JB3A 1SU4A 3ZWDA 2R8XA 3R09A 4E88A 5AKXA 3N07A 1IWOA 3AR4A 1WR8A 4UARA 1MH9A 4UMEA 4HGPA 1TA0A 1KYTA 3M1YA 1SWWA 3WK9A 4EX6A 3PGVA 4C4SA 5ALNA 4G63A 2FPRA 3WKCA 5ALJA 4OFZA 4Y2RA 2YBDA 3QU9A 5AKZA 3OCUA 3ZI4A 4B6JA 2WFAA 3GYGA 3L7YA 3SF0A 2GO7A 3L1VA 1Z4PX 3CZ4A 5ALSA 4QQFA 5AVZA 4UASA 4BKMA 1CQZA 2EAUA 2G08A 1TJ3A 3E8MA 1FEZA 3AR6A 1S8OA 2MSNA 3UMGA 3WKBA 3AR2A 4L6AA 1RMYA 5AM5A 4YCLA 1RRCA 2G1AA 2P69A 5ALWA 2RBKA 3EF0A 4GIBA 5ALOA 2MU1A 2FPWA 4KN8A 4BEVA 1U02A 2O9JA 3FGOA 2HI0A 5AI4A 5AK5A 1ZOLA 2JGAA 3J7TA 2FI1A 3L8GA 5ALQA 2WHEA 2NO5A 4DFDA 3U7GA
chains in the Genus database with same CATH superfamily
1PX2A 2BMAA 4QWMA 2ZT6A 3PL1A 5F35A 4HEA6 4BO8A 2HHCA 4LOAA 2ZIZA 3KG2A 3ONDA 4PSKA 1WY7A 3OJOA 5FQNA 2NN3C 4B3JA 4EA8A 3Q15C 2XCSB 3I9V1 1DGJA 1P2VA 4IXNA 2HRQA 2HPZA 3VKFA 3AVVA 3CLRD 3I9V6 5LA6B 5HJ7A 2HYIC 1QSGA 2F00A 3N70A 2Y1LA 3SYZA 2JI4A 5A02A 5CH5A 3J7AC 1H69A 2OQ2A 3D6HA 4CCHA 1ECLA 1PR4A 4LPSA 1B6GA 1E64A 1BX3A 1FA9A 2EXXA 1LKYA 2QMEA 3D1JA 3CRRA 3H6GA 5C2JB 5JZOA 2CL7X 2VWHA 2NOAA 1T2DA 3NBQA 2QZ9A 4HB4A 2KSQA 5J5AA 1V4VA 3IAEA 3DOCA 4CMEC 1I6KA 4NBWA 5FIUA 1HMPA 4BHTA 4FYKA 1BG6A 1NM5C 4TWIA 3H2HA 3BTUA 3M6VA 1FSSA 3RC9A 1MZPA 1MAUA 3VR6D 3EZYA 1H0RA 2DBVO 4GKAA 3X2FA 5HNKA 5I3ZA 4PHDA 4PU0A 1E2EA 2VLIA 4I0WB 4K9PA 4FNOA 4YNBA 5ARCA 2ZT7A 2J30A 2AKYA 4ECAA 1BRTA 3WHKA 4EY5A 5K6RA 4OU4A 2XVTA 4R64A 5DX8A 4UPDA 1GWNA 2XV1A 4R3WA 3BOSA 4YP6A 3DE0X 4UXJA 1Z0FA 2V97A 5JLAA 3ZY3A 2PRYA 2QD4A 4LYHA 2M2IA 3O7MA 2BHTA 1YJ5A 1VSQA 2B2CA 4BZZA 4Z0PA 2V3WA 2CNWD 1BS1A 2P0EA 1NVWQ 1KMNA 5EQTA 1WUIS 1PDWA 2WG1A 4ZI5A 4ETIA 2OAQ1 4MDEA 2VAPA 1IOLA 2GQ0A 1J2TA 2QM7A 3LL4A 3N8GA 2O6KA 5JWHA 2OGTA 4M9ZA 4HY3A 4GR9A 3RUCA 1ODKA 4ZQBA 2Y92A 1TX4B 1AD2A 1LNZA 1YQEA 3HDVA 2K87A 2CD7A 2X7XA 3GV0A 4O4IB 4WFIA 2Q3JA 2QMHA 2GD1O 5GWXA 3L6UA 3VR0A 2G76A 2NAPA 1O6BA 1LC0A 3C8UA 3EA4A 3GPDG 3OQ6A 4QDZA 5HUJA 3VC8A 5ALVA 3EPRA 1P31A 1XZIA 4KP7A 4H17A 1JN3A 3CONA 3BQ2A 2CY0A 3ZBPA 5COBA 2F3TA 2WKRA 2DQYA 1WZCA 8ICWA 2AG0A 5DGHA 5C1DA 1NRXA 2QX9A 1VKOA 2H0RA 2MSDB 3D7KA 3MEQA 1TYAE 1GQSA 2VPPA 3MLBA 3KUXA 4KPFC 4Y6QA 521PA 3VKGA 4EL0A 4NXMB 2GO1A 2UVVA 3EN0A 1GFIA 3VPDA 1PW7A 4AVYA 2HB6A 1N48A 2DRIA 5I3CA 3RSZA 3K20A 3CNOA 4PTLA 4IS3A 2JH1A 4ZAFA 5TARA 2AZDA 2PSSA 1C5KA 3SAJA 2K2QB 5KQLA 1THGA 3CT6A 3HB0A 3H4MA 2FZKA 1SCBA 1QIDA 2P91A 3KOOA 4NBRA 4R81A 3ZQ6A 4X0EA 2B4TO 1Q2XA 4DLKA 4OQXA 4F7DA 4ZAGA 4OGWA 3SQLA 4R2WA 1K5PA 4BXOB 4ALMA 2RCYA 3K6SB 3BD8A 2R8EA 2Q5QA 5KFXA 3IQZA 2RGCA 3N2ZB 3FGNA 4DQ0A 3U19A 4JWTA 5BOMA 1CY1A 1JFRA 2ZRLA 4Q7MB 1VPWA 4P3YA 3NPMA 1XTPA 3I92A 3L8FA 4IXTA 4G4SO 5AKLA 4GPD1 2XDQB 4QQNA 5DTJA 5FO1A 3TLJA 5KYUB 4B3BA 1MC5A 1EUDB 2VOJA 3OCCA 4JP1A 4Z6FA 3LLUA 3U4QB 2AR9A 3LWNA 4RH0A 3DAPA 1YB1A 3IEUA 3KHLA 3P9CA 2GPTA 3I52A 2ACVA 2HY7A 3JD0A 1NXSA 1SA0B 3IP8A 4ZT5A 2CC2A 4LC1A 4JELA 4QZFA 1GTL1 1YZGA 1N1MA 4Y2GA 2CXNA 4JC4A 4DCCA 1I1QB 1O54A 3Q0IA 2ZG6A 2P30A 4UB1A 4Z49A 3CNEA 4REMA 1JDVA 2JGKA 3CS3A 4WN3A 2C2WA 1WMAA 1E7RA 2W6ID 3TTXA 5CA1F 1DE0A 2BW0A 3K8ZA 1XELA 4PHAA 2GK3A 3HADA 3LP6A 4DSLA 2A78A 2P41A 5CHEA 1SC4A 3H6HA 3V4PB 4GDMA 1A9RA 2BEVB 3TQHA 3DCNA 4LF4B 2MOKA 3B3GA 4EY4A 3NOVA 4XE5A 2K7ZA 3HJFA 4M3NA 3O8OA 4S24A 3W5HA 1PW5A 3QMMA 4BQEA 1GNSA 1E6UA 3RC2A 5EA2A 3MTQA 4YRJA 1OFUX 1BCRB 1TVEA 1VKJA 3GZTB 4GPEA 2CEKA 3A37A 5EZYF 2QTLA 1KMMA 1TK0A 4LXTA 1U9IA 2WP8J 3QK7A 3ZU3A 2QG9A 2ERCA 2C4VA 1QWOA 4WD3A 3OJUA 3I9OA 3E4CA 1J2UA 1N5OX 1ZQ9A 2NT3A 3KEMA 4HNHA 4RZQA 3CNBA 3DT6A 2DC1A 4NLZA 2P9TA 3OLXA 4HATA 4P4SA 4HP8A 4EYIB 1KOFA 3UW1A 3ZNOA 5EESA 1WEKA 3MCZA 4MI1A 4MGHA 5IEBA 2KD1A 1NR7A 1EAYA 2FYTA 2C04A 4MQ4A 4M99A 3T3MB 4JXZA 1CERA 4K9MA 4F9GA 4PTZA 1M2JA 1J24A 4TRJA 5IJ9A 1Y4UA 4QG7A 3R3UA 1YOVA 1VBKA 2RARA 2OCPA 1OLXA 3ETEA 1E9SA 3F4KA 4LXIA 1UKVY 4OBXA 4BOYA 4EMUA 3VAAA 5KUTA 4XYEA 3MABA 2WB1F 3W8RA 1CRXA 4DSEA 4PO1A 3SJCA 3WLAA 1W2GA 1JIXA 1EUZA 3DG9A 7MHTA 1I10A 1WOMA 3C6ZA 2PZLA 4JWKA 3UKDA 3I9MA 4N40A 3EG9A 7ICSA 3R0VA 3IIIA 1MXFA 4GF5A 2HJHA 1DKQA 2PD4A 4NBNA 1LWNA 1TU4A 3N2IA 1K7SN 4BNHA 4YYZA 3IHLA 1PJSA 3NC0C 1QR6A 4JD5A 3UWDA 1XMSA 1RPLA 2IYYA 2VVTA 4OKSA 1ZO8A 3CSUA 2C4KA 3HO8A 4Y1EA 3BEDA 1V37A 2GXAA 3I05A 1UC9A 1KI6A 2BCRA 3C3WA 3DDUA 3NI2A 4BQPA 2P2NA 5KFOA 1ML3A 3HHPA 4QUEA 2OG2A 2VKTA 4D0LB 1C3VA 1ZOPA 1RJ9B 3DOEA 4TVBA 2W9XA 5CM2Z 2BGNA 2YJNA 5BT9A 4JV5B 1O6CA 3RVJA 3SE7A 2O8CA 3MLEA 1P9WA 4L8LA 4P86A 1OWOA 2YVLA 3K15A 1EUCA 3LUBA 3QBDA 2H16A 5E9JA 5J0PA 2P9JA 1G17A 4YB8A 2QAGC 1N2EA 1O95A 4DFMA 3U1TA 3PQ8A 3GW8A 4B7ZA 3AL0B 1S9HA 3FI0A 1QV7A 1L7MA 5J8YC 1W85B 4D43A 3W4KA 1U5BB 2Q5JA 5AXCA 5LWHA 2PUHA 4M9JA 3CE6A 1Q19A 3U13A 3G89A 4HB2A 3G9QA 4LZGA 2B2XA 2OZPA 3D59A 4AC9A 4A2QA 2HPAA 4W1QA 3SM3A 4CM3A 3R74A 4PIPA 4C8MA 1TVKB 2XR1A 3MUFA 2B94A 4U2DA 1O6GA 5BVHA 1WLYA 3NATA 2JIZD 4TS1A 1D9ZA 2CXXA 1I1OA 4R63A 2ZI3A 5CVTA 3F2BA 1U47A 2HAEA 4KLFA 2C8LA 2B1IA 2HGSA 1TMYA 1DC5A 2ZS9A 2II6A 1EXNA 3KQHA 3DB2A 4C78A 1WETA 3OIYA 3HL0A 1KEEA 2F62A 4Q47A 3OLYA 5HQ3A 1THZA 5IANA 4ENVA 4CL2A 1WDWB 5IKEA 1ADYA 1O0CA 5AM3A 3I4CA 5GIOE 1G8FA 4DCJA 1C3JA 1UFVA 1NXTA 2PUTA 3R41A 2C2HA 4FBLA 2AX4A 4P98A 5GM1A 2R8OA 3K4QA 4RGYA 3FVVA 2GNPA 3T4PA 1PHPA 1WB5A 5K03A 2CF5A 1E9BA 4B4OA 3AY7A 1LJUA 5DE3A 621PA 4MB0A 4BGVA 5HM6A 1F1JA 5JSFA 1QCCA 3AOGA 4Z1OA 3MWKA 4XQ0A 5EHXA 1V3QE 5COQA 1DQZA 5IJXA 3RRYA 5EJAA 4GI1A 4EG4A 2BUBA 3SJUA 2EFHB 3GA0A 1PEKE 2EZZA 3LC0A 4WKBA 6ADHA 1PYGA 2YVQA 1RADA 4K6HA 1RHQA 2OXIA 5KX5A 4INPA 1L5MA 1UM9B 3FNHA 2JR5A 2A2ZA 4Q93A 3I2YX 5EKXA 1Z5GA 1MA3A 2GHRA 3WK4A 1WJGA 1ZIDA 3GIMA 2NLOA 3IUEA 3Q9LA 4K40A 1MQAA 2VDNB 4KQHA 2ZB2A 3SXJA 4WAUA 3ZHQA 2H9AA 4CUZA 5K09A 1AB5A 3AVUA 4O4HA 4MMXB 1JU9A 1R37A 3EOBI 3MR6A 1PR9A 1GRNA 2OBYA 3LV8A 2ZSAA 5KQSA 4NPCA 4ECSA 2I2XB 1RVV1 2B8JA 3D8NA 1FW6A 3PPXA 3HRKA 4YACA 5AOCA 3ZE0B 2IVFA 1QQBA 1Y81A 3QNMA 1X1TA 1JVSA 2LKYA 1JPJA 5KYXB 4S35A 3F53A 3M81A 2XCUA 4Q15A 5DDIP 5BPHA 4LFBB 5HCIA 2GTHA 3JSAA 1O58A 2QNRA 3VPAA 1SXJC 4QWWA 4P08A 5C37A 3KYBA 3V1YA 3QOWA 4G8BA 4R2XA 3PC7A 4RA6A 4W6QA 4PICA 3UMYA 1G18A 3Q0TA 4Y0VA 4RIEA 3SHOA 1JJAA 4TYYA 4KNWA 1VRVA 3A26A 2OFFA 2X6TA 3UICA 2Y4NA 1VFPA 2A6PA 1CEZA 1HDEA 3GJ8A 4BBPA 1WABA 4E5NA 2V7WA 3ACCA 4K6CA 2VF8A 1G7RA 3HVRA 3NGMA 4MHSA 2VJOA 3JARA 3PDHA 2GLEA 1R10A 3WIVA 1N5KA 2V6MA 3LUHA 3LFHA 3Q7PA 4KLJA 1NULA 3BGVA 3F4LA 3R7WB 3IG5A 1EDZA 4FFNA 3LYSA 3AHCA 3D02A 2QOEA 1EIZA 4CL0A 1M1YE 2VK2A 4GRDA 4I4LA 1KVSA 4MVJM 4TS9A 3TBFA 4BVEA 5ARBA 1CUDA 4LFCB 2GZ1A 2O3QA 3EK2A 2GCPA 2GN4A 3PKZA 1U2EA 3PV0A 5TV2A 3E3LA 3IKMB 1MJ5A 3X1ZA 3QNUA 2JIRA 2F64A 2I6QA 3N3AC 3FX2A 4QWBA 8ICEA 1EBUA 4MA5A 4ZO4A 3RKSA 1X7XB 3I6QA 1U0FA 4JJ4A 4N54A 2WTMA 5K3EA 2A1TS 5GJBA 4XWTA 5F5LA 1TQHA 4F2SA 2YVKA 4M0LA 4MVJA 3RRZA 3RUFA 2HNKA 2I1VB 2JGNA 4Q34A 3KTFA 1VI6A 5FOSA 2B83A 5HQJA 1ZGJA 1L8AA 2PX2A 3N8KA 4MRMB 1CBUA 1ZI9A 4MLZA 4RADA 3JPPA 3RJ9A 3CGWA 4US8A 4QZBA 2FJPA 2IFTA 3V97A 2AFRA 3WI7A 1IN6A 1R8SA 1TL7C 4ML3A 4MUAA 2XKJE 3KV1A 2D5AA 4BNFA 4DWJA 3THYA 3GF4A 2FG6C 4B9EA 5DQGA 2PUEA 4M7OA 3FWHA 3TFSA 4MFCA 1XRQA 2DR0A 5TMBA 3OAAA 1GKUB 4QGAA 4EENA 5BUQA 1T9GR 3UWPA 4UOEA 1L2TA 3LQKA 4NCKA 5HR5A 1XN4A 1ONPA 1R9JA 4IHAA 4ND6A 4PGGA 4B3CA 3RRJA 2CLCX 2RSLA 3L77A 2O3SA 1HQDA 2BHRA 1QVZA 1TJYA 3AUUA 1KKUA 5DH9A 4L50A 4KAAA 2ZRAA 2L5YA 4KQIA 2J0UA 4LQDA 4G0OA 5IAGA 3FHJA 3FZEA 3PPVA 1S89A 1VL8A 2FFJA 1TM4E 3HEMA 4FWBA 3Q6NA 3V7WA 4N3NA 4S2UA 4D97A 2ZE7A 5HBRA 4D3FA 2PUWA 5DMHA 2DKXA 1ZRHA 2EAPA 4XUSA 1ZYUA 3B36A 4HDMB 1KZ9A 4ARSA 4D81A 4J0DA 4FZJA 3FMFA 4JGIA 3TW0A 1H9CA 5KG2A 3AGPA 4BMNA 4KU4A 4ZVSA 3WJAA 5KNCH 3DDNA 2RG7A 4IMPA 1UJBA 2QD3A 3LW8A 4MAFA 4XQ9A 3GVXA 3IRVA 1ISMA 2X4IA 1Y8ZA 3HYTA 3HN6A 3MRVA 4MW5A 3SI8A 4TV9B 3RW9A 1IV8A 1JHVA 2JS7A 4AY4A 3QJ5A 8ICBA 2WK1A 4YCDA 3RS4A 3GMTA 1B00A 1WZEA 2YXBA 5A71A 2ATVA 2ORED 5A7GA 4FE4A 2KFNA 2B36A 2CJYA 5DYGA 4EYGA 1II8B 3ZGXA 2AQKA 1AGNA 2MSWA 3H5AA 4L9WA 3OFND 1JKXA 2A1UB 3UCEA 5CVVA 3WA7A 4DR3B 4EO7A 1QFYA 5IIKA 2C29D 3E1KA 3QVSA 4G23A 1WIWA 2QN9A 4TZ6A 3HVHA 4YRIA 3CJQA 1EGQA 3KE8A 4L27A 5G53C 5B1DA 1T3SA 2IDMA 8GPBA 1YB4A 2CHVA 2V1UA 3F2DA 1GPDG 2CNKA 2O3RA 2DP4E 1U02A 2ODPA 1SUCA 3K53A 2FRDA 2Y99A 4TTQA 5LKAA 3AKZA 3L02A 4G5FA 2QX4A 3GCGA 2I6UA 2OLJA 2VK1A 3NONA 4WCFB 3G9TA 3UK0A 3HPOA 1M76A 4OQEA 4QTUB 1ZOLA 1S0MA 1N8TA 1PBNA 4KLHA 3HN7A 4G8JA 2BCUA 3SQXA 4Z8YA 4NYJR 4Z9FA 4MS1B 2HHQA 4MQFA 5K3FB 2WHEA 1HYQA 4C6TB 3L79A 1E1LA 1UR5A 2M6SA 2YDXA 4H1UA 3BXHA 5JTUA 3ZCQA 3GVIA 4OHOA 4YAUA 4PYIA 4I2BA 5IVPA 4A6XA 3U0VA 1ORDA 1YHYA 5LYJA 1QM5A 4X24A 4MUYA 3A10A 4REOA 2J07A 5JNWA 2K8CB 3ABZA 2PVCA 4RU1A 2CVPA 3WX0A 4ZODA 2R00C 2SKCA 1W48A 4UE6A 4ZMSA 4JQCA 1C14A 2FW7A 1WHSB 4U2KA 7ICOA 2EARA 1RRFA 2GBGA 3W5CA 3NHZA 2Z6VA 4ED8A 4N76A 4JH0A 2GILA 2VEDA 3T7IA 5CDFE 2F4VB 2PUVA 2WU8A 4EY7A 2HFKA 2QEQA 3VVMA 2H3ZA 3R24A 2QV7A 2XCIA 5D84A 5DIFA 1ILEA 1W46A 1FVHA 2IHUA 3GIJA 4ARZB 5HZMA 3AOEC 5TRTA 2C5GA 1ZQKA 1Q8KA 2WIFA 1VA4A 2PT7A 2IIVA 2H5LA 2DFTA 4BFVA 1ZESA 5AUPB 2JI6A 4FZLA 2YV1A 4P31A 1E1DA 3ZVNA 1EFLA 2HQSA 4I4TA 4K8OA 2ZYIA 2OGZA 4HDSA 4C29A 3KETA 4Q39A 3GLIA 1OXXK 1QQ7A 3QU5A 1XBTA 3OX2A 4KXUA 2YNMA 1QTRA 2LIPA 4S05A 4OLJA 3N2KB 1QRAA 5AW6A 4X97A 1Z25A 1HDGO 3TK1A 4OHCA 4Y1RB 1Z15A 4UM7A 5BOVA 4Y2SA 4WPGA 2Z9BA 2I6XA 1FW8A 1JQJC 1WD5A 1B8OA 2WIGA 3CLRC 1ZDMA 3GNLA 3LC1O 1DVRA 1BDIA 2GPJA 4M47A 3C87A 2FZVA 3UJCA 2QYTA 2XQKA 3PTLA 5DWQA 1KR5A 3KKLA 5F1OA 4YGXB 4JUAA 2XF8A 4BWJA 1PFQA 3GT3A 1EP1B 2NO7A 3EFBA 4ZPXA 1A5TA 2FSFA 1A76A 1PFGA 4IXDA 4BVLA 2P4HX 1KL9A 3BBLA 3PPYA 1V7CA 3TLKA 2DY1A 2YXDA 5DGTA 4IOKA 3F1KA 5FI3A 2XRMA 4TQGA 5E9AA 1RPZA 3DTVA 4LHXA 2PUGA 4KNYA 1Q7CA 4CF4A 5A3JA 2J32A 5SYAA 4MW9A 3RHTA 4MW0A 2V58A 1NU8A 4CRWB 4DV1B 1EVLA 5DNYB 2YWJA 5KKAA 1A27A 4QUJA 1U5CA 3TS1A 2UZ0A 4J1NA 3B3FA 4NQZA 4KIGA 1RTKA 3W5AA 5ALZA 3O47A 1MQ9A 1UPXA 2A94A 2JLYA 1NVTA 2YB4A 1CP2A 2X0NA 8ICVA 3DVQX 1T2AA 3AM9A 3WQQA 3OZRA 3T8YA 3L4KA 1DK3A 2H7CA 2IX3A 1DCTA 4LJXA 2XGGA 3Q9UA 3P94A 3BCUA 2AOUA 1RAIA 1Z36A 2MA1A 4GO1A 3TB6A 1R4NB 1XEXA 3VNQA 2NIPA 1R9MA 4O5EA 5IKOA 5KX5B 4TV8B 1U9JA 4OHWA 3QX9A 2Z56A 2YWCA 4TL7A 4DB4A 2EQ5A 3PO5A 1HV8A 4CFSA 1DTEA 3KZCA 5JQGB 4FFBA 1ZSYA 2Z5LA 3F1LA 3MIZA 4EJ6A 5HOQA 1ZQUA 1L4YA 2OG1A 4UB3A 1R0YA 1LK5A 3O83A 3K0FA 2J3MA 2WKSA 4JB0A 1NMQA 5KFDA 1ZFNA 2Z8XA 3KKKA 2WT4A 3UK1A 4KIUA 2DUYA 3AI7A 1UAYA 3PQ3A 1S7GA 1VP3A 2A9QA 1CE8A 1QG6A 5EVCA 4TZ0A 2BFEA 5CBPA 3TRHA 1OBFO 3LDAA 1I3CA 2V9ZA 2G9UA 5EJ5A 4CMKA 1ZM7A 3UH1A 4RHTA 4E5MA 2J08A 3D1LA 3T5TA 5L4SA 4ACBA 4JYZA 3BHMA 3D0RA 3QBEA 1E5QA 2OHOA 2ZJ3A 1KP2A 2O7VA 3LUJA 1FPQA 2C20A 1HGXA 2RGXA 3KEOA 4DWWA 3CRZA 1AURA 4FZ3A 2UDPA 2OYCA 3JVEA 4NXNB 1YASA 1U3WA 4AJNA 2XXBA 3QA3E 4FIDA 4R51A 4RACA 5KTRA 1ULBA 5IZCC 1OZGA 3FDZA 1N2GA 1EEXB 1ZM2A 3VU3A 4LVSA 2ENUA 1PT5A 4X8MA 1DFGA 5K1ZA 4BLQA 4JFAA 3TACB 5CLHA 1WXFA 4CF5A 1KFKB 1Z39A 4Q9IA 1TF7A 2HXYA 1KU0A 2W55A 5SYNA 2KG5A 1OGIA 2WSSA 3F97A 1ZCBA 4FW9A 5BQXA 5L45A 5LOVB 1T0BA 2FEWB 4JNKA 4ALLA 3IH5A 2EFYA 4MQBA 4E03A 1WSWA 4YRLA 3SEZA 1VA5A 3TM4A 1DUIA 1HE3A 3AQIA 2IU6A 3IV7A 4HLUA 4KJZA 1AN9A 4N8EA 1ZNXA 2RAFA 3EDCA 1S01A 2L2QA 3CH4B 3F98A 3RS5A 4CODB 2EKLA 1HQKA 1JFSA 2IYSA 3GLGA 1TKBA 2KWIA 3SYKA 4NU6A 1HL3A 4RHUA 2IBKA 2QHXA 1MIOB 2HH9A 4L3OA 1HM5A 9ICHA 4PL1A 1P7CA 1E0SA 2PX5A 2QVGA 4HMQA 3ZIAD 5KPJA 3ADCA 1G8SA 1P72A 3GRVA 2OHJA 5EIXA 3T4UA 2HTFA 2LPEA 2IXTA 5AI6A 3OM9A 1MC1A 2ZI4A 5GZ1A 3KSAC 5KFIA 1TM2A 2TECE 2VF4X 4X61A 4ADSG 4UUQA 1IM5A 3GJ4A 1VCMA 2DPJA 1VRWA 1RZUA 2VSOA 4WOPA 1U6KA 4JSYA 4WLVA 3ZZNA 3ZDEA 4CPDA 1M2NA 3BE6A 2MTBA 2YYYA 4COKA 2QE6A 2WAAA 2QTVA 5GGXA 1WMSA 3O3NB 4MWCA 4PXYA 1K5HA 4RK6A 2WWFA 3O9MA 2WIDA 4PPYA 4UTVA 5I4CA 2PSHA 2FMSA 4GLOA 3ROPA 2GXQA 3W8NA 1A4XA 4EG5A 1QLNA 3IHWA 5B53A 2ZETA 1AGPA 2QE7A 2FFQA 3C4QA 1EX7A 1KJQA 3K92A 2PZMA 2WW8A 5ALIA 3EFOB 3PQ6A 5THXA 3SYNA 4MJXA 3WL8A 4GR5A 2EKQA 3O2SB 1SZDA 1Z0JA 4RS4A 4WNAA 3E7DA 5JD4A 1JPVA 1VLJA 2DJIA 7ICKA 4MV4A 2WD9A 1TO2E 1G0OA 1PKXA 1Y7LA 2OZKA 1X1RA 2YZ2A 1YU9A 2QSJA 1LFDB 2YJTD 1P3DA 1CHDA 4X1KA 2HHWA 7ICVA 1P4GA 3THRA 3ZHUA 3DOFA 5BMVA 1ZMXA 2YY6A 2ODWA 1VLZA 2D4HA 4U2GA 2IV3A 5T4HA 3IDQA 2AB0A 3DVAB 4UCFA 5C1PA 1OH6A 1CS0A 4QRDA 2V45A 2GNOA 1ZINA 3VR6A 4IJ6A 3DYIA 9ICTA 2IBSA 4G25A 1QKIA 4RQ2A 5KNIA 1JTVA 1D09A 1RXYA 4DA8A 1IHPA 2ODBA 1EH5A 2FZ5A 4HNGA 3DOJA 4R0VA 3LK6A 3A2LA 5JRJA 1AS3A 5TQ2B 1OR8A 1GXSB 1ST3A 4C6SA 1JFVA 4YRGA 2MHCA 2PYZA 2GDJA 3C48A 2Q07A 4JQSA 3AHJA 1F2VA 4JJIA 3GRKA 3C3MA 1C3EA 1UXIA 3OJFA 3CEMA 1NXQA 4YMTA 2Q50A 3MWEB 1NBHA 1FLAA 3LKZA 2MUTB 1ODIA 2H3IA 3BCRA 1ZVKA 1LQ2A 1MSWD 1OLUA 3RB4A 2IYUA 2X7JA 5LBUA 4XAQA 4X1IB 1A4RA 1YVDA 3TXAA 2QI9F 3OHMA 3C4VA 3JWPA 1QWSA 4KIFA 5EZYA 2Z4RA 3DF9A 2C9BA 1L7QA 2VJBA 5EJ2A 3HJNA 3CBGA 4ZO6A 5HSGA 4TTRA 3TIFA 1N78A 5KYKA 1IK6A 5BOSB 5TS3A 4EW6A 3ROFA 1ZBQA 1ZPDA 4L2IA 4HNVA 1NSYA 5AESA 2WE8A 1GUFA 3M34A 4YT4A 1J2YA 3A6PC 3Q3VA 3AMZA 2XNKA 4LHWA 1BD3A 4BP1A 1Z1VA 3H7AA 7ICEA 4LXGA 1QTNA 1DWUA 3M6WA 4I5FA 1N75A 4TKLA 1O8CA 4NU8X 3NCTA 1IBSA 4L6IA 3TLCA 1SV0C 2JZNA 3QIAA 3ROKA 2AN3A 5DEOA 2VZ8A 5B1HA 2XADA 1X0XA 2P2DA 3DOUA 3TLYA 4BU1A 4LJ6A 1LV8A 3F6RA 4HZUA 4PSCA 5DYWA 2COUA 5CVDA 2ASVA 1FTGA 1JHPA 1K2VN 4K0RA 1QXSA 1EGHA 3G0CA 1MB4A 3PUJA 1I7PA 3WJ1A 5IZ4A 2XXAB 5KAPA 1AUPA 3PW0A 2W4MA 1GTG1 1AO3A 2V0CA 2WBLC 1I5EA 3DE6X 2XPCA 3D5QA 2C3YA 4NFLA 5L6LB 3V8NA 1JVBA 5JPDA 1R74A 3I6YA 4HQ0A 2IHMA 4FGJA 1EFHA 4RJJA 2BD0A 2GT1A 2P2CA 1T6BY 3IUJA 3LCVB 1N63A 1LB2B 1Y4DE 3IYLW 3LY9A 4LDAA 3K96A 3EDYA 1K97A 4YMHA 3VZBA 1U0RA 2DFLA 1AZTA 1QIEA 3NXSA 4RGQA 1JI0A 3AH8A 4JLKA 4K9LA 1RHJA 4BQQA 3PNBA 4HWTA 3U37A 3GD5A 5F7ZA 3ZXIA 1G9XA 1EX9A 1B8PA 2ZUVA 4I2CA 3IKVA 3K2BA 2Q0XA 4FHDA 2C59A 3AU9A 3LPDA 4ZQHA 1NNSA 5HDQA 4XWWA 5KVCA 1V16B 3PQDA 2QN6A 1L4GA 1MGPA 2YV3A 2DFKB 4GFDA 3KK0A 4Q3LA 4X6XA 4XDYA 5CX1B 5L9XA 1KFTA 1XTVA 3C4JA 4AJPA 1YFKA 5LQDA 3LXXA 1QHGA 1M73E 2FZEA 2IYPA 2VEOA 1RHUA 1XWWA 3O4FA 4MVXA 1FNNA 2DUNA 2ZTHA 1VL6A 3N2GA 4TSFD 3ZX5A 3WLEA 1NZBA 1B16A 1NVFA 4IIEA 4D9JA 5A5FA 3GU3A 4MHVA 2QYSA 4QSMA 3V2HA 3G6KA 2VHTA 1Q17A 3SBOA 2M32A 2ANCA 4PZEA 3TFQA 4UPEA 3MGBA 3W1WA 1XTQA 3ZEIA 2QAIA 5EP4A 1PU2A 3DONA 4RQBA 1W4ZA 2CLEB 4MGIR 2FPPB 2O2JA 4NU0A 4I2AA 5EWFA 4KOEC 2ZQYA 3KCQA 5HX7A 1OFVA 1GQ2A 4ZP1A 4AUKA 4AUMA 1ZJZA 4ZJPA 2P67A 3IBCA 3EUB2 2RDJA 2HYDA 4FUTA 3K8YA 4YC7A 4A8JB 5LSAA 1EWTA 1RI1A 2CXTA 3W2TA 2GPBA 1NW6A 5E3HA 1JE0A 2EWMA 3DMTC 4JB2A 4ZAVA 5K6AA 1MKYA 3N7SC 1J39A 1YQDA 2H9IA 2O23A 4JFRA 4Y1GA 5HF6A 1CU1A 4R8UA 2J59A 1GAJA 3DQPA 1NBEA 4E07A 3S40A 3OJEA 5BN1A 3WMGA 4IH4A 4PL2A 1OLSB 2C2GA 5HGXA 1Y8CA 5JD6A 2XSZA 4GBMA 3ABOB 2GESA 3GL9A 2PNFA 2R8HA 3OPYI 4DQLA 1NASA 4NFSA 4YROA 1LC3A 3UXYA 1PE0A 4OXXA 3CUSA 3QE4A 4M0DA 5DBOA 4AZWA 3JASA 3RRXA 4DA4A 4BKOA 5TISU 1N5IA 4I1SA 4W4TA 3JVIA 5AM1A 3WGNA 5B66U 3WRXA 1OB5A 1ZD9A 1S2LA 1ZD4A 4RU9A 2PANA 3BILA 4G3XA 2RGGA 1XD8A 4KZPA 3VPSA 5HZKA 3KHHA 4P0QB 1ZK3A 3COVA 4WACA 5COAA 3VPHA 4OLAA 3QPDA 2ZJFA 3SNKA 4J0QA 4M6WA 1C4OA 3KJGA 3CA8A 3LHIA 3LQ4A 4A1FA 4BVFA 4AMVA 5JAMA 1RAEA 5AJHA 5K0GA 3H2BA 1C8LA 2JBHA 4M8IA 3AP3A 3U4DA 3M6IA 1C9YA 2DSNA 1SKRA 5CYGA 3JQ9A 3EEIA 2ZUFA 4D0RA 3C39A 5K0EA 2I66A 5J2FA 2HR1A 2V8OA 2PM8A 3M1LA 4HDRA 5B5SA 2JFWA 3U7IA 1QF6A 2LHTA 2XGSA 4XUGB 5CU7A 3OOWA 4B4DA 5AR1A 3SIRA 3TXYA 4F3NA 1VHDA 1WR8A 5K8LA 1GAXA 1FJHA 3ZCRA 4MLCA 4JS0A 1EVZA 4P3XA 4RPXA 4ED6A 3QVGB 1K63A 4DF8A 4PQFA 2HMUA 3ONWA 3RHZA 5JADA 1G20A 1N5RA 3R23A 5LOVA 3CT4A 1YB5A 1KH3A 1IB0A 1QHHB 2LKDA 3I0ZA 3RYCB 1Z63A 2ENWA 3SSMA 4F97A 1LW7A 3QP9A 3RJEA 5HF9A 2XE6A 3D8UA 3MAJA 3NHWA 4MV3A 4OFZA 5H80A 4C01A 3QG5A 3UMJA 5I9NA 1JIIA 5G0UA 3DEAA 3LW7A 4D8YA 3U17A 1CETA 1JXOA 4G85A 5A4IS 1NQOA 2O57A 3WIOA 8MHTA 3A6FA 5LA6F 4Y6SA 5F33A 4BO7A 1BXZA 3WSVA 4CLHA 1PUIA 4QQFA 3EJWA 4I1YA 4FGWA 2BUCA 4YXFA 4BKMA 3MAGA 4Q48A 2JRZA 1HKHA 4J9NA 2GB4A 4DOBA 3BQ9A 1I2CA 3H18A 5IC4A 3KPJA 2G9QA 4D7AA 4L08A 3HV0A 3ICCA 1A97A 2BMFA 5I7EA 1Z35A 3ECCA 1YT5A 5L7TA 4AP6A 3VHQA 1I80A 1IBRA 1BCSB 1NSTA 3DQZA 5KYVA 5DO9A 2DLNA 2I9PA 2B4KA 5DYIA 5FL7A 4YUYA 4NL4H 2RJOA 2BOVA 2NWQA 3A1VA 2KTQA 1H05A 3FJ1A 4YT5A 4AQ7A 4MTCA 4LYDA 3ERCA 1YKFA 2Q29A 1KY5A 3TN7A 4KQWA 4H60A 4YAJA 1QHSA 2VDUE 3MBIA 2QJWA 2E21A 1DJQA 1E1CB 2HCBA 2WMOB 2WQ7A 4QOFA 4CEJB 2NTNA 3D9QX 1V3UA 2COKA 4FFRA 5EGNA 5JVDB 5FWXB 3G9XA 5DDYA 4HTFB 1RRVA 2VSNA 3GBVA 2IHBA 4OOFA 2IPNA 4HF7A 4NH4A 1L6IA 5FOUA 4LOKA 2AW3A 3R9WA 3RAFC 4IJWA 2PKQP 3HA7A 4CI0B 2QZJA 2P9CA 2RJNA 1DQYA 2OHFA 2JZCA 4KBGA 1AQUA 2MYTA 4Q4LA 2FAXA 4WL0A 5KC8A 2WU0A 4I1OA 2AX3A 1TLLA 2XMCA 2GERA 2OP1A 4DWOA 2B5OA 2KE7A 2Y1DA 2YB1A 2IW1A 1H38A 1C1DA 1QOPB 2E82A 1WQ1R 2XNSA 3DEHA 3HFRA 3OZBA 3PR1A 1CQIA 1PNOA 2XBLA 4C87A 2CXRA 3IJPA 1ZVMA 4RIFA 4C4YA 4NFYA 1XLVA 1CKEA 2H4JA 1P7DA 1KEZA 5KYWB 3CY6A 3A9VA 4RGVA 1NDHA 1N33B 1E7MA 3ROQA 2L42A 3UV6A 4DIBA 5KT7A 2DPXA 3OMXA 1ZUWA 3GPLA 2JI9A 3F3KA 5LQCA 1W19A 1ZQLA 1ZQMA 3I09A 2Y0DA 3U7EB 3W5BA 2IT1A 2QL9A 2D5BA 4H3KB 3ISVA 3WRYA 3VHXB 4OYLA 1UFQA 2WJ6A 1R0XA 4M2LA 3V33A 5HPYB 4FOOA 1KXJA 2RHGB 3U1BA 3HT3A 4F4ZA 1L7EA 4INZA 4UW9A 1EGMB 2XSZD 4K6OA 3GVCA 4R9SA 4KQ1A 3J81A 1QYVA 2XECA 5HCNA 1DXQA 2ZEJA 2OXOA 3UVEA 4KPUA 3I12A 2F3PA 2JDIA 2Y9TA 1GV1A 4JHLA 3SV4A 5I45A 4M88A 4H1VA 1GXSA 4LPKA 1JSLA 3KQTA 1IN5A 2NPIA 3EY4A 3EZNA 2NVUA 1JEJA 3HUTA 2WMNB 2RGUA 3OICA 1KQNA 1QPGA 3B7GA 3ENQA 3JQ7B 3RQIA 4FX2A 4CF7A 1LNSA 5AJXA 1J2JA 1EFVB 3TTUA 4BX0A 5DSXA 4EA6A 3EGDB 3TQRA 3KLOA 3WDMA 2Q4OA 4HX9A 1GZVA 5K45A 1FDVA 3KKAA 1XZDA 2IL1A 3QVLA 2QMZA 2Y0EA 5DF1A 1OUMA 2NACA 1L7DA 5DBGA 3O2QB 4L4SA 5H83A 3NVWA 3S70A 4EB3A 4QU9A 1I01A 4PC6A 3K0CA 5BYBA 3NVZA 1Q1BA 1A77A 5EOZA 2JFGA 2P6PA 4M4SA 4I1PA 1SA0A 4LMBA 3MNFA 4EUSA 2QAGA 4DMRA 2WD7A 2BQUA 4V3CA 3BMNB 4XPIB 5IT5A 3NVYA 3C41J 2VRCA 3KHRA 1L4UA 2ZSJA 5ALGA 3JR7A 4IAOA 5EJGA 5FWYB 4EG0A 3HDQA 5K0NA 1M8JA 3HBNA 3GIIA 2G77B 1ODFA 2B20A 2BAGA 4BJHB 4PGQA 1E6WA 2ILTA 3FE2A 4X7RA 1J8MF 2C4MA 3BMOA 4WW0A 4O2LA 1K1EA 3OMWA 2WFLA 1FS5A 3G2OA 3AHGA 1OLOA 5HHTA 4FZMA 3OKCA 4D92A 1AE1A 4ZVRA 2FR0A 3S2YA 2QROA 1FUUA 8AT1A 3VU8A 2X2PA 2E4UA 1F6DA 4JIGA 3LVQE 4XRGA 4X65B 1TO6A 2WIAA 4JL8A 3NIFB 4BDSA 1ZGAA 3WYGA 3V9AA 1Z8NA 4RTSA 2JF0A 3ENKA 5KSOA 1X92A 4RIHA 3CF6R 1W8IA 1D6SA 4YQZA 4PAGA 2QZPA 3GXOA 1X94A 3LP8A 1L4NA 3M5DA 2O5EA 1PJ2A 2YJZA 3L4PA 4DLEA 1VSUA 4Q1VA 5FD8A 2WF8A 4QGGA 3QU4A 1J0DA 1V5WA 3FDFA 2QUKA 3W1VA 2HL6A 3OSNA 2NQ8A 2YFKA 5CDSA 5KTPA 1V3VA 5HMMA 5KG7A 2WI8A 3GEGA 4PHTA 1PR3A 2OLKA 4G0ZA 1R1DA 2XGMA 4BLTA 8ATCA 2JZBA 4LHEA 4TTJA 3W7BA 1ZD2P 4AP9A 1FYVA 3D2SA 4L4ZA 1T5SA 2KZZA 3E61A 3NHPA 3AV0B 1U65A 1S8AA 3O4JA 1IU9A 1GT6A 2Q8PA 1GEGA 1Z1BA 1A1SA 3AESA 3GGDA 2PLRA 3IXQA 1RG6A 3HU2A 3Q8RB 3VDRA 4TUYB 1J99A 2JGDB 1TJPB 2NNWB 1ZN2A 4BQFA 1SCAA 3G49A 4KACA 4I2GA 1G4HA 1DG9A 1HYEA 3V9PA 4TLCA 2J9FB 2R7NA 2QP3A 1N6KA 1NR5A 1P5ZB 1KW4A 1ZI8A 1Z0UA 3KOYA 4XOUA 5H4GA 1H4TA 3OJLA 5B58T 3H8WA 1Q20A 2AGVA 4EKIA 4L8WB 3RC7A 3F6CA 1SCNE 1T36B 2G5CA 2HQBA 2P2YA 2PA3A 2VYVA 4HI0E 5H16A 1OAOA 3SEFA 3FTPA 1OY1A 2YN2A 2WV7A 3EYZA 1N1EA 2NYUA 1VJGA 4RMHA 3ZJ4A 3LX8A 3C1YA 2IPXA 1PD1A 1BWQA 5LU9A 2BGIA 2CKDA 1ND5A 2IMWP 3ED5A 2Q6LA 3JYLA 2A5JA 4F5YA 2AC4A 3DA8A 2ETVA 2A86A 1E66A 5H3HA 2WYWA 1KRXA 1SUBA 2D3TA 1SCIA 2O52A 3OLWA 3OI7A 4ZJYA 4H35A 5ITZB 4P92A 2B4RO 4B1FA 2UZ4A 4Q1AA 4DIMA 4TVOA 4OHXA 4EX7A 1BA3A 1KZYC 1BXGA 1P18A 1V7QA 2A30A 2VDRB 3GAMA 3Q3JB 4PFSA 2GEKA 4UU7A 4B3IA 3ZHYA 3I72A 3ZXUB 5B57C 5KMGB 4DTCA 4LRSB 4NAHA 4C4OA 3QWFA 5LDGA 4CMIB 1F8YA 3IVRA 1IUOA 5LLSA 4IOLA 3EVNA 1QONA 3K1JA 3D4BA 1AKEA 2DKNA 2OPHA 3SCZA 2DB3A 5B3LA 5EEHA 4XUCA 1ZJJA 2A67A 1I7NA 1LLFA 3KQKA 3PUVA 2R66A 1REQB 4N48A 3NASA 4P0QA 3IERA 1S3GA 3E0QA 1ISRA 1ONOA 4F04A 4E94A 3PS9A 2VAWA 3NHUA 1JZTA 4FDAA 2CVZA 5LYJF 4D98A 3W6ZA 1KFJB 2G3YA 3AFHA 3PT9A 4ISCA 4FFDA 1NA5A 1TYZA 2GBLA 3AZOA 9ICQA 4HN9A 3E9RA 2ZATA 3GDFA 1V9CA 1E2NA 1OFGA 4WZBE 4AYTA 1U6JA 2BDTA 4IQ4A 5IJ0B 3PWTA 2C83A 4XQCA 1XEAA 5EE1A 4QECA 1MT3A 4IGFA 3PQ4A 2NU8B 2P1ZA 1HEYA 4UB5A 4I2VA 2JDID 1LDBA 1GL7A 1IPFA 1PNRA 2VCYA 3ZWMA 4YRSA 5CIYA 4IDNA 2JEIA 3BGIA 4HPJB 5JSYA 5LQJA 1VE1A 1FFUA 3K32A 2NU9A 3M5WA 4P3OA 2XIQA 4R1LA 4TV9F 5H4HA 5K3SA 3CISA 1E9AA 5HUHA 2AN9A 3ADOA 3KAKA 1C1YA 1NW5A 1KXZA 2H11A 1NVMB 4TSRA 4WXYB 4AX4A 4A82A 5CMLA 4BZXA 1X9HA 3DB1A 4K87A 2XX3A 3H5TA 1XMIA 4CLRB 4BQOA 2PBLA 5AOAA 1VLMA 4IXMA 4PBTA 4X66B 2V6BA 2YIMA 2X23A 1JIVA 2XE8A 3K2IA 1FVXA 1J00A 4I55B 3UK6A 1HLGA 3QEMB 1RYHA 3QLJA 1VDZA 3IPCA 1DZ3A 1P2DA 1V47A 2JVIA 4X85A 2JJ2D 3STUA 3M4YA 1N9GB 5J4KA 1R12A 4RAQA 4G0MA 3JS5A 2IS6A 4LBWA 2I33A 1P5JA 2VAXA 1SZPA 3TWOA 5GP1A 1R4AA 4JUZA 2QM0A 4DMGA 3SC6A 1KVRA 3FBWA 1HEUA 4BLUA 1BPEA 4GFJA 5JDCC 1VGQA 4RPKA 5DI3A 4FYXA 4DT1B 2AI3A 1N2BA 3KT6A 4YJKA 3D81A 1P9RA 4BNIA 5JVDA 1VZ2A 3RSCA 1RI3A 3EPPA 4BFYA 4GNKA 2QPOA 1I14A 2X6QA 3OTIA 2XMPA 7ICNA 5KYXA 1CVRA 4Y2QA 5D4BA 1XKQA 2CZQA 1DK2A 2H65A 3HVJA 4RE6A 5TSDA 1BWSA 1L8XA 1BN7A 4OK6A 1T3NA 1JQAA 4ZOBA 4E13A 1IVSA 2E1PA 1EIWA 4LX0A 2EFGA 1Z4LA 1E1NA 4HEQA 2CNNA 1BS9A 2ZT5A 1W4CA 2H9YA 3PFHA 2JEJA 2HF7A 1NRIA 3PEUA 3FETA 1F60A 4GSLA 3AF0A 4M1KA 4Q4AB 1M3SA 4UHKA 1KBUA 4EABA 2IS2A 1HDIA 2C0CA 4R69A 1PVOA 3EXEB 3STHA 1MQSA 3BZWA 4GX2A 5EFOA 3K0SA 3MSCA 2YZNA 3ZJYA 4P7KA 2F3RA 4DZTA 4BLWA 3JD4A 5ESRA 2GDZA 2X8JA 2FOLA 4D4GA 2P66A 1N1GA 2ZTSA 5AIAA 4RM3A 5CDTA 3PXGA 6PFKA 5AW8A 2QRVB 3DL0A 1X1BA 1J8YF 3C24A 4OXNA 5KT6A 1U3UA 2A9FA 4JUDX 2Z57A 3BD9A 4N7JA 1Y3FE 4IRXA 3EZ7A 4D57A 4Y2TA 2YV2A 4K8RB 4R16A 3U56A 1PG2A 3Q87B 2HMTA 3HMKA 4H1TA 2W70A 3MDCA 2HQ1A 4JBIA 2ZVQX 3JZAA 4EZEA 4OH1A 5FULA 1YXMA 2GS9A 2R7KA 3ID6C 2OY0A 3WFIA 2P40A 4S1NA 3O0DA 4CLDA 4BEBA 2HADA 2EEZA 4EYHB 1N2SA 1JI7A 1E2LA 4R1OA 1FNCA 4IMJB 3PUWA 1OGJA 1KDYA 5LUAA 3M6MD 2AXNA 1BFKA 5B2EA 5KJFA 3VO9A 4KMSA 1OCEA 3RC8A 2G5IB 3B1JA 2N0SA 4NE9A 1FYEA 2YOHA 3N5CA 4YRAA 1O6ZA 3BK1A 1EWVA 1YIAA 4HWGA 1GGVA 2REBA 3ZYCA 1W88B 4Q9HA 1BRMA 2PT9A 1A5BB 1ISHA 3FPSA 3NOQA 4C22A 2YL2A 3FCEA 1GUBA 3IKLA 4JJ7A 2NSYA 4PNPA 1ZSVA 3QTLA 3RV4A 3SHTA 4QX6A 4XYGA 4B45A 3U48A 4BO6A 3HB9A 1XA0A 1C1XB 4RKWA 5FNZA 4Z53A 3SAGA 4DV4B 1IXKA 3QKSA 4NULA 4P9NA 2ATLA 2QN3A 1M0EA 5D7NA 4Q9NA 2ZBRA 2FE1A 4N3BA 3C3XA 2J6HA 1GSOA 4KDRA 4N8DA 4CM1A 4DEZA 4H18A 4JT2A 2FUG6 1Q0HA 1ZU4A 2QL6A 1W4AA 5F7JA 4O1HA 3A6DA 2ASLA 1E2UA 1BPBA 1OKKD 1QHYA 1QU3A 4Q05A 3G2QA 1HY3A 1NUQA 2ISQA 3OCJA 5DGXA 1NMXA 3GUHA 4DYHA 2K7FA 3OF5A 4F2HA 3U5TA 1Z3CA 1EVEA 1K8RA 1NYQA 2KP7A 3KELA 4WBNA 3W2HA 1NN1A 5G1NA 1DX4A 1OYWA 1QCDA 2Z3WA 4MWSA 5K8TA 2R8ZA 4Q6WA 3LF1A 4EA7A 4UCQA 1R9GA 1SIJA 3LM8A 5TQ0A 4O25A 1RYEA 4ZREA 5CFMA 2RHOA 3KEFA 4LZWA 4R5MA 4B3SB 5E6RB 1KSJA 5DMXA 4DR4B 1A5SB 4ME6A 1I7QB 2VA3A 3LQ1A 4GG1A 4RTNA 1LI4A 3DHWC 3KVRA 3UOWA 2FLPA 2FN4A 3GLFB 1KAGA 1E2PA 3H86A 2FWAA 5AHWA 4OUDB 1ADBA 2IV7A 3ZLJA 2EG5A 2X4DA 4BFCA 3ISCA 3BICA 4WN9A 3HDYA 4OU5A 3V1KA 4AQDA 3GPBA 5T41A 4CDRA 3N0WA 2JAXA 1ZR4A 1I5OA 2DQ4A 4HK4A 3N8HA 4ZV7A 3D5TA 5LC1A 4AZ0A 4BP9A 5JXHA 4V0NA 2OFOA 3IIMA 3Q85A 4TL8A 2R6FA 2Q6OA 3U60B 1SBHA 4PZAA 4EKNB 3LA8A 3FCSB 3G82C 3BAZA 5C8YF 2FEOA 3TX6A 4DREA 3HJRA 2GM4A 4D0GA 1JYSA 3FB4A 3OEWA 3A1SA 2EWWA 4E5VA 2JBAB 2NVOA 5I7WA 5AUOB 2O8NA 1MZVA 2C9MA 1F5NA 4WNCA 4WV3A 1IHUA 1SOUA 1SCUB 3FI9A 3RJ5A 1WB4A 2YHSA 4V0RA 1X7WB 3DAGA 4KK3A 3B82A 3CUTA 3SX2A 2MT9A 2PGIA 1A69A 2FR1A 5A05A 3G59A 2WSBA 2AZTA 3BTSA 4M1SA 1DPGA 4MO9A 4DIKA 5A2QA 3SLKA 1VLVA 3MLAA 5EMHA 2EJTA 1Z0KA 3PQ2A 1PR5A 3LE8A 2VJAA 3V6JA 4IKOA 4V2UA 3VO1A 4CT4B 2CLKB 5DGAA 2OO5A 4H6VA 1TO1E 3TQQA 3EIQA 4TUYA 4PCUA 1IJEA 4KGXA 1MC8A 1KPIA 1ENOA 1YAHA 2Z2YA 4I1IA 4BNNA 3N7PD 2ZYTX 4GBGA 3T9FA 4DUGD 3DUFB 1PG5A 1TJNA 5B30A 1IDN1 3BA1A 3BKWA 4JL5A 1CZNA 3Q40A 4MXDA 1ULSA 4AP5A 4F6RB 1XROA 3I04M 5A6SB 1KMIY 2UAGA 3L8ZA 4JLNA 4MMZB 3JPOA 1JHQA 2XOKD 3TL6A 4J0KA 3WL6A 3HJEA 1BC5A 1USIA 4PZLA 3OJSA 5LQRA 2PZBA 4JEUA 3PO4A 4D0SA 1XTKA 3VMFA 4OX9B 1MRSA 1CNEA 3ICWA 1S3FA 4FLMA 1UC4B 3Q2KA 1WHSA 2YICA 3OX3A 4PC7A 4AWBA 4FK8A 2PX0A 4TMKA 3H9JA 1KAHA 1JXMA 3TAHA 5IVIA 1DT5A 3VYWA 2GD0A 1W4RA 1QGYA 3RH4A 1CUFA 1SOAA 3BQNB 3F96A 1PS9A 1OYOA 3OP4A 2F44A 1PT6A 3K75D 1GCIA 2HV9A 2VUUA 3JD3A 3WB0A 2WAMA 3T5JA 3WMEA 1IULA 2EX4A 2XZTA 4EUFA 1PDOA 7MDHA 1JIHA 2YV4A 1QOZA 4DQDA 2DBRA 1ZA2A 2A9JA 4LJKA 1H9BA 1FX0B 1SUWA 3CTMA 3DZKA 1N6PA 1JE1A 3JRWA 3H5WA 3FGOA 4Z6EA 5KFSA 3F74A 3G2LA 4JOSA 4RH1A 2BKEA 3WHLA 2G88A 2VH5R 1M1XB 5D85A 2IF2A 2QJOA 3FR8A 5AO9A 3THXA 3VBEA 4W63A 5KQPA 2V7XA 3KL4A 4QBKA 3LBAA 2A9KA 2YINC 2AJBA 2QKYA 5D86A 4NP6A 4AWXA 2W9CB 1SVSA 3AUTA 4DBLC 1CYEA 4RK1A 5JAOA 2BI8A 2ES6A 3LGAA 1ZWKA 1DT3A 1PZXA 1Q0UA 1ORIA 3QVJA 4EHKA 4YQEA 4EFKA 4HNAB 4LNUB 2XQVA 3LA6A 4RGBA 3W77A 1YDGA 3WQHA 1Z4IA 4B5LA 1L7RA 3AI1A 5DYTA 5GAJA 1Y3DE 3SMQA 2BZ0A 2F1IA 2LV8A 1H85A 4QAQA 4TUYF 4G9BA 2VZLA 2ZJ6A 4LDRA 5EGSA 1FVFA 1DC7A 2AOXA 2ON6A 3QIVA 4JP3A 3OAAD 2NU9B 2CDAA 3B70A 5J1TB 2YCLA 3UAGA 3TH5A 5TGTA 1E2FA 4IGAA 3AU6A 4UNRA 4DF4A 1NYTA 3OPVA 3TEFA 1NOIA 5JCZA 4CW7A 3BD7A 3JQFC 4CQMB 5CJ7A 3L6BA 3NTRA 4W99A 4NMHA 2CNBA 1XJCA 5IH3A 3E3MA 4PBSA 3D8BA 1KZ4A 5IVKA 3HRHA 4UFNA 2WVHA 1ORTA 1GGMA 1YQ9A 2GKSA 2PVSA 1S0UA 5BY2A 1RM0A 4R6WA 4P4UA 1GDHA 1N9GA 3O91A 3NBMA 5CA1B 1DG3A 3NHJA 1SC3A 2I1WA 2JI7A 3Q3GE 3LT5A 1YBHA 2JC3A 4I55A 4CKWA 5JCOA 1IY9A 4RDIA 3WLNA 2R25B 2XY4A 2GZ3A 3CVYA 3BF8A 5L51A 3IE2A 5LP6B 1PL8A 2X1HA 1L7VC 4EECA 4FP9A 2FPOA 2ZBDA 3ZN2A 2Q2OA 4AG3A 5BN5B 2ARKA 4EPVA 1H1LB 5KL8B 2N9UA 3EB9A 3KU1A 3HVUA 2DFNA 2JATA 3UGTA 4CETA 1A8IA 3RHSA 3OQ1A 4EA9A 2QRMA 2YN4A 4OXYA 4RABA 4YREA 1QFZA 2C92A 1SURA 1KFEB 1HL7A 4I1VA 5TEWA 4PHEA 1CE8B 2JNWA 2X5XA 2GJ4A 1Q1AA 2C4UA 4EJ0A 3L9WA 4QJ3A 3O1LA 1Q22A 2CJPA 1ELOA 4X60A 3SHQA 4E2FA 2O2SA 5KB3A 1GPLA 1Z2DA 4EGAA 2RQ5A 1TK3A 3STXA 4YDSA 2X40A 4PGFA 4BX8A 5KT2A 4EUNA 2Y27A 4IZ6A 3SFZA 3PJFA 4OQYA 4FFLA 4LQLA 5FA8A 3LOPA 1KAMA 2QRGA 5AXBA 4USAA 2HRCA 3HCEA 3NZEA 5ESXA 5IDVA 4E51A 2HBLA 1Z12A 3K9WA 3W9SA 2YZMA 4IZOA 5ICGA 1Y6GA 4D44A 4GYJA 1AQIA 3EXEA 2ZIWA 4O3NA 4UU0A 3S7TA 1GPBA 2R6DA 1Y82A 3EZFA 4N7RA 4RV5A 5B1IA 4A8EA 1KTQA 4RBNA 4OAOA 3UO8B 4ZZ3A 5EIEA 2ETXA 4UNSA 4QKQA 2HPHA 2W58A 2AXQA 3GFRA 3DZ8A 2RRDA 3MQ2A 2BEKA 5KCZA 1XJ5A 3UM9A 3AWDA 1N77A 3AHDA 4L95C 1CEEA 3AOEA 4YRBA 3D8HA 1QZZA 3PIRA 3E3OA 3QXCA 4TKVB 1Z16A 5K51A 3W8FA 4EYSA 3PRYA 1KEVA 4G5RA 1OI3A 1T3QA 2FUEA 1E3JA 4J43A 4PR3A 4URZR 3RNLA 1U8FO 2W4IA 1NN3A 4M0KA 5C4MA 2P75A 4GD3Q 3X44A 3CVXA 3WFJA 4YN3A 4GP7A 2QTHA 2VR1A 4MX8A 5BV0A 3D3WA 3F67A 2E7ZA 3PHLA 1GUDA 1XWIA 5KYNA 5ELXA 3LSYA 1E32A 3NC1C 4W1PA 2CFTA 3EH2A 2TMYA 3LC2O 1P2BA 4KO3S 4IDBA 3JPTA 1HH4A 3A6LA 3PFFA 5ALDA 5JH7B 1K5GA 2Y76A 4KSYA 4O5CA 3UZUA 5ED0A 1WUDA 1OV4A 2P6OA 3EVAA 4FE7A 1WCIA 1EVQA 3EQ7A 4ZRMA 3STTA 5I8ZA 2IKQA 1PDVA 4OA8A 1ORVA 4XGIA 3WA6A 2PH5A 3M9MB 3ITNA 2QN2A 3M6AA 1PR6A 3EVEA 3D7NA 1W6RA 2CFRA 2VT2A 5CD9A 2Z30A 2WWYA 4QPPA 5AVYA 1IIRA 1XQYA 3RGGA 1ZQYA 4BQNA 3NBXX 4DLXA 2PH1A 1ESDA 3K70C 2BFBA 4QIHA 3K8OE 4KQ2A 1S6YA 3MJRA 3QVVA 4NYMR 1LF5A 1ARZA 2NX2A 1J6UA 3PQ5A 4OM8A 3ZHTA 3WGUA 2PUCA 3MUNA 5NULA 5IK2D 3OZIA 4CM7A 3K70D 2WWXA 5C1IA 4ZGGA 2R0QC 4P4GA 3C2MA 4GXKA 3SJBA 2ZYVX 3DBRB 1P0QA 2J3LA 3W9YA 3CE9A 1FTWA 1G3QA 3LYUA 1PJRA 3PX3A 3GCDA 4P3PA 4RH3A 2BGTA 4MS3A 1F1BA 4RQ7A 1YQWA 3SG0A 3TI9A 5FH9A 4JGGA 3T5LA 2MWMA 1V45E 4YAEA 1KIMA 3I62A 3IMCA 4L8VA 1EKXA 3HXTA 3HC7A 5DNUA 4MPRA 1WDLA 1XNJA 5DULA 4BNDB 2FSVC 5A62A 3GIKA 2YY7A 1MLDA 1U94A 3FNFA 1DAOA 1Z3EB 5CTAA 4YBRA 4YJ2B 1F14A 1IAVA 1NVUQ 1RSZA 3T0GA 4KKXB 2GCNA 1X9GA 5DKWA 3W2EA 1TIKA 2BVNA 4M54A 1BOFA 3FSEA 4LJLA 5F76A 3TIXB 3GX1A 4CLEA 3DOIA 4YRCA 2AI1A 1T91A 4RNCA 4Q6BA 1AV6A 2NUPB 2XCQA 3ECAA 2HVHA 1N2IA 2PZGA 3N8DA 4TYPA 4H0FA 1PJAA 1TQ4A 1TQ6A 1UBLS 1Z75A 1Z62A 3DTVD 4DGQA 4OQDA 5I7OA 2QDXA 2X5KO 1WPRA 1NJ2A 2DUJA 1G8YA 1CY8A 2PZKA 4IUDS 1YMUA 3UHFA 3MB5A 1NURA 4MWDA 1ISPA 2X8AA 3CSSA 2YYSA 4DCTA 2OK8A 2DXIA 4A27A 5B64A 4FOTA 5B12A 3H83A 4A8TA 2OEPA 2OT3B 4CG0A 1QFXA 4KBYA 5KYYB 3K0KA 2ATEA 3ONNA 4IW3B 3C7KA 2QBYB 2O8DA 5JRZA 1D0IA 1EX1A 1C7FA 2HHAA 3NAQA 3M33A 3R0ZA 2EX0A 4V0ME 5KOYA 1CDZA 3LECA 4BCBA 4LK2A 4R68A 4DLZA 3LYAA 2VLBA 5AW4A 1L8OA 4MV0A 1C7IA 2WIKA 1EP9A 3W3AH 2YNMD 3PGMA 3TD9A 2VPYA 3TAPA 4P4TA 3ER8A 3G2JA 1RPJA 4N5HX 1YDEA 4AY2A 1L8QA 2XIDA 2I78A 1QIIA 4MUMA 4XWGA 1DQNA 4PWZA 3OZXA 3TQOA 2H7VA 2XQIA 4F3KA 4O63O 3UUEA 4KO2S 5TT1A 2QT1A 3U81A 4OMFG 4DJAA 5KNCD 3C7TA 2VJDA 2WWTA 2ZBEA 3OPYB 4HNSA 4IPTA 4XB2A 1DV2A 3W6OA 3I39X 1UBRS 5CR9A 2PSDA 4AZTA 1CEXA 5EJ6A 1LBTA 2FN3A 4ZKDA 4OJPA 4QFBA 2IJGX 2IQIA 5K7SA 1LDEA 4ZZIA 4NMXB 1P8JA 2C8JA 3UAZA 2P62A 3PIDA 2PMFA 4GC5A 1PZHA 4G37A 1A98A 1T9CA 2ODAA 4MW4A 5IG2A 5K99A 4LWZA 2XUHA 2VUSA 2Q1UA 5ISMA 1ZLYA 1ZQWA 3WU2U 3PUXA 2LP4Y 4M1OA 5BNWA 3VGJA 3COZA 2GHTA 3LAWA 3EPHA 4RD4A 1JLRA 4M7RA 4UOZA 5LMCA 4Q4CA 1T6XA 1FVOA 1XMVA 3HVIA 3SOPA 1RYSA 2UUAB 4Z3KA 3EC1A 2EG9A 2HHXA 3CB2A 3FTDA 1E3QA 2VJNA 4WK6A 4DMUB 1A71A 1T1EA 3C6YA 4QIWF 3NANA 4L8FA 3WRVA 4MYHA 3CNHA 4JVSB 2WP0A 5LKRA 2B30A 2W6IA 3FHLA 5HIKA 4TUQA 1IH8A 2P0AA 1HG0A 1XB2A 3NVMB 3OCYA 3NBUA 4II7A 3V8EA 5CP2A 4XI9A 1NVDA 1RMTA 4CV0A 1N34B 4DJJA 3FMOB 1KNXA 2X4LA 3R3JA 2C0PA 3VAZA 5KAIU 1QZTA 1BDBA 4EMBA 2I62A 4IR7A 3ZD9A 1KSHA 1E1MA 1I1HA 3EPIA 4BVBA 1VIMA 1F48A 5AI5A 2GFQA 2WIBA 2JJYA 3N2GB 1H5QA 4M0UA 3TCNA 4E3WA 4KQ6A 3GG9A 3DMHA 5IKMA 4PX3A 1MJGM 4B6GA 3WXBA 1BKYA 1M2VB 5T57A 3E23A 2F1OA 3T9CA 4D1YA 4S04A 3DBLB 1TU3A 1P6XA 1HFWA 2J5XA 2AC7A 2ZAIA 3IMGA 4Q3NA 3WWCA 9ICNA 1ZUD1 1ZM9A 2H2GA 3OFNA 4PSAA 4GDFA 3LK7A 2D74A 1RYNA 2VQDA 2V6JA 4G5OA 1GKIA 4KYTA 4MKZA 1SCJA 3NR2A 5DHAA 4RCVA 3NPAA 1X8LA 1ZEJA 2BCVA 4D02A 4ZHQA 1IBKB 1UDBA 2GGSA 4QTYA 4E4TA 1TUEA 4XIGS 3AUXA 5EUCA 4IRDA 1ZQ1A 3DV0A 3ND7A 1T34A 1F17A 1UT8A 2BFWA 2ZQ5A 3G9UA 1HI9A 4YECA 1QYWA 1YTLA 1U8UA 3Q7TA 2I1QA 2J6CA 4R8UB 2EV9A 3NOOA 1AUOA 4AKSA 1T35A 2POQX 5AVTA 4JKIA 2OQVA 3CYMA 3SFTA 2WJAA 5LQSA 4JU8A 5E8JA 5B2FA 1J25A 2W98A 1N5JA 3CX7A 3IOMA 3R6WA 3G7UA 5NLLA 2HZBA 5C81A 2AXTU 1WDTA 2F1JA 2C57A 4MPTA 4QDUA 5EHQA 5BN5A 1U4BA 3UGJA 1JQLB 5C0YA 5FUQA 4JI3B 4PYKA 4ECEA 3AX6A 2RH5A 5C46F 4NABA 2X19A 2PMBA 3E0XA 1KYQA 3I9NA 2EW8A 3ZV3A 4PRZA 1K7XB 3KQUA 1MQ3A 5FJIA 3K2EA 3C23A 1GSIA 4RMIA 1COOA 2PQ2A 3PC3A 4FHGA 2FVYA 2Y8EA 1CTQA 4KRFA 3V32A 3B51X 1SXIA 2ZJAA 4OQZA 4QJ5A 1QP8A 2FOIA 1M2WA 2VJMB 4WKCA 4X45A 3DHVA 8ABPA 3HYSA 4LZNA 1GZ5A 3GV7B 3Q8KA 4H9GA 4M1TA 5CT8A 5LL6P 3OHAA 5KJEA 3FDSA 2Y1JA 3P20A 5KNBA 4L72A 5D01A 2W93A 1M8FA 2Y67A 3AJRA 4FC6A 1CLEA 1ZRMA 2O7RA 2HBQA 2ZOSA 3WLOA 3E7PA 1W52X 4ZRNA 5JSZA 1ICIA 1ZK1A 1M8PA 1Y1LA 4UCWA 2IY8A 1GITA 3HEBA 2IPAB 4UAUA 2QB1A 4ECTA 1Z0DA 4MH0R 4Q7EA 2ZIWB 1Z37A 5FNVF 1TVCA 3C6BA 4JHXA 4GH5A 4MVJD 2F43A 5JXIA 3BIJA 3HFSA 3M6FA 4B3XA 4DA9A 3FUUA 4JLDA 3OIGA 5K0FA 3ZZTA 4BO9A 1JFTA 2GPSA 4GRAA 4IFTA 3PV8A 3GEBA 4R8LA 2XCRB 1E1RA 3V8PA 4Z4HA 2GBIA 4CU2A 4A2WA 5BSGA 1ULTA 1ZXLA 3B7PA 1Y6ZA 2A4MA 2FE4A 2JVKA 3AK4A 1U49A 4BWFB 4TKVA 1NN5A 2BBWA 2NZWA 5TGDA 2BFPA 2R4QA 3AJAA 4DBZA 5FUVA 4LS3A 4XLZA 2UXBB 4IUBS 2IYEA 3FLAA 3LYLA 4IQ8A 4MOWA 2YQZA 2DBYA 1ODCA 1VOTA 3IPAA 1NHWA 3BK7A 1MF7A 3KZXA 4HWKA 3ZI7A 3F46A 3KUKA 4UU8A 1QS0A 3AHHA 4LHVA 3SS7X 3GJQA 2RHBA 4B43A 5KOIA 3FRIA 1GTVA 1V8OA 1Y1SA 4DFKA 5DYNA 3TOXA 4B84A 1PAUA 2QVXX 3OJXA 3A32A 1PEAA 1X7DA 3WISA 1YRLA 3NO4A 3OF3A 3RBEA 4II2A 4U7JA 2ZK7A 2XE7A 2OV2A 2ZAGA 3I1FA 3KEGA 1YA6A 3CM0A 4MR7A 1PSZA 5BW4A 1TAGA 3AU2A 3IG8A 5TZVA 1L4BA 2FU5C 1EDEA 2QQFA 2ZSUA 2X3UA 1KZ6A 4MQEA 2J3EA 4UTXA 4ZVNA 2YQ4A 4DV7B 4HGPA 1XC9A 3IA2A 5FYQA 2PK3A 3MG9A 1KYTA 1Z2NX 2UVPA 3R7BA 2PXHA 4AW9A 4YCBA 5K0ZA 3FGPA 4O3SA 3K09C 1YFJA 1FZQA 3T9DA 4BN5A 1XCGB 4MGZR 5E8RA 3NH9A 4IR1A 1T2UA 3V8RA 1TPYA 3WKCA 1OIWA 5PNTA 2ZU6A 4XD7D 1YR1A 1K0UA 1BH2A 5GJVC 2W0SA 4K9QA 3DHYA 3AEQA 4EF6A 4ZYLA 4YQYA 3AM4A 1SZJG 3N3BC 4MGYR 4YR2A 1XU4A 3L1VA 3MBKA 1ST2A 221PA 1QCYA 2B99A 2KHVA 1W1WA 2BHSA 2VRNA 3AL3A 5KDLA 2Z6QA 4ED7A 2CMHA 2QVZX 3NVAA 2OXEA 4EOGA 3UYLA 3UQZA 4A2CA 1UQUA 2E4XA 4XEUA 1TJ3A 1YJAA 3V1UA 4JBGA 4JC0A 2ZSDA 4BKUA 2JJ2A 1KTIA 3FNGA 1CJUC 1F06A 1RXWA 2NNLD 2EZTA 2EKPA 1YUMA 3DC7A 3QMWA 2WPDA 4NC9A 1KDZA 2H1CA 3HP6A 1TMOA 2HRZA 5I7AA 4DLUA 5DWVA 1FU8A 1ZICA 4IH9A 1NF3A 3CN7A 3HP1A 2AOWA 3MJHA 4H4DA 4IDFA 1P44A 1R8JA 2ISOA 1DAKA 4RQ3A 3SC2A 3SK0A 1AMOA 2PYIA 5J0WA 2EZ8A 4J7CA 4TKUB 5JISA 3O9ZA 4AY5A 1WBJB 2YTUA 2H3HA 2WINI 2DT8A 3HHEA 5BURA 5F7XA 3C2LA 3N6RA 1A8SA 2C0QA 5AI4A 2WUGA 1PWXA 2YUIA 2JGAA 3D6TB 3WLSA 5BN4B 4E21A 4EHFA 5LXTA 4LYEA 2G25A 1EFRA 1N2XA 1MHPA 2PGXA 1ORRA 1UKYA 3WL4A 3PZBA 2IUFA 3WB9A 1PP4A 2R4UA 3TKAA 2RIPA 2VBCA 4BVKA 5LOVF 1JAYA 4AB1A 3ZVMA 2IEYA 2I5HA 3OFSA 4LV5B 3UTCA 2BJHA 5C1OA 4X5VA 2AFVA 2H5JA 1J7JA 4CL8A 2HJGA 4U2EA 4WLOA 3C70A 3WLKX 4C76A 1J5EB 1MHTA 1KOGA 1Y42X 3KBOA 3ZLUA 4KVZA 2H31A 1P2SA 2JJ1D 1L3BA 4E14A 4F06A 1VYHA 3FROA 3KLBA 3TEJA 1RQNA 3H3JA 3MT7A 3SEAA 3TR6A 3EYAA 3GJXC 3HXMA 1AKQA 1SUEA 4W6ZA 1ZS9A 1ZSNA 3IR5A 4GPAA 3UKJA 4F9EA 3Q8MA 2NO9A 4MK4A 1HO3A 5E7MA 1CJCA 3U31A 3M3PA 2ZUDA 3VA7A 3EE6A 4V3BA 2WAQC 1R00A 5CDYA 2O50A 1K3UB 4YK7A 4ZIRA 1YR3A 2CE7A 1GNTA 3TNJA 3G3EA 4C0AC 1E99A 3GGJA 3HY3A 5FFMA 2RLTA 2OFWA 1MH1A 1Y5IA 3OKAA 4HOYA 2OD2A 3WGYA 1IWPB 1E2IA 1ZLXA 3C3YA 3CU5A 1QGZA 4FI3F 4K9KA 1SOVA 2ZSIA 4MHOA 1RQGA 2G8LA 5IDQA 4WEOA 1L5GB 3UXHA 2Z6AA 2VNSA 3AFMA 3G13A 2GOLA 1O4VA 2HXSA 3IBGA 5DHRA 1ZIOA 3X0DA 4R83A 4CCWA 1B1CA 1K8YB 5DBEX 4BN4A 4AYXA 5AJYA 3VDXA 5M04A 2UYQA 2NUAA 3L0DA 3E8XA 3V6KA 2NVBA 4HZGA 3SFVA 4M9QA 3W2FA 5JARA 3KSBC 3UKOA 4ED0A 2BRUC 1V1RB 5AYVA 3C6XA 3RYFA 2XTAA 5AHOA 4JKOA 1UWCA 3N0XA 3SF8A 7AT1A 2MMCA 4D5GA 4BBZA 4CGYA 2AR7A 1ZEMA 3H11A 4O4LA 5TDHA 2G7ZA 2PRSA 3CLTC 4J0EA 4DHWA 5JNSA 2L82A 4CJXA 1FP6A 1NJ8A 1RLMA 1T4CA 2IA5A 2FQQA 4GYWA 1DBIA 1TEVA 2GETA 1XZQA 3OQNA 2O8EA 2BUAA 3OQJA 1O87A 1W5TA 5ANRB 1ZG3A 3M1IA 2RHTA 1JHUA 1MO6A 4GUDA 3KOUA 2PWZA 1A6SA 1EU1A 1M34A 1R16A 3QBJA 1M2VA 4U0JA 3P9IA 9ICJA 4OHUA 2RAVA 1T1IA 1RJDA 2YOGA 3S2UA 4EYQA 2QP9X 2PFQA 3ZV4A 4EY8A 3BRSA 2DYKA 5D3ZA 2PPLA 3O4HA 4U63A 5KSPA 1OAOC 4DY6A 4EB0A 5EXDA 4PGYA 3A4LA 2ZCJA 2HOQA 5FWAA 3G5MA 1M83A 3ORHA 4ZYXA 3HN2A 3FG9A 1TXGA 1N0UA 3ELWA 3LD9A 4WFQA 2BGMA 4WFJA 5HIAA 2QZ4A 3AYXB 3I5YA 1U99A 3BYZA 3C8ZA 3QWIA 4KYVA 3OHBA 3RSLA 4D4IA 1XCBA 2FX5A 2J1LA 1VKHA 1JNYA 4D2IA 3A9RA 3VO2A 1K3FA 5HRUA 2HCFA 4L76A 4ECYA 1D1TA 3S81A 4KO4S 3VZPA 2W8LA 2QRHA 1JIJA 5CJ2A 4MINA 5K0BA 2QVLA 3D64A 1X9MA 1U1FA 4KIWA 1QB8A 4BQSA 4BEJA 5LMUB 1QG0A 4ZRDA 4WOKA 3B0YA 4Q3DA 1UBSB 1DRJA 4PC1A 5JRTA 2W6CX 2R5WA 4FEYA 2H1WA 3W9BA 4KLQA 1UXGA 1NVVQ 4MLPA 2CV2A 4PJ0U 5D3KA 3WNCA 4C3ZA 4MKXA 1W36D 1PWHA 1NWHA 3L93A 4ECZA 3ZY6A 1XEXB 1GP2A 3QXGA 5FAXA 1EYZA 3AF5A 5FBLB 4FZ5A 4QQRA 4ZOLF 2V03A 3BEOA 2VPZA 4M55A 3TZCA 3VVLA 5I7HA 4PQRA 2BGWA 4LJ4A 2XB6A 3MWDA 2L0XA 2Q5LA 1GPNA 1BD4A 3ICVA 3WHIA 5TNXA 1UPUA 1H2EA 3M82A 3OKPA 1GNRA 4DGSA 3RARA 1OH5A 4CMIA 1B0UA 3K0FB 4QSHA 4QJIA 1KJIA 3ENZA 1X1CA 2H07A 4E5SA 2ZPTX 1DOAA 1A95A 1RYYA 2QX7A 5JD3A 1B23P 1UBGA 2FKAA 5LQAA 1XMQB 3C0KA 2VRCD 4GI5A 3TFWA 1HYGA 1G0NA 2XDQA 3DKIA 4XDZA 4EFLA 1REQA 1R6BX 2HCJB 3KRTA 1UBKS 3PVSA 3ETLA 1X42A 4DARA 1KU6A 1PX0A 4UZFA 4XH9B 4ND8B 5BQPA 1OYVA 3EA5A 5CB6A 1AHPA 3BRWD 4EBBA 1U8YA 4YJFA 1CX9B 3BCSA 3O5AA 4KX3A 4FBTA 4G9GA 5B2ZA 2FG7C 3RE1A 1SCDA 1MB9A 1EZZA 2B34A 2Q6TA 3G2IA 2LM4A 3ILSA 4POAA 4C0JA 5IJ0A 4YMUA 4I55F 5CAEA 1IQ0A 4U8HA 1NI5A 3SBXA 2UVWA 3LK9A 5IAAA 3PTZA 4BWYA 2YRFA 3E7XA 1XEWY 2KS6A 1C50A 1FRFS 2WQZA 1HKUA 4KAXA 1VI5A 2MU2A 4KIJA 1DTWA 2BM0A 2W6OA 3BERA 1RE0A 3SNHA 4DAEA 3DTTA 1SKSA 1VG0B 2W6NA 3GY0A 1BVHA 2ZR8A 4QLOA 4B9TA 1VBFA 3MINB 4J7AA 4XX0A 4GR4A 3I2JA 2ZI6A 2N42A 3OEEA 3BE8A 4FZNA 1QIJA 5BYKA 5JJLA 1YZ7A 1FYXA 3DMYA 3QEJA 1ZQCA 121PA 1KQ3A 2YYAA 4KLSA 1PJ3A 3KS9A 3CVWA 1JLMA 1GSAA 3CXRA 3WYFA 4CQNA 3KFUF 2P3QA 5KWSA 1G2IA 5D46A 2W8ZA 1TMGE 4IJKA 5DB6A 4KMOA 9MHTA 1L3VA 2H7XA 2I6GA 1LY1A 4OREX 4BMZA 5DQIA 1NK7A 2FF7A 3L2OB 3TLEA 4KR3A 1CRPA 2P3SA 3ZBTA 3GXBA 1KO5A 1XLUA 4Y6OA 3PMLA 1O5TA 3AFOA 4OSPA 3C98A 1EE1A 1PSWA 5JHGB 4JLJA 1G7TA 4DM7A 5CRXA 1V3TA 1EMDA 2PVPA 3M8KA 5L4NA 4YFVA 2XGPA 9ICGA 3PENA 2O5RA 5AVWA 2GEBA 4X3OA 3H1BA 4J3NA 1D8BA 3Q5EA 5FEUA 3FZYA 2I4OA 3G9ZA 3OECA 5T8KC 5JS7A 1BDHA 3G1UA 4R9NA 1FX1A 3ZE1B 4CHGA 2I4IA 1CF4A 5BNFA 1LBHA 1JHRA 2WJIA 1JAIA 4FDVA 2LYBA 4OJOA 1D03A 2CW5A 2QD5A 3LUAA 5AFSA 3SQMA 2K60A 1OI4A 2PJUA 2R8JA 1G20E 4TKMA 3GLRA 1T3LA 1Y37A 3G17A 2RGBA 4FONA 3NCHA 4DL9A 4F93B 3QXHA 2DOKA 5SV2A 1U7OA 3JQAD 3IOYA 1ABFA 1NJ5A 2Q5EA 4LRQA 1WUTA 3VR4A 4TQAA 3LUKA 1DJNA 3LU1A 3IEPA 2H51A 1AKNA 1I7DA 2ROQA 1OJ7A 1E6KA 2A19A