3QU7A

Crystal structure of pyrophosphatase from bacteroides thetaiotaomicron, asp13asn mutant complexed with calcium and phosphate
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
221
structure length
221
Chain Sequence
KLKAVLFDMNGVLFNSMPYHSEAWHQVMKTHGLDLSREEAYMHEGRTGASTINIVFQRELGKEATQEEIESIYHEKSILFNSYPEAERMPGAWELLQKVKSEGLTPMVVTGSGQLSLLERLEHNFPGMFHKELMVTAFDVKYGKPNPEPYLMALKKGGLKADEAVVIENAPLGVEAGHKAGIFTIAVNTGPLDGQVLLDAGADLLFPSMQTLCDSWDTIML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Divergence of Structure and Function in the Haloacid Dehalogenase Enzyme Superfamily: Bacteroides thetaiotaomicron BT2127 Is an Inorganic Pyrophosphatase.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
molecule keywords INORGANIC PYROPHOSPHATASE
total genus 78
structure length 221
sequence length 221
chains with identical sequence B
ec nomenclature ec 3.6.1.1: Inorganic diphosphatase.
pdb deposition date 2011-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3qu7A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3qu7A01
3HYCA 3R4CA 1XPJA 1Z5UA 4Y2TA 1K1EA 2ZXEA 5AW5A 1NF2A 5AKLA 3U19A 2B8JA 4UW9A 2YJ4A 3OPXA 3VAYA 5ALTA 4UAUA 3I76A 2WFAA 5AKIA 5AI0A 5ALJA 2OM6A 3ZI4A 3MN1A 1F5SA 1S2OA 3KOOA 1Z4IA 3N1UA 4KYTA 5AVVA 1U2TA 4DW8A 2P69A 3W5BA 5AVXA 2OA0A 2HEGA 3KBBA 4G9BA 1IWOA 3SMVA 2OBBA 5IS2A 2WHEA 1TJ5A 5A3SA 3IB6A 3ZWKA 2EARA 3J7TA 2GMWA 2G09A 1Z4MA 1ZD2P 5AVUA 2OYCA 5AM2A 5ALOA 3L7YA 1LTQA 5AW0A 3MC1A 3N28A 3OCUA 4JB3A 2MU1A 2WF7A 3CNHA 1RDFA 3WK9A 1RMTA 4QJBA 4YIKA 1RC8A 2W43A 5AI4A 1RLMA 5AVTA 4QQFA 2B1QA 5AW2A 1RPZA 2CN1A 4GXTA 2EAUA 2IA5A 4UASA 5AKJA 5AKZA 2I33A 3FM9A 1O08A 1Q92A 1L7MA 4HGPA 1QQ6A 2P11A 3ET5A 5ALLA 2ZBDA 2HI0A 5AVQA 5AW4A 3CZ4A 1RMYA 1Z4LA 4GIBA 4BX2A 5AVRA 4O8CA 3KD3A 3KC2A 5ALMA 2ZBFA 2P9JA 5AW1A 4I9FA 4AP9A 4UU0A 3NANA 2I34A 2YJ3A 1T9ZA 2GO7A 4ZEXA 4EX6A 3WKCA 4YGYA 1EK1A 3FPSA 5AKKA 1NRWA 1RQLA 3UM9A 4FFDA 1X42A 2JGAA 4UMEA 4BX0A 3E58A 4C4TA 1U2SA 3L5KA 2BY4A 4KN8A 5AK3A 5AW8A 3IJ5A 2PKEA 4HAIA 5AW7A 4CE6A 1TA0A 1ZOLA 3MPOA 4B6JA 4BNDA 4FYPA 4EX7A 1VFPA 5ALNA 5A3QA 3W5AA 5ALUA 2WF8A 4Y2XA 2I54A 2C8KA 2HO4A 2BDUA 3WKAA 4EEKA 2CFRA 1YS9A 2C88A 2B1RA 1J8DA 5AKHA 5AM5A 4F71A 1Z4NA 2X4DA 3DAOA 1Y8AA 3W5CA 4G63A 2BDEA 5A3RA 2IOHA 2FPRA 1O03A 2AH5A 3L1UA 3AR8A 2FPXA 5ALQA 3AR4A 1ZRNA 1S8OA 5ALPA 5AVZA 2HDOA 2IOFK 1WPGA 4L6AA 4AS3A 1YJ5A 4BYGA 5AK5A 1EK2A 2C9MA 4OD0A 2AUTA 2I55A 3QU9A 4UAVA 4EZEA 2R8XA 2FEAA 3SHQA 4UARA 4UATA 2YFYA 3E8MA 1WR8A 3NALA 4NAVA 3AR6A 4Y2PA 1T5TA 5AESA 2FI1A 3SD7A 5AIAA 1RLTA 1Z4PX 2RB5A 4Y2JA 2G80A 3ESRA 1T5SA 3N8GA 1Z4OA 5ALSA 1Z88A 4OFZA 5AW9A 4ZEVA 5AW3A 5AI6A 4YCLA 5AVWA 3UMGA 3WKBA 5ALFA 3QU5A 3E81A 1N8NA 1YV9A 2AGVA 3I28A 2ODAA 3OTQA 3QUCA 2ZBEA 3OCZA 2Q5EA 3DNPA 3OCVA 1TE2A 5T41A 5AI8A 1Z4JA 5ALIA 3U7HB 3ZW7A 1SU4A 1RKVA 2FDRA 4UM5A 3ZTYA 2YBDA 3DDHA 2JARA 4KNWA 3ZUPA 4C4RA 1LVHA 4DFDA 3WK8A 3QXGA 2I6XA 4I9GA 2WF5A 2HSZA 4J2TA 4RESA 4BX3A 4E88A 3SF0A 3NUQA 4DWOA 3GYGA 3U13A 2QYHA 2VKQA 3L0CA 2WM8A 3ET4A 4H1WA 3QU2A 2YJ5A 4KX3A 3ZTWA 3NRJA 5IT0A 5AK4A 2NO5A 5AKXA 5ALEA 3M9LA 3E84A 2EATA 3EF1A 3ED5A 2D2VA 3EPRA 3NIWA 1ZD5A 1U7OA 3DV9A 1CR6A 3K1ZA 5IT4A 3A1DA 2FPSA 2R8ZA 4HGOA 4AS2A 3U26A 4BBJA 1RKUA 3WKEA 1QQ5A 3L8EA 4EELA 1L7NA 4CF4A 3R09A 1ZD4A 2YMQA 4CF3A 1U7PA 3WK7A 3S6JA 2HOQA 2HF2A 3QUBA 3B8EA 1L8LA 4YIHA 2ZBGA 4J03A 1NNLA 2Q4TA 3L1VA 3ZX4A 1L7OA 2ZOSA 5AKYA 3D6JA 1RLOA 2GFHA 3PGLA 5AICA 2MSNA 3U7FB 3L0YA 5AVSA 1RQNA 4MUMA 3M1YA 2JAUA 4BNDB 3U7EB 3QGMA 1Z4KA 3AR3A 4OCZA 5ALDA 2ZG6A 3P96A 2RBKA 3W5DA 2C4NA 4UMFA 1QQ7A 5FP0A 5AVYA 2I7DA 2HF7A 5ALRA 5AK6A 3QYPA 1ZRMA 2B8EA 3ZX5A 2O9JA 2IOFA 1U02A 3QLEA 3B9RA 4Y2VA 3TLMA 4C4SA 3L8HA 2FUEA 3L8FA 4UM7A 2PR7A 1RKQA 1WVIA 5AI5A 2PQ0A 3HLTA 5ALZA 1N9KA 4UMDA 1YNSA 3ZU6A 2G0AA 5ALXA 1SWVA 4KNVA 1JUDA 4Y2YA 5AI9A 1XVIA 3R9KA 1SWWA 2G07A 1ZS9A 2B82A 4JDPA 5AHXA 4UU1A 4XOUA 3AR2A 4XE5A 3ZWDA 2HCFA 3AR5A 5AKGA 3FZQA 3QX7A 3QU7A 4XQ0A 3QUTA 2GHQA 3NASA 1QYIA 2B30A 3FVVA 1L7PA 3RFUA 3AR9A 4MWOA 2Q4RA 1ZD3A 3ZVLA 2C8LA 5JJBA 3ZVNA 2CFSA 3PGVA 2FUCA 5AKEA 5AM0A 2P27A 4NWIA 3OCYA 3A1CA 3EWIA 1TJ3A 2GHTA 3N07A 3B9BA 4IFTA 4KX5A 1TJ4A 4DCCA 1ZJJA 1RRCA 4L57A 3UMBA 5ALHA 2G08A 4FE3A 4EENA 3ONNA 5AIBA 4NFLA 4ZEWA 3RF6A 5AM3A 2FPUA 5ALYA 2YMLA 4YCNA 3WK4A 1L8OA 2AMYA 1YDFA 2QLTA 1MH9A 2B0CA 4Y3UA 5ALWA 3QUQA 4PNHA 5ALVA 3KDPA 4UMVA 5AM1A 1Z4QA 1KYTA 2YJ6A 4XPZA 1QH9A 2YMMA 3QU4A 1RMQA 3ZVMA 5ALGA 3A1EA 4OHFA 3PCTA 3WGVA 2YMPA 1AQ6A 3AR7A 5E0OA 3BWVA 3BA6A 2FPWA 3L0BA 3WGUA 3I1YA 2W11A 1XP5A 2O2XA 2YY6A 3F9RA 3OCXA 2DQSA 3KZXA 3SKYA 5AM4A 4F72A 1CQZA 4HGQA 2NO4A 2W4MA 1PW5A 4HGRA 4BKMA 3IRUA 3EF0A 3PDWA 3MMZA 3WK6A 3NAMA 1Z5GA 1L6RA 2R8EA 4L6CA 2HX1A 3N5KA 4BEVA 3FGOA 2IYEA 4Y2QA 5ALKA 3I6BA 2NYVA 4Y2RA 1J97A 5AW6A 2WF6A 3UMCA 1YMQA 4IG4A 3A3YA 4NV0A 3ESQA 4BEWA 3L8GA 2G1AA 2CFTA 1VJ5A 3FPBA 4RETA 2MU2A 4NABA 2RAVA 2JAOA 2WF9A 2R8YA 4YH1A 3U7GA 2G06A 1WZCA 1Q91A 2YN4A 3WK5A 3SLRA 4HGNA 2RARA 4CF5A 3SKXA 4Y2SA 4CNQA 1FEZA 3WKDA 1VJRA 4HYTA 2HHLA 3QNMA 4Y2UA 4YCMA 2JAWA 3OCWA
chains in the Genus database with same CATH superfamily
5TEVA 3L04A 3R4CA 4UCFA 5LQSA 2IE0A 4HEA1 4WKNA 4PZDA 4MULA 3LX4A 3AEUB 2VC2B 1YQ9A 2WJZB 3EXFB 3CXRA 2ODGA 1L1FA 1ORTA 1V38A 1B0AA 1P7PA 4PGYA 1D2AA 3NBKA 421PA 4FLFA 3B9PA 4NNJA 1NT4A 4MQEA 2WFAA 2PFSA 3LDUA 5BWOA 1IXYA 4I1VA 2YQEA 1G7RA 1FS4A 2AF4C 2VATA 3TR5A 2W7OA 5ALJA 2CXHA 2W9CB 1JJIA 3DP9A 4E31A 2J6BA 5KYTA 1U0BB 3DEAA 2PX5A 3GNQA 4HUTA 1PI3A 4NOJA 3GZFA 1P17A 4PTZA 3ZJ4A 4PFKA 2K8CB 3IAM1 2P2NA 3PFWO 4BE7B 2EW8A 5KQLA 4CEIA 1NX9A 3EA4A 3R3UA 4IDOA 4S1VA 4BFYA 1POWA 4BHTA 1NA5A 1I36A 4AG3A 1R5BA 2NACA 4BE9A 3L4EA 3QTLA 3T9AA 1NXXA 3CQ9A 1Y6GA 2R6JA 4KLIA 2VYCA 2Y0BA 3I09A 5A3SA 1P7CA 1JR3D 5EQJB 1IN8A 3PQ6A 3CW2A 2FHSA 2HLHA 2X7HA 1QOPB 1ZD2P 1UMCA 3GMIA 1DQYA 5H80A 4DSNA 7ICQA 4PYNA 3L7YA 1ODIA 1T36B 3RVBA 2IBMA 2D54A 4BX9C 4RU9A 1ZH8A 2JEIA 1YDMA 5LNK6 3Q3HA 2DF4B 3JR3A 3REQB 1ZI9A 3DPIA 4PQYA 4JBLA 4QQFA 2XDAA 3RU3A 1AUOA 3ROXA 5KVCA 4ENVA 3BBLA 1G5PA 3FM9A 3P9RA 2KG5A 3MB5A 1TQ4A 4O5EA 3JZIA 1FQJA 4I2AA 1M67A 3HC7A 3I9OA 5CW1A 5AW4A 5J0XA 4I1PA 1RMYA 2WJAA 3LP5A 2XY6A 3KHLA 3GOHA 1JI7A 4OP1A 2BCUA 1QDUA 1P8AA 2BMVA 2FF7A 2O8BB 2FPGB 4MJLA 7ICPA 1XTKA 4H35A 3H4DA 4F5QA 1BFDA 3AX6A 5J2JA 4GMDA 4JV0A 1D8TA 4OL9A 4YRSA 2X0FA 4J0DA 3T4UA 4DMMA 3FCXA 4QNNA 2GO7A 5B4TA 3V6HA 5E1OA 2FX2A 3Q7PA 4PNEA 5K4HA 1WCWA 2QRNA 4IDBA 1Y33E 4L5BA 1W34A 2EKZA 3DEIA 2O1SA 1E3DA 1DUSA 3F6EX 3AU8A 4X20A 4I6EA 4RJ2A 2G9NA 4BX0A 5LOVF 3UMYA 5JBNA 2C03A 3CZRA 3WLEA 5FNVF 4JMPA 4WA7A 2ECKA 5DTIA 3VC7A 5SZIA 1GQ2A 5AK3A 1JAHA 4KO1S 2NO0A 1VQ1A 1V16A 2AD1A 2H7XA 1PVDA 2IEIA 2PKEA 4EPRA 2AR7A 2P4QA 1WF3A 1G291 2WIKA 1ODLA 4PYOA 2WC1A 5BMVF 3UUWA 1KJ9A 4AUKA 2BM9A 5LM3A 1C8LA 1D3AA 1OR8A 5ALNA 4YAKA 3KSBC 1QRRA 2O14A 3QKSB 5DCWA 1OYYA 3OWOA 3GBVA 4D92A 1C0PA 3GP3A 3MCWA 1GQQA 2M6SA 3R3YA 4OO1J 3DDWA 3K72B 4JA2A 4O2BB 4ARSA 2IEBA 1G5TA 4KQ1A 1IRXA 2XR1A 1YS9A 3H5VA 3PO4A 3AERA 3BMCB 4L50A 4MRNA 3FPCA 2PRKA 4ZJYA 5JISA 4LWQA 4D8WA 3UJ6A 4Q24A 1XK7A 1QGOA 2ACWA 5K0GA 1R8JA 2W2TA 4KODA 5D5QA 1GXSA 1L7RA 3GLQA 4PZUA 4H9GA 2NRXA 1SC1A 1ZCZA 2B9VA 4OQ4A 2RE8A 2UUAB 5DHRA 1CY2A 1ZMXA 4YB8A 1LV8A 4FFPA 1DT5A 4ZV4A 5GZ3A 3DJFA 1VMIA 1HDZA 3ILYA 2GEVA 1SBYA 5TSDA 4BYGA 1ORVA 5DG8A 4CFYA 1NQWA 1PFWA 2Y05A 3TRFA 4BQRA 1X94A 4CKEB 2IXFA 3H87A 1WMDA 2CL5A 2QS9A 2DPJA 3PC2A 3BB3A 4LK2A 3P20A 3TW6A 4ED2A 2W48A 4R8MA 5JS6A 5KMGB 2R8XA 3K6SB 3MHPA 1U28A 2QD4A 1W1IA 4H7FA 3PFKA 4P32A 3O8OB 4ZAYA 4RY2A 5B1YA 2O6KA 2GD0A 3HCNA 3MWYW 1N0WA 1QIDA 2EGUA 2F9FA 3FVTA 1FL9A 2CL6X 3OM8A 4QOJA 4YR2A 4F4XA 4OJPA 4W5RA 5K3OA 4LSZA 4P3KA 3N74A 3B2QA 2EEPA 3TPCA 1HIWA 2B83A 2XX3A 1VKNA 1ZL0A 4KSYA 1T5TA 5AESA 3OZXA 2AXPA 1QRTA 4EEYA 4M0KA 4RMGA 3EOZA 4EHBA 3A2LA 3PRJA 4HNHA 3LCJA 3U0BA 3WLPA 3UT0A 4TVSA 3Q41A 3GY0A 1EUCA 1YIDA 1YRAA 1ZBDA 3UMGA 1VE7A 2RG1A 3CGWA 3LC2O 3KHRA 3LT2A 3VTFA 1GITA 1N1DA 1PJSA 3JV7A 1I1NA 1N8NA 1QFZA 3PHLA 2AGVA 2ODAA 3BMQA 4US0R 1J42A 2HBQA 2WUFA 3CT6A 1T4MA 3WHPA 1ADFA 1E2HA 4QOFA 3PFIA 3UHOA 1SKMA 1DXYA 2LBOA 4ZU6X 3P4UA 5JC8A 3EZ5A 1VL1A 4HQLA 2DT5A 1N7HA 4EKNB 4WLVA 4MW9A 5A3JA 4CIBA 2FFBA 1O94D 3K20A 1PGQA 4HNAA 4TMWA 4OFBA 1Z5VA 5LIPA 3HDHA 4O4LF 2DC1A 1UDCA 2OGUA 5KDDA 4OHRA 3B0XA 1D8YA 2GLTA 4BJ5A 3MCAA 1LVHA 3ZD8A 2XD4A 3K6JA 3MWEA 4IG9A 2W98A 3GF4A 2ZCVA 4IY1A 3IPLA 4DMKA 5CDTA 4HNAB 1NG9A 1D07A 2GCGA 3CP8A 2KB0A 3RNLA 1K2WA 1RP1A 3ZZMA 3SF0A 1J90A 1LWNA 4GBED 4FP9A 5IUNC 2XYHA 2NTNA 2VBIA 3O8CA 3GO4A 2VJMB 1ES9A 1NAIA 3EXAA 3H2ZA 5AWFC 3OOHA 5KTSA 2J6CA 4YYZA 2H3ZA 1FW8A 4ZI2A 4AURA 4QRIA 4H1WA 1VCOA 3QU2A 4MVYA 5EXEA 3JASA 5J2TA 5M04A 1A8HA 3NRJA 2WJIA 3KQKA 2G28A 5HKBA 5KFQA 2QD3A 1EVLA 2DKFA 2J08A 2WWIA 3L4BA 4L85A 4BBPA 3AJ9A 2HRCA 1S9HA 5BN3B 1CCWA 2HMAA 3PXAA 1BWRA 1WB6A 3EF1A 4MVJA 2H0AA 4MRRA 4ZCRA 5AJHA 1XDWA 4XSHA 4ECAA 1TEVA 5CR0A 1MABB 4RS3A 1M76A 3KVNA 3NWBA 3IPYA 3F97A 4AS2A 3GN2A 3HUFA 1KMMA 3IVCA 1FNBA 1V47A 3L9XA 1G3MA 3GFGA 2H1FA 1BHO1 4PLHA 3DMFA 3J81A 4H4CA 2IBKA 3FKJA 5A03A 2ZWPA 4PE5B 1CDZA 1XKLA 1KRWA 1GCIA 1L3VA 1U5CA 4C0KA 4QU5A 1DOAA 1RYUA 1GV1A 4K0RA 2QTRA 1F8YA 5B5EU 1X14A 2KYRA 4C3UA 3PEFA 3F0TA 4M1ZA 3JPWA 1YL7A 2FHPA 1CB7A 1GPH1 1ZJMA 4PS0A 4S1PA 2ETVA 4U8GA 4RA9B 5FBVB 1PQWA 1NNLA 4XLZA 3G2LA 4Z9AA 3UICA 2OL4A 2QPLA 4C4OA 5JU6A 5T3YA 3Q8MA 1O0CA 2Y2UA 4JL5A 5KAFU 1PJQA 1TCUA 1G8MA 5THKA 1F1BA 1Y34E 2BBWA 2BFCB 1X38A 4ED3A 1GHTA 2Q9BA 2GZMA 2RBGA 3DMYA 3JQFC 4GR4A 4IH4A 4RZIA 1X9XA 1FVHA 1QVZA 4ER5A 5KI6A 2VRBA 1RSZA 3E2PA 4NMWA 2BTEA 1T6NA 3F5QA 3C74A 3EDYA 2WAQC 3OQIB 2KFZA 1Q0UA 1U8UA 1DBSA 4JQOA 4QAJA 3V8MA 2KLBA 1V2HE 1MVNA 5HF8A 4AM8A 1TAQA 4OCZA 4ZO9A 3PQFA 5ALDA 1DZ3A 3OEED 5JR3A 2YV1A 1ZBQA 3DDSA 3CLVA 4HEHA 2VTVA 1F2TB 4MV9A 4WN3A 2J4FA 4YO8A 2B98A 3M9XA 1CUYA 1SFRA 3C5CA 4BAUA 4ITRC 1GQFA 4HDRB 1T5IA 4M0EA 2DLNA 3K30A 3LCVB 1YZKA 5DV9A 5EJ2A 3W4IA 5JANA 1SK8A 2DP4E 4TTRA 4GQIA 3E7FA 5JMOA 2YC4C 1NC1A 3R23A 4K6HA 1KTQA 1XZHA 4KE8A 4OU4A 4BS9A 2XKAA 4OQLA 3ABSB 2GLXA 2XUQA 1H4QA 5EIBC 4KLMA 5IJ9B 3BWCA 4LZLA 1VMDA 5E7IA 4D96A 5K6AA 2GOYA 2ZIXA 1Z5OA 3FR7A 3KRTA 4G4IA 4XCXA 4DLBA 5EWMB 4UAYA 1F7VA 3BXGA 2ZJ6A 3WGNA 2HMTA 2XCOA 4I6JA 3U44B 1WVIA 2HLPA 2YFKA 1GKLA 4FE4A 1LH0A 4E30A 1SHUX 3T5AA 5HGXA 4FFWA 4X9XA 1Z8NA 3C5WP 5HIAA 4ZO8A 3F98A 2PGAA 2J3LA 3HDQA 4MVJE 4OQMA 2X1MA 2HFJA 1UDXA 1GNPA 3Q3EA 3UJAA 1X1CA 4XGRA 4J9VA 3WAJA 2UUOA 5F9NA 2NU9A 3EOAI 1UBCA 3IP7A 3H4IA 4C14A 1G5HA 2PBFA 2ZK7A 5AYVA 3TQSA 5A4FS 1E1MA 4MEJA 3T61A 4LQLA 2NO9A 1VSQA 4CODB 1K1QA 3M5CA 1UBFA 4F60A 2PBRA 4IHKA 4GC7A 4I9HA 3RUAA 4N3CA 1Z0JA 3ROQA 3K4GA 1TFRA 1G2OA 1OBCA 1Q0QA 1YKSA 4V0KA 5D1HA 2E5LB 1SVKA 3G0CA 3JQ9A 3GQBA 5EFZA 2O3JA 3E9DA 2HCBA 3HFSA 2PMWB 2XI9A 3NAZA 1OFVA 3BE6A 2F67A 2PVSA 4QZFA 2AW5A 3D8BA 5CFNA 1KNQA 4EUSA 4DA7A 2P65A 4WLFA 4BJ1A 3P9KA 2J41A 3VSAA 3WBFA 3ZV5A 1RR6A 3HWRA 2Q4RA 3AP2A 4RHFA 1ZQVA 3USZA 1DBVO 3GJ4A 4YJ2B 2DKOA 2CB0A 4GPTA 5ESRA 3LT5A 1GDHA 1KYIA 3L4PA 1XFAA 2HDHA 1OHHD 1RQRA 3BSYA 3HP6A 5DLGA 1P0MA 2UVPB 2V7PA 5JG7A 2NUBA 2OB1A 3DVSX 3M4YA 8AT1A 5JSZA 2R47A 3L0DA 3BGVA 1UIMA 2NYUA 2BGWA 1DCFA 4HQ0A 3O03A 4LI3X 2QN8A 4HX2A 4QKQA 1J25A 1XTTA 1U9LA 2YXDA 4BQIA 5IJZA 1AGNA 2B8NA 2QJTA 3LC0A 2TYSB 3SYNA 5F4ZA 1PZEA 4DCCA 3ZW8A 5BPHA 1SVOA 3G13A 2PZGA 5IJ0B 2YHSA 3RLIA 3QUAA 1AJEA 3OZEA 4RACA 4TTIA 1JLHA 1JKFA 1Z6PA 2PA3A 4WASA 1Z82A 3H9JA 1QO9A 4GT1A 3BILA 3CN9A 1L4BA 1ZJWA 2WJHA 4N39A 4O0IA 1FO4A 1DTSA 4WGFA 5IWCA 2OK7A 2VXOA 5JNWA 1N8TA 2L0XA 1JDVA 1V11B 3HGMA 4K7JA 3IJPA 2TMGA 2X1LA 1E7YA 3BQMB 3L6RA 5ALYA 3KQNA 2K60A 4YP9A 3IPAA 4XGQA 4DUPA 3KV3O 5FI3A 5C5DA 2F00A 2HUNA 1HUOA 4XDHA 3N5CA 4OLJA 4C43A 4DNPA 5CIYA 1IK4A 4G5GA 6LDHA 3F47A 1U1EA 3QUQA 3HKZC 1I4TD 3CYFA 3KZKA 4EFDA 3UPTA 1IH8A 3C1AA 2DUUA 5FOUA 3O21A 3NTUA 4ZQGA 4ZVKA 4JUAA 3ZYZA 5JJIA 1YD7A 2FLNA 4G8CA 2V7XA 4LQCA 9ICBA 2RAUA 3ZCSA 1IB0A 3ZIAD 4MYUA 4F5EA 1A76A 3QU4A 2YMMA 4RVGA 4EHAA 4EAQA 3X43A 4A3SA 4NZYA 4LJRA 1MEOA 2AJLI 1KBOA 2HBRA 4INZA 5D1NA 2XIJA 3UFBA 2R1UA 5DBHX 3TLYA 3TYXA 4FD3A 4L16A 4WDRA 3X2FA 5LR6A 2H7YA 4WXRA 5LQRA 1KJ8A 2C5LA 3A70A 2ZSBA 3M8SA 4JMLA 1W581 1ED1A 2KMDA 4P3PA 5F7JA 4B1FA 1TYBE 5AXDA 4DMGA 1V3UA 2L69A 1IDOA 3FGZA 3MAJA 4S0XA 1W94A 2IJGX 3D2QA 2FUKA 2HHXA 2H4WA 2PPVA 4BKOA 1PSZA 1SKRA 3HKBA 2CT8A 1SR8A 4NBUA 2F64A 4QRDA 1D04A 4BNGA 2C78A 4F72A 2YL2A 3A7DA 5M3BA 4B7ZA 1C4KA 5E6UA 3FGNA 3OQNA 3PR1A 1U2ZA 3GEGA 3JD4A 4WCFA 3QKRB 4F04A 1JJFA 2MSLA 2AJ8A 1ZJNA 1HETA 3KYDA 2FRXA 1FW6A 2VZEA 4NBRA 5EWJB 5FWXA 4TTTS 3MW8A 1VG1A 1A5SB 3FSGD 1H22A 1UXKA 5BYKA 5BOLA 1FDOA 1M0EA 4AKTA 4YDQA 1KJJA 2Q3BA 3R9XB 1YBVA 4CIXA 1WPQA 1QU2A 2WIFA 4H0NA 4H77A 3EAQA 3NKFA 4IJMA 1YMQA 3DOHA 2COUA 5IJ0A 2K6GA 2YN2A 5K6AC 3C5FA 2QVLA 3L06A 4NPAA 4WEOA 3NX4A 2A5DA 2CYAA 1WVMA 2UZ4A 1YDGA 3I3OA 5SZHB 3VHXA 3JQRA 2F8SA 3DDOA 2CFTA 3PE3A 3AY6A 4KAJA 2D6FA 1P4GA 4YRIA 2DSTA 3JYNA 4S1TA 2IHZA 4B3MB 1ZGHA 4J75A 4JLDA 1PEKE 4ZXFA 3I9V1 3NH9A 4UFPA 1AXRA 4RQMA 1UA0A 1NR5A 5EAIA 2OTCA 2BTQB 3ZH2A 3UMVA 4Z1MD 2IS1A 2I3BA 5AOBA 2QGNA 3BREA 4WNAA 5G0SA 3WK5A 1TMKA 1KR5A 5HYVA 1SZPA 1SBHA 1XTIA 3HJBA 4I7EA 5KT4A 1E8NA 4QTTB 2R86A 4PF1A 5I5GA 3RBZA 3T3MB 1EU1A 2G5GX 1X1AA 4QG7A 1KFEB 2EX1A 3NB0A 4UTPA 4BATA 2F1HA 2J87A 4JENA 2DSNA 1WCIB 521PA 5CT8A 4ELUA 1NOMA 1PL0A 3N87A 4WK0B 3WWCA 2LZ0A 2Y1CA 1RI3A 1STOA 5DBFA 5CA1B 2OESA 2Y1FA 2JJQA 5KHOC 1T4GA 4WN9B 5A4KA 2I6TA 4YMIA 3X0DA 1OWMA 3ZGNA 2XCRB 2I22A 3ITKA 3ZEAA 1CF4A 3I3SR 3GT7A 3VAYA 1UINA 2C2WA 4MQ5A 4ML3A 1UPFA 5E0KB 4BB5A 2CFCA 1UZNA 4P7FA 2AQIA 1U2GA 4S12A 4IWYA 2DOKA 2DULA 1HT1E 2ILVA 2VWQA 2PD6A 3DKKA 3K4QA 5FV7A 4B75A 3OFND 4XFJA 4F5DA 1GZ3A 3E3LA 2EZYA 3NTXA 4DMRA 3AI2A 1AOXA 2DUYA 3OKAA 4LMRA 3Q3CA 1IZ9A 2QLJA 3BTSA 4CMAA 5K8CA 3IUEA 4ZN6A 1OF1A 2E5FA 3GV8B 3GPIA 2HEIA 5C1BA 1YR1A 2HEGA 2VP6A 4L07A 4E2YA 4RLSA 3SMVA 2KX7A 2OBBA 1ZR2A 2O8FA 1NDUA 4JAVC 1JA9A 1SG6A 1K0UA 1FYVA 1J1IA 2AFHE 4IJQA 2C3YA 4UU8A 4DAEA 3BFPA 2EZTA 3T7KA 1A98A 2WVJA 2OYCA 4TKUB 4CM9D 1ZIPA 4QVGA 5L1JA 1ID1A 2Q3DA 2WINI 1PE0A 2H4HA 1ND5A 4N0MA 1JSLA 4HXGA 4C7OB 3UUGA 5GTHU 4GXKA 5CXXA 2ZBRA 2OC9A 3QNWA 1IPFA 1ULBA 4PVCA 3E23A 1NQXA 4G81A 2PLWA 1VBFA 4R2IA 4QIWC 3PGMA 2FSFA 3IHQB 4QXMA 2Q49A 3SM3A 3C8ZA 3OQMA 3ZVKA 4AJOA 1PTJC 3T3OA 3BHJA 4RM2A 1YZUA 1JAYA 1DDIA 2P41A 1K4MA 2FPGA 3HXMA 2JFHA 3ETLA 4J9MA 2ZAYA 3A6FA 5ITZA 1MAHA 3ZN2A 4OATA 5D49A 3O9ZA 1JIJA 4GZLA 3WQBA 3VPDA 4GOXA 4RS4A 4KLHA 1NQVA 3C1ZA 1T8YA 3ITNA 3E9CA 1EBBA 3DEHA 8ICKA 3WLIA 3L7NA 4FFBB 3STTA 1AKYA 4CDNA 4AD8A 4MWBA 2ZIWA 3VC1A 2NIPA 3JYHA 1G7TA 2WY2D 2FW8A 3OOJA 5JY6A 4ISCA 2XUPA 4YP5A 3C0KA 4M9LA 2WUVA 4DMUB 1HYHA 2CJWA 5M29A 2A86A 1H66A 4TUYA 2WIGA 5I3ZA 8MHTA 4RXUA 4ZT4A 2XZDA 5G3YA 3BJRA 5F51A 1EVYA 3TG8A 1O9GA 1II9A 3A9RA 4M9SA 1IZ7A 3Q9NA 5I9BA 4BLUA 4GYYA 2ZTLA 1HYGA 5KSZA 1NM5A 1WW8A 1Z5WA 5D5HA 1U49A 3ZZTA 4AX8A 2JKYA 4BQQA 2V9PA 4BLPA 3LYAA 3BRQA 3O3MB 3SHWA 1OU0A 1SIUA 3EQ2A 5AQ1A 4HAIA 1NYLA 2Q4EA 2BFDA 1W85A 1O9HA 5DI3B 2JFPA 1YUBA 1ZVQA 4B47A 4BNVA 9LDTA 1CRPA 1VMEA 3RUCA 1G20B 1DPGA 1QQTA 3U3OA 3D3KA 3TTTA 2Z4SA 5A3QA 3BTUA 1YZQA 5L3QA 3NBQA 2JH3A 3LVWA 3HVIA 4XQ9A 2I54A 2ZUDA 2FH5B 5EXXA 3SR3A 2W55A 3D8HA 3ROEA 1TAMA 5HQTA 3PEVA 2R8BA 2UYOA 1TZKA 1C4WA 1TCBA 5B6JA 2B1RA 2G4VA 1SD2A 4QGFA 1TVCA 5EJIA 5JPIA 2GN8A 2PV7A 3NZEA 3L7CA 2RD2A 4CUZA 4FWTA 2RGGA 4OHXA 4OXXA 2B4TO 2G88A 1IBMB 2I8AA 4C7KA 1THTA 4IVQA 4MEBA 5TEWA 2FPMA 4ZC1A 3TXAA 2CMFA 1PYGA 4IOJA 2ZXHA 2GJ8A 2NOAA 2OV6A 4PYLA 5KFBA 4MYDA 4BRSA 3MGIA 4G36A 1H2YA 1HOXA 4WZ6A 4IF4A 1E2DA 1F06A 1XG5A 1U3VA 5IIIA 3G23A 1NBOA 3L9WA 3NWEA 1ECFA 4UAVA 1ZQOA 4KV7A 5J2HA 4JT4A 1KAHA 3LKBA 4H17A 1NJ8A 5EESA 2CV0A 2YWCA 2DPIA 2PRZA 1FFXB 4ZOLF 4M8KA 1I2CA 3E8MA 3WSWA 1K7FB 3D8RA 4MKXA 4NESA 1T9KA 1FUUA 1XA0A 2IVFA 4RGVA 1GKIA 4M88A 2GPYA 2ZB2A 1RP7A 4C5CA 1EX7A 3HPQA 1G2PA 2GJKA 4MLCA 5AIAA 5J9FA 2COKA 3SC6A 1SXJC 2Y1IA 1U7ZA 4W1SA 4G0MA 1YZTA 5EIHA 1T5HX 5TMBA 1LSOA 3CCCA 3ZHZA 4TLEA 1OY1A 3O38A 1C9MA 5K8UA 1FP7A 4DGQA 1OLUA 1MP0A 4W6ZA 3LRPA 6ADHA 3DWEX 4MQEB 1WBJB 2OH2A 1UBNA 1EDEA 4DRXB 3SNKA 1AZWA 4LV6A 4Z7QB 4G2NA 1JIVA 3LPMA 2OO3A 4PHFA 4KR6A 3E82A 3GAFA 1DKUA 3RC1A 3DBLA 2C0QA 3O2QB 2HT1A 1ENYA 1KNXA 1MB2A 3A6GA 3I9MA 3GVCA 3KUCA 3LGAA 2QL9A 4JVSB 3MUOA 4KW7A 2FDRA 1IHUA 2A5JA 4TSKA 3WMRA 4DSJA 4OBWA 5INTA 2AS0A 2WV7A 3DDHA 4K6GA 5KAIU 3JW8A 4QZBA 1QKKA 1RC1A 3P9IA 2IXBA 3QJGA 5GP1A 3T3IA 1ZN2A 4JOSA 2AKYA 2WT4A 4OK5A 3U40A 4URXR 5I7VA 2OGSA 2D2IA 3D2NA 5F9FA 5IVIA 1Z29A 1XF1A 5DHQA 4Z0PA 1Z0FA 2VYND 2FJUA 2QUHA 3C1UA 1SAYA 3OTHA 4IKOA 4LJ6A 5ERYA 1DEXA 1PWHA 2WF5A 2W8BA 3AKEA 3P0RA 1R0CA 4H7KA 3NUQA 2I1VB 3OZSA 1I5EA 3AHHA 3CR7A 2CXNA 3KCNA 1U1DA 3D8NA 3ORQA 3L0CA 3F6SA 4YVZA 3ZE7A 3QH4A 3ZZNA 2XNKA 2GLUA 1CJVC 2ZSEA 5IILA 1P5HA 3VOAA 4BRWA 4EBFA 2VS1A 4K9SA 3OMWA 3N2KB 2JI7A 3EZGA 2RMKA 4YV2A 4F3RA 3QMVA 1WU7A 3UJ3X 5AKXA 1IN1A 2DFTA 3C3JA 2QJRA 4F6RB 1UMBA 2GUWA 3CUTA 1GRNA 1QRAA 1NLUA 2FU5C 1CFZA 4PC6A 1ZVVA 3ADDA 1WCXA 3C5EA 1UWKA 1T8WA 1ZVJA 2PSDA 1I3KA 3P0EA 4OXYA 4CIVA 1HURA 4YD1A 3CFYA 3WLFA 4GKBA 4ED6A 2Z8YM 3N2GA 1BS2A 4CG0A 4PPGA 2POQX 4TURA 1VPVA 3Q5DA 4BVBA 2XLBA 3D7NA 1ZCBA 1QO0A 3UKDA 2CF6A 1XNHA 3JYPA 1EE9A 1MDFA 4I2BA 1TNDA 1YS6A 2UYYA 3IP3A 4PXSA 2LM4A 5E8RA 5EQFA 1T5DX 3EDCA 3ZWQA 3H0MB 3OI7A 5D84A 3PJDA 3VH4A 1QRSA 2J31A 2DFLA 1GNQA 3MTIA 1CUXA 4M83A 2XO7A 2AGQA 4KLLA 3KB6A 3SJCA 4NX2A 4CQMA 2B5OA 4N47A 2AQKA 1MMFB 3FHOA 1USWA 3DDCA 4Y67A 4URFA 1CEYA 4D9CA 3ZX4A 3CBGA 2J3IA 1T9HA 2X8AA 2X22A 3ZK7A 2VUHB 5KNDA 4G37A 4LRTB 1XSPA 4F4HA 1ZM2A 2X5XA 4O3QA 4DJAA 5LDDC 4FFNA 4GEGA 2RHFA 2P0YA 1KSHA 1NK9A 1DFIA 1CR4A 1KJWA 4FDTA 1YFKA 4GE0A 2V5UA 3F96A 3WIEA 4ZMSA 5LQNA 4EZ9A 1T2CA 4I5EA 3SSAA 4B7XA 4FC7A 3WTCA 1IZZA 2B4AA 1NKVA 4IIJF 1RVDA 4X60A 1GG2A 3OUTA 3HA5A 2OHOA 1B0UA 4JEHA 4P4GA 5KT3A 3G02A 4KVFA 1Z08A 3TUZC 2LYBA 2CFOA 5IJWA 1J00A 4RM3A 3G5TA 4WNCA 1D2CA 5EHZA 1IJFA 3SSNA 5HS6A 1YA6A 2FZWA 2O1EA 1NU6A 3V7UA 4AW9A 4LDNA 2P67A 5CEHA 4QDKA 3QW2A 3IODA 4ZOLB 4E5YA 5CHEA 5F2KA 5A4JA 1QIHA 3KTOA 1Q84A 5CGQB 5AI5A 4UNPA 2R751 1JG6A 1L8XA 4GUAA 1P7YA 2YB1A 4P3XA 4U2EA 2W6MA 4YP6A 3ME5A 5EWLB 4LOIA 4OXIA 1GSHA 1CYEA 1KZ9A 1YZ7A 1BXGA 1Z25A 2CYCA 3L07A 5ARDA 2DUNA 5SYNA 2EKPA 4Q39A 2QNBA 4Y30A 4YCAA 3TPZA 4C30A 8ICVA 3W0LB 5K3CA 1RZRD 2C42A 4WESB 4BFTA 4CQLB 3EDOA 2OXTA 2MAXA 2I8LA 2QTZA 3DE2X 3U9SA 4JP3A 3H2SA 1TM5E 5J5VA 3Q8XB 1FTQA 3COYA 4FHZA 1ADBA 7ICNA 1XCGB 1N2JA 2VA9A 2GKGA 4NLCA 4DQUA 2BZFA 1NSFA 1IM4A 4MAMA 1VGRA 4O0LA 2Z1DA 3NO4A 1I8TA 2GPTA 4KI0A 1LRLA 5LU9A 5EUCA 1PN3A 1TV9A 5IFKA 1VB5A 3E27A 4XVUA 4J9UE 3V1NA 5JZSA 1IXZA 5LU8A 1QHFA 3PX4A 3ICPA 4PHHA 1Z2NX 5HS4A 3ZJ5A 4GFJA 4DSLA 2GRJA 3CONA 4CKWB 3TRHA 3FNFA 2H29A 4I50A 4DZRA 3NYIA 4R8UB 3QG1A 2C3OA 2IZOA 4OXKA 4QICA 3TE7A 4GI1A 3KOUA 3ZVLA 4CJXA 5KTRA 1ZWLA 3LFTA 1NUPA 3HN6A 4HQNA 4E5DA 5AKEA 5BSFA 2AL7A 3SVLA 2AI3A 2EL9A 3H7AA 3PPVA 4FFVA 5AHKA 3LSTA 1QV6A 1DXQA 3BX1A 2BGUA 2DL0A 1QE3A 1W5AA 2BKXA 4DFJA 2H2FA 1F0PA 4HATA 3EGWA 4GP6A 2OFWA 1YB6A 4HUQA 4YJ2A 2G5PA 4DDWA 3GLGB 6AT1A 4IFTA 1YA8A 3OLWA 3EH2A 1N25A 4UHFA 1AGPA 2PLRA 3FRIA 5REQA 4C22A 3ST7A 3KLNA 3HSYA 2BEWB 4PNZA 2O2EA 2PZBA 2YICA 3DPUA 5ALHA 1PNRA 2P91A 4M04A 2H4YA 3ONNA 1AHIA 2E6KA 2A9PA 3CNNA 4K03A 4XYGA 2WTFA 1ECBA 5DBOA 3TZ6A 5LYJF 1H1DA 2AK3A 4ZEWA 4ZCLA 5J58A 2CC2A 4Z49A 1RVV1 1VSUA 4QSHA 1E8DA 4OA8A 4F2WA 3TANA 3L8DA 2XQFA 4RJTA 3VSDA 3A1SA 4MPJA 5JH7B 1L8OA 3OJEA 4RZ3A 3NAQA 5LJLA 1Q3HA 3SBEA 1K3TA 1TT7A 2R5WA 4LISA 4LXGA 5JCJD 3ZD6A 2PA0A 4JKIA 4IMIB 1DJOA 2AOTA 2XQKA 4RIFA 3RSZA 4Z9XA 4HWPA 3R3XA 4NLZA 1JWAB 4RTKA 2YWGA 5JE8A 2R8PA 4CV2A 1QLJA 2PGOA 2CVHA 5LXTB 4D0SA 3DWIA 4HXFB 1YDHA 3HW8A 3UGQA 1USVA 3I0MA 1YOBA 2GGSA 5JI2E 1E1CA 2SCUB 5G1PA 5B1EA 4QZ8A 1K7CA 2IZ0A 2RHLA 3G1UA 3OBBA 1WSAA 1N7IA 5HUJA 1V6CA 2REBA 3VH1A 5BW5A 2NZVG 1CQIA 1QGZA 1REQA 3RV3A 5KEIA 5F5XA 3EXFA 5DKWA 1PGPA 1XZDA 3K9GA 4AU1A 1MQAA 1U0HC 1P74A 1R12A 3UAXA 4YX9A 1BMTA 3M9WA 1DC5A 4AZ3A 1DWPA 2ZULA 2E89A 2JGKA 2ZUFA 3VO1A 1DKLA 3O92A 2AEFA 1E9DA 3F9RA 4HDKB 1T1IA 4KXQA 3VOBA 3A3PA 3L40A 1RHRA 5AM4A 4GH5A 5EIWA 1E2BA 4IQWA 3C2MA 4UTOA 1PG5A 1Z2OX 3FXAA 5J0WA 1UP6A 3MWDA 4QUDA 3GIKA 2RGCA 1R8SA 2QUAA 5HFJA 7GPBA 3RB6A 1CDOA 2C2MA 1CXZA 2A5LA 4Q1EA 3MTGA 3ZWOA 5C8VA 3O47A 1OWOA 1UZUA 1U0SY 4KO8A 1C3XA 3GQCA 3OE4A 1GL7A 4MCAA 4MV5A 1EFVA 4WY5A 3KYIB 3RC7A 3CYMA 3HQ4O 3SJZA 2IGTA 2IPXA 4Z4CA 3ZU3A 4P6VF 4TKLA 3LVVA 2VDQB 1UDAA 4IRMA 3JVIA 4RVCA 3UT5B 2QE7D 1R9GA 1IEWA 1HE5A 1HQCA 2E82A 4MR8A 2BAGA 1MKYA 1P1FA 1KVUA 1PQPA 3KTFA 3M81A 4KL8S 5G0UA 3DEYX 4W5OA 4GZ5A 4Q4LA 3LBHA 4GDFA 4TTAA 1Y81A 3OM0A 3VVCA 2C9YA 3NIGB 1F8GA 4IDCA 1Q0LA 4HVTA 1QHNA 3EIEA 4IS2A 1ZWKA 4IFIA 4RQ2A 1CB0A 1L2TA 3EXG2 5KFCA 5K3BA 4Q4DA 2QZPA 4XVQA 4D0RA 3E4DA 2GD6A 4UOQA 5E3IA 2CXQA 4PAQA 2MU2A 1O95A 2YJGA 4E14A 2PFNA 2JLUA 4MI6A 1FFDA 2XV1A 2JAOA 4KRXA 3HNOA 2VH2A 3C6XA 4DLUA 1ECCA 2D5IA 4RQ6A 1PQ4A 4QOIA 1C1XA 3UXYA 1A9TA 1SOVA 5HZGA 3AK4A 4WESA 2QGZA 2GVDC 4CQLA 4E1BA 1G41A 1NSTA 3FPLA 1U98A 1JF8A 2WU1A 3EZ6A 5EJEA 3FCOA 4DNQA 1G17A 2YIVX 3AHCA 3TDMA 1U6KA 2P75A 3WGYA 1DU4A 2H9IA 2JGMA 4DGSA 4EYOA 1JIHA 1LRKA 3DZBA 3QX8A 3N3BC 4YJHB 1IN4A 1TU3A 5D00A 6NULA 2PRYA 4N8SA 4NMMA 3OG9A 3W3AA 2WHRA 4HPJB 3JVVA 4A16A 1GL3A 1EQ2A 1OKKA 1YE5A 2ZXEA 4CZ2A 2X0RA 1ZQXA 1S8FA 2WUEA 3HCDA 4YFYA 1EAYA 1SXJE 3OPXA 2YJ4A 4YJHA 2P5YA 3LL4A 5FPKA 1YE3A 2Q8QA 4G67A 3KR1A 2O7NA 4PZZA 1EFPB 3IGFA 4ZI7B 4DNXA 4MW7A 3RS4A 1E64A 2E6UX 1H5QA 3MGAA 4WUVA 2O05A 4KG7A 5J40A 3R7DA 5KVVA 4KCGA 3R8FA 2FZEA 1OZHA 2JAPA 1OTHA 2JKVA 1XTRA 1E3WA 2ZAGA 4A2QA 5AVVA 1LDBA 3K2QA 4AO6A 4IZ6A 9ICGA 1IWOA 1W35A 3FPAA 2QI9C 4OM8A 1UMCB 2BE9A 2WHEA 5DQGA 1NVXQ 3HJCA 1FY2A 1NF3A 3O75A 3QVKA 3LHSA 2F3SA 2AC4A 4P81A 2M1XA 1WB5A 3ZWKA 1U2QA 1GRCA 4Q15A 2IYQA 5AD1A 2EFCB 3LPLA 5WRFA 5JLJA 3T5JA 2B78A 2W8KA 1KQQA 2WTXA 1K6JA 3UBMA 5KTPA 3LP6A 2L19A 2QMHA 1NRXA 2NV3A 2Z95A 1UPBA 2JGDA 5BN1A 3QLTA 2HRQA 1P29A 2JHAA 3N28A 4R81A 4ZOAA 5NULA 3T3HA 3ZXSA 1U8XX 2W6QA 5DM70 3WK9A 2ZI9A 3BRWA 1JAXA 2QMOA 3F49S 4FO6A 1CW2B 1DBPA 3EZYA 3JRNA 2WMNB 5E4TA 4E13A 4F0JA 2ORYA 1XOIA 2PZLA 4QPZA 2TS1A 5E1BA 4BEBA 3BE5A 4MUKA 1UT5A 4C3ZA 4UVIA 2DPGA 4QZ9A 4IIVA 1FK8A 2OZLA 1YL6A 3SQXA 4V3BA 3TINA 5EMHA 4DV1B 1QMPA 1KKUA 1BXZA 4C6TA 1IJKA 1A71A 1HG1A 1D2NA 3IP9A 4OA5A 1ADJA 1A7JA 1XGKA 2WWTA 3ESZA 2HF9A 4Q18A 3VVLA 1Y1TA 3TSOA 3QRWA 4X7BA 3NVVA 1C2TA 2ID4A 3F8TA 3QA9A 4KKXB 4P5PA 5LZ7A 3WYEA 2H3HA 2I34A 3FKQA 2FSGA 4WOJA 5CX4A 3GJSA 4EX6A 3V8BA 4E94A 1LNSA 1UOOA 1YBFA 5JS2A 3NMUF 3WZMA 2QE7A 2QVCA 5EWFA 3ZNNA 4Q9HA 5L45A 8ICPA 1LRJA 1R0RE 5L6MB 4PQRA 2J32A 3GFVA 4ZARA 4ZT3A 7ICHA 1X7YA 2YVAA 4RFVA 4DQDA 5C1OA 3FMFA 2XHZA 5FX2A 1C1DB 3V2GA 4F56A 1U2SA 3B85A 3TIXB 3V55A 3GXBA 4Y6OA 3SZOA 5JXWA 3PEWA 2O1WA 1K06A 4XDGA 4U39A 3EGDA 3EBPA 4YTEA 4PO1A 3ZHCA 2IV2X 1Y3IA 1HUZA 3JQ7A 3R3WA 4YJ3A 3WDKA 4KIGA 2H1CA 4RENA 1G59A 3EIOA 3FAZA 3PPWA 3HG7A 3CB2A 1AKEA 3A9CA 1UJCA 3GRFA 1B22A 1CQWA 3BQ0A 4LYFA 2X77A 1SBQA 3LI2A 2GXAA 2BDUA 2FN4A 3HB1A 4H1TA 1X66A 4KO2S 4LXTA 3RVJA 1MO2A 2H3IA 2RQ5A 2OZEA 3IAUA 4N8EA 3OZFA 2FSVC 3G17A 2WB4A 2GXSA 2H65A 1XRNA 1RG6A 2XDWA 3H1EA 3G2NA 1J21A 1EFRD 3EWSA 2JHGA 3G2OA 3CF6R 5A7FA 3NI2A 1Q74A 4MQMA 3AR8A 3NV9A 2DWCA 4LHWA 4GZ3A 2PWYA 3BIOA 2GTPA 3AM5A 3H8JA 5ALQA 2HNKA 3CX8A 4KGVA 2UZIR 3LDGA 2VHUA 2FMQA 4AI6A 4CRWB 1BVHA 1XMVA 2ZVDA 3INRA 1HFJA 5D6NA 5TDHA 2YY5A 1ODJA 3AB8A 1L9XA 4DFMA 2X9GA 4WCVA 4F3NA 4IQGA 3ZK8A 3ZU2A 4A2CA 1U31A 1NDHA 3NH6A 1F1JA 5IMBA 4A2WA 5CNJA 3QFCA 3NT2A 2XVAA 4ERXA 4KAXA 2WE8A 4GW3A 3SHQA 1XI2A 3GRCA 4RKRA 1XTSA 3GGSA 4UARA 1GYQA 3HEBA 2Q3LA 2WM3A 1DSSG 4OGGA 1DAOA 4D98A 2C4UA 4HQ6A 2HBMA 2ZJBA 2W2VA 3EZ9A 3BQ9A 4EGCB 1GFIA 3FVWA 3PGKA 3C4QA 3LX6A 4NAVA 4X94A 2CEKA 3K0EA 1PTKA 5BQOA 1OB5A 2W9BA 4PX5A 3KL4A 4XM0A 1BU8A 4DSEA 1N5JA 3AHGA 4B34A 3SD7A 1EE1A 1L5RA 1Z4PX 1GM5A 1KVSA 2NUAB 3UCXA 5ESDA 1P1JA 4IIXA 4MAFA 2VT2A 2W37A 4PZPA 3W2GA 4V3CA 4RA9A 1E59A 4PR3A 4U7PB 3DLIA 2H11A 3PR5B 1RRPA 3RRGA 5JRDS 5FOVA 4F8YA 4DXHA 5AW3A 4EPWA 1GDTA 1QGDA 4I5GA 2PFOA 3V2UA 5BY2A 5ALFA 5KKNB 3F5EA 2HXSA 3F71A 3T94A 1QBKC 3D3EA 4YP3A 3UHAA 1YV9A 2ZBEA 4C1BA 4BO9A 4RY0A 4BQFA 4DNFA 4QPJC 2WVGA 1D8LA 1JA1A 2PKQO 3SYKA 5LYJA 4LF4B 1DAMA 5HG0A 4ALNA 2C82A 3UV3A 1D6JA 3ODGA 2EH9A 5TNXA 4PU0A 4DLPA 1R5JA 2QAGA 5JYEA 3FPJA 3JALB 1ZN9A 2WA2A 2PS0A 1Q57A 3B51X 4AJEA 1Z2AA 2Q3EA 3EMKA 5DISB 2GBFA 1U99A 3ZLTA 4B44A 2NO6A 2X14A 4DRYA 2PVPA 4M7RA 3ZV3A 2UZAA 1E79A 5EHQA 1U1FA 3ZWNA 3IAAA 5A4IS 1F3LA 2W2MA 3QXGA 4I9GA 4OQZA 4LVSA 4H15A 4A8JB 1KQPA 3CCFA 3LVFO 4LRUA 5JQGB 2XJ4A 3DLCA 2HSZA 1M0WA 1OLXB 1T25A 2B7LA 3M6FA 1T3LA 4RXTA 1CG6A 3MWKA 3HS3A 3PD7A 1J8FA 5COBA 4YRCA 1JLRA 5I9TA 2XD9A 1UHUA 1HDEA 1Z6QA 1JXEA 2QYTA 3OX1A 2VP3A 1N4AA 3ZE9A 1QO0D 5JYCA 3BULA 4CT5A 5B7NA 1W47A 1Z16A 4I81A 4J2OA 4D8XA 2MTBA 2GCOB 3L8ZA 1K88A 2XUFA 4OQYA 1NLYA 3QMWA 4KX3A 3FOBA 1G3RA 4EO7A 4NLKA 1L8QA 4WOPA 3KJGA 4MKIA 1CNFA 1PQYA 1PP4A 2QUJA 3F5AA 3A36A 3SIRA 4EVRA 1VSTA 1M0SA 1WNTA 3G2JA 3TQQA 4F9EA 2R8KA 5B2EA 4KITB 1NYRA 4F93B 2KIWA 1ESEA 1FSFA 5FUBA 4BMVA 4M9CA 3DV9A 2PIDA 1K8XB 3DEJA 2GM9A 4ZGBA 3IIEA 2W7TA 5ULLA 4CMEA 3EPIA 4C4XA 4E32A 1BDMA 3RRZA 4ED9A 5BSVA 4BLQA 1NJYA 1NK4A 1R50A 1T6BY 5K8VA 8LDHA 2E4YA 4WXEA 3LHFA 4CF3A 1U7PA 3A4TA 1EGQA 3IDFA 5U4QA 2VK4A 1GNTA 4F4KA 1JAZA 1SVMA 1KL9A 3S2IA 2WG2A 3GVXA 3ZV4A 3RVSA 2Q3JA 2KSOB 4R40A 1X74A 1JFFA 5J2UA 1JG4A 5A6SB 3U0VA 4F92B 2QV7A 3GBPA 2QKQA 1ZLYA 1YBAA 2EAPA 4MPTA 3CE9A 4GXNA 2CKDA 3D64A 3RSCA 2J48A 3GLKA 2GJ4A 3D6JA 2JZCA 2X4LA 3OAAA 4MINA 3HX0A 4F50A 1K5HA 4M0AA 2BWJA 3L0YA 3N0RA 5D85A 5AT1A 1NZBA 1T24A 3DB2A 3GGCA 1W8DA 4D4HA 3FW1A 5KX5A 1C30A 4ZAGA 2XSZA 8ICRA 5F76A 1ZCJA 1A77A 2ANBA 3FMVA 3RIYA 2G63A 2CK3D 2O3TA 3UPQA 1J9ZA 3GDOA 3JWGA 3PTZA 1V9LA 3HPOA 3ZDDA 2LPMA 3PA8A 4EPTA 3BH0A 4E33A 1YRBA 2XWSA 5DHPA 1DL5A 3G5AA 4PRZA 1VTKA 2XZTA 3FAHA 5KYUA 3W5DA 4LF7B 5D2CA 2IU4A 2XDYA 2UVRA 1RQXA 3FF4A 2Y92A 2BF4A 3TZKA 4F3CA 3GLIB 4WOBA 1GUBA 3H1AA 3R44A 4BNLA 4CQJA 1KWGA 1A1VA 1G6HA 5BYBA 4M22A 2WD8A 4CT4B 5BXYA 4KXFB 4ND4A 3Q8SB 1JT9A 4WLEA 5JDIA 1H9CA 1KY2A 3ND9A 3D4PA 1P2BA 1QIFA 4DIEA 1ZXLA 4Y2VA 3PFGA 3ZQKA 3WGHA 4CCWA 3W78A 4DR6B 3RVMA 4TWIA 5HWSA 1U80A 1XLTA 4QNLA 3A4VA 5IYZA 1E6KA 1GU1A 2JGJA 5DX0A 3W7VA 2WSSA 1XPOA 4FHGA 2RB4A 4L9SA 3AJEA 3HU2A 3DE5X 2XTMA 4IGFA 1XNRB 3U80A 1TGVA 1AF4A 4DUZB 1E60A 4TM8A 2A5GA 4YXWA 2CNLA 5A9RA 1XUOA 3A9SA 4Y9RA 2HUPA 2PSFA 1QBGA 1U9ZA 1USIA 3KVRA 2HRBA 2Z56A 3K35A 2XQIA 3R9KA 4Q21A 4BQNA 3PNBA 1Q15A 4OPMA 4KRGA 5ECWA 2O8FB 1QFXA 5LOVA 1ZH4A 3EGIA 5ILQA 4DXDA 1JLKA 2QLFA 4JKYA 4UU1A 3RREA 3ZHSA 1WSDA 1MGOA 3ANYB 2PT6A 3JQ9C 3PNQA 2VPXA 4NDNE 3TOCA 4O4HF 1CKEA 1V4VA 3VFDA 4P54A 1QHGA 9ICMA 2WU3A 4RABA 5BOSB 1ZQJA 1C0IA 1F4LA 1GGHA 3D54D 3TM5A 1ZQKA 3ZWDA 1CIJA 1UQRA 4NBSA 3AETA 3R3VA 4L6IA 1RWMA 3EW7A 4MQ4A 2NO7A 4PPFA 1R3UA 5HF6A 4D4MA 2YWBA 2CDNA 2YUIA 3LHIA 1JHXA 2BP7A 3A6LA 3NORA 4WZAE 1IBCA 1DCMA 4NFYA 4CKYA 4BP1A 3C29A 1OZFA 1X0VA 3F5DA 4HMOA 4DG9A 5C7LO 5ESWA 4QXRA 2ZAIA 5EI5A 4MWOA 3FWNA 2JC3A 4D9BA 5DDMA 5ABPA 1YR6A 4CF6A 5K2MA 4XUEA 2H2HA 5JJBA 1IONA 4LIPD 2FJPA 2VUSA 3D43A 2YIDA 4QRHA 5HSGA 3AUYA 4E0BA 2WLTA 1T0HB 3D81A 6REQA 4DG8A 4MWGA 5JY1A 5CVCA 3FUUA 4MVWA 3A4IA 1K1SA 2B8TA 4HBGA 4EYSA 2BHNA 2CE7A 3P0JA 1WB4A 3RG2A 4FIZA 4HEJA 3VKHA 3N3AC 4UAWA 1AGXA 4DCGA 4LJSA 2ODBA 4YUYA 4M9QA 3V3KA 1SKYE 4NCIA 2ES6A 1KKLA 2NG1A 3MUEA 2QD1A 1HTBA 4UVGA 4I5FA 4ROTA 2IYWA 3LCUA 3PQ2A 3Q3VA 4RLHA 2OD2A 5JVDA 1VLVA 1VSBA 2BFPA 4Q9DA 7ICGA 3UB3A 1FLDA 2ZJ4A 5BV1A 1NNEA 1IV8A 1ORRA 1VCMA 5IDXA 2WAAA 1AM4D 2OD9A 2P4EA 4HC4A 1ST2A 5BT9A 3UV7A 2XRMA 4RPCA 5EKXA 4AMGA 1CY0A 5JPDA 1WXDA 5IBPA 4QNRA 4C6RA 4HH0A 1UL1X 3TXYA 1KYVA 1NVAA 3R7NA 4G24A 4TKVB 3JD2A 3BK7A 4UE3S 3DT8A 4CM3A 1FPMA 4DKXA 1OXTA 2GLEA 5TF4A 3CM0A 3EAGA 4EFLA 2Q6OA 3B7PA 3BGDA 3QWIA 5FUVA 1HO3A 1K3FA 2EIHA 3U81A 1X87A 5AM1A 2YJ6A 4MMZB 1H8HA 1GUZA 1SC3A 1YHZA 4AYXA 4HP8A 1NVVR 1SBTA 3MJCA 2XYRA 4IAOA 1DO0A 1S5LU 1L9KA 1EWQA 4OHBA 1L5GB 2I1QA 4N40A 3RT7A 2NUPB 1U8FO 2QM0A 1XN1A 3IV6A 1MVOA 1HFKA 1XVVA 5H9WA 4OHFA 4MMYB 1JZSA 1NE2A 1ZUHA 1E9EA 2J5KA 2XBUA 3RQSA 5ELMA 1EKXA 2B1GA 4AK9A 2F2AB 2BRUC 2KHQA 5G2OA 4N3NA 3LPAA 5FFMA 3CHYA 4FJ0A 1I33A 1PEYA 4R1QA 1MX9A 1F8UA 2YZGA 3KZXA 1TPZA 1LDYA 3ZLJA 4YT8A 2CZQA 5E9JA 2ZIUA 1KI9A 5KFGA 4GLXA 4Z4IA 4DEVA 1XKTA 5FBHA 4BXOB 2IHJA 3IT0A 5EIOA 4O63O 4Y9TA 4S1WA 3MWJA 3N7SC 4NY8A 3GZJA 3QVTA 5LBIA 1K8ZB 3DFUA 4L6CA 2P77A 3CJQA 3QXJA 4WXHA 1PR9A 2PKWA 1ISGA 1D8AA 1VJ1A 2HCRA 3L18A 4XUCA 5AMXA 3WGLA 4NBVA 3ZPXA 4RZXA 2BGIA 1FFWA 2NNLD 4ZMRA 3LUAA 1Y4UA 1YJAA 1YMUA 3M2PA 1ZQYA 4IHQA 4U02A 5DIFA 4QDXA 4PC1A 2HREA 3CB4A 4FI3C 3S28A 2FPIB 4QGGA 4X8OA 1H93A 4HB2A 2J3KA 3OPYB 2HMXA 3REQA 2ZTEA 1ETHA 2D4AA 4NE2A 2Z1NA 4U2BA 2LYHA 1SG0A 1YKFA 2V96A 5EXTA 3L8GA 5KFOA 1UBTS 2IYOA 1AGYA 3SICE 3WI7A 2DQKA 1KVTA 2HIHA 2QYOA 3FTPA 5SY4A 1SGGA 3QVVA 4MHVA 3FPBA 4GLOA 3N2GB 2IPAB 4FXPA 4D9GA 1WQ1R 1JYSA 3I62A 4FTWA 4Q7EA 2AG8A 3TWOA 4ZVTA 4ZAVA 2ZT8A 4NOLA 1P75A 5HP4A 5AUPB 4N3GA 2UZ1B 2WNSA 4G5SA 4RPGA 5SY6A 5TT0A 3GDHA 4RZSA 2ZANA 4KKVA 2Y8EA 2C20A 1T3QA 2KSOA 1UFVA 2WQ6A 4IZOA 1Q83A 3QEOA 3IUPA 4L5AA 1VI5A 3BFVA 1MZVA 3CINA 2JEOA 2CVQA 4RANA 4YCMA 2FE1A 5F2NA 1A97A 1B42A 1HYEA 4P92A 3WE7A 4D8UA 2QK4A 4JBHA 1DKNA 3A6EA 1R10A 1FMLA 1EFCA 4X3OA 2E4ZA 3D2SA 4W5JA 4IDHA 2AOUA 4XAQA 2B92A 4ZAWA 1H2ZA 3RLFA 2ZRJA 4YJDA 3HUEA 4DMFA 3NHFA 2YWDA 3HVKA 4MIKA 4QUHA 2WD7A 3GYBA 5DYYA 2ZBUA 1EHYA 2ASLA 1NVGA 3KEOA 4HNTA 1RJEA 4DVJA 1O0SA 3BT7A 4C7OA 4LHYA 2JGNA 2WSIA 4OH1A 4F11A 3ISCA 1KPHA 4QFMA 3H2BA 3L4BC 4NYMR 4Z6EA 4YT2A 3H6KA 1YF3A 1U2DC 3RBEA 2WIAA 4CWAA 3UJ7A 1CY4A 2WAMA 2IUUA 3IXQA 4CU2A 5CYPA 4ZYTA 3H3XA 1C5KA 1MC4A 1EFRA 5T4EA 2XMGA 4XR4A 1C9YA 3UXOA 1SVIA 2N1MA 1Y6JA 3M4NA 4OXNA 4EMBA 4V1CI 3BGWA 3UJBA 4BTEA 1JNYA 3QOXA 3U5TA 1RM4A 1TJ5A 1TM1E 4DDMA 1ZX1A 4ALKA 3WBJA 2EZ8A 3L0ZA 1DAFA 4A8JA 2G3YA 4JLNA 1UC8A 5K8TA 3QF7A 4A91A 1YT3A 2O5EA 1E98A 2BCSA 4KLEA 4UEJA 4A8EA 1UC5B 3R7WA 3MC1A 1XXLA 1ZOOA 2VAMA 1MC5A 3HO6A 3I05A 4O5AA 3CNBA 1JFVA 4I2NA 1H2XA 5J2UF 1BVRA 4JZYA 1F7UA 2VZ9A 4URYR 5AI4A 2R8GA 2HSGA 3PFFA 5BMOA 2XGPA 2IYFA 1QC5A 1RXYA 1VG9B 1NJSA 3QSGA 4GSYA 4L4YA 4X97A 4XIYA 4B46A 1DBWA 3SENA 1G21B 1NBIA 5F23A 1Q92A 2R1ZA 2W58A 5BN5A 2JVJA 4G0QA 3TMYA 4DZTA 1D2RA 4C7YA 4NV1A 3CX3A 3VH3A 4U2KA 4B3JA 1YXMA 4I0WB 1EWVA 4M36A 4PRYA 4C20A 1M2VA 1OFGA 4NPCA 4M0LA 1E6EA 4AY5A 2ZPTX 3EFHA 4D79A 1UODA 1PCXA 2NUAA 3E1KA 3ZDAA 4CCYB 2XMZA 2RHCA 2B61A 3DFZA 3GLFB 5ECYA 2PDAA 3ACCA 4B40A 1KO5A 1KAEA 3BL5A 3VRHA 1NRWA 3K9QO 2IU0A 3KNZA 3U1VA 3I0NA 3PVCA 1LLQA 3M83A 1L5ZA 2BV3A 2GBLA 3WRWA 1KJIA 4EHDA 2JGAA 2BFBA 3NHRA 1VJCA 4YHHB 3E58A 3TKLA 3GNLA 2RCYA 4IV0A 3CO5A 3RW9A 2ZQ5A 3LG2A 2YKGA 1N5WA 4KYUA 3TL2A 4NCNA 1BEEA 2X2FA 1PD1A 3BFKA 8ICYA 1N3YA 3HVUA 2O57A 1JIUA 4KUGA 4RZUA 3RIEA 3SWWA 3TG2A 3MPOA 4P0QB 4IMPA 3V6KA 2G76A 4E70A 1ZN8A 1SQGA 2EWVA 3NHBA 1DGSA 3TD6A 4CR8A 1LDMA 3BC1A 2FMUA 3EYAA 4JJAA 1N56A 1QJ4A 2HFKA 1Z7YA 2ZYWX 1MA0A 1K86A 1UWCA 3DL2A 3DO6A 2P2CA 4EOGA 4DLYA 4TRMA 1LPNA 4Q9LA 2D8MA 5KYVA 4BUGA 2PL1A 3MLBA 2OPBA 3OJLA 3T4EA 4I3GA 4RIHA 3TQOA 3TSYA 4AICA 4OP2A 1DPFA 2PG3A 4IJ5A 2P6PA 4A8PA 3B3FA 5L40A 2XRZA 4BGEA 1P5ZB 1CI4A 4D0GA 3B48A 4URHA 1KHHA 2FRDC 1U0RA 4TZ0A 1SCDA 1XQWA 1WXWA 1KEZA 4F71A 5F1YA 3JVEA 4DSTA 4GXJA 4WKCA 5C31A 2K89A 3M1LA 3WRXA 2IHTA 4PAMA 2FPRA 1PR6A 1R9JA 4MF2A 1O6ZA 2G1KA 3ABIA 3C28A 1BNCA 1Z7GA 2HXYA 3E9ZA 2JXJA 3FPKA 4IGAA 3ZZUA 4QLOA 4U0JA 5LLDA 4BQPA 2W93A 4YPFA 4F4YA 3T9EA 1EB8A 5AJWA 4AS3A 5JROA 3WOVA 4LZDA 4ZO7A 4UTXA 2OV2A 2ZYTX 3TGWA 2BBTA 5HILA 3GLRA 2V9WA 1AKRA 1WEHA 1RM3A 4Q3DA 2O07A 1HTWA 3RARA 1KK2A 4L4ZA 2Y1OA 4C05A 3T1HB 3QP9A 5EIAA 5JZOA 4RTMA 4C0XA 3HHPA 1IUNA 1XRJA 3V4PB 2VKTA 1FDWA 2NU6B 2VYQA 4URUR 5KG2A 3V1MA 3OF2A 4Q7QA 4HEA6 1PRYA 4HAWA 4DSKA 1SU8A 1ZC4A 1YL5A 2CSXA 3AVUA 3JRXA 3WWPA 1SUCA 2DHCA 2CEAA 3BJMA 4ZVRA 5DOVA 3SXPA 2H8KA 3ZCQA 4YPOA 4DHEA 4AL4A 4DKJA 1H0SA 4ME6A 4QZCA 3M7IA 4GZ6A 4N12A 4OJLA 3L7LA 4DEYA 2PKXA 3LQ2A 5DNEA 1NPTO 2C59A 1C29B 4X64B 2PCJA 3S8YA 4UE2A 1W48A 2DJIA 2JLYA 3D0KA 3WKBA 4JXZA 2VYNA 4MITA 1NXVA 4QJ3A 3GK3A 1MNAA 4FGLA 3C5GA 2IUFA 3DKIA 3PNKA 1K5GA 3UENA 4U3JA 2DWPA 1OIVA 4KZPA 1E1RA 4BWMA 3KXLA 4BL5A 4UUPA 1HDOA 4IDPA 2OLKA 2ETXA 1SG9A 2R6CA 1C1HA 1YASA 3F2CA 5ADUS 2CXXA 4ARZB 3JAKB 4TVBA 2C2HA 2HY7A 1T4DA 1QMGA 2HXGA 1J1ZA 1O57A 4K9RA 4KVZA 1IHXA 1T43A 1X8KA 4RV5A 4YREA 4EEXA 5LP6A 4JBNA 2P6MA 3GB9A 3A0BU 2R1VA 1K0FA 4C80A 2FSHA 5KU1A 4DOBA 4U0KA 4AZTA 2PHZA 2PXAA 3HKDB 1MDBA 2GZHA 5DYGA 1K7SN 4F5OA 4LS3A 3L7JA 4BX3A 2O8VA 2VP5A 4Z1OA 2FUG6 2UYGA 4HDMB 5FYQA 4DYVA 3U7IA 3WS7A 4QBGB 4AP5A 3NNSA 1UFOA 3AIIA 4M8LA 5EEHA 4AY6A 4A23A 1AVTA 3ZKAA 2A67A 1YMVA 3QA3E 1TX4B 4P7BA 1JVNA 3D1LA 4II7A 5TVKA 3DL0A 5JUWA 3ZTWA 1NK8A 5IT0A 1WSBA 4NZMA 4LRYA 4XWTA 1XLVA 4Z6KA 3JPTA 4QZEA 1VL0A 2ZRHA 3BH6A 1F6DA 2J85A 3MAGA 4GLLA 4UHEA 1DIGA 1U0JA 4JI6B 3S1AB 4AYTA 2DLDA 1ENZA 3N2KA 1PV2A 2XUOA 3OFVA 4LGCA 2A88A 4LHXA 4TN1A 1YZFA 3B5EA 1LF5A 3NGMA 4FDLA 4HZIA 3ZGOA 4E07A 2AU0A 1X1SA 3K8YA 2G7MC 4D5EA 1PZGA 1N6HA 1HYQA 3GLIE 3ECAA 2Q3CA 3BMNA 2HHSA 1NQUA 3CEMA 3L8EA 3PFNA 3EYWA 4IEIA 1U47A 4J6FA 4MQUA 4PLZA 4RMJA 3U5ZB 4MW4A 3OZWA 4GBGA 5KG3A 1URJA 3WK7A 1PJAA 1TL7C 1YULA 3H13A 1EWTA 1SU7A 5DPMA 4AY2A 2IZ5A 4FW8A 1YRQA 3MLAA 1BC5A 2N1BA 3Q7SA 2HF2A 1P0FA 1J0XO 2WU4A 4A2PA 4NMHA 2GFQA 2MINA 2JS7A 1IUOA 2P90A 3B8EA 3ONVA 4B4WA 1SVLA 2R7KA 2PX3A 4WVFA 5KOHB 4LY6A 5IBCA 1SXEA 2XUGA 4GRDA 3DWGA 4YRTA 2OFXA 2XW6A 4E3ZA 3T5MA 2Y99A 3GI1A 4CR6A 4LFBB 3M33A 3UGTA 4MUMA 1KI4A 1R0LA 4YCXA 2R48A 3LHDA 2BZSA 3ONDA 3FHCB 4BGDA 3PMLA 1XTQA 4RORA 2NAFA 2BKVA 1A50B 2IDMA 1QIEA 3ICXA 4G3XA 4N1AA 2ZG6A 5LL6P 4WKOA 5A71A 3VV3A 5DW0A 3E9RA 1N6OA 2ATXA 3PUJA 4Q6BA 1UXJA 3NC1C 1FU4A 4PICA 5HJ7A 4F4WA 2H5JA 1U2PA 3F1LA 3FDZA 4JU8A 5ALRA 1EFVB 4OJ6A 3QM1A 3EWAA 1SUSA 4R1OA 1QR6A 2EKQA 2QTAA 3D0OA 5GINE 1OLXA 4ZOLA 1YJXA 1TLTA 3PPIA 3QWFA 4CIWA 1YB5A 3RVLA 4RHYA 3HJRA 2V54A 4CMBA 1Z9BA 2J5RA 4G1VA 3MOIA 3MTQA 4IR1A 3TLMA 3L43A 4BYMA 2BHLA 4YN4A 2D5LA 4MICA 3LVQE 4I4CA 3HU3A 2PR7A 2PL3A 4LWPA 1Y7TA 2ACKA 2F4NA 2TRSB 3BRWD 5J0TA 2ZUEA 1WKVA 4NP6A 4JP5A 1H0HA 1M2VB 2FN8A 4PHPA 2X40A 3KJNA 3CX4A 3KLPX 1VLBA 3H4VA 1SV0C 5YASA 1C8VB 1WPRA 3PR2B 4OJQA 4UFOA 3KHUA 4FGKA 3M0EA 2FGKA 1JDUA 1VKOA 3UJ8A 1JUDA 4DE5A 1M5TA 1G21A 4LBYA 4BIIA 3C8HA 5U4XA 1T6YA 1B93A 1T10A 1QPBA 3NU1A 3O9VA 4MWSA 3TBHA 2VI5A 3CRRA 5AHXA 4B35A 5LMCA 1F38A 3NJ4A 5C4IA 4DLVA 1C3OB 4OMDA 4ND5A 4YECA 3IFSA 3EZ2A 1LDNA 1U2DA 5IVDA 4XE5A 4K86A 4L8YA 2H5XA 5KFIA 3B2EA 1RT9A 3GEPA 2IC5A 4FZ5A 1EA5A 1RWPA 3K1AA 3KHTA 4HBZA 4LHVA 4NENB 5JAPA 1Y9ZA 2O06A 2IODA 4NNPA 3EC2A 2NU7A 2RHRA 2GILA 3LQYA 3UMRA 3C6YA 1AK2A 1E61A 3G9ZA 4KDRA 4XQ0A 4JYAB 4PLPA 2O8DA 5TGTA 1CP2A 3L1KA 3U09A 1RYSA 3JQAD 4HH4A 3WB1A 2OKGA 2UVPA 2F44A 3ZR4B 5KNBH 1F6WA 1VMAA 4PCLA 3D8UA 4GKKB 2XA2A 1XPRA 2WWYA 5A2QA 1JQ3A 5KCZA 2EKBA 2NSHA 3CVJA 3KQUA 3ZVNA 1E9FA 1SXHA 2P9QA 3LQ1A 3MBYA 2J0SA 3UYKA 2FRVA 5J0OA 2HHTA 3G59A 4Q3BA 4E4RA 1CLEA 1SKSA 3V7LA 2FYTA 2HA5A 1CUCA 2R9VA 3OX4A 1K98A 1TJ3A 4GVXA 2M9NA 4WBSA 2FMIA 3TR6A 5CYFA 5H4HA 4S0ZA 1T8UA 5B1IA 2BGTA 3VKVA 5HX7A 4Q47A 1C7RA 4NBTA 2NZYA 1T3TA 2VT6A 4M7WA 5FO0A 3VO8A 1F17A 5CCBA 2Q28A 2CMKA 1EX9A 1E6CA 4KN5A 5FO1A 2EF0A 3TLGB 4DB4A 2IH2A 2XXBA 4R2XA 5EGNA 4IRDA 3BD8A 1QH0A 4Q1AA 4W7SA 3R9IA 5BUCA 4Z7OB 2NV2B 4BQOA 2ZIAA 3O31A 4KPEC 4M53A 5DCYA 4G0PA 4FE3A 4XCVA 3RJ9A 1J9EA 4JV5B 5HR7A 5CDFE 4G4JA 4LZOA 1Y4AE 3MG9A 5FFFA 5IULC 5ECDA 1P19A 4PQGA 4ZVOA 3T54A 4AT1A 5IPFA 3A4MA 1EFUA 3KTAB 5DGXA 2VL7A 4C0BA 2Q45A 1CZOA 3AOGA 4F45A 5JWOA 3AFMA 2AOTB 1LF0A 3A4NA 3DDUA 3ZS8A 5LD2B 1FDSA 2R00A 4B6SA 3DT6A 3HCPA 5KWEA 1O9BA 1OAOC 4LA4A 3KOYA 4UPDA 3P9ZA 2ASEA 4F3OA 5BPFA 4CRXA 4R3UC 1FUIA 5GMOA 5JH7A 4LGMA 4D82A 4OP3A 1RWQA 3GA7A 3QWAA 3ZBTA 4J9KA 5I7RA 3MT9A 4XPZA 2HU2A 1KE1A 2G70A 2ZRLA 4XQEA 5JRTA 4TQSA 5FI5A 3H97A 1UAGA 2RJ3A 3OLVA 1XXHA 1FDVA 2K5UA 4W1RA 5EMNA 1R66A 1U7TA 3TJRA 3THVA 3IX7A 1N6KA 3I23A 4IQTA 3BSSA 1W73A 3BXHA 3QLUA 4B6PA 4E2FA 2YYZA 4EG4A 4EG3A 5GZ1A 2EFGA 3C3BA 3O1HB 4YR0A 2XTNA 4RTPA 5LA6B 2OO5A 1OXVA 2FTKE 4CMHA 4BNHA 5H8WA 1KZYC 1SD5A 1ZI6A 1XP5A 4QTXA 3BFJA 4ZK2A 2HOIA 2J7KA 4FN5A 4FVTA 4Z0NA 2C4TA 2PYZA 1QVRA 2H7CA 1GVNB 3E22A 3MWLA 1S7GA 4KFRA 3TZQA 3I34X 4B83A 4DZZA 3LLVA 2OCAA 3MVEA 3WP0A 3IRUA 4J0IA 3ORYA 1LDGA 1Y1PA 3DBRB 2ONJA 4JP2A 4RKWA 4BP9A 4ENRA 1TZBA 1ZM3A 1GVHA 5DWQA 3TBKA 1GNSA 3TFOA 2A0FA 4ZCIA 2K4EA 5KYKA 3CH4B 2HX1A 4RY9A 1ZXIA 4ZCQA 4KR2A 4A6PA 3KOZA 5FOSA 4GF5A 3R5KA 1TZ2A 4DJEC 3FOEC 1TTTA 1XQXA 4F4JA 3LIPA 3A1NA 4ZMBA 4V0QA 5I7AA 1QE5A 2B34A 3IKVA 2BYTA 5UKDA 5F9HA 5J43A 2RH8A 3LMKA 1D0VA 4NE7A 4YO7A 1BRTA 4DJ5X 5KG1A 3FHJA 5LPNA 4HDQB 5F64A 2W2OA 5ERXA 1LPBB 4DBLE 3SVTA 4Z6DA 4CFSA 4DPMA 2KP7A 3AU9A 3EGXA 3JPNA 1USGA 2ODEA 2JK0A 1NW8A 3WYGA 2CBXA 1XSEA 4A27A 4CKBA 4YV1A 5B2FA 2WWXA 1HORA 2BCEA 5BW6B 4AC9A 1WXIA 2ZJZA 2UU9B 5GIOE 3FWHA 4GPZA 4H6WA 3AVVA 1YTLA 2POCA 3EHEA 1SZJG 1JI3A 2RAVA 4PL2A 1M2HA 5SZJA 3S44A 4ZT7A 4B81A 2G06A 1E4YA 1JI0A 2QTTA 3B9JA 4D4JA 5KFXA 2AEEA 5H59A 3ZBQA 3Q2OA 4FS1A 4D8TA 4PX3A 2E55A 1RWVA 1C3OA 4RHCA 4HYTA 2IWRA 4ESHA 2PS1A 2H54A 2CHQA 2OK8A 5K8JB 3AY7A 4DJDC 4IIEA 4P5DA 5J63A 2A58A 3T7SA 4CQMD 4DM7A 4ZYLA 4OGLA 4YQWA 4UXJA 3ONEA 3RR7A 1WKBA 1BHSA 4Y2TA 3OBIA 5C1PA 4OYLA 3BDPA 1S1MA 1ZH0A 4QW9A 4RJKA 1ATZA 5BQ3A 4HNVA 4U6PA 1XLWA 3HCFA 1T35A 1VDMA 3O74A 1JHYA 5CVDA 1E20A 4ATNA 2ZWIA 3I76A 1E0SA 4XA5A 1IIRA 2WYWA 2BGJA 4ZHSA 1A7UA 5HA5A 2OXFA 3IEKA 3ZZ0A 5A4DA 5KB3A 3AINA 3R7BA 1GRVA 3GELA 1F5SA 4P4NA 3EJ6A 3A1WA 1I4DD 3WZLA 4X93A 5KX5B 2HWUA 4X90A 1WDTA 2P69A 4C8LA 1B7GO 1ZAKA 3LX8A 3G2KA 3OQIA 4MGIR 4BO7A 3UF0A 4YROA 1B1CA 1AS3A 3I4CA 1Y89A 2Z9BA 1VA5A 4I5IA 4UVDA 1CFJA 3K9HA 2H9YA 4OKIA 1J22A 3G8YA 4TYQA 3V32A 4C0JA 2YS6A 3N6RA 9ICVA 4CTNA 5I7WA 4YRFA 3AIMA 4NYJQ 5DZSA 3KR2A 3BXPA 2PAAA 1MX3A 3AI1A 4FHCA 4NBLA 1ZHFA 4QA9A 4Y9DA 4JI0B 5HKKA 5A62A 1HDGO 3CNHA 1I14A 1RDFA 2WWHA 4QJBA 1GGKA 2QR5A 1I5RA 4YJFB 5C8YB 5C5EA 2YRFA 3CX6A 3MR3A 1H1LB 3FE2A 3Q15C 4HEQA 4IR7A 4K9DA 2IP4A 5AKJA 3IAHA 3KJHA 4FINA 4OHUA 5EMMA 1QQ6A 5JUMA 1FRZA 3ET5A 4J29A 3FG9A 1QLWA 2G9ZA 2VO1A 1MFPA 4GOOD 4RSMA 5FOTA 4ZJUA 5C7IO 1T9AA 4R3WA 5PNTA 3ZWPA 5T6MA 3V1YA 3FFWA 3KKPA 3EY9A 4JJ6A 3JPOA 1F4PA 2YDXA 1LKYB 4BNUA 5J4KA 2DWOA 3U4IA 4YLEA 1N75A 4KRYA 4C4AA 4YMOA 4TL7A 3S55A 1ZD1A 4M37A 1TLFA 1GCGA 3CLSC 3G88A 1IVSA 4U9IS 3WL6A 4JWNA 5IT9A 3THSA 4AMVA 2KN7A 1M1UA 4F7WA 5A5DA 1KEWA 3WL7A 4R8UA 1TK9A 1U3CA 1XEWY 8ICWA 2PSSA 1S2MA 2V6MA 2G67A 4IIUA 4YALA 2H1VA 4HFNA 3SZLA 3LU1A 5A9SA 4OBEA 3H2KA 2O0LA 1MBZA 3C6KA 1I2MA 1WHSA 4ELVA 1NJWA 1Z38A 2X2OA 3MJ4A 4GC9A 4YT5A 4DPLA 1TEZA 2Y9UA 2I87A 4YRAA 1OKKD 3D4IA 3WR5A 4LRWA 5HBRA 2IQIA 4FCTA 4G26A 4CN8A 4B79A 2ZPAA 3EVEA 1V16B 4MH0R 4NC9A 1MN8A 1RWNA 3AEKA 3F46A 621PA 3TUIC 4W7IA 2E4AA 1JAIA 2WM9B 1YCDA 3GEIA 5BQ5A 1E5LA 2LXNA 3EIWA 1JHPA 5C81A 5I7EA 2H63A 1F0MA 2VXYA 2VNAA 1JT2A 2WTNA 3CA8A 5FNZA 3STHA 3HCRA 3IAXA 4GI3A 3FOCA 2L42A 4NFSA 5B6IA 4TQRA 1HDXA 4L5IA 5EE1A 1X7ZA 2I2BA 2P0EA 4XWAA 2WD9A 3TPFA 4FB4A 3ISBA 1H2BA 2DERA 4Y9UA 3DAOA 3KZ1E 3GLGA 1QF6A 3B36A 4R2LA 5LQAA 1XQ6A 1HSZA 1GJRA 5E6RB 3TZLA 2AH5A 3BIWA 3Q5EA 1Q3TA 4UU7A 1NNSA 1SCJA 4HDSB 1A0PA 2W9MA 2EYUA 3W06A 4QYWA 3IR5A 1XDGA 1P31A 2GEUA 4KDEA 1PJLA 3C1TA 3GH3A 4L6AA 4DS5A 7ICMA 2MJLA 4O8ZA 1GLVA 1GFZA 4ZQIA 4P9NA 3UXHA 4F96A 2WJWA 1J2YA 4RVOA 4ECUA 1ZSVA 3GP8A 3K09A 4MUBA 5J2BA 2R68A 1D4ZA 2VDOB 4QZHA 1T8TA 4JC4A 4KQCA 1ZK3A 4U9UA 2NSJA 1A5ZA 4GX5A 1ECWA 3UYLA 4P2BA 1FF9A 1VYHA 2YNMD 1CY6A 3PQCA 3H0EA 4LYJA 3TJMA 1G0OA 1RW4A 3IJRA 4BWGA 1PYDA 4P7KA 1SA0A 2QE6A 2ZCJA 3FNRA 3WNZA 2VEDA 3TJZA 2AQHA 5KYWB 4OJMX 5EYPB 3WNVA 4B17A 2Y66A 2BONA 4TQUS 2NRTA 1VP9A 3TIFA 2QT9A 4O29A 3DMTC 3G2QA 3W2IA 2FZCA 2BGRA 2BGNA 4P0PA 2C7VA 2FEWB 2AFRA 2QT0A 1RHQA 3P19A 4K46A 4LYGA 4QT0A 4TMKA 1LPPA 1CUKA 2DKNA 3CS3A 3L1IA 3DO5A 3GFPA 4M1WA 3UIEA 2TMYA 2YW9A 3M9NB 3KFVA 4J4HA 1KO7A 7ICFA 3RS5A 3VHQA 2G6BA 2LM1A 1NMSA 3OCVA 3WYFA 3H8MA 1ZQDA 3F2BA 1L5YA 1O97D 2AA3A 1RWKA 1AQLA 1M34E 2FDXA 3BDIA 3MD9A 4GM4A 4L8FA 2I99A 2ORVA 4RPIA 1WMFA 1K9SA 3O73A 1M2FA 4XD7A 1QHHA 4E5MA 4JOCA 2ZUBA 1S3GA 3DLPX 2P3SA 3ZE0B 3ILXA 2EZUA 3EEQA 4J1SA 4Q01A 4XSGA 1YVPA 2K4MA 4YMHA 4NLBA 3EHDA 4DWJA 1LVUA 1SQ5A 5FLXA 1OX4B 4OVKA 1JXOA 1BPEA 4O3SA 2G9VA 2QAGB 5C8DA 4OIFA 2WSMA 1LSSA 1SKUA 3HDYA 3ETGA 1IJEA 3AUKA 1H9AA 1L3IA 3BERA 3IVXA 4LY3A 4XM1A 1C7FA 3K3PA 4KOAA 1Z47A 2I03A 5G4KA 4D0LB 3L8YA 2Q1SA 1O6FA 3ZLUA 4TT3A 1OAOA 1KK1A 4V02A 1JHZA 1M75A 2FPPA 2PUTA 1RPJA 4CLDA 2GHIA 4H6XA 1J2MA 4UVEA 3Q8LA 1C0EA 4R7ZA 2VUTA 1BXRB 2WFMA 2C4HA 2X3UA 1RZVA 2YJ5A 1K92A 5JCPA 1OI7A 4QPNA 5F1KA 1GZHB 4EL5A 5JBIA 2O2GA 4L5YA 4BP3A 3NFRA 3M3DA 5EZQA 1A7KA 2H5LA 6Q21A 1HA3A 1PDWA 2ZJAA 4DUGA 4FFRA 3VZBA 2V7QD 2X3FA 2RGNA 3COVA 4RYLA 4B9TA 3JASB 4DIMA 5KYNA 3A06A